Document zQxx8zy6b9O580dEqpzV921r7

Download
AR226-1030A039 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Study Title Hydrolysis Reactions of Perfluorooctane Sulfonate (PFOS) Data Requirement: Based on OPPTS: 835.2110 Author Thomas L. Hatfield, Ph.D. Study Completion Date March 27, 2001 Performing Laboratory 3M Environmental Laboratory Building 2-3E-09,935 Bush Avenue St. Paul, MN 55106 Project Identification 3M Laboratory Report No: W1878 Total Number of Pages 71 Page 1 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 This page has been reserved for specific country requirements. Page 2 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Statement of Non-Compliance Study Title: Hydrolysis Reactions of Perfluorooctane Sulfonate (PFOS). Study Identification Number: W1878 This study does not comply with the requirements of the US EPA Good Laboratory Practices Standards at 40 CFR Part 792 (TSCA). However, many GLP standards were used in the development of the analytical method (Appendix A), and the quality assurance procedures followed in this study were based on the practices described in the GLP documentation. ____________" Sponsor Representative Dfe y ? Date Page 3 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Quality Assurance Statement Study Title: Hydrolysis Reactions of Perfluorooctane Sulfonate (PFOS). Study Identification Number: W1878 The following table provides details of the audits performed by the 3M Environmental Laboratory Quality Assurance Unit (QAU). Inspection Dates 8/11/00,8/16-17/00 9/7, 8 ,11/00 3/13-14/01 Phase Data and Draft Report Date Re ported to Management Study Director 8/18/00 8/18/00 Data and Draft Report 9/11/00 9/11/00 Draft Report 3/14/01 3/14/01 . lio -^ P X QAU Representative 2l. O o\ Date Page 4 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Table of Contents Statement of Non-Compliance............................................................................................... 3 Quality Assurance Statement................................................................................................. 4 List of Tables............................................................................................................................ 6 List of Figures........................................................................................................................... 6 Study Personnel and Contributors.......................................................................................... 6 Location of Archives.................................................................................................................7 S u m m a ry ...................................................................................................................................8 Introduction.............................................................................................................................. 9 Summary of Kinetics Model...................................................................................................10 Materials and Methods........................................................................................................... 11 Chemical Characterizations............................................................................................. 11 Sample Preparation..........................................................................................................11 Sample Analysis................................................................................................................ 12 Deviations...........................................................................................................................12 Results and Discussion.........................................................................................................14 Data Quality Objectives (DQO's)..................................................................................... 14 Anomalous Analytical Results......... ................................................................................ 14 Statistical Methods and Calculations...............................................................................15 Data Summary and Discussion........................................................................................ 15 Conclusions.............................................................................................................................19 References............................................................................................................................. 20 Signatures.............................................................................................................................. 21 Appendix A: Analytical Method............................................................................... 22 Appendix B: Kinetics Model...................................................................... 38 Appendix C: Selected Analytical and Kinetics Results.......................................................48 Appendix D: Selected Chromatograms................................................................................59 Page 5 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 List of Tables Table 1. Summary of Results Based on PFOS Concentrations.........................................8 Table 2. Summary of Results Based on the Mean and Precision of PFOS M e a s u re m e n ts ..........................................................................................................8 Table 3. Characterizations of Test and Reference Substances.......................................11 Table 4. Observed (50 C) Slopes of PFOS Concentrations in Aqueous Buffered Solution for Various pH Levels.............................................................................. 15 Table 5. Calculated Slope of PFOS Concentrations in Aqueous Buffered Solutions Using Data Pooled Over All pH Levels................................................................ 16 Table 6. Degradation Rate and Half Life of PFOS in Aqueous Buffered Solutions Based on the Concentration Mean and Standard Deviation.......................................... 18 List of Figures Figure 1. Structure of the Potassium Salt of PFOS.............................................................9 Figure 2. Observed PFOS Degradation for Various pH levels......................................... 16 Figure 3. Pooled PFOS Data and Slope Regression.........................................................17 Study Personnel and Contributors TSthuodmyaDs iLre. cHtoatrfield, Ph.D. 3M Environmental Laboratory Building 2-3E-09 935 Bush Avenue St. Paul, MN 55106 (651) 778-7863 S3MpoCnosroproration Professional Services Contributing Personnel Kuruppu Dharmasiri, Ph.D. Kevin Macklin Mark T. McCann Anthony E. Scales Angela Schuler Joseph J. S. Tokos, Ph.D. (Pace Analytical Services, Inc., 1700 Elm St., Minneapolis, MN 55144) Page 6 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Location of Archives The 3M Environmental Laboratory will retain the original data documents and digital copies of the original data related to this work for at least 10 years following the effective date of any related final ruling. Information may obtained through written inquiry addressed as follows: 3M Environmental Laboratory Building 2-3E-09 935 Bush Avenue St. Paul, MN 55106 Page 7 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Summary We report here the results of our study of the hydrolysis of perfluorooctane sulfonate (hereafter, PFOS). Our methods are described below and in Appendix A to this work; our results are based on the observed concentrations of PFOS in buffered aqueous solutions as a function of time. 3M's Environmental Laboratory staff developed the study procedures; they are based on EPA's OPPTS Guideline Document 835.21101but do not fulfill all the requirements of the guideline. The chosen analytical technique was high performance liquid chromatography with mass spectrometry detection (HPLC/MS). Table 1 summarizes the results of the study. During this study, we prepared and examined samples at six different pH levels between 1.5 and 11.0 over a period of 49 days, and our results indicate no dependence of the degradation rate of PFOS on the sample pH level. We have excluded the "Day 0" samples because they were improperly stored before analysis; see the "Deviations" section below. Our observations of the PFOS concentrations for the 42 day incubation period ("Day 7" through "Day 49"), pooled over the six observed pH levels, are presented in Table 1. Table 1. Summary of Results Based on PFOS Concentrations. Calculated slope (d ay1) 2.98 x 1(T Calculated slope upper limit (2o) (day'1) 5.30x1 O'4 Calculated slope lower limit (2<y) ( d a y 1) 6.66x10' These results indicate no degradation of PFOS; the derived positive slope does not provide a half-life estimate. The mean value and precision of PFOS concentrations do provide an estimate of the PFOS half-life, presented in Table 2. Table 2. Summary of Results Based on the Mean and Precision of PFOS Measurements Maximum Possible Rate at 50 C ( d a y 1) 4 .6 4 x 1 0'4 Maximum Calculated Rate at 25 C ( d a y 1) 4.64 x 10' Calculated Half Life at 25 C (years) >41 Page 8 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Introduction Three primary chemical routes of environmental degradation are hydrolysis, photolysis, and biodegradation. Studies of these routes provide information on the environmental persistence of both the "parent" compounds and their reaction products, and are ideally carried out over the range of chemical conditions pertinent to both environmental and metabolic processes. The hydrolysis of the potassium salt of PFOS (or, more generally, its degradation in the presence of H20 ) is addressed in this report. The structure of the PFOS salt is illustrated in Figure 1. Figure 1. Structure of the Potassium Salt of PFOS FFFFFFFFO FFFFFFFFO Page 9 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Summary of Kinetics Model A full mathematical description of the kinetics model employed in this study is presented in Appendix B. The data in similar studies typically allow two independent estimates of the hydrolytic half-life, but only one estimate is available from our PFOS data. A first estimate is usually based on the observed degradation of the compound in dilute, appropriately buffered aqueous solutions. Equation B10 describes the estimated half life (t ^ in terms of the estimated total hydrolysis rate k p: Eq. 1 We attempted to determine the quantity k pfrom the experimental data as described in Appendix B. The data corresponding to "Day 7" were used to determine the relative concentration ratios (see the "Deviations" section below; see also Equations B8 and B9). The derived rates, both at various pH levels and when pooled over all pH levels, were poorly determined, and indicate only that PFOS does not degrade in aqueous solution. A half-life second estimate (see Equation B37) is available from the mean p and standard deviation o of the observed PFOS concentrations, assuming that they were essentially constant over the experimental portion of the study. This estimate is H2) )h > (\t 1P/2/)mi.n = (kp)max p A t ln( 2) 2o Eq.2 where A t represents the sample incubation period. All the samples used in this study were maintained a reaction temperature of 50 ( 3) C. The quoted results, valid for the reaction temperature 25 C, were calculated from our experimental results according to methods described in Appendix B (Eq. B38 and B39). Page 10 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Materials and Methods Details of the characteristics of the test materials, sample preparation techniques, and analytical methods are presented in Appendix A (ETS-8-13.0, "Hydrolysis of Perfluorooctane sulfonate (PFOS) and Analysis by High Performance Liquid Chromatography with Mass Spectrometry Detection"). A summary of these items is provided below, as well as a description the known deviations from the procedures of Appendix A. 3M prepared and analyzed the samples included in this study between May 24 and July 12,1999. Chemical Characterizations Table 3 describes the sources and properties of the materials used in this work. These materials were used to prepare both the samples and the quantitative standards used to quantify them. For this reason, and because Equation 1 involves only ratios of the parent and product concentrations, the resulting rate and half-life estimates are largely independent of the material purity levels. Table 3. Characterizations of Test and Reference Substances Source Chemical Lot Number Physical Description Molecular Weight (gm mole'1) PFOS (Potassium Salt) 3M ICP/PCP Division Batch# 171 Light colored powder 538 THPFOS ICN Biomedicals Batch # 53406 Brown waxy solid 428 Sample Preparation We prepared four 1.0-mL aqueous buffer samples (a sample, a duplicate, a triplicate, and a matrix spike at each of six pH levels (1.5,3, 5,7, 9 and 11) for analysis at eight time intervals (0, 7, 14, 21,28, 35, 42 and 49 days). Buffered solutions containing 501.5 ng/mL of the potassium salt of PFOS and 368 ng/mL of THPFOS (3, 3,4, 4, 5, 5, 6, 6, 7, 7, 8, 8, 8-tridecafluorooctane sulfonic acid), the latter serving as a surrogate for the compound PFOS, formed the basis of all these samples. The chosen buffer solutions are described fully in Appendix A. All the samples were prepared simultaneously, and all but the "Day 0" samples were placed in an orbital incubator/shaker maintained at 50 ( 3) C. After the appropriate incubation times, subsets of the sample vials were removed from the incubator; they were then spiked (as required) with the PFOS solution, diluted 10:1 with methanol containing the internal standard THPFOS, and refrigerated at -4 C. Similar treatment of the "Day 0" samples is prescribed by the analytical method (see Appendix A); they are Page 11 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 to be agitated for a minimum of three minutes, diluted and spiked as described immediately above, and then refrigerated rather than incubated. In this study, the "Day 0" samples were not refrigerated; see the "deviations" section below. Except during the relatively short periods of time required to prepare them, all the samples were shielded from light. Eight calibration standards containing PFOS (301 to 802 ng/ml) served as the quantitative basis of the study. All these standards were prepared at the appropriate pH levels using the buffer solutions described in Appendix A. Sample Analysis The equipment we used for the HPLC/MS analysis was a Hewlett Packard model 1100 equipped with a Dionex lonPac NG-1 HPLC column (aqueous ammonium acetate/methanol solvent gradient) and an ALS Model G1322A degassing module. An ALS Model G1315A column heater maintained the column temperature at 40C, a quaternary pump supplied a column flow rate of 0.3 mL/min, and an ALS Model G1313A auto-sampler provided 5 pL sample injections. The detector was a Hewlett Packard MSD mass spectrometer, operated in negative-mode electrospray ionization mode; anions of PFOS and THPFOS were detected at the mass-to-charge (m/z) ratios 499, 427, respectively. We processed the resulting data using the computer program HP ChemStation for LC (Rev.A.06.0). Further analytical details, including the gradient elution program, instrument and detector parameters, and performance specifications, are presented in Appendix A. Deviations After incubation and prior to analysis, all samples were stored at temperatures (-4 C or -20 C) rather than at the prescribed temperature of 4 C prescribed in the Method. The pH meter calibration was performed with only two standards (at pH = 7.0 and 10.0) rather than at the three Method-prescribed pH levels (4.0, 7.0, and 10.0). Only three ions were monitored in the analysis, instead of the seven specified in the Method. tThwanotshaempprelesscr(iPbFedO9Sm-1L57, aannddthPeFcOoSn-c1e1n3tr)awtioenrereqsuuelntschweedrewciothrr1e8ctmedLtoorfeMfleecOtHthirsatfhaectr. TtlTttgiaaeehhndmehwmddeednemiotpeicPcotbroeiaoFaaournetndOtaenfvicidftdoauSaeueinlpntmrnridreotooosereroanaffsamgclotuaftuireirilloelatotteiasssnadnoe,est"arentuvwoDtassriestfoeaoainoptonbyfhhlrdslueesrae0atpoaavi"ysPtmoafeoesranFEslpeepnuOwqldxardteuiiSncasfoo"aldosnuwrDdtrisdh5etoeauoeaganrmysdlernsfeaB7M-dptpdlha"i8iraaksefe.rrdteipat"in"a;ioFtaDDfgthtniarohceaewa.reiirydynTatit"hlta0hh0ltDheyhn"ea"seaPdnrersdyaFefaatai"ishOm7snrtDueeas"aSlptdalt2fdlyssyrtetazeeomhostev0smeafwtdM"et"aanhteaaDrnhressendaeesapadouleyeydysrs"ctitaase0ogeDi.tddf"ariidaaneeOicsniydandtoedlnil7anottiyhnpttu"cnhereriastroneonhelcectotdebaa-eremrlnaanmstcutasodsuinileioeslyenstandhs,sgotsetotif.i.fhosodmtneTr,haoahetnseifsed Page 12 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 tvheerisfiacmatpiloeninsajemcptiloenawlsaose1x0ce|ieLderdatthheerathllaonwtehde 1sp5e%ciffoierdth1e0se|iLre;-rthuenscosnamtinpuleinsg. calibration Page 13 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Results and Discussion Data Quality Objectives (GOO'S) We briefly describe the data quality objectives applied in this study below. Appendix A describes them in greater detail. With the exceptions of the anomalous results noted below, all the DQO's were met. Appendix C presents the results for each sample set, organized by pH level. Calibrations. The minimum acceptable coefficient of determination (r2) for linear fits to calibration data is 0.990. The acceptance criterion for individual calibration points is that their values fall within 25% of the linear fit value; data outside this range are excluded and the linear fit is recalculated. No more than two points may be rejected from a calibration data set. Data for the high or low calibration standards may be rejected, though this results in a smaller effective calibration range. The average results of calibrations performed before and after the analytical procedures are used to calculate the analyte concentrations. Continuing Calibration Verification (CCV). Selected calibration samples are examined at the beginning of, during, and at the end of each analytical procedure. The results may not deviate by more than 15% of the known values. Matrix Spikes. The acceptable percent spike recovery range is 70% to 130%; recoveries outside this range % place the analysis out of control, and require intervention by the Team Leader or designee. Analyte specificity is demonstrated by acceptable analyte spike recoveries. Identically Prepared Samples. Triplicate sample results with relative standard deviations (RSDs) greater than 25% place the analysis out of control, and require intervention by the Team Leader or designee. Solvent Blanks. Concentration results for solvent blanks exceed neither 5% of the highest calibration standard nor 25% of the lowest calibration level. System Suitability. Suitability was demonstrated by either an abbreviated mass-to- charge (m/z) check-tune or performance of a full auto-tune routine. y Anomalous Analytical Results With the following exceptions, our analytical results met or exceeded the data quality objectives of Appendix A. Spike Recoveries. The triplicate samples PFOS-157 through 159 (pH = 7.0) failed to meet this DQO and were rejected. Page 14 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Statistical Methods and Calculations Using functions provided in Microsoft Excel software, we calculated means, standard deviations, and first-order rate constants (see Appendix B, Equation B8) for various subsets of the acquired data. Our linear regressions included the determination of constant terms, that is, the regression fits were not forced to pass through the origin. As described in Appendix B (Equations B38 and B39), rates measured at 50C were extrapolated to 25C by dividing by a factor of 10; this approximation is valid for reactions, such as these, with Arrhenius heats of activation near 18 Kcal/mole.2 Data Summary and Discussion The LOQ is defined as the concentration of the lowest (accepted) standard in the calibration set for which the known concentration exceeds 400% of the indicated solvent blank level (see Appendix A). During this study, the LOQ for PFOS was 308 ng/mL. Results for the surrogate compound THPFOS were very consistent throughout the study. The percent relative standard deviations of the measured values, calculated for each pH level, ranged from 1.2 % to 3.4%. Table 4 presents the results of the slope determinations (see Equation B8) at six pH levels and 50C. Table 4. Observed (50 C) Slopes of PFOS Concentrations in Aqueous Buffered Solution for Various pH Levels. pH Observed Slope (day'1) Percent (2a) Rate Uncertainty (day1) 1.5 0.00025 3.0 0.00032 5.0 0.00011 7.0 0.00015 9.0 0.00057 11 0.00030 111 73 618 253 89 161 Figure 3 illustrates these values, which are all positive, and the fact that they are generally only poorly determined; their percent relative 2a (95% confidence) uncertainties range from 73% to 618%. The data do not indicate degradation of PFOS at any of the six pH levels. In the absence of a clear trend relating the degradation rate to sample pH, it is appropriate to "pool" the data over pH level and determine the concentration slope using the entire data set. Figure 3 illustrates the results of this pooled analysis according to Equation 1, and Table 5 summarizes the results of the analysis. It also indicates no degradation of PFOS, and the positive slope does not provide a half-life estimate. Page 15 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Table 5. Calculated Slope of PFOS Concentrations in Aqueous Buffered Solutions Using Data Pooled Over All pH Levels. Calculated slope (d ay1) 2.98 x 1 a 4 Calculated slope upper limit (2a ) ( d a y 1) 5 . 3 0 x 1 O'4 Calculated slope lower limit (2o) ( d a y 1) 6.66 x 1045 Figure 2. Observed PFOS Degradation for Various pH levels. Page 16 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Figure 3. Pooled PFOS Data and Slope Regression. The mean and standard deviation of the PFOS data do provide a useful estimate of its half-life. Details of the related calculations are presented in below (see Appendix B, Equations B36 and B37). The maximum degradation rate is given in Equation 3: 2aP k F ( k p L x Up A t Eq. 3 and the minimum half-life is given in Equation 4 j i / 2 -> fnni/2 \ _ h ( 2 ) _ p.p A t l n ( 2 ) p - V pAnin (Vk r )/max 2 a pr Eq.4 We note that in both Equations 3 and 4, the mean PFOS concentration (jxP) and standard deviation ( a p) can be either molar or mass quantities. Table 6 presents the results of the calculation. Page 17 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Table 6. Degradation Rate and Half Life of PFOS in Aqueous Buffered Solutions Based on the Concentration Mean and Standard Deviation At (days) 42 M-P (ng/ml) 512 aP (ng/ml) 5.00 Maximum Observed Rate at 50 C (day'1) 4.64 x 10'4 Maximum Calculated Rate at 25 C (day'1) 4.64 x 10'*3 Calculated Half Life at 25 C (years) >41 Page 18 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Conclusions We have performed a study of the aqueous hydrolysis of perfluorooctane sulfonate (PFOS). Six different pH levels were Included in the study, which were carried out at 50C and extrapolated to 25C. Our results based on direct observation of the PFOS concentration indicate no hydrolytic degradation at any individual pH, nor do the data pooled over all six pH levels. From the mean value and precision of PFOS concentrations, we estimate the hydrolytic half-life of PFOS to be greater than 41 years. Page 19 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 References 1. "Fate, Transport and Transformation Test Guidelines: 835.2110: Hydrolysis as a Function of pH," U.S. EPA Office of Prevention, Pesticides and Toxic Substances, publication number 712-C-98-057, January 1998. 2. Experimental Physical Chemistry", F. Daniels, et al., McGraw Hill Book Co. (New York), p. 131,1962. Page 20 of 71 Signatures BACK TO MAIN 3M Environmental Laboratory Report No. W1878 William K. Reagen, Ph.D., Laboratory Management Date Page 21 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Appendix A: Analytical Method Method ETS-8-13.0, "Hydrolysis of Perfluorooctane Sulfonate (PFOS) and Analysis by High Performance Liquid Chromatography with Mass Spectrometry Detection." This Appendix presents the analytical method employed in this study. Page 22 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 3M Environmental Laboratory Method H y d r o ly sis o f P erflu o r o o c ta n e sulfonate (PFOS) and A n aly sis by H ig h Performance Liquid Chromatography w ith M ass Spectrometry Detection Method Number: ETS-8-13.0 Adoption Date: ^ q j0 o Effective Date: Approved by: Laboratory Manager Date Team Leader Bate ^ Page 23 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 1.0 Scope and Application____________________________________________________ 1.1 1.2 hTs(oCsRptyfhaoedein1mcsfrdeto,mrpa1rloeryae,dmns2tt.iichebs,eo2tRlprd-ey1etre8opad(t.drneMr1eaufa)sih.Sclneyyt)enPstdsdetFbraestoOyth.ti(eveSthcPreisiteagditcorenhehfpnicleopusamaneo)fnrforiifdlcosuroaoqordalcmunrestoataataeonrlnncyuctectiscteteaitsadsunutlirioelaoqefnfonssudpun.iadelaqrfIrteocuteflnhasiu(shinrPocootbFrimawafoOicsoaenieStcdddoit)nagb(oaTnryAnnaeHtpdtEhtsPhauiP1FysclA,fhOm1(omHS,nOe2Pe)atP,hntLaePot2sCTd(AtP)hSu.Fwe:sOii8intnS3hgt5)emt.rh2nae1as1las0nion 11..34 ATtrR(eeRhetccreifcoasfeevhermpeyrttrdoteaiortebohSsSl(oee(tecdr1cmit0diitosi0eaoncdtnrae1i)f13c4fi0e0lnufs%efooodfrr)rootaahrtoshrecaeeptnqeuaqaurnsuflaeeoyaldrislstmiiufytsyola.farncosAeconsaeunqicc-rtubhraaeoanscolscaiuepedmdsae.(rpsTvaolTameHllauumPertatigFaeoteOitrnotrssiSnaxt)aon.cttaorbvliyeteaetvraeriainooalauurflsayostzbureeurtrmhdfofibesgetyramhettoedehdtmpihspHoamedstrr..efi)oxthrsmopdai.knece. 2.0 2.1 ASulimqumoatsr oy of Method____________________________________________ f PFOS stock solution are added to vials that contain buffers at pH 1.5,3.0, 5.0, 7.0,9.0, and 11.0. The vials are then placed in an orbital incubator/shaker set at 50 3 C. Sets of vials are removed at designated intervals and the date and time recorded. The aqueous sample from the hydrolysis of PFOS is diluted 1 to 10 with methanol (MeOH) containing internal standard. PFOS, incubated in one ofthe several buffers is separated oacneatarteev/MereseOpHhasoselvDeniot ngeraxdIioennPt,acwitNh Gde-1teHctPioLnCbycoelluemctnrousspirnagy aionnaimzamtioonnimumass spectrometry in the negative mode. 3.0 3.1 3.2 3.3 3.4 vMDtaddwuSsiSMahconoeoshomeoraaelefcuoylanfamuttiodvuerundhnitcmcurnrempgietro/eitionnoeiMlnhdxideteotstalteenytriensnobbthonvoatsprOdflletatroiicnaaiiisaplHcpkoosfcnusnleearnensoa_)aikkopxlactm_tti.m(.apapmmeahs_Mmropet_aAeAiapaaerrln_ttSitnvelitshnnes_emiis)tna.oolstae_a.iyaremTentdl_munnrisanPsh_oc.amoaabbptr_arntmaltlleerleir_yeasetisprren_ptax.neiueato_tekl.sksh-resM_dcafeufTeeei_ormpnaldstdhaet_nahnrittipelbe_qnitrahrsianlpo_yimuglmrexmay_auoetsasiftah_rgoustiesrdtat_neepohaugur-td_daifiikmsmhsxkiaro_tenaiieble_tneontmnlgtheus_oshnaseaf_mfpaea.ttnfwrp_ehlrseokdeiepe_paahrnmdnnl_,mstaiugioitc_wcnauiospawh_rapanemfhenl_brldenatioydi_iphclnl(pctt_mlrirhfeiodetr_eecroyeeasei_pepadr.sppssax_lareeisaeegt_rtnptTxhrrneasoe_graaaheertdn_of.ictmmnee_otictstostani_Toenimpaonnrt_dallthganveeei_reupevnee,et_srarthetdntem_ho1anioa.t_meco0dad,ednB_e:dnfteta9aa_shhbeetaftl0ns_heefdolylc._aayeeabdtcoi_lncetuTunyislb_tfkcastafth_loottaiesfmaihac_ieslsfstnraes_irephtgcuplekb_hresaessde_ploeailtaaec_rrscmmnmdaeoi_efcnak_ceistpaagea_eosltirdl_de.esrryi_niuxtetred_eoi_nsn the method's recovery efficiency. PFOS HydrolysiEs TanSd-8A-1n3a.l0ysis by HPLC/MS Page 2 of 15 Page 24 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 3.5 3.6 3.7 IarsppHrrCsCenautntruayafoatontareinnedlcncloridtydrrehtebsooantisaanirnarlsrvacsacyd.dnueaelettssdildiris,nocfiubtnfaosgnasyhenotrenahacsdttednldahtaavf.dcaveal-baaainlirslbiocrrdudvordorraielaanet(uttsrotIoidttidniSreontetag.)hhunns.ceraeuuAhvoAndlmciuteeddoiarbvgnkimiccleehgnfucoripostutscfnohiwtr.ratoaoueartnnnTomnciedolydhaonlantimetforohnirdv(rfrgoeeCeastfuesthoerComnlhieerolteaVeumeucno,pat)asaierfs.rolelneuaaiynsbtcSrmsusceirotesloaoamistfitnnmusoiieadonnnadnprantteotoseacrcdprunocnoeusrndanofsorldcattvbacc,endeueoinasaa.selrtdtlassopryeTdt.acoeelzethekndfeIidmi,oSddtsbhntieooarndseenrsnotuaaseaetlrpntlrupdishlmnogitpesoimgneleoanipsdmnieoaeluidanafsamprnritiaalpneataeinnyrnltysoayoeaolrrltavoyiyefnicrtstdtdiaitmhcec.laeaaally 3.8 3.9 nDavuaILSnnoisiiae(admtllsudlbs)ymtieiaittmsoeirpox/enambrefy.erudiqepsbf.AumcafeeairIboesrfnitnvldtsetehceiopftodwelrauirotfdinptmitriihoootolhurnmnataethitdt(eneihoLnidgyftcOpefdisuersnQroerbtoteploaa)vlna.tyneittrsoahneTsilnestoyhiitudtaseserftniu/collndbuoedroutwbyniiofnnee-frpgsmfesrlotrtoorsirucssotceocomelntvilndhubueecumeltnneeirtotnes,ba,nataeliirm,nrfaaltittndphwqihaeoleuaehlsnynsidiidrcstiaeth-ilhhrslduaie.e.atqtiauncTcsnaigoahdalnliislvbseyobexrzslenavttertterediaepion.cslntiotaIaiicocfdbscuntdlmuhyreivresedmsersptaeesooefltalrytavtsefhnoueardernrdtmaehttdrdeeeedsddst.. 3.10 wSibRss1sitl0eimaeagtcnsnthrtpiidkieimdlonasaiunfe.rtsydeasp1rSldties4thnaac.h.me3ittafaTh)mnipeehrdledizeeucnperalLpioriimlonemOribt.rguiciQrntmHerasgontao.iouctrowaoeftFnignaenhoecccveirucegedlmunrrhiav,frtlbafraeyieaontctrtrmyymhieaoanta(aanotsctnyrereiwaiysebxlbiyeg-oStedthrpeenteewecsoapa,rtmeteai9teoenth9irinndnen%tseahtgLhnla1clcOatn4y.oot.Q1n4cnafhdctaiiotiidsnumtseidsaeoneelnncs1lksee4wtn.ch.l2otiieTetm)whdhlaieinenantvscdtLtehhotlOphaenortesQcefeteclhtonighiesswtuericgoiaesdoetnsoienntol(lcevninsenreoeanieennnltslt-ryzaatoet5irootno scfotuarrnvtdheae'rsdrle,isnviedearusraurlessgtahrreeesrseios2un5l%ftoo.rbmtauilnae. dFforor mthethpeubrpaocksecsaolcfuthlaetisotnuduys,inthgethaeccceaplitbarnacteiocnriteria Residual = known conek.n--owcanlccuolnaete. d cone, x 100 4.0 4.1 WH44..1e1a.a.12rltnhinagnWpHphsdrroaooeaonscpadnadere.fdldrteehuetCeayryelaeplw.uwrsoaWtoerpilanvoehriernenannlstgate_sabsv_lile_anrt_tita_pmir_ohee_sos_fso.oi_bdr_l_afeo_llar_np_ada_llr_ptp_sra_aor_ctf_tsit_cho_aif_sl,t_phd_re_iol_duc_etee_sd_cus_rari_emb_.ep_dW_le_ssae_maw_r_pi_gtlh_leo_spv_or_ele_svp_eaa_nnr_tad_it_nio_an___ PFOS HydrolysiEs TanSd-8A-1n3a.l0ysis by HPLC/MS Page 3 of 15 Page 25 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 4.1.3 pRFaoecvrkipeionwtge.nmtiaatlerhiaazlsa,rdansdof3eMacEhncvhireomnimcaelnutasledL,arbeofrearttoorimesatCehrieaml sicaafeltHyadzaatradsheets, 4.2 C44..a22u..12tionstREsthhenieeqnsnuspueedurnermacyltelpht,goataoltranteshrddusewutnhHcadaerPtreytLthh.iCneerpwmeohiossibscisihblueifslftipaithcyniadeosanefrtscdqoasunraeatranpemtripteiyrnpeaatptoriaeocrdneo.dfmrwepslihethtper1ti:ho1eratrcouenbt.oengDein/oMnnienoOgt Haal,lrouwn 4.2.3 4.2.4 EtrEhunnenssscuu.orreemttphhuaatttebtrheteforoerseaisvseteanarotlilunrgguhnthndeiatrrtoau.gnesneqinuethnecesuthpeprleyitsanamk tpolechomarpdldetiesksesqpuaceencoen 5.0 Interference 5.1 5.2 htCtiCoonaootrdednndreettwfaammemmarooreiinennnnsscamattenrtriaaatoasyttetneiclnttfoahhrwuosaaosmtteldttvhheiceneteonertrleceteusrt,miiifossernnernnesaooln,gecHessveuuneP.cctlssLhhU,.CiigsnnTletttahueetsebrrhsffiweerenorrgraeeuor,nnteuiacc,ntneeiaen.d.neaddnaeaontlteayhclseytiorssrisosacfomosmfpollpalevboeponnrreotantbctoeslrasmynsikmansygemctohaurousadstnebbalelayunsskisesd 6.0 Equipment_______________________________________________________________ 666...123 AHShneawakllyeetrti,tc-iaPnlacbcuakblaaartndocr(eHcsaPepn)asb1ilt1ei0vo0efHtmoPa0Li.n1CtamSingyisntegmte,mopr eerqautuivraeleant t50 3 C 666...333...123 PASuoumltvoepsn,atmqdupealgteearrs,nsAaerrLy,S,MMMoododedelelGlGG11313231211A3AAo,,roveraqeruiqaiuvbialvelaeilnnetjnetction volume capable 6.3.4 Column heater, Model G1316A 66..45 DMiaosnsesxpIeocntrPoamcetNerG. -Hl ecwolluemtt-nP,a3c5kamrdmLxC4/M.0SmDm, ,o1r0eqpumivpalaecnkt,incgap, aobrleeqoufivoapleernatting in the 6.6 sCelloecckte,dd-iigointa-ml. oOnintloyrionngemcloodcek should be used, to insure unambiguous documentation of 66..78 tpChHeenmctroierftrueegrc.et pcCeaorpfmaobirnlmegaoMnfcmoedaoeiflnpt3ar0io8nciepndHgu/rT3e0es.m00prepramtufroerM5 emteinr with 3-in-l gel filled combination 66..910 6.11 ReDDreleeaacfcttoraatrirgdasoeyindnrsaeagtlety(oampsrniH,.sdc/sArpaoerpffoPaetcwbCreelaesncrscoeoie:nmf/gHtmpeesumaiwtigepnlnreetaarctaltiasn-tpPuifanrarbeogc)lmke,4aoorthrdfe2ec-qodCunCehittvereoacmllteloSinrntatgtitohneH, VPLerCsisoynsAte.m6.a0s3woerllmaosre recent. PFOS HydrolysisEaTnSd-8A-n13a.l0ysis by HPLC/MS Page 4 of 15 Page 26 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 7.0 Supplies and Materials___________________________________________________ 77777.....12345 PCVLGaariraisbamtldeselup,usa-4rct0pea-dipmppeaLitupstV,eotgvOsli,aaAsglssl(,a,Isd-1sCi.,s5Hpd-moiEsspMLaobsloaerbeleq,u1iv-maleLntto) 10-mL 7777....7689 VHBAeoauamltuokimmelrteaos,ttnrigciGclpaafsilspsat,eisgtvkthasot,rri,vocasuyarsiproisanuibzgsleeesssioz(efpsdreiscpiseinosning 1% oftotal volume), 10-5000 pL 10-pL to 1000-pL 8.0 888...123 8.4 RMAt1gtSACrh8reaemlaeae.cnla0lmttmswmihigbfMosaeeaoernrnoiranngirkotf1liihtinuawl2owtsgmms.(ni3aaMttsm.hton1ahaee)nodco1ar.Onde.u8S1itEHl.uaW0dtS-xLtm)atMbea:aanvemtHna(edoiacrpdlPrlaepeulawwLcetrpmrao:CariddtrtoeAte/hsdeStxSe(rnrlPiritdomaceoaEwnatccfoaCgdlckeatee/rtemsGShnprlketyeotiC.axsglnAb2uirtgselathdtemriadaooadrbnedMreno)uc1esseuft)0iffn.g0rmemtho.orT0lumLsy0haso0.itoEwsl1unfMietoMsgiitogcSebnhhcOeribioseHuomnmsaceaataedstad,o.aneogdprrbarteyephqshewueniricevvqisgaauoltheailivvnnneettgi,ntdaottiuAilvut et(0esl.ye1teo5 8.5 8.6 8.7 88I8B7gPBHn....4u4r5uu0ate.i..efn1,fd2p1ffrdaeaeennblrrriaedosnslobefocP1ispT0MnTSiTokasounsolo0r.eFnHHfuhtfr1feelon.eapafaOr0uati0pOcPdcePforsinlt0a1yoeear(eSFi1mCFHdsMr0o0psnndls0OoeOaihin.apto.s,msbFdglr)are0Sr.lurSairdfleaTmu0Leasoltatotdptii0ihtppetf(iidnoorrvisioTa,tarTeicnsnpoothonleTrrpHkcgHunlysweysopaauror/toPddPaomfearooimnalclernFddFaurfcnfloioLdeespttnOOedppbniliptdponnyiorHTHecSoSMnPrirtnseMciHorru)hienMn=iatM/exsinsyfPqDttesaOielMirsseu1FOamnoaeaddiitOiHs.OdclnttuvieHa5k1uieflsHdoOa.tuSoTo0r,teal(3ntiy.rt.freHol(Rnmnes.a.yEtnoa0Pdtgd(hen.moLtpxEfP,1uf)esiSbc7pea.a(ax0nrfrvkrfErrom.eopcka,ii0oeoM0phlnrpnxemsnpvlx,m0aatgraau9claaeeipo0rsmliemma.edneOnnelx0:MtepddptdgeiiabH1,A:omgailtteu8pteatreanr/ioOia.tf:mdHnPlo2cofTytTAdtFnHe)e(LhfH.mceSralO1l1yeasPTladbse0Pa1StlsorsmicHy,4ikF.le0kGbt0lt0useaOupiPa0wrtoua0tnuaatr0oaFiSniniekdstordnocdOideiipanoikd8ggwnennrgStnbl.ih/godsh4ttiio/mrienitmsosfse.inogfhr2ettnLlsangnpoauLub)sMgasnaacHitub0mii(diblldknnnfRyoe.eyf1saepts5gOnsloeetdrte0l.ioawarfdet0Hnidi0o2enlnslssseeueu0ur..ddops5dtpietotsahgailgirT.nrfifourn)LreehnircdhdpnotogopigeimisnoHrofmassi1gsftorna1Pao0e4sM8lsrFCud0k..0Oi1Rtenaipw,)OoSCt.L1inaHt-hL. PFOS HydrolysiEs aTnSd-8A-n13a.l0ysis by HPLC/MS Page 5 of 15 Page 27 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 qsbbc8touu.ua7naffn.ffnc1deeetarrintsrsitdeoirnsaslpau.tosi)HtoefiConap2anl1sHel0.sia5db7r4oregm.fal0gtpaLe,isH7vsao.e0c1pfn,o.o05bnar.1,etnt3aaldoNi.bn0wl1e,eH0.r5ps.C0..RH01,,e/a(tc7neroe.md0radm,pg9eefe.rin0anat,satguualrrrnpaeedHdmteh1)mee1t.epe0arHasuutosraifenmmaglblepinbeutnurstfcofrheofarosasemloldlbtupeutHmfiofepncreassr.l.aibtPSurrarteoetpi.roaenrTehe b) 125 mL of 0.2 M KC1 (reagent grade) c) Adjust pH to 1.5 with additional 1N HC1 d) Bring to a final volume of 1L with 18.0 MQ water 8.7.2 ap)H13108.0..20g pMoQtaswsiautmerbiphthalate (reagent grade) dissolved in approx. 600 mL b) pH adjusted with 1N HC1 to 3.0 c) Bring to a final volume of 1 L with 18.0 MQ water 8.7.3 ap)H Am5.pL0pr1o8x.0imMaQtelwy a3t.e8r777 g ammonium acetate (reagent grade) added to 250 b) Add 250 mL 0.052 M acetic acid (reagent grade) c) Add 18.0 MQ water to about 900 mL d) Add to glacial acetic acid (about 0.5 mL) to adjust to pH 5.0 e) Bring to a final volume of 1 L with 18.0 MQ water 8.7.4 pa)H 570.00 mL 0.1 M KH2P04buffer (reagent grade) b) 291 mL 0.1 N NaOH (reagent grade) c) Adjust pH to 7.0 with either 1N HC1 or 1N NaOH d) Bring to a final volume of 1L with 18.0 MQ water. 8.7.5 pa)H 496.0mL of 0.1 N HC1 b) 125 mL of 0.1 M borax (Na^BO^HjO) (reagent grade) c) Adjust pH to 9.0 with either 1N HC1 or 1N NaOH d) Bring to a final volume of 1 L with 18.0 MQ water. 8.7.6 pa)H 51010.0mL 0.05 M NaHC02(reagent grade) b) 227 mL 0.1 N NaOH PFOS HydrolysiEs TanSd-8A-1n3a.l0ysis by HPLC/MS Page 6 o f 15 Page 28 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 c) Add water to 950 mL d) Adjust pH to 11.0 with 1N NaOH e) Bring to a final volume of 1 L with 18.0 Mfi water 8.8 T88..e88s..1t2AnaPpolcovaaS11yorpdoF0f2fpetnpdl-t.aeOipu1hmkcrinat.moaieSi1iLsrnaxonn1eeptsgitndvd)temropr]oassoi.lbSratclutoofiyupttoalxeftmiuihalnnolikaytmdeenaieosdotlkas1rfiysinspit0noaacte.i0etgpnllkhfuypd[ensl0etEarogi1n.(dos5oxl/S0kixumanal,emiud0tmsamcLit0d:nLotipi0eandnooldtoge.pfend:ftlpPtio[yAo1l1mFEu2051tOtxs.h,i0P10apnmSe0.Fm0ig1]kLm0O.n2ptigon)Slbape/graugtm:kshnf/stAmfLedwaoennlLmrMiaudt(afthaaPSetinreorOMFeakdrncOlHMywe(tiiSSOtsoiedeetpHnsOihcslrtot.uae1HMinltpo2uiFdaeno.dt1irOainin.8eolr5aHudd.(n)4lSt,.ib(.oceo1rSyofcAen)entsPatci(ucooFd1tSleind0Otoaenii-ncn1Sntp1rtg2gLia80io.tsi.-10in4nmao...l111naiL1q)maf)utifonoiLtseatarl 9.0 9.1 RSaemcoprldetiHmaesn dofliinnigti_a_l_p_r_e_p_a_ra_t_i_o_n_a_n_d__d_i_lu_t_i_o_n_o_n__t_h_e_f_l_u_o_ro__c_h_e_m_i_c_a_l_d_e_g_r_a_d_a_t_io_n________ 9.2 (Ohnycderothlyesi9s.)0amnaLlyosfisdsilaumtipnlgesporlevpeanrta(tiSoenctsihoene8t .(5A.1tt)ahcahsmbeenetnBa)d. ded to the hydrolysis mshioxutuldrebse, tshteorseadmaptl4ess2houCldbbefeoarneadliylzuetidown withitihn M24ehOoHurasn. dAulntetirlnaantiavleylsyi,stchaensbame ples performed. 1100..10 QInutearlniatlySCtaonndtarrodsl.__I_S_(_s_) _a_re__a_d_d_e_d__in__a_c_o_n__st_a_n_t_c_o_n_c_e_n_t_r_a_ti_o_n_t_o__a_ll__st_a_n_d_a_r_d_s_,________ samples, and matrix spikes. 10.2 Sample triplicates. Prepare and analyze all samples in triplicate to provide a measure of t2h5e%proercgisrieoanteorfsahnoaullydsibse. nTohteeda.naAlypsptroshparilal taecscteepptsRmSuDstvbaeluteaske<n25to%c.orRreScDt tvhaeluperosbolfem bCeofnosruelatnwailtyhsitsheisTaellaomwLedeatodeprroorcedeedsi(gen.ge.esfaomr dpilreercet-irounnasn, dadfdinitailoancaclebplatannkcse, eotrcr.)e.jection 10.3 oMstfuatdhtyre.ixaCnsoapnliyckteiencsat.rlaPrtuironenp. saroefathpeosspt-ihkyedsrhoolyusldisbmeaatpripxrosxpiikmeafteolryeeaqcuhaolftothae mpHids-ruasnegdein the cthaelibsaramtipolne tsrtiapnldicaardte.s Ttohewmhiacthriixt csoprikreespsaomndpsl.e sThhoeualdnableysatnsahlyazlleadcicmepmtepdeiracteenlyt sfoplilkoewing recoveries of 100 30%. Spike recoveries outside of this range should be noted. Appropriate steps must be taken to correct the problem before analysis is allowed to proceed (e.g. reruns, additional blanks or spikes, etc.). Before the analysis is allowed to proceed, consult with the Team Leader or designee for direction and final acceptance or rejection of the analytical run. PFOS HydrolysiEs aTnSd-8A-1n3a.l0ysis by HPLC/MS Page 7 of 15 Page 29 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 10.4 SCboevoCleloVvrwei,snatthanBedplrlaaoifmnbtekliert.mnoSof,oqumlusvoeaernnbettaittcbhakltaai-nontonk2sb0(LasichnOkojQeuscl)odtiloovbfneetnshr.teubAnilnacbsncetkerfsupo.mtraebeanlentdv(Saaelfucteetirsoefnvoe3rr.t9yh)ec. abIllifabanrnakatailoyrentevccuaalrurvreeys, 11.0 Calibration and Standardization____________________________________________ 11.1 11.2 rpSSsrCaLueomrtteavnaoalauloni,gnidetudrbadiewaoanfrratmratnesrdotrrhdsisrafohoeotdfpivownrroeroeulssesrifmlinytpdrgaaoean2aapnmarepl0rdraseopotatribhrifnerooolcegjdexeonrrsmicien.dn.mtstitiAwasrePoaeiirnnrtonicneetsanthalpa,ilyloypacathsrznap3neteler0dapcoa0ndiurapntidilntoretalaieegertarsrian/dttonemoesd.ntatLclpsooEsoesiffttxxnotroctatfchecaonr8eerelardnin0mllbraait0aubrrrtilaadnenrnstta.ggiitattoohUa/nitmonnnehassndleeLasyaotnsetsarPthafxidansleFttndy.hecOddataereCnraalSdiirtaponbadsalentrsrreaacaseeroatktundilrtfoliahaeutbPnrlcecwreFotsmabaiitOmottaeiarhnonSgmaydnttishiniebaoonmnenerfddviMteTunw.eetseghderaeasOo.rodmuedHfTsoitfh.tlhhodiesegayta. 12.0 Procedures__________________________________________________________________ 12.1 S12a.m1.p1le 12.1.2 12.1.3 atmBhDO"Obnhasoedeniebpvnxftetioeesseiakmorrvpsieamen.lii"tiuakzsit.lPltnehepeiaroeeaiptetknhsptarietheentpaaoferpgpeocenrfaahuwfouanrrelpapimecvtartphvtiiuibsraaeotaoeltolonesnrpvwfyrfonieioiauafolvlrltmtfaeiaebmptbnahesocdeaeerlhrmaacpsobtpatpoioefHpolilcen4ne,ikt0tpdsmf.-rrsUmtaoetuhaspmlsLantae"itdrpssVwtaaatlhtoriOmiiiedlcosdlAspkns,blbmestvweryo"iaaoaa,ltnlunlrh"lsskteadeifsrlowueynhnvrpizuestolaeehmi.lpdctuscap.bmatreaeEpoern"sxado,ficaotfmchrnrpirdapetsHitalpmecisticlaekyeaaridltnnpa1ebagob"molei,ytanlooLzrsterdwaodn.fildl 12.1.4 12.1.5 12.1.6 12.1.7 12.1.8 12.1.9 RaaTsawFsMtRtPdtRhohfnefaoeeolfiteeemldemaateimtucrmhxeackrcipitoprleoenniaotaal"merolovcirdtnevTrostnhd1ueaiiuysetfnit0abebht,trmthut-leotaoheaehccspherddateeao.eeatevooLtdrhbslnicZidrvofliecmaayattGtitnaoetliicepahisoentsaratnfmlht.e,ehnsoussohttettoe,ehp"eaiefTfte.goraeencmtcahosohshdroaapamaeamtnppedlnpmmrytreldiuetVeas1nhtroppi-srht-ba0tialOe.ylwlimeatesseeorRupbdAelaisinibsprLnecnaezreseromlgtvicsec,eeileohonoeiuoypadeenaf.olrfbnnavdlyddtvuftardhaR,hauii1ltaitrpaednnoperhre2tmoliiardcrceP.snioer1toulno.aeagFxanpy.cbctrt7dpOHAdoieltastt.odehuihhteSfgltrondeoewhdeis1hr.emtefehe/datetmtseeantoeeytshh(niaktntLssmAiaesceiirtankrgeh.deotesnegcetnapfabaiaCr.toanmicltluntfoyfhaochTefdopctnueanfmdehrleedbpte.aei1tpresdalnthpan2onhrttsiuepeiectu.olteo1ieurmsemloaBno.ceutt1pntip.p)atobtho1p.ieprtfeoenRi.mriorrmaonia,sre(mFta.ptaSeepcuenrom.meoHairubarcercpuae,tdthaelliifdtelsoliftiyvltmhesnaiiroemtmabee8tlael.h.opy8c.neok.1riitni)ontr PFOS HydrolysisEaTnSd-8A-1n3a.l0ysis by HPLC/MS Page 8 of 15 Page 30 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 12.2 12.1.10 12.1.11 12.1.12 12.1.13 I111n222s...212tr...112u4m 12.2.3 12.2.4 12.2.5 12.2.6 eavRAUU4P8aCCPiabViS0Snsnpiu0.pll3elasslehha8etaapfat0iapm1iivtlooeer.qnccnnrsvs2r4iepccrovnekueeooggfa)m9kkaoixygtsosvpitta9ttaas.lhe/ihuattetrolat.mmt4hhqi.ehSte2-apb1atitaausaL)paho5hl0vtsCe.tteeettpne--aeiqettn2Taapmar:mthhcSluvcpo"ollLyHaeesslLaeiespxlaaCtcvpnPsi1ilGiachamlgboeneamics5FpoeskirsmmarepprftdOafaaemsavhrirlrdascpptt"tenneSoioeeiioitouallcoganamlvpeeltolmaHtyilnhhuussitrnyttraeeitteeoPttmts1aasailslehedsottsuLitnnatsahameayrse.aneuddCpnnnertnssncdHLtoiIiaddusomdpnansatalaatPbrseasegtomvsaursaroeeaqrdLtoeendettfr,domaoaui,lkC(drasetrucamneseto,aIenaaprdt.atDndedcrccgchdoilbmddtcoaaetdaoh.,eeoepercrnstll9pmomodirsubl1hstqbrlayanarm0moeuep(srurcaavmrStletMhnaeeryepiLnt.ahterae.uopnpLbioaiaalciotmlMcnoietsderntnsnduholiscedrieoentoreiohbfnacovtedOnadwcicfPohe.otm1tokwtHtehF8rnahhn4tAnasctee.lOeiee.4,lseskct,a1ldyhi.tsStatomn2oAr9iselspnuctmaa)nsttr9soelpaoetctnnteltp9nareenrmrootaabuiiiosrridaklwntssenemyepidatcai(icvjsoansrunEruaveteteeiicdhglgstcsaenxsmqlyehsee.ytttas.ua.idesdia,vmovofepexlaEonyrianilqnptapeuanrtdenucrlhlpflltt.eaodeeseries(eeoaib:xenortgtrtcnc.eoaihclgsemshovlbeae(.reacnelSatqaadma0oentttneuees3oeetpwnacen1llltltnoyteh4iyifsctuo.o9es.hegnir9sh).. 12.3 H12P.3L.1C Isne'Ast'StunaTlpalAl:ythNseiDscBoolYfuP"mFonOn: SDHiPSoansmeyxsptelIeomsnsPf)r.aocmNpHG-sl,14.5.0,3x.03,55m.0m,7,.01,09p.0maonrdeq11u.i0v.alent. Solvent A: 2mM Ammonium Acetate in 1% MeOH (Section 8.3) Solvent B: MeOH Solvent Gradient: Time,041m...000inutes 8.0 %60A 6550 %B 44990505 0F.3lomwLR/matien 000...333 mmmLLL///mmmiiinnn Post time: 5.0 minutes; Column Temperature: 40 C 12.4 R12e.c4o.1mmeAndneadlysMisaossf PSFpeOcStroamt petHerss1e.t5u,p3;.0*,5.0,7.0,9.0 and 11.0. AIPDoorcnlyqiaizurnaiigttsyiioGtinoasMnFMoldooewde Nebulizer Pressure SEelelectcrtoesdpIraoyn (SIM) N8 eLg/amtiivne 30 psig PFOS HydrolysiEs aTnSd-8A-1n3a.l0ysis by HPLC/MS Page 9 of 15 Page 31 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Drying Gas Temp 300 C Capillary Voltage 3500 V Example conditions are applicable to Hewlett Packard HP 1100 equipment only. Tim e SIM Identity (m in) Ions 5.6 399 PFHS2 (M -H), quantitation ion 5 .6 4 0 0 PFH S 13C , (M -H ) qualitative ion 5.9 427 THPFOS (M -H ), quantitation ion 6.2 499 PFOS quantitation ion (M -H) 1-"6Q.2upaenrftl"uoiorno5hf0eo0xraTnHesPuFlPfOoFSnO;amS i1d3eC"Q,uaqnut"ailoitnatfiovrePiFoOnS 2- perfluorohexanesulfonate 3- perfluorooctanesulfonamide G ain (EM V) 1.0 1.0 1.0 1.0 1.0 Fragm enter (V ) 70 70 70 70 70 D w ell (m sec) 210 210 210 210 210 12.5 Autosampler set up* AAuuttoossaammpplleerr:Program: Injection volume: ANLonSeModel G1313A 5.0 pL Example conditions are applicable to Hewlett Packard HP1100 equipment only. 12.6 S12a.m6.p1le 12.6.2 aEaoAsbIcntdgaefnaanraeftltnaronhiyeydnlrretsyoa.eiitfzvrsshyaedIeeenfqtrc(hd.msuCateelaaoCinenfbrtcVledreeeaa)rct.trhttiadrhoaRfo,enntunesCs2ranictm0eCasavnopiVcendllqrv,ejayeuearacdnni2ntsstdi0id,otbiaunaloQfapnsntnCdeatkfrorriisetlun2heantfs0eoofttwrsihebmnerieejttaethcrohtcuaieaftonlinisonh,baniaarimgsnapnh,ttppaioearlolsyenonttszhpdceserttoatihaaasleincetcbehqdocrpueaaancrretltdiiekniobnsfcfinruexaoai.sgtrntitaaoagaDbinnnnlcodyeasa.antlatraionbdtnhta,rdaelaytrietodennsd 12.6.3 12.6.4 12.6.5 PeaiSSsxulataactDvocreeteeseacttdthhmeheefmeipvssblseeeeteqqarrcnuuth1redeaan,nar1ycrca9deeac9s.ctt,e8carso,bsarslmideafivpwntehlgeiettshth,oseeaatqnshneudeaqemQounreecCdnecec(coremortnhraaestetsaryi1pixn2oas0rnsep1dmi9ilknio8segr.ts)eetdoathnitandondtsha9aeym9'sslpiendlqeaeutbsee.ln.acn(eek..gs). into the if today 1133..01 DPctiinhnoeatatmeaentggkpa5rroEaaAu(ttviifnnooiavdannleu.lsi)aspyCtteifsimocroioismnfemias:pcnotPbihduoeaennasCekdbs.lassaisnlmwPeeceliuiuttansohkltesbiabsnacteoosoimseionsyleesnimnrisdsfemo_ept_rrhere_tetrhd_rosi_aecfut_nogi_rtrneh_acg_sasaih_olap_ainbe_psra_ehoak_ofta_iuutno_hlsdn_dein_eimcd_grhe_uoarn_srou_ttmiat_hfos_iaame_avtdo_aedg_btiipr_yscae_cmoae_rekx_r.t_tmehr_Paes_aecien_gatci_ukhno_atgn_sl_dg_pr_ee_aa_tke_r_ PFOS HydrolysiEs aTnSd-8A-1n3a.l0ysis by HPLC/MS Page 10 of 15 Page 32 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 13.2 psatCckhhrariaeenioloileubcccrtlauruidtaclrolctsvabiupetoaeliesnaorirtonanfmeotbtdeeoartgamuyfcirsoknaibinn:etneegsdgCdtaatfacThwrnlcoeHcteimut(epPhklxtaF)atttthOhbeceerleaSentnchp.aaaealblsCriecPebtoaFhndrlnaeOtiesbttciiuSeronoalrnttmmcteiswoorpinnanniotcanehumelddnntsethbdtthtaryehauenotTpndiidollnaeoeonrtastedlmstsori.nnigonLagHytlh:e.eoseaawtrdcawheenrvidoseoaefrrr,tdnhde.oeextseAtpiedgHsr.nnsuemaQemlausfittaonrainrgnctdediftisiaarrreutsdictso-tioninorgddnaetra Ln f If-p--r-n- -c4l -N versus minus elapsed time (-t). The subscripts t and 0 refer to analyte concejnPtFraOtSioJons)determined at some elapsed time t and at t = 0, respectively. The slope of 13.3 13.4 t0CMomoh.bba8eaatsl0tacertr0ierurinxiv,slxeuaecsdtldospetipnfimntrkishogkeuaemeltlptrsPiien.ttxFhhrecOCeesiepsSaTcnilakkteccl.aeruioebmlTnrcarecohatLceetveoineetovrahtr2nredieasevretipsaiareoelnusounr,dsrcesicendtfaihngeonletcsrteiurihtgeanlhencactietoehsferoevpnotleflhalfroooleytrtwh(afsodeiovhnirprerogeerHuexcaealttgdqimecoeurhbnanaseot.atprilf>iio)cktnhe0se:ste.ar8venm0ced0oara.stvrrudeiFsx.roytsr.uprsiC2kivnaeaglsc.lutuheUleasstcelienutsgrhsvetethhsean V Recovery - (kserve<*spiked saacmtupallearmesouulntt-sopbikseerdved sample result) _ 13.5 sSaammppleles:triplicates. Calculate the relative standard deviation (RSD) for the triplicate RSD = StanMdaerdanDCeovniaet.ion x 100% Tofhtihsepamraeamne.ter is also known as the coefficient of variation, a measure of the confidence 14.0 14.1 MClininoteeeetrafchrfeicocpuidter,nvPpetaesorrtififscDou0erl.a9tmer9lr0aymnofciornregaa_rtce_ioca__tune_rra(_.rc_2y_T)_.ho_eAf__qcn_uu_aar_cvn_cet_eist_pas_tth_aioo_b_nule_lad_ct_obt_hee_fe_ef_ixlc_oai_wem_n_iatn_no_ed_fd_hdc_iel_got_ehs_ree_ml_nyi_dn_fsao_to_ri_ofl_intn_he(_era_2cr_)iu_tf_yrov_ra_en_. _d The acceptance criteria for curve-fitting residuals (Section 3.10) is 25%. Alternative 14.2 mtcMmhoeeeratarrhteseroluiaadxrstesiosomnopnsefikcncfoeotusserr.fvoufefisPcipfeniieertgfrtnoicqtneru(gmnra)t(adesfnr.opacgrite.kiqcqebuuaeraaseqddecurdroaaavttwtiieioccarn)ycrsnum.firrnavogyemsabnimesdna0cte.ro9cinx9est0srsopaolirrkylgeimirnseiaatsmtsoeapmr.rleeeRsrc.eeaccsToeohsmre.dmaiAnnenanthldayeecsdctreasfpwhotaradlblaltea rapacrnocgbeepletpmplaebcrceeeftonhrteesapannikaaellyyrsseiicssooivsuetarloylofvwcaoelundetrtsoool.pfrAo10cpe0perdo.p3r0Ci%aot.nessSutpletipktsheemreTucseotavbmeerLiteaeskaeodnuetrtsooidrceodreorsfeitcghtnitesheefor direction. PFOS HydrolysisEaTnSd-8A-1n3a.l0ysis by HPLC/MS Page 11 of 15 Page 33 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 14.3 14.4 SafcadmCocolealoercsnomaniemtwgsrptpounieetlnleradeR.euesdTtuS.iAonrDraepgipnpmprvacolraleioacyclnpleutaiteerebstidesairos.sat<fe.tgBir2rsoeeeP5tlnefaaeop%ttrveisrfveer.omertraiRhmfpunaiSesaacntrDlnacybc1tesieve5onias%tbtnlaiuad.ksfseierfIeasofnfdlemolttorwhofewet2nahce5crpoende%eritrrtnorceouogfecerprtnaergvttnopharddcleeliiueafccpefteaoeerd,tonrre,rebtepcrnslllooaeacalmnmtecilsevipfumboetllehertitsfetottos.hhartaeehTenreTaaheamleeniyrnaeaosaimclitnuysoianasmLollitysueosmstaitftsadeosnnefhdrdaaeolrldrd 14.5 cLcuhiremvceikt, sosttfaonQpdutaharednrtwiutnial.ltiboOennu.lysTetdhh.eosRliemesaiantmaolpfylqzeeusaranenmtaitlaayitznioeindngbisseaefmoqrupealtlehsteowltahitseht laaocnwceeewpsttacsbatalleinbdcraaalrtiidborinnacttiuhorenve. 14.6 cSsosicnttaluoaaedltlnniaivbicddnneraaiaasnntrrttetdgdrisoubovtnmihlnaraeclescnuutnaekrertlluvsaieabm.lecrrtceetarSohnotooinatsoblttpvcnasiroemesacnnryghivttnareesbeamcodlatakuiitionnernscnkartesa.tstie,hnosqIadanhfunna.opedru4denTrla.ttdehikiapmIesslflhaiewssnocosoisiwlt,nttvhhrtgenuwegnomoolrteremebvsacnlotoelateellrnvsraeohkenttfhasnihn,tlathaltgnbhnbel2ceeasao5norml5%ukluv%ansmeitmnshnnchtetasaao,rbyipurntleyuableadnbedokkibvnnbsaeeeg.yrrcs,etetfaehorstooposcrmap.foreayudagl.tohohwiTlgryhuhilse 1155..10 15.2 15.3 PbUDCstrooosioserllkplaleesogcmunsetetagHdilolrolaPuefsnLrmssabCPcmoironsrpneeotltvhleacveeiowennlhneuatatrmsziswtoaentarnosbdsdaytoweiunphsisdplenawonWctshaipenesaogtosesssfaticintgebeolhllalMellisiegtstaceohptnaimoioacprnciegnlutoaetimermwmesuai.eBzlanoeTtntiwUotnahcsecotea2nnntga.de_inn_Efee_lmorr_asop_trait_.oys_n_ai.np_tp_or_ot_hp_erifaltaem. mUasbele 16.0 16.1 1166.32 RFPSriieglilncnotoauorntuddtthshd_eaa_hrt_dey_dac_rlo_lop_gliy_resa_sip_soh_sf_iaca_msl_lap_gnl_reda_ppl_ahr_bei_cpe_sla_rwaa_nit_tdih_od_nia_nwt_sato_rar_ukn_msa_hle_yen_set_itsI_Dcs_ou._mm_p_ml_ea_tre_il_ey_s,_fm_o_ra_ka_irnc_hg_i_sv_uin_reg_._to__in_c_l_u_d_e_ 11116666....4567 16.8 PaPEpSAlrhrtnlrioiocntnirenthtteoriicctcvhaihaoaeyllrllpdioesbsyrmltraoeaaonclantyftdtidroostoahidgnsnreardtiastacleampobsmdrg.lseaebppatsolanaeaordtnpoakditrpniaeocpatpenugparrerrinvnoaaaetpflinoroisdinrnatmfaitownnearcdtommilarourkaenddtdseiihiornaeetnhpetwheatoshnerctediossnntpsafttynohnoerdeircneaarelratisldhnwsaseatnrhpdrayreaal.eywtrpasaaefdwrisala.etdta.iaoftnialelfo.ilgeb. ook. Make a 111777...012 AAAttttttaaccahhcmmheemnnettnABt..s_HR_ey_pd_rr_eo_sley_ns_it_sa_tSi_va_em_C_p_lhe_e_mL_oi_cg_as_lh_Se_etr_tu_c_tu_r_e_s_______________________________ PFOS HydrolysiEs TanSd-8A-1n3a.l0ysis by HPLC/MS Page 12 of 15 Page 34 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 18.0 Bibliography 18.1 18.2 TFC0O5aoRpt7xeeC,ir,cJaTHatinrSaoauunnnabdasrslbpytooDa1ornet9kcfa9eionn8sifd.(tCiOTohPnreasPmnTosisfSfotp)rrHym83a,a"5ntR.id2oo1Pnb1hTe0yersHtsictCysG.d,Wru1oisdletyeaSslsiittsnu,edaPssehnOa.DtfFEf.,uidcn1ietc9ioto8ifo8n,Pn, p"roeB.fvDupef-nHf8te7,iro.EnSP,oAPluet7si1oti2nc-siCde-s98a-nd 19.0 Affected Documents None. 20.0 Revisions Revision Number Reason for Revision PFOS HydrolysiEs TaSnd-8A-1n3a.l0ysis by HPLC/MS Page 13 of 15 Page 35 of 71 Attachment A. Representative Chemical Structures 1. PFOS (Perfluorooctane sulfonate, C8FwS03) MW (anion) = 499 F 3M Environmental Laboratory Report No. W1878 R+ R = K*in this study, but may also be Li+, Ca+2, or DEA (diethanolamine) 2. THPFOS (1,1,2,2-tctrahydro(trideca)fluoro sulfonic acid) MW (anion) = 427 BACK TO MAIN ETS-8-13.0 Analysis ofPFOS Hydrolysis Products by HPLC/MS Page 14of 15 Page 36 of 71 3M Environmental Laboratory Report No. W1878 Attachment B. Hydrolysis Sample Logsheet TEST AKAYLTE: Lab Roquas! Humben D o m in a) Intensa): Nomina) T em p e ra tu re;. C Sample No. Time: initials; Irrt Temp pH 1.5 1.5 bik 1.5 Buffer Fluorochemlcal Degradation (Hydrolysis) Analysis Test Analyte _ Incubator ID: _ S tart Date: _ Stop Date: _ Incubation Interval: , Spike Solution _Jays. Time: _ Time: p hours. Dilution Solvent SoluflcnTO Amount (m l) Solution 10 WOAmount Solution IP Amount jp U Solution P Amount <mU Freezer )D: _ Start Date: S lop Date: Internal Standard Solution ID Amount (I*.) Tima: _ lim e ; Comment blk bik C o m m ents: Component Cone. Component (MCoBn/meL. ) Component Cone. (uo/mL) Component Conci C>o*O E T S -8 -1 3 .0 Analysis o fPFOS Hydrolysis Products by HPLC/MS Page 15 o f 15 Page 37 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Appendix B: Kinetics Model This Appendix includes a mathematical description of the kinetics model employed in the study.Appendix Page 38 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Kinetics Model B1. Reaction Components and Rates The arguments below are based on the following idealized set of reactions representing the hydrolysis of a parent compound P and its hydrolysis products A m, which number N. The actual hydrolysis reactions that occur under neutral, acidic, and basic conditions are subsumed in these equations, and are assumed to proceed with pseudo-first order rates k Pm(forthe parent) and k Am(forthe parent's hydrolysis products). P + H 20 <=>nm A m+ Y ml (m= l to N) (B1) A ra + H 20 Y, (m= 1toN) (B2) where the general symbols Y ml and Ym2 represent all the other hydrolysis products. B2. Parent Compound Concentrations Equation B1 indicates that the pseudo-first order differential change in the parent concentration P is given by (B3) which is equivalent to the separable differential equation (B4) Equation B4 may be directly integrated to obtain the general solution ln[p]= " XN nmkPmt +C m=l W ith the initial condition P (t = 0 )s P 0, the specific solution to Equation B4 is (B5) using the additional definition of the total parent hydrolysis rate Page 39 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 N' kp= X nmkpra m=l (B7) Equation B6 can be re-written in a form that allows a least-squares estimate of the total parent hydrolysis rate: /p \ k pt -In vV (B8) Using the initial (t = 0) measured value of the parent concentration P0and later values P measured at later times t , one can calculate and plot the (linear) quantity [-In (P/P0)] versus time and obtain a least -squares estimate of the slope of the line. The resulting slope is the least-squares estimate k p of the total parent hydrolysis rate. Equation B6 indicates that over a period of time T 1^ (the parent hydrolysis half-life) the parent concentration P is reduced through hydrolysis by a factor of two, where (B9) A least squares estimate of the parent hydrolysis half-life is therefore available from ,l/2_ 2 ) (B10) B3. Product Compound Concentrations The pseudo-first order differential changes in the product concentrations Am (using Equations B2 and B6) are d A m= ( n mk PmP - k AmA m)d t = ( n mk PmP0 e"kp ` - k AmA m)d t (B11) and the (first order, non-separable) differential equation governing the product concentrations is dt + k AmA m = nmk PmP0 e,-k p t The "standard form" of Equation B12 is (B12) Page 40 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 A m+ S ( t ) A m = Q ( t ) where the "function" S (t) is actually a constant: S (t) = k Am and Q (t) = nmk PmP0 e~M . The general solution A mto Equation B12 is contained in A m eJS(t)dt = J.Q (t)e JS(,')dt' dt + C (B13) (B14) (B15) (B16) where gJS(t)dt _ e JS(t')dt' ,, g k ^ J d t _ (B17) and dt + CjQ ( t) e 's(t')d*'d t + C = nmk PmP0J ekAm` e'kpt (B18) There are two cases of Equation B18 to consider. In the circumstance that k Am = k p , which occurs only when the hydrolysis rate of the m`hproduct is identical to the total parent hydrolysis rate, the general solution to Equation B18 is (f o r k Am = k p ) Amekpt= nmkpmP0t + C (B19) and, using the initial condition A m(t = 0 ) = A ^ , the specific solution to Equation18 is (f o r k Am= k P) A m= (nmk PmP0 t + A m0)e'kpt . (B20) We note that when k ^ = k p = 0 (that is, when both the parent and potential product are hydrolytically stable), Equation B7 requires (also) that k Pm= 0, so Equation B20 becomes Page 41 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 A ,, = A,, (B21) indicating, as required, that the product concentration does not change with time. The circum stance k Am = k p is highly improbable, and is neglected in the remainder of this discussion. However, the reader should bear in mind that the expressions derived below do not hold when the parent hydrolysis rate k pand the product hydrolysis ra te k ^ approach each other. In the more probable case, for which k Am ^ k p (i.e. that the hydrolysis rate of the mth product is different from the total parent hydrolysis rate), the general solution to Equation B18 is A ,, e`Am1 ^m^Pm^O (k^-kpjt kAm-kP (B22) and the specific solution to Equation B18 with the initial condition A m(t = 0 )= A m0 is Am A m0+ knpmk--Pkm*Pm0 \ / t __ n mk Pm P 0 g-kp t k P ~ k Am (B23) Of greatest interest here is the case in which the product compounds are known to be hydrolytically stable, that is, when k ^ = 0 for all m. In this case, Equation B23 becomes (for hydrolytically stable products) A,,=A- + ^ = A (l-e * '') . Kp (B24) B4. Relationships Between the Parent and Compound Concentrations Equations B7 and B24 can be combined to obtain (for hydrolytically stable products) N V ( Am" A m0) (B25) Page 42 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 so that (for hydrolytically stable products) ( l-e " kpl)= ^ ^no) m=l P 0 or (B26) (for hydrolytically stable products) kpt = -In "1- r ( A ,, - A n,,,) m=l P 0 (B27) If the changes in the product concentrations are ail small compared to the original parent concentration, that is, if Y Am -A m0 m-1 P0 1, (B28) we may use the expression (valid for -1 < X < 1 ) ln(l + X) = X ---2X 2 + -3X 3- -4X 4+. (B29) and Equation B23 becomes (for hydrolytically stable products and Lm0 <<Po) t AV A -A-^mO^ k p t= - 77 po (B30) Page 43 of 71 or (for hydrolytically stable products and BACK TO MAIN 3M Environmental Laboratory Report No. W1878 (B31) B5. Parent Half-Life Estimates Based on Limits of Quantification of the Products In every experimental determination of k P, there is some set of values A " *3 (the "limits of quantitation") below which the product concentrations A mcannot be reliably measured. If during an experiment carried out over the period of tim eA t all the product concentrations A mremain below their limits of quantitation, then the maximum possible value of the rate k p is obtained by assuming (for all the products) that 1) A ra0 = 0 and 2) at tim e t = A t , the product concentrations have increased to the values A m= A ^0Q. With these assumptions, the experimental data indicate that the reaction rate k pis less than some maximum value (kp^ as follows: (for hydrolytically stable products at concentrations below the limits of quantitation) k P < (k PL , = Tr 0 ra r 1r mS=l A TMQ (B32) Under the same circumstances and assumptions, the experimental data indicate that the parent half-life T 1^ (see Equation B9) is greater than the value (t ^ ) . as follows: (for hydrolytically stable products at concentrations below the limits of quantitation) -1 T 'p M Tl L = 7VK Pr /mfax- = At p1* 2) X Ar _ m=l (B33) The reader should note that Equations B32 and B33 are valid only when both 1) the products are hydrolytically stable and 2) the concentrations of all the potential products are measured. Otherwise, the quantity (k p)maxin Equation B32 may not actually represent the maximum possible value of the rate constant k P, and the related result in Equation B33 for (t ^ ) is also questionable. Page 44 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 B6. Parent Half-Life Estimates Based on Limits of Quantification and Experimental Precision of Product Concentrations In certain experiments, some hydrolysis products are present at quantifiable but essentially constant concentrations over the time (A t ) of the experiment. In this case, it is the experimental precision of the measured product concentrations, rather than the limits of quantitation, which contribute to the estimate of the maximum value of the parent hydrolysis rate k p. If the set of concentrations measured for the mth product have the mean value p.mand standard deviation o m, the data do not exclude the possibility that the product concentration increased from the initial value o m - p mto the value o m + p mat time t = A t . Taking this possibility to be the actual case for the measured products, the maximum value of the quantity (A m- A m0) is 2 o m. This reasoning suggests that the following estimate of the maximum parent hydrolysis rate is appropriate: (for hydrolytically stable products at either 1) constant measured concentrations with standard deviation amor 2) concentrations below the limits of quantitation) k P^ (kpL = LOQ + X 2* , Below LOQ Cons tan t (B34) Under these circumstances and assumptions, the experimental data indicate that the parent half-life T 1^ is greater than the value (t ^ )minas follows: (for hydrolytically stable products at either 1) constant measured concentrations with standard deviation crm or 2) concentrations below the limits of quantitation) ~y2 p >~ V(t 1/P2) 'min 2) = A t P0 2 ) ( k p )max Below LOQ Constant (B35) The reader should note that Equations B34 and B35 are valid only when both 1) the products are hydrolytically stable and 2) the concentrations of all the potential products are measured. B6. Parent Half-Life Estimates Based on the Experimental Precision of Parent Concentrations In certain experiments, the hydrolytic parent remains at an essentially constant concentration over the time (A t) of the experiment. In this case, it is the experimental precision of the measured parent concentrations that determines the maximum value of the parent hydrolysis rate k p. If the set of concentrations measured for the parent have the mean value p pand standard deviation o P, the data do not exclude the possibility Page 45 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 that the product concentration increased from the initial value p P - g p to the value p P + c P at tim e t = A t . This reasoning suggests that the following estimate of the maximum parent hydrolysis rate is appropriate: (for essentially constant parent concentrations with mean value p Pand standard deviation GP) k P < (k p)max ^ p A t ` (B 36) Under these circumstances and assumptions, the experimental data indicate that the parent half-life T 1^ is greater than the value (T ^ ) as follows: (for essentially constant parent concentrations with mean value p Pand standard deviation 0 P) t !/2p ( ^ )t\ pP/r'min ln(2) _ pP A tln(2) (k p)max 2G p (B37) B8. Temperature Dependence of the Reaction Rate and Half-Life In order to increase the speed of the reactions of interest, we conducted this experimental study using samples maintained at the temperature 50C = 323 K. Of greater interest are the corresponding results for the environmentally important temperature 25C = 298 K. When the Arrhenius activation energy for a reaction is A H a, Equation B38 B1 provides the following relationship between the hydrolysis rates (Iq and k2) for that reaction at two different absolute temperatures ( T and T2): k , ____ [AHa ' 1 1 " [ R LTA2 TJ (B38) where R = 1.99 x 10'3 Kcal mole'1K'1is the ideal gas constant. Using the value82 A H a=18 Kcal/mole, the rate ratio k , / k 2 at the corresponding temperatures T, =298 K and T 2=323 K is ki _ _ 18 1.9 9 X 1 0 '3 '1 .3 2 3 - 2 91 8 1J J1 exp(-2.35) = 0.095 (B39) i ___1/ Page 46 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Equation B39 indicates that the hydrolysis reactions of interest proceed approximately ten tim es more slowly at 25C than at the chosen experimental temperature of 50C. Accordingly, the rate reactions reported here for the temperature 25C are ten times lower than those measured at 50C, and the hydrolysis half-life estimates reported here for 25C samples are ten times longer than those calculated from the 50C experimental data. References to Appendix B: 811. N Levine, "Physical Chemistry," McGraw-Hill (New York), pp. 498-501 (1978). 82 F. Daniels, et al., "Experimental Physical Chemistry", McGraw Hill (New York), p.131 (1962). Page 47 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Appendix C: Selected Analytical and Kinetics Results This Appendix includes selected sample data and their related kinetics results. For brevity, some solvent blank and continuing calibration verification results that did meet the data quality objectives have been excluded from the following tables. However, all data failing to meet the data quality objectives are included below. Page 48 of 71 PFOS Buffer Hydrolysis Study at 50 C. 3M Environmental Laboratory Report No. W1878 All cpo1.nH5centratiToinmsein7(Dnagy/sm) l. 111111......555555 223441185294 Cone. 508 551100 555510115473 In [P]t7[P]o 00..000050 00..000152 -0.001 00..001114 pH 1.5,PRFaOteSc@onSsOtaCnt graph 0.05 0.00 -----*----- ----------- ---- -- EI --00..0150 " -0.15 y = 2.5R02E=-034.9X3E- -50.315E-04 " - 0.20 -0.25 0 20 40 Time (days) 60 p3.H0 Time 7(Days) C5o0n4e. In0[P.0M00Plo 333333......000000 442231129854 555555111110120409 000000......000000111211152007 PFOS @50 C Time (days) SUMMARY OUTPUT Regression Statistics Multiple R R Square Adjusted R Square Standard Error Observations 0.62682 0.39291 0.27149 0.00515 7 ANOVA Regression Residual Total df 1 5 6 SS 0.00009 0.00013 0.00022 Intercept X Variable 1 Coefficients -0.00053 0.00025 Standard Error 0.00435 0.00014 % 2a Slope Uncertainty 111% SUMMARY OUTPUT Regression Statistics Multiple R R Square Adjusted R Square Standard Error Observations 0.77640 0.60279 0.52335 0.00431 7 ANOVA Regression Residual Total df 1 5 6 SS 0.00014 0.00009 0.00023 Intercept X Variable 1 Coefficients 0.00313 0.00032 Standard Error 0.00364 0.00012 % 2a Slope Uncertainty 73% BACK TO MAIN Page 49 of 71 PFOS Buffer Hydrolysis Study at 50 C. 3M Environmental Laboratory Report No. W1878 All cpoHncentratiToinmsein(Dnagy/sm) l. 5.0 7 55..00 2114 5555....0000 44235298 Cone. 515 555555000112388800 In [P]t/[P]o 0.000 ----000000......000000001211594440 0 .1 0 -i o 0.05 - -S ' 0-00 1- 0.05 - - 0.10 - 0.15 0 pH 5.0,PRFaOteSc@on5st0aCnt graph y=* 1.1R128=E-20.045x4-E9-.08267E-03 -- -- --- ~ 20 Time (d4a0ys) 60 pH Time (Days) Cone. In [P]t/[P]o 777...000 77..00 77..00 41724 24231589 455711484 551152 552109 0.000 ---00000.....000000010024286 0.10 I 00..0005 -0.05 - - 0.10 -0.15 0 pH 7,0,PRFaOteSc@on5s0taCnt graph _______y_=__!.5R122-E-U045x4-E7-0.414_2_E_-0_3__ 20 Time (d4a0ys) 60 SUMMARY OUTPUT Regression Statistics Multiple R R Square Adjusted R Square Standard Error Observations 0.14332 0.02054 -0.17535 0.01279 7 ANOVA Regression Residual Total df 1 5 6 SS 0.00002 0.00082 0.00084 Intercept X Variable 1 Coefficients -0.00987 0.00011 Standard Error 0.01081 0.00035 % 2a Slope Uncertainty 618% SUMMARY OUTPUT Regression Statistics Multiple R R Square Adjusted R Square Standard Error Observations 0.36797 0.13540 -0.08075 0.00646 6 ANOVA Regression Residual Total df 1 4 5 SS 0.00003 0.00017 0.00019 Intercept X Variable 1 Coefficients -0.00744 0.00015 Standard Error 0.00557 0.00019 % 2a Slope Uncertainty 253% (A) Data in Italics have been rejected from the fits on the basis of the data quality objectives (see text). BACK TO MAIN Page 50 of 71 3M Environmental Laboratory Report No. W1878 PFOS Buffer Hydrolysis Study at 50 C 9.0 999999.....0.00000 174 2234418529 507 555550012152202 00..000040 -0000....000013104055 pH 9.0,PRFaOteSc@on5s0taCnt graph SUMMARY OUTPUT Regression Statistics Multiple R R Square Adjusted R Square Standard Error Observations 0.70888 0.50251 0.40301 0.00942 7 y =5.713E-04X- 7.766E-03 R2= 5.025E-01 20 30 40 50 Time (days) 60 Time (Days) 7 14 223185 4429 C5o1n4c^ 555555100111195876 In 0rP.0W00[P]o ---0000....000000019967 00..000075 PFOSatSOC Intercept -0.00777 0.00057 % 2cr Slope Uncertainty 89% SUMMARY OUTPUT Multiple R R Square Adjusted R Square Standard Error Observations__________________ 0.48645 0.23663 0.08396 0.00902 7 0.00025 BACK TO MAIN Page 51 of ' PFOS Hydrolysis Analysis Results HP LC/MSD 1100 PFOS Hydrolysis Study 50 C .; pH 1.5 All concentrations in ng/ml PF0S MeOH Blank L1 Std, 300.90 L2 Std, 401.20 L3 Std, 451.35 L4 Std, 501.50 L5 Std, 541.62 L6 Std. 601.80 L7 Std, 702.10 L8 Std, 802.40 MeOH Blank MeOH Blank PFOS-001A PFOS-002A PFOS-003A PFOS-004A PFOS-025 PFOS-026 PFOS-027 PFOS-028 PFOS-049 PFOS-050 PFOS-051 PFOS-052 PFOS-073 PFOS-074 PFOS-075 PFOS-076 MeOH Blank CCV1.5, 501.5 MeOH Blank PFOS-097 PFOS-098 PFOS-099 PFOS-100 PFOS-121 PFOS-122 PFOS-123 PFOS-124 PFOS-145 PFOS-146 PFOS-147 PFOS-148 PFOS-169 PFOS-170 PFOS-171 PFOS-172 MeOH Blank MeOH Blank L1 Std, 300.90 L2 Std, 401.20 L3 Std, 451.35 L4 Std, 501.50 L5 Std, 541.62 L6 Std, 601.80 L7 Std, 702.10 L8 Std, 802.40 External Standard quant r^O.999 Linear, include origin Calibration range: 300-800ng/mL V ial# 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 - 51 52 53 54 55 56 57 58 !/ PFOS0003.D RT 0.0 PFOS0004.D 6.2 PFOS0005.D PFOS0006.D PFOS0007.D 6.2 6.2 6.2 PFOS0008.D 6.2 PFOS0009.D PFOS0010.D 6.2 6.2 PFOS0011.D PFOS0012.D 6.2 0.0 PFOS0013.D 0.0 PFOS0014.D PFOS0015.D 6.2 6.2 PFOS0016.D PFOS0017.D 6.2 6.2 PFOS0018.D PFOS0019.D 6.2 6.2 PFOS0020.D PFOS0021.D 6.2 6.2 PFOS0022.D PFOS0023.D 6.2 6.2 PFOS0024.D PFOS0025.D 6.2 6.2 PFOS0026.D PFOS0027.D PFOS0028.D PFOS0029.D 6.2 6.2 6.2 6.2 PFOS0030.D PFOS0031.D PFOS0032.D PFOS0033.D 0.0 6.2 0.0 6.2 PFOS0034.D PFOS0035.D 6.2 6.2 PFOS0036.D PFOS0037.D 6.2 6.2 PFOS0038.D 6.2 PFOS0039.D PFOS0040.D 6.2 6.2 PFOS0041.D 6.2 PFOS0042.D 6.2 PFOS0043.D 6.2 PFOS0044.D PFOS0045.D PFOS0046.D PFOS0047.D 6.2 6.2 6.2 6.2 PFOS0048.D PFOS0049.D PFOS0050.D 6.2 0.0 0.0 PFOS0051.D 6.2 PFOS0052.D PFOS0053.D PFOS0054.D 6.2 6.2 6.2 PFOS0055.D PFOS0056.D 6.2 6.2 PFOS0057.D PFOS0058.D 6.2 6.2 Spike Amount = Original Amount= AREA 0 904650 1174066 1319550 1498940 1621894 1761605 2049253 2315618 0 0 1610328 1615948 1614464 1911799 1492442 1523548 1503439 1761706 1501472 1498384 1539735 1825238 1506431 1516998 1519482 1805033 0 1486941 0 1586882 1477990 1506268 1783638 1489526 1525801 1497479 1796727 1515386 1522659 1530943 1859840 1526048 1531093 1525693 1812642 0 0 911389 1197270 1329980 1569355 1654212 1791298 2086339 2356392 100.30 510.50 CONC. 0.00 300.8 393.4 443.4 505.0 547.3 595.3 694.1 785.6 0.0 0.0 543.3 545.2 544.7 646.9 502.8 513.5 506.6 595.3 505.9 504.8 519.0 617.1 507.6 511.2 512.1 610.2 0.0 500.9 0.0 535.2 497.8 507.5 602.8 501.8 514.2 504.5 607.3 510.7 513.2 516.0 629.0 514.3 516.1 514.2 612.8 0.0 0.0 303.1 401.4 447.0 529.2 558.4 605.5 706.8 799.6 ng/mL ng/mL or VcRSD 100% 98% 98% 101% 101% 99% 99% 98% %Spike Recovery 0% 102% 1% 87% 2% 107% 0% 100% 4% 1% 1% 0% 101% 100% 99% 106% 103% 101% 101% 100% 89% 100% 115% 98% 3M Environmental Laboratory Report No. W1878 THPFOS Day RT AREA CONC. 5.9 444137 367.9 5.9 439597 367.9 5.9 428929 367.9 5.9 448527 367.9 5.9 445358 367.9 5.9 457122 367.9 5.9 442512 367.9 5.9 450877 367.9 Day 0 Day 0 Day 0 DayO Day 7 Day 7 Day 7 Day 7 Day 14 Day 14 Day 14 Day 14 Day 21 Day 21 Day 21 Day 21 Day 28 Day 28 Day 28 Day 28 Day 35 Day 35 Day 35 Day 35 Day 42 Day 42 Day 42 Day 42 Day 49 Day 49 Day 49 Day 49 5.9 445707 367.9 5.9 442993 367.9 5.9 447797 367.9 5.9 449355 367.9 5.9 438799 367.9 5.9 443628 367.9 5.9 447460 367.9 5.9 436481 367.9 5.9 441226 367.9 5.9 444754 367.9 5.9 449044 367.9 5.9 453987 367.9 5.9 454803 367.9 5.9 448561 367.9 5.9 448125 367.9 5.9 445533 367.9 5.9 445695 367.9 5.9 476345 367.9 5.9 445579 367.9 5.9 449198 367.9 5.9 442980 367.9 5.9 445723 367.9 5.9 449841 367.9 5.9 445467 367.9 5.9 459061 367.9 5.9 451623 367.9 5.9 454163 367.9 5.9 447915 367.9 5.9 458757 367.9 5.9 455665 367.9 5.9 458353 367.9 5.9 457178 367.9 5.9 458383 367.9 Mean STDEV %STDEV 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.938 0.008 0.13% 468259 463704 454923 471691 470565 459784 462734 464047 451285 9527 2.1% 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 BACK TO MAIN Page 52 of 71 3M Environmental Laboratory Report No. W1878 HPLC/MSD 1100 PFOS Hydrolysis Study 50 C .; pH 3.0 AH concentrations in ng/ml . ' SSsuMiJfe-1\ MeOH Blank L1 Std, 300.90 L2 Std, 401.20 L3 Std, 451.35 L4 Std, 501.50 L5 Std, 541.62 L6 Std, 601.80 L7 Std, 702.10 L8 Std, 802.40 MeOH Blank MeOH Blank PFOS-005A PFOS-006A PFOS-007A PFOS-008A PFOS-029 PFOS-030 PFOS-031 PFOS-032 PFOS-053 PFOS-054 PFOS-055 PFOS-056 PFOS-077 PFOS-078 PFOS-079 PFOS-080 MeOH Blank CCV3.0, 501.5 MeOH Blank PFOS-101 PFOS-102 PFOS-103 PFOS-104 PFOS-125 PFOS-126 PFOS-127 PFOS-128 PFOS-149 PFOS-150 PFOS-151 PFOS-152 PFOS-173 PFOS-174 PFOS-175 PFOS-176 MeOH Blank MeOH Blank L1 Std, 300.90 L2 Std, 401.20 L3 Std, 451.35 L4 Std, 501.50 L5 Std, 541.62 L6 Std, 601.80 L7 Std, 702.10 L8 Std. 802.40 External Standard quant: ^=0.998 Linear, include origin Calibration range: 300-800ng/mL PFOS Hydrolysis Analysis Results PFOS V ia l# 91 1 2 3 4 5 6 7 8 91 91 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 91 83 91 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 91 91 1 2 3 4 5 6 7 8 FILE# RT PFOS0050.D PFOS0051.D PFOS0052.D 6.2 6.2 PFOS0053.D 6.2 PFOS0054.D 6.2 PFOS0055.D 6.2 PFOS0056.D 6.2 PFOS0057.D 6.2 PFOS0058.D 6.2 PFOS0059.D PFOS0060.D PFOS0061.D 6.2 PFOS0062.D 6.2 PFOS0063.D 6.2 PFOS0064.D 6.2 PFOS0065.D 6.2 PFOS0066.D 6.2 PFOS0067.D 6.2 PFOS0068.D 6.2 PFOS0069.D 6.2 PFOS0070.D 6.2 PFOS0071.D 6.2 PFOS0072.D 6.2 PFOS0073.D 6.2 PFOS0074.D 6.2 PFOS0075.D 6.2 PFOS0076.D 6.2 PFOS0077.D PFOS0078.D 6.2 PFOS0079.D PFOS0080.D 6.2 PFOS0081.D 6.2 PFOS0082.D 6.2 PFOS083.D 6.2 PFOS0084.D 6.2 PFOS0085.D 6.2 PFOS0086.D 6.2 PFOS0087.D 6.2 PFOS0088.D 6.2 PFOS0089.D 6.2 PFOS0090.D 6.2 PFOS0091.D 6.2 PFOS0092.D 6.2 PFOS0093.D 6.2 PFOS0094.D 6.2 PFOS0095.D 6.2 PFOS0096.D PFOS0097.D PFOS0098.D 6.2 PFOS0099.D 6.2 PFOS0100.D 6.2 PFOS0101.D 6.2 PFOS0102.D 6.2 PFOS0103.D 6.2 PFOS0104.D 6.2 PFOS0105.D 6.2 Spike Amount = Original Amount= "'r e a 911389 1197270 1329980 1569355 1654212 1791298 2086339 2356392 1614579 1630018 1615096 1913128 1482241 1508691 1512531 1788783 1524174 1535721 1493221 1832061 1536518 1509305 1502071 1806145 1514429 1522352 1535855 1518633 1803572 1511584 1523640 1523080 1815571 1530536 1513422 1545677 1838657 1526013 1520230 1521742 1818700 928344 1190154 1340916 1535521 1642704 1755846 2041833 2301233 100.30 510.50 ; ~ /o ot otaridarci CONC. or %RSD 299.8 398.8 444.7 527.5 556.9 604.3 706.4 799.9 100% 99% 99% 105% 103% 100% 101% 100% Recovery 543.2 548.5 543.3 646.5 497.4 506.5 507.9 603.5 511.9 515.9 501.2 618.4 516.2 506.7 504.2 609.5 508.5 511.3 515.9 510.0 608.6 507.5 511.7 511.5 612.7 514.1 508.2 519.3 620.7 512.5 510.5 511.0 613.8 1% 1% 1% 1% 1% 0% 1% 0% 101% 99% 108% 100% 96% 102% 107% 102% 305.7 396.3 448.5 515.8 552.9 592.1 691.0 780.8 ng/mL ng/mL 102% 99% 99% 103% 102% 98% 98% 97% THPFOS Day RT AREA CONC. 5.9 468259 367.9 5.9 463704 367.9 5.9 454923 367.9 5.9 471691 367.9 5.9 470565 367.9 5.9 459784 367.9 5.9 462734 367.9 5.9 464047 367.9 DayO Day 0 Day 0 DayO Day 7 Day 7 Day 7 Day 7 Day 14 Day 14 Day 14 Day 14 Day 21 Day 21 Day 21 Day 21 Day 28 Day 28 Day 28 Day 28 Day 35 Day 35 Day 35 Day 35 Day 42 Day 42 Day 42 Day 42 Day 49 Day 49 Day 49 Day 49 5.9 461517 367.9 5.9 464987 367.9 5.9 451634 367.9 5.9 448685 367.9 5.9 440387 367.9 5.9 440863 367.9 5.9 448559 367.9 5.9 444912 367.9 5.9 448819 367.9 5.9 450797 367.9 5.9 443601 367.9 5.9 449371 367.9 5.9 441970 367.9 5.9 449535 367.9 5.9 449151 367.9 5.9 439038 367.9 5.9 439801 367.9 5.9 446475 367.9 5.9 444351 367.9 5.9 442297 367.9 5.9 438219 367.9 5.9 438608 367.9 5.9 451702 367.9 5.9 435628 367.9 5.9 439283 367.9 5.9 440005 367.9 5.9 438938 367.9 5.9 446735 367.9 5.9 444873 367.9 5.9 442251 367.9 5.9 446017 367.9 5.9 443867 367.9 5.9 445836 367.9 Mean STDEV %STDEV 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.938 0.006 0.10% 462115 457623 454403 468438 465895 452965 449514 456062 450641 9918 2.2% 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 Page 53 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 PFOS Hydrolysis Study 50 C .; pH 5.0 All concentrations in ng/ml Sample MeOH Blank L1 Std, 300.90 L2 Std, 401.20 L3 Std, 451.35 L4 Std, 501.50 L5 Std, 541.62 L6 Std, 601.80 L7 Std, 702.10 L8 Std, 802.40 MeOH Blank PFOS-009A PFOS-010A PFOS-011A PFOS-012A PFOS-033 PFOS-034 PFOS-035 PFOS-036 PFOS-057 PFOS-058 PFOS-059 PFOS-060 PFOS-081 PFOS-082 PFOS-083 PFOS-084 MeOH Blank CCV5.0, 501.5 MeOH Blank PFOS-105 PFOS-106 PFOS-107 PFOS-108 PFOS-129 PFOS-130 PFOS-131 PFOS-132 PFOS-153 PFOS-154 PFOS-155 PFOS-156 PFOS-177 PFOS-178 PFOS-179 PFOS-180 MeOH Blank MeOH Blank L1 Std, 300.90 L2 Std, 401.20 L3 Std, 451.35 L4 Std, 501.50 L5 Std, 541.62 L6 Std, 601.80 L7 Std, 702.10 L8 Std, 802.40 External Standard quant: ^=0.999 Linear, include origin Calibration range: 300-800ng/mL PFOS HydrolysisAnalysis Results PFOS Vial # 91 1 2 3 4 5 6 7 8 91 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 91 43 91 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 91 91 1 2 3 4 5 6 7 8 FILE# PFOS0002.D PFOS0003.D 0.0 6.2 PFOS0004.D PFOS0005.D 6.2 6.2 PFOS0006.D 6.2 PFOS0007.D 6.2 PFOS0008.D PFOS0009.D 6.2 6.2 PFOS0010.D PFOS0011.D PFOS0012.D 6.2 0.0 6.2 PFOS0013.D PFOS0014.D 6.2 6.2 PFOS0015.D PFOS0016.D 6.2 6.2 PFOS0017.D PFOS0018.D 6.2 6.2 PFOS0019.D 6.2 PFOS0020.D PFOS0021.D 6.2 6.2 PFOS0022.D 6.2 PFOS0023.D PFOS0024.D 6.2 6.2 PFOS0025.D 6.2 PFOS0026.D PFOS0027.D 6.2 6.2 PFOS0028.D PFOS0029.D PFOS0030.D 0.0 6.2 0.0 PFOS0031.D PFOS0032.D 6.2 6.2 PFOS0033.D 6.2 PFOS0034.D 6.2 PFOS0035.D 6.2 PFOS0036.D 6.2 PFOS0037.D PFOS0038.D 6.2 6.2 PFOS0039.D 6.2 PFOS0040.D 6.2 PFOS0041.D 6.2 PFOS0042.D PFOS0043.D 6.2 6.2 PFOS0044.D PFOS0045.D PFOS0046.D 6.2 6.2 6.2 PFOS0047.D 0.0 PFOS0052.D 0.0 PFOS0053.D 6.2 PFOS0054.D 6.2 PFOS0055.D PFOS0056.D 6.2 6.2 PFOS0057.D 6.2 PFOS0058.D 6.2 PFOS0059.D PFOS0060.D 6.2 6.2 Spike Amount - Original Amount^ ARE 0 920859 1213792 1322391 1567941 1636007 1762987 2035774 2318415 0 1599697 1620745 1609628 1905791 1536180 1514846 1551056 1898623 1518639 1486225 1554591 1827548 1505528 1475788 1514395 1780324 0 1404658 0 1511241 1525099 1505194 1808328 1552671 1542978 1545524 1802633 1554103 1530315 1540760 1828799 1493355 1516484 1532381 1832744 0 0 924706 1224849 1344452 1517149 1636681 1791592 2077403 2347306 100.30 510.50 dNC. 0.0 302.1 403.9 441.6 526.9 550.6 594.7 689.4 787.6 0.0 537.9 545.3 541.4 644.3 515.9 508.5 521.0 641.8 509.8 498.5 522.3 617.1 505.2 494.9 508.3 600.7 0.0 470.2 0.0 507.2 512.0 505.1 610.4 521.6 518.2 519.1 608.4 522.1 513.8 517.5 617.5 501.0 509.0 514.6 618.9 0.0 0.0 303.5 407.7 449.3 509.3 550.8 604.6 703.9 797.6 ng/m l ng/mL % o f Standard or /cRSD 100% 101% 98% 105% 102% 99% 98% 98% %Spike Recovery 1% 102% 1% 126% 2% 107% 1% 98% 1% 0% 1% 1% 101% 102% 100% 102% 102% 100% 100% 99% 102% 89% 99% 110% THPFOS Day 0 Day 0 DayO Day 0 Day 7 Day 7 Day 7 Day 7 Day 14 Day 14 Day 14 Day 14 Day 21 Day 21 Day 21 Day 21 Day 28 Day 28 Day 28 Day 28 Day 35 Day 35 Day 35 Day 35 Day 42 Day 42 Day 42 Day 42 Day 49 Day 49 Day 49 Day 49 R ' AREA" CONC. 5.9 473070 367.9 5.9 460726 367.9 5.9 439572 367.9 5.9 490981 367.9 5.9 467449 367.9 5.9 457579 367.9 5.9 435372 367.9 5.9 452504 367.9 5.9 452903 367.9 5.9 458464 367.9 5.9 457729 367.9 5.9 446683 367.9 5.9 452315 367.9 5.9 451206 367.9 5.9 447136 367.9 5.9 461076 367.9 5.9 454800 367.9 5.9 455213 367.9 5.9 470258 367.9 5.9 457698 367.9 5.9 451840 367.9 5.9 454891 367.9 5.9 453183 367.9 5.9 448199 367.9 5.9 435070 367.9 5.9 449803 367.9 5.9 448098 367.9 5.9 439229 367.9 5.9 453428 367.9 5.9 446110 367.9 5.9 448727 367.9 5.9 449347 367.9 5.9 444454 367.9 5.9 458675 367.9 5.9 446514 367.9 5.9 449537 367.9 5.9 460270 367.9 5.9 450174 367.9 5.9 448540 367.9 5.9 452518 367.9 5.9 447058 367.9 Mean STDEV %STDEV 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.934 0.011 0.18% 461022 461213 453927 455268 457342 452098 456825 452021 453601 9576 2.1% 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 Page 54 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 HP LC/MSD 1100 PFOS Hydrolysis Study 50 C .; pH 7.0 All concentrations in ng/ml PFOS Hydrolysis Analysis Resuits f?FOS Vial # FILE# :.:v ,:RT; "'AREA MeOH Blank 91 PFOS0052.D 0.0 0 L1 Std, 300.90 L2 Std, 401.20 1 PFOS0053.D 6.2 2 PFOS0054.D 6.2 924706 1224849 L3 Std, 451.35 3 PFOS0055.D 6.2 1344452 L4 Std, 501.50 4 PFOS0056.D 6.2 1517149 L5 Std, 541.62 5 PFOS0057.D 6.2 1636681 L6 Std, 601.80 6 PFOS0058.D 6.2 1791592 L7 Std, 702.10 7 PFOS0059.D 6.2 2077403 L8 Std, 802.40 MeOH Blank PFOS-013A 8 PFOS0060.D 91 PFOS0061.D 51 PFOS0062.D 6.2 0.0 6.2 2347306 0 1614386 PFOS-014A 52 PFOS0063.D 6.2 1625352 PFOS-015A 53 PFOS0064.D 6.2 1643727 PFOS-016A 54 PFOS0065.D 6.2 1996185 PFOS-037 PFOS-038 55 PFOS0066.D 56 PFOS0067.D 6.2 6.2 1536161 1539901 PFOS-039 57 PFOS0068.D 6.2 1573828 PFOS-040 58 PFOS0069.D 6.2 1847467 PFOS-061 59 PFOS0070.D 6.2 1546353 PFOS-062 60 PFOS0071.D 6.2 1525687 PFOS-063 61 PFOS0072.D 6.2 829055 PFOS-064 PFOS-085 PFOS-086 62 PFOS0073.D 63 PFOS0074.D 64 PFOS0075.D 6.2 6.2 6.2 1869928 1561583 1519208 PFOS-087 65 PFOS0076.D 6.2 1540515 PFOS-088 66 PFOS0077.D 6.2 1841934 MeOH Blank CCV7.0, 501.5 91 PFOS0078.D 83 PFOS0079.D 0.0 6.2 0 1498004 MeOH Blank 91 PFOS0080.D 0.0 0 PFOS-109 PFOS-110 67 PFOS0081.D 68 PFOS0082.D 6.2 6.2 1536776 1558166 PFOS-111 PFOS-112 69 PFOS0083.D 70 PFOS0084.D 6.2 6.2 1501554 1871247 PFOS-133 PFOS-134 71 PFOS0085.D 72 PFOS0086.D 6.2 6.2 1569507 1536293 PFOS-135 73 PFOS0087.D 6.2 1560610 PFOS-136 74 PFOS0088.D- 6.2 1911482 PFOS-157 75 PFOS0089.D 6.2 1070252 PFOS-158 PFOS-159 76 PFOS0090.D 77 PFOS0091.D 6.2 6.2 1572360 1624806 PFOS-160 78 PFOS0092.D 6.2 1930723 PFOS-181 79 PFOS0093.D 6.2 1569774 PFOS-182 80 PFOS0094.D 6.2 1540069 PFOS-183 81 PFOS0095.D 6.2 1547540 PFOS-184 82 PFOS0096.D 6.2 1852935 MeOH Blank 91 PFOS0097.D 0.0 0 MeOH Blank 91 PFOS0102.D 0.0 0 L1 Std, 300.90 L2 Std, 401.20 1 PFOS0103.D 2 PFOS0104.D 6.2 6.2 940355 1209946 L3 Std, 451.35 3 PFOS0105.D 6.2 1336484 L4 Std, 501.50 4 PFOS0106.D 6.2 1521050 L5 Std, 541.62 5 PFOS0107.D 6.2 1688557 L6 Std, 601.80 6 PFOS0108.D 6.2 1775771 L7 Std, 702.10 7 PFOS0109.D 6.2 2061130 L8 Std, 802.40 8 PFOS0110.D 6.2 2350847 External Standard quant: ^=0.9989 Linear, include origin Spike Amount = 100.30 Original Amount= 510.50 Calibration range: 300-800ng/mL (A) Excluded on the basis of data quality ojectives; see text. CONC. 0.0 302.8 406.3 447.5 507.1 548.3 601.7 700.3 793.4 0.0 540.6 544.4 550.7 672.3 513.7 514.9 526.6 621.0 517.2 510.0 515.0 628.7 522.4 507.8 515.2 619.1 0.0 500.5 0.0 513.9 521.2 501.7 629.2 525.2 513.7 522.1 643.1 353.0 526.1 544.2 649.7 525.2 515.0 517.6 622.9 0.0 0.0 308.2 401.2 444.8 508.4 566.2 596.3 694.7 794.6 ng/mL ng/mL or%RSD 101% 101% 99% 101% 101% 100% 100% 99% Recovery 1% (A) 1% 102% 1% 114% 1% 104% 2% 1% 22% 1% 102% 100% 99% 101% 105% 99% 99% 99% 117% 122% (A) 103% THPFOS - D is iv i^ Day 0 Day 0 DayO Day 0 Day 7 Day 7 Day 7 Day 7 Day 14 Day 14 Day 14 Day 14 Day 21 Day 21 Day 21 Day 21 Day 28 Day 28 Day 28 Day 28 Day 35 Day 35 Day 35 Day 35 Day 42 Day 42 Day 42 Day 42 Day 49 Day 49 Day 49 Day 49 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 6.0 5.9 6.0 5.9 5.9 AREA 461022 461213 453927 455268 457342 452098 456825 452021 455718 469425 459640 470701 455495 451192 457439 458953 463196 457566 486012 458974 456902 461554 464677 462077 452456 454292 461071 461556 458235 460375 468735 460087 471402 459110 460919 473396 467274 463144 460801 460690 464364 CONC. 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 Mean STDEV %STDEV 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.940 0.009 0.15% 476762 460494 455558 474146 476733 459538 453813 468450 461710 7335 1.6% 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 Page 55 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 PFOS Hydrolysis Analysis Results PFOS Hydrolysis Study 50 C .; pH 9.0 All concentrations in ng/ml PFOS THPFOS * v Sample TM *".' MeOH Blank L1 Std, 300.90 L2 Std, 401.20 L3 Std, 451.35 L4 Std, 501.50 L5 Std, 541.62 L6 Std, 601.80 L7 Std, 702.10 L8 Std, 802.40 MeOH Blank PFOS-017A PFOS-018A PFOS-019A PFOS-020A PFOS-041 PFOS-042 PFOS-043 PFOS-044 PFOS-065 PFOS-066 PFOS-067 PFOS-068 PFOS-089 PFOS-090 PFOS-091 PFOS-092 MeOH Blank CCV9.0, 501.5 MeOH Blank PFOS-113 PFOS-114 PFOS-115 PFOS-116 PFOS-137 PFOS-138 PFOS-139 PFOS-140 PFOS-161 PFOS-162 PFOS-163 PFOS-164 PFOS-185 PFOS-186 PFOS-187 PFOS-188 MeOH Blank MeOH Blank L1 Std, 300.90 L2 Std, 401.20 L3 Std, 451.35 L4 Std, 501.50 L5 Std, 541.62 L6 Std, 601.80 L7 Std, 702.10 L8 Std. 802.40 External Standard quant: ^=0.9985 Linear, include origin Calibration range: 300-800ng/mL Vial#. 91 1 2 3 4 5 6 7 8 91 11 12 13 14 15 16 17 18 19 20 ` 21 22 23 24 25 26 91 43 91 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 91 91 1 2 3 4 5 6 7 8 FILE# RT PFOS0002.D 0.0 PFOS0003.D PFOS0004.D 6.2 6.2 PFOS0005.D 6.2 PFOS0006.D 6.2 PFOS0007.D 6.2 PFOS0008.D 6.2 PFOS0009.D 6.2 PFOS0010.D 6.2 PFOS0011-D 0.0 PFOS0012.D 6.2 PFOS0013.D 6.2 PFOS0014.D 6.2 PFOS0015.D 6.2 PFOS0016.D 6.2 PFOS0017.D 6.2 PFOS0018.D 6.2 PFOS0019.D 6.2 PFOS0020.D 6.2 PFOS0021.D 6.2 PFOS0022.D 6.2 PFOS0023.D 6.2 PFOS0024.D 6.2 PFOS0025.D 6.2 PFOS0026.D 6.2 PFOS0027.D 6.2 PFOS0028.D 0.0 PFOS0029.D 6.2 PFOS0030.D 0.0 PFOS0031.D 6.2 PFOS0032.D 6.2 PFOS0033.D 6.2 PFOS0034.D 6.2 PFOS0035.D 6.2 PFOS0O36.D 6.2 PFOS0037.D 6.2 PFOS0038.D 6.2 PFOS0039.D 6.2 PFOS0040.D PFOS0041.D 6.2 6.2 PFOS0042.D 6.2 PFOS0043.D 6.2 PFOS0044.D 6.2 PFOS0045.D 6.2 PFOS0046.D 6.2 PFOS0047.D 0.0 PFOS0052.D 0.0 PFOS0053.D 6.2 PFOS0054.D 6.2 PFOS0055.D 6.2 PFOS0056.D 6.2 PFOS0057.D 6.2 PFOS0058.D 6.2 PFOS0059.D 6.2 PFOS0060.D 6.2 Spike Amount = Original Amount^ REA 0 953102 1218775 1367918 1551173 1677402 1769358 2089069 2378629 0 1616062 1624393 1653756 1957832 1501590 1526483 1505235 1824064 1500355 1514313 1535649 1836909 1516350 1500761 1515632 1814578 0 1484761 0 788677 1543909 1521618 1826663 1543536 1534697 1515054 1813976 1581877 1550129 1535004 1846288 1508950 1554719 1536965 1844447 0 0 933689 1203251 1330908 1508612 1614221 1790279 2072483 2304052 100.30 510.50 cerne. 0.0 311.6 403.6 455.2 518.6 562.2 594.1 704.7 804.9 0.0 541.0 543.9 554.1 659.3 501.4 510.0 502.7 613.0 501.0 505.8 513.2 617.4 506.5 501.1 506.3 609.7 0.0 495.6 0.0 482.0 516.1 508.3 613.9 515.9 512.9 506.1 609.5 529.2 518.2 513.0 620.7 504.0 519.8 513.7 620.0 0.0 0.0 304.9 398.2 442.4 503.8 540.4 601.3 698.9 779.1 ng/mL ng/m l Standard^ Rpyery .: r Day 104% 101% 101% 103% 104% 99% 100% 100% DayO DayO 1% DayO 113% DayO Day 7 Day 7 1% Day 7 108% Day 7 Day 14 Day 14 1% Day 14 110% Day 14 Day 21 Day 21 1% Day 21 105% Day 21 4% 1% 2% 2% 101% 99% 98% 100% 100% 100% 100% 97% 111% 98% 100% 107% Day 28 Day 28 Day 28 Day 28 Day 35 Day 35 Day 35 Day 35 Day 42 Day 42 Day 42 Day 42 Day 49 Day 49 Day 49 Day 49 Mean STDEV %STDEV RT REA CONC. 5.9 473117 367.9 5.9 464785 367.9 5.9 457051 367.9 5.9 467730 367.9 5.9 465651 367.9 5.9 451964 367.9 5.9 453078 367.9 5.9 458733 367.9 5.9 452326 367.9 5.9 456282 367.9 5.9 443496 367.9 5.9 454976 367.9 5.9 435799 367.9 5.9 433949 367.9 5.9 435077 367.9 5.9 428602 367.9 5.9 426103 367.9 5.9 430148 367.9 5.9 428441 367.9 5.9 428754 367.9 5.9 429907 367.9 5.9 436263 367.9 5.9 420444 367.9 5.9 428401 367.9 5.9 425257 367.9 5.9 457837 367.9 5.9 439145 367.9 5.9 427872 367.9 5.9 427362 367.9 5.9 427211 367.9 5.9 430577 367.9 5.9 421647 367.9 5.9 423606 367.9 5.9 437492 367.9 5.9 422229 367.9 5.9 419751 367.9 5.9 425829 367.9 5.9 434632 367.9 5.9 429837 367.9 5.9 424155 367.9 5.9 426168 367.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.937 0.005 0.08% 462354 444905 450015 454336 444002 446180 456637 444952 439648 14909 3.4% 367.9 367.9 367.9 367.9 367.9 367.9 367.9 367.9 Page 56 of 71 BACK TO MAIN HP LC/MSD 1100 PFOS Hydrolysis Study 50 C .; pH 11.0 All concentrations in ng/ml PFOS CLLLLLLLLLLLLLMMLLLMMCMM6835724PPPPI8PPP56723PPPPPPPPPPPP4PPPPPIPPPPPPPVPeeFFFFSeeSSSSSSSFeFFFFFeSFFFFFFFSFFFFFFFOFFFFFFSSSSFOSFSSOOOOOOOOttttOttttOOOOOOOOOOOOOOOOOOOadtOOOOOO1OddddddOttttdtttHHddddddddHHSSSSHHmS1,,,,,,,S,SSSSSSSSSSSSSSSSSSSSSSSSSS,,,,,,,,----86574543.-BB---------00000--B5---567844--3B----------B-11Bp11105004011111000101100000000110012222,040000509ll95668421112l146147l10l17196laa794446994294la1234a1112211a0e1a23789.....004682.51..nn927006578935!46n43861n529AAAAn........n568143192kkkk05020000kk0200050.05 V88899777776777776669896655566669555555234567891i11123456782016789511102341937811a268903456723451l# External Standard quant: ^ 0 .9 9 8 2 8 Linear, include origin Calibration range: 300-800ng/mL PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOFSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSI00000000000000000L0000000000000000000000000000000000000011111111100000000000000000000000000000000000000000E000001000000009999999988888888788777767777766666666555655555#0984567235670123445678923901237890145656781234789045623.........................D...D....D......ODDD....DD....DDD.......DDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD 66066666660066666666666066666666666660666666R66666606066......................22......22222..........02200........22222......2222.2..222220222222222022222222222220T202 211111111111111111122111111111111111111111111112A9567913585457554755034447475547447669554563567279381333112488691192857088606990018190882433019R0700093620858677964270842608240810085453413867770780840357E614315399180870971046465413140444098506223296274698688228643811085187A7674649858789932312501783848684963312494339266151264753132266653377100829 Spike Amount = Original Cone., pg/mL = C673455555655655565455565555665655565554455677553885159O9010001301111220019001100100421011005515119560010532453960..6.2729665632556620541.463446883.20021341000N5.0.00...0...0................97.........9...249.......657......5501838246.22136001735415557405294522086C. 100.30 100.30 3M Environmental Laboratory Report No. W1878 o r/R S D 101% 100% 102% 102% 102% 101% 99% 1% 2% 1% 1% 0% 3% 0% 2% . .. %Spike Recovery 111% 112% 109% 104% 103% 101% 102% 102% 101% 103% 101% 101% 99% 100% 101% 101% 103% 106% 101% 104% 103% 103% 105% 101% 103% ; -S B DayP-^' THPFOS RT 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 DayO DayO DayO DayO Day 7 Day 7 Day 7 Day 7 Day 14 Day 14 Day 14 Day 14 Day 21 Day 21 Day 21 Day 21 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 Day 28 Day 28 Day 28 Day 28 Day 35 Day 35 Day 35 Day 35 Day 42 Day 42 Day 42 Day 42 Day 49 Day 49 Day 49 Day 49 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.9 AREA 462354 444905 450015 454336 444002 446180 456637 444952 454432 456158 454644 453156 451881 449709 443583 446222 446631 448105 453359 456369 460494 448780 452682 440280 439032 444445 444672 451687 445630 451864 448317 451377 447168 452262 445268 450919 448199 452866 443889 453467 447050 V?. v y-:-:- CONC. 376.7 362.5 366.7 370.2 361.8 363.5 372.1 362.5 370.3 371.7 370.4 369.2 368.2 366.4 361.4 363.6 363.9 365.1 369.4 371.8 375.2 365.7 368.8 358.7 357.7 362.1 362.3 368.0 363.1 368.2 365.3 367.8 364.4 368.5 362.8 367.4 365.2 369.0 361.7 369.5 364.3 100% 100% 103% 103% 99% 98% 98% ng/mL Mg/mL 5.9 5.9 5.9 5.9 5.9 5.9 5.9 5.937 0.005 0.09% 459975 450262 461681 459085 447599 450097 451922 450360 5537 1.2% 374.8 366.9 376.2 374.1 364.7 366.7 368.2 Page 57 of 71 BACK TO MAIN BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Figure 3. Pooled PFOS Data and Slope Regression 0 10 20 30 40 50 60 time (days) SUMMARYOUTPUT Repression Statistics Multiple R 0.384852267 R Square 0.148111267 Adjusted R Square 0.126267966 Standard Error 0.010265446 Observations 41 ANOVA Regression Residual Total d f SS 1 0.000714538 39 0.004109796 40 0.004824334 MS 0.000714538 0.000105379 Intercept X Variable 1 Coefficients Standard Error tS ta t -0.005616288 0.003550759 -1.581714762 0.000298279 0.000114548 2.603963638 F Significance F 6.780626626 0.0129706 P-value 0.121791782 Lower 95% -0.012798369 0.0129706 6.65838E-5 Upper 95% Lower 95.0% pper 95.0% 0.001565793 -0.012798369 0.0015658 0.000529973 6.65838E-05 6.66E-05 0.00053 5.3QE-04 Page 58 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Appendix D: Selected Chromatograms A representative set of chromatograms from the present study is included in this Appendix. Page 59 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Method C :\HPCHEM\l\METHODS\0922_50 .M Calibrtion Table Calib. Data Modified : Calculate Based on ' : : Rel. Reference Window Abs. Reference Window Rel. Non-ref. Window Abs. Non-ref.'Window Multiplier Dilution Sample Amount Uncalibrated Peaks Partial Calibration Correct All Ret. Times 9/24/1999 10:08:51 AM External Standard Peak Area 5.000 % 0.000 min 5.00.0 % 101.0..000.000000000000m0in O rnam i /h it s p H g o Gffi'JOffo not reported Yes, identified peaks are recalibrated No, only for identified peaks Curve Type Origin Weight ' Linear Included " Equal Recalibration Settings: Average Response : Average Retention Time: Average all calibrations Floating Average New 75% Calibration Report Options : Printout of recalibrations within a sequence: Calibration Table after Recalibration Normal Report after Recailibration ' If the sequence is done with bracketing: Results of first cycle (ending previous bracket) Signal 1: MSD1 427, EIC=426.7:427.7 Signal 2: MSD1 499, EIC=498.7:499.7 Signal 3: MSD1 399, EIC=398.7:399.7 ' RetTime Lvl Amount Area [min] Sig [ppb] ( II__II_I_ I--------- 1 5.642 3 1 300.90000 3.78048e4 11 300.90000 3.80593e4 . 2 401.20000 4.74013e4 22 401.20000 5.i4873e4 3 451.35000 5.60681e4 33 451.35000 5.86619e4 4 501.50000 6.94725e4 44 501.50000 6.86155e4 . 5 541.62000 6.91006e4 55 541.62000 6.74844e4 6 601.80000 7.89434e4 66 601.80000 7.90989e4 7 .702,10000 8.70628e4 77 702.10000 9.13195e4 ' 8 802.40000 1.00442e5 Amt/Area Ref Grp Name 7.95930e-3 7.90609e-3 8.46390e-3 7.79221e-3 8.Q5003e-3 7.69409e-3 7.21869e-3 7.30884e-3 7.83813e-3 8.02586e-3 7.62318e-3 7.60820e-3 8.06430e-3 7.68839e-3 7.98866e-3 PFHS Page 60 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Method C:\HPCHEM\l\METHODS\0922__50.M 5.931 6.222 Lvl Amount Area Amt/Area 3, ( tPPb] ( l1 1 88 802.40000 1.00128e5 '8.01373e-3' 1 1 367.92000 4.73070e5 7.77729e-4 2 367.92000 4.60726e5 -7.98565e-4 3 367.92000 4.39572e5 8.36996e-4 4 367.92000 4.90981e5 7.49357e-4 5 367.92000 4.67449e5 7.87080e-4 6 367.92000 4.57579e5 8.04058e-4 7 367.92000 4.3S372e5 8.45071e-4 8 367.92000 4.52504e5 8.13075e-4 11 367.92000 4.61022e5 7.98052e-4 22 367.92000 4.61213e5 7.97722e-4 33 367.92000 4.53927e5 8.10526e-4 44 367.92000 4.55268e5 8.08140e-4 55 367.92000 4.57342e5 8.04475e-4 _...66 ,367.92000 4.52098e5 8.13806e-4 77 367.92000 4.56825e5 8.05384e-4 88 367.92000 4.52021e5 8.13945e-4 21 11 2 22 300.90000 9.20859e5 300.90000 9.24706e5 401.20000 1.21379e6 401.20000 1.22485e6 3.26760e-4 3.25401e-4 3.30534e-4 3.27551e-4 3 . 451.35000 1.32239e6 3.41314e-4 33 451.35000 1.34445e6 3.35713e-4 4 501.50000 1.56794e6 3.19846e-4 44 501.50000 1.51715e6 3.30554e-4 5 541.62000 1.63601e6 3. 31062e-4 55 541.62000 1.63668e6 3.30926e-4 6 601.80000 1.76299e6 3.41353e-4 66 601.80000 1.79159e6 3 .35902e-4 7 702.10000 2.03577e6 3.44881e-4 77 702.10000 2.07740e6 3.37970e-4 8 802.40000 .2.31841e6 3.46099e-4 88 802.40000 2.34731e6 3.41839e-4 Peak Sum Table TfiPFOS PFOS ***No Entries in table*** ' Calibration Curves PFHS at exp. RT: 5.642 MSD1 399, EIC=398.7:399.7 Correlation: 0.99520 Residual Std. Dev.: 2578.76545 Formula: y = trnc + b m: 126.82582 b: 571.81435 x : Amount[ppb] y : Area Page 61 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Method C :\HPCHEM\1\METHODS\0922_50.M THPFOS at exp. RT: 5.931 MSD1 427, EIC=426.7:427.7 Correlation: -0.99395 Residual Std. Dev.: 12673.93S65 Formula: y = mx + b ' m: 1244.66095 b: -3.54902e-10 x : Amount[ppb] . y : Area PFOS at exp. RT: 6.222 MSD1 499, EIC=498.7:499.7 Correlation: 0.99860 Residual Std. Dev.: 31589.73759 Formula: y = mx + b m: 2878.88299 b: 51022.56267 x: Amount[ppb] y : Area Page 62 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Batch Run # 1 of 60 Data File D:\DATA\092399\PFOS0001.D Sample Name: MeOH Blank Injection Date 9/23/1999 9:53:01 AM Seq. Line : 1 Sample Name MeOH Blank Vial : 91 Acq. Operator Acq.' Method Last changed MTM I n j V o luImnje :? 5 11 1_ C:\HPCHEM\l\METH0DS\PF0S_NG2.M 9/23/1999 9:50:00 AM by MTM -Oaio,/w)i fwQ'ii'. Analysis Method Last changed C :\HPCHEM\1\METHODS\0922_50.M 9/24/1999 10:12:55 AM by MTM (Results are from a previously saved Batch) J[J7 r?~/TS^/Itco NGa- eolutnn,SIM Analysis (ES-) for THPFOS, PFOS, and PFHS using 4rnmx35mm Dionex IonPac S/N 12879. MTM External Standard Report 359 52--C s S S S C S J S S S S S S Sorted By Calib. Data Modified Multiplier Dilution Signal .191./.00200400/001999 10:08:51 AM Signal 1: MSD1 427, EIC=426.7:427.7 RetTime Type [min] Area Amt/Area . Amount Grp Name [ppb] 5.931 Totals : THPFOS 0.00000 Signal 2: MSD1 499, EIC=498.7:499.7 RetTime Type [min] Area Arat/Area Totals : Amount Grp Name -[.p.p..b..]... -------------------- PFOS 0.00000 Page 63 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Batch Run # 1 of 0 Data File D:\DATA\092399\PFQS0001.D Sample Name: MeOH Blank Signal 3: MSDl 399, EIC=398.7:399.7 ~ RetTime Type [min] Area Amt/Area Amount .. Grp Name , " Ippb] 5.642 . - - .- PFHS Totals : 0.00000 1 Warnings or Errors : . Warning : Calibrated compound(s) not found Area Percent Report Sorted By : Calib. Data Modified : .. .-Multiplier : Dilution : Signal 9/24/1999 10:08:51 AM 1.0000 1.0000 Signal 1: MSD1 427, EIC=426.7:427.7 Peak RetTime Type Width # [min] [min] Area 1 5.931 . 0.0000 0.00000 Totals : 0.00000 Area % Name 0.0000 THPFOS " . signal 2: MSDl 499, EIC=498.7 :499.7 Peak RetTime Type Width Area Area Name # [min] [min] % 1___ 11_______ |i______ |______ | _________ |._______ j 1 6.222 0.0000 o . o o o o o o . o o o o ' PFOS Totals : 0.00000 ' Signal 3: MSDl 399, EIC=398.,7:399.7 Peak RetTime Type Width # [min] ___ 11_______Ii___ 1 5.642 [min] 1 . o.oooo' Area Area Name %. 1 |____________________ 0.00000 0.0000 PFHS Totals : 0.00000 Page 64 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Batch Run # 1 of 60 Data File D:\DATA\092399\PFOS0001.D 1 Warnings or Errors : Warning : Calibrated compound (s) not found '- , *** End of Report *** . Sample Name: MeOH BlanJ< .. ' Page 65 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Batch Run I 6 of 60 Data File D:\DATA\092399\PFOS0006.D / Sample Name: L4 Std, 501.50 Injection Date 9/23/1999 11:04:05 AM Seq. Line 6 Sample Name Acq. Operator L4 Std, 501.50 MTM Vial Inj 41 A c q . Method Last changed Analysis Method Last changed C ;\HPCHEM\l\METHOD"S\PFOS_NG2.MIinj/ * M U S S9/23/1999 9:50:00 AM by MTM f l) D - lwC:\HPCHEM\1\METHODS\0922_50.M J_ p V)Unolu um,Me l O %rr%K&f)nC><93//2244 // 119< 39999 I1f0l :f I1J2. :R5i5! AA MM bh yv MM TT MM _/ 9 5 pi (Results are from a previously saved Batch) SIM Analysis (ES-) for THPFOS, PFOS, and PFHS'using 4mmx35mm Dionex IonPac NGl column, S/N 12879. MTM T iiStyR /, fclt=426-/:42/:/(Liy2'JSiaTP'FO'SOOBXiy-PR:S'Negative ^ 2/ MSDTSSa, LKJ=4ya./':4yy./ (OS23SS\PFOSOOU.U)" AiJl-fcS Negative 1 1 i 4 MtiL)T3aa, hlu^aats.r.aa.c (UBZ3\PFOS06.)'VM-ta Negative 2500 /V ' 1 ' ' ' ' ' 1 i Jy Z 3 \V ' ' ' ' ' ' _min a a s = a sssB sa s:= H 3 :s= B S S s:a ts sssa a ^ sa ssss:sse = s 5 S ssa e sa :a s= 3 B :s a s a is: External Standard Report stessa Sorted By Calib. Data Modified Multiplier Dilution Signal 119/..00200400/001999 10:08:51 AM Signal 1: MSD1 427, EIC=426.7:427.7 RetTime Type : Area Amt/Area Amount Grp Name - [.m.i..n..]....! - .......... I----------------1----------------1......[..p..p.--b] - I - - I ............- 5.920 BB 4.90981e5 8.03432e-4 394.46965 THPFOS Totals : 394.46965 Signal 2: MSD1 499, EIC=498.7:499,7 RetTime Type Area Amt/Area Amount Grp Name [min] ..........- I -- .............. I---------------- 1-- [-p.p..b..]........1 - 1 ----------- 6.216 PB 1.56794e6 3.36054e-4 526.91202 PFOS Totals : 526.91202 Page 66 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Batch Run # 6 of 60 Data File D:\DATA\092399\PFOS0006.D . Sample Name: L4 Std, 501.50 Signal 3: MSD1 399, EIC=398.7:399.7 ' - RetTime Type Area Amt/Area Amount , Grp Name [min] .. - [ppbj " ------ j------|..........|------------- ------ .......... 5.628 BB 6.94725e4" 7.81993e-3 543.26994 PFHS jTotals-- --- 543.. 26994 * * * End of Report *** Page 67 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Batch Run # 18 of SO Data File D:\DATA\092399\PFOS0018.D Sample Name: PFOS-03E Injection Date 9/23/1999 1:54:44 PM Seq. Line 18 Sample Name PFOS-035 Vial 17 Acq. Operator MTM inj Inj Volume 5 p1i Acq. Method C :\HPCHEM\1\METH0DS\PF0S_NG2.M Last changed 9/23/1999 9:50:00 AM by MTM Analysis Method C:\HPCHEM\1\METHODS\0922 50.M Last changed 9/24/1999 10:12:55 AM by"MTM 1 (Results are from a previously saved Batch) SIM Analysis (ES-) for THPFOS, PFOS, and PFHS using 4mmx35mm Dionex lonPac NG1 column, S/N 12879. MTM External Standard Report Sorted By : Calib. Data Modified Multiplier Dilution Signal 911/..00200400/001999 10:08:51 AM Signal 1: MSD1 427, EIC=426.7:427.7 C)y7i?ihj4L p H S S firyim (yu RetTime Type (min] Area Amt/Area Amount Grp Name [ppb] 5.940 BB 4.4713Se5 8.03432e-4 359.24296 THPFOS yr / Sr/^o/oe? Totals : 359.24296 Signal 2: MSD1 499, EIC=498.7:499.7 RetTime Type Area Amt/Area Amount Grp Name - .[..m..i.n..]....i ----------1----------------I----------------I - ....[..p..p..b.]........ I" l --------- 6.227 BB 1,55106e6 3.35931e-4 521.04708 PFOS Totals : 521.04708 Page 68 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Batch Run # 18 of 60 Data File D:\DATA\092399\PFQS0018.D Sample Name: PFOS-035 Signal 3: MSD1 399, EIC=398.7 :399.7 RetTime Type [rain] Area Amt/Area Amount Grp Name [ppb] " 5.653 PB 6.61458e4- 7.81667e-3 517.03982 PFHS Totals : 517.03982 *** End of Report *** BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Batch Run # 19 of SO Data File D:\DATA\092399\PFOS0019.D Sample Name: PFOS-036 Injection Date 9/23/1999 2:08:58 PM Seq. Line : 19 Sample Name ! PFOS-036 Vial : 18 Acq. Operator; MTM " Inj Inj Volume : : 5 .(1xl Acq. Method j C:\HPCHEM\1\METHODS\PFOS_NG2.M Last changed ! 9/23/1999 9:50:00 AM by MTM Analysis Method C :\HPCHEM\1\METH0DS\0922_5 0.M Last changed I 9/24/1999 10:12:55 AM by MTM (Results are from a previously saved Batch) SIM Analysis (ES-) for THPFOS, PFOS, and PFHS using 4mmx35mm Dionex IonPac NG1 column, S/N 12879. MTM External Standard Report Sorted By Calib. Data Modified Multiplier Dilution Signal 911/..00200400/001999 10:08:51 AM -fOrti&iKwc /htM&S tJ /f,,t7lf'ia''jrii spirit: Signal 1: MSD1 427, EIC=426.7 :427.7 RetTime Type [min] Area Amt/Area Amount [ppb] 1 sS 4 M P & Grp Name yr 5.944 BB 4.61076e5 8.03432e-4 370.44323 THPFOS Totals : 370.44323 Signal 2: MSD1 499, EIC=498.7:499.7 RetTime Type [min] Area Amt/Area Amount Grp Name [ppb] 6.231 BB 1 ! ! 1i" 1 1.89862e6 3.38022e-4 641.77689 PFOS Totals 641.77689 Page 70 of 71 BACK TO MAIN 3M Environmental Laboratory Report No. W1878 Batch Run # 19 of 60 Data File D:\DATA\092399\PFOS0019.D Sample Name: PFOS-036 Signal 3: MSD1 399, EIC=398.7:399.7 - RetTime Type Area Amt/Area Amount Grp Name ---[-m-i--n-]-- i----------_.-------------1.-.---------!...............[.p..|.)..b.]..... -'| - l ............ - 5.656 BB 8.69266e4- 7.83296e-3 680.89256 PFHS Totals *. 680.89256 > *** End of Report *** Page 71 of 71