Document ypmKEdMMm0bn0bkz8mBkbNEn3

FY1-or0/-1378, a tong nd st Madcon . Nfoavaa?be Tne s DuPont Haskell Laboratory A R 224-000 FYI --o0-00 (37 G5ol 00000 > January25, 2001 Dr. Charles M. Auer, Director U.S. Environmental Protection Agency < & Office of Pollution Prevention and Toxics 2 Chemical Control Division - 410 M Street NW Room 403 `Washington, D.C. 20460 x IMPANYSANITIZED =o Dear Dr. Auer on In my June 23, 2000 letter that transmitted DuPont's Voluntary Use and Exposure I1n),foI rnmoatteidonthaPtr,ofaislepa(rUtEoIfPt)hefoornAgmoimnognsiuurvmeiPlelrafnlcueoorfoowcotrakneorastepo(tAePntFiOa,llyCAeSx#p3os8e2d5-t2o 6APFO, aseries of blood samples were taken in year 2000 from workers and that DuPont would voluntarily submit a summary of the results when they became available. The results of the blood serum tests are now available. A summary of this year's results for workers with identified APFO exposure potential is below. Year [ooo #of 1 Samples | 72 | Minimum Concepnptrma)tion Maximum Concenotprma)tion `Mean Conc(eonptmr)ation oa[90 | 1.53 Note the following concerning the above data: > Five samples, all from workers in one particularjob, ested greater than 5.0 ppm. Among the jobs with potential APFO exposure, this job should have the least exposure potential. We are investigating the cause of these clevated results in this group of workers. Eliminating the five data points from these workers gives a maximum concentration of 4.9 ppm and a mean concentration of 1.16 ppm. > Some employees not routinely working with APFO provided blood samples. APFO levels in this group of people are consistently less than 0.2 ppm. 8 = 5 $2 S38 = 2) Ss 2 January 25, 2001 Dr. Charles M. Auer > Blood serum APFO concentration seems to be a function of length of time in assignments with potential APFO exposure. Due to variances in length of service among workers in assignments with potential APFO exposure, average values may be influenced not only by exposure potential but also by average length of service of the volunteer group. oAldddeirtidoantaalhgarsobuenednwaltoecarteadn.d Tsuhrefsaeceadwdaitteironmaeladsautraaemrentresphoratveedboenenpargeepsor5teadndan6dosofame revised Voluntary UEIP. Please replace the previous submission with the attached version. Note that there is a public copy and a copy containing Confidential Business Information. If you wish to discuss the information contained in this document, please contact Robert F. Pinchot at (302)999-4074 or e-mail atR@obuerstFaPi.ncdhout pont.coomr me at (302)3665259. Attachments Very truly yours, okt NVerndy Gerald L. Kennedy Director, Applied Toxicology and Health 'e Ba Qo Oo Q J i / = A EE . RVeovliusnetdarJyanUuEaIrPy,2A0m01monium Perfluorooctanoate. Voluntary Use and Exposure Information Profile `Ammonium Perfluorooctanoate (APFO) (revised January 2001) rNeovties:ioTnhaendilnofrormmoaditfiiocnatcioonn.tainiend this documentis submitted voluntarilyandmay be subject tofuture CONFBUISIND ESS IENFONRMAT TIOI NREDAACTLED I CHEMICAL IDENTIFICATION Chemical Name: CAS Number 3A8m2m5o2n6-i1um Perfluorooctanoate IL COMPANY IDENTIFICATION Company Name: E. 1. du Pont de Nemours and Company Site Locations: Site where APFO is used as a reaction aid: Washington Works Route 892 Washington, WV 26181 Sites where APFO are processed: containing products made at Washington Works Parlin Plant Cheesequake Road Parlin, NJ 08859 Spruance Plant 5401 Jefferson Davis Hy. Richmond, VA 23234 Site which disposes of waste containing APFO: Chambers Works Ree. 130 Deepwater, NJ 08023 `Confidential Business Information Redacted 4 _------ ee -- . _--_-- ReVvoliusnetdarJyanUuEaIrPy,2A0m0m1onium Perfluorooctanoste Technical Contact: Robert F. Pinchot (302) 999-4074 DuPont Fluoroproducts Chestnut Run Plaza Bldg. 7112210 Centre Boulevard Wilmington, DE 19805-0711 IL DUPONT AND CUSTOMER ACTIVITIES Narrative Description of APF Use Tprhoecebslsoecskddiisacgursasemdobnetlhoewbaancdk tphaegeesttiitmlaedte"dDeumPiosnsitoUnsSaAssPoFciOatBeadlwaintche"thdeessecarcitbievistitehse. DanudPotnettruafsleusoAroPetFhOyleansea r(eTaFcEt)iocno-apiodliynmetrhes.proTdhuectpirooncoefsspoultyitleizterdafaltuDourPoocnthty'lsene (PTFE) W(aansdhionthgetrocnoW-omroknsomfeorrsmaifkidensgirPeTd)FEinaanndacqou-epooulsymmeerdsiacownisitshtas osmfaplollyammeoruinztinogfTAFPEFO to aid in the reaction. FaonldlAowPiFnOgotrhecpoonlcyemnetrriaztaetdio(nresmtoepv,intghespoomleymoefrthdeisApPeFrsOi)o,n sistaebiitlhiezreddrainedd tsoolrdeamsovane water aqueous dispersion. The dried polymer contains very litle,ifany, APFO. `oTfhfesiAtePiFnOanreimncoivneerdatforro,mcatphetuproeldyamnedr siesnrtetcoovaenreofdfsfiotre riencdyucslter,iaclaplatnudrfeildl,anadndd/eosrtermoiytetded 0 air or water at the Washington Works. `The stabilized polymer dispersions are sold by DuPont to industrial customers (both in the US and outside the US) foar varietyofuses, internally transferred to the DuPont `Spruance Plant for the productionof Teflon fibers and PTFE coated synthetic fibers, or internally transferred to the DuPont Parlin Plant for the productionof Teflon Finishes. A small amount of non-hazardous waste polymer, water, APFO and other additives gCehnaemrbaeterdsaWtoWrakssh.inTghtiosnmaWtoerrikasl iissterietahteerdeimnitatweadsitnewthaeteCrhtarmebaetrmsenWtofrackislitwyaatterDudPiosnchta'rsge or captured on carbon and landfilled in a secure landfill. `The intemal process at the DuPont Spruance Plant to produce Teflon fibers involves, for most of the product, a "sintering" step in which the APFO contained in the product is destroyed by the following reaction: S* tJu.dieKdnubsyicH,iDg.hC.TeRmopee,ra"tTuhreermGaals-Dpehcaosmepo"siNtMioRn.ofAC8NeFlwuoArlilneartendtiSvuertfoacTthanetrsmaanldGRrealvaitmeedtrMiacteArniaallyssis, DuPont Internal Report. `Confidential Business Information Redacted Page2 VReovliusnetdarJyanUuEaIrPy,2A0m0m1onium Perfluorooctanoate CFA(CF2)COONH,* > CF3(CF3)sCF:H + CO; +NHy `This reaction goes to completion at 350C and 0.25 residence time. A small amount of product processed at DuPont's Spruance plant does not get sintered and thus contains a `small amount of residual APFO. These products are used for industrial pump, valve and compressor packing materials. `The process for making Teflon finishes at the DuPont Parlin Plant involves a blending `operation of fluoropolymer dispersions with other additives including solvents, binders, and pigments. The small amount of APFO emissions to water from this facility is due to waste generated during product changeovers. Some of the fluoropolymer dispersion is processed at contract facilities where the material is dried at temperatures >350C thus. destroying the APFO according to the reaction above. This dried material is then incorporated into finishes products `The final product produced is then sold to applicators that apply the product to a substrate: (suchas cookware) via automated spraying or rollercoating. Emissions of APFO from these operations conofsovierssprtay that is either captured on filters and landfilled or absorbed into water resulting in a water emission. Product that is applied to the substrate is then typically "sintered"attemperatures approaching S00F resulting in the removal of the APFO from the substrate and subsequent destruction according to the reaction above. `Customers of dispersion products use the material for a variety of applications. However, `most applications involve a "sintering" step where the APFO is destroyed. There are a small number of applications [ J where the customer heats the dispersion products to temperatures that allow the APFO to sublime resulting in air emissions. There are also a small number of applications [ J where the customer' product is not heated resulting in the APFO staying with the product. `These applications include industrial packings, and industrial filter fabrics. IV. SITE RELEASE AND TRANSFER INFORMATION FOR TRI CHEMICALS Not applicable- APFO is not listed on the TRI V. SITE RELEASE AND TRANSFER INFORMATION FOR NON-TRI CHEMICALS A. Onsite Air Releases 1 Estimated Total Annual Releases(bs. 1999) Negighle | 0| 0 T- 0 | [Stack(PointSource)[24000 [0 | 0 | 0 Confidential Business Information Redacted ` Page3 . RVeovliusnetdarJyanUuEaIrPy,2A0m0m1onium Perfluorooctanoate Comments Air emissions are estimated using engineering calculations and judgements and limited measurementsofspecific point sources conducted in the past. B. Onsite Water Releases 7] Estimated Total Annual Releases( 155.1999) [PointSource | 55000 300|150 | 18,500 Comments `Water emissions are estimated using engineering calculations andjudgements and limited measurements of specific sources conducted in the past. `Washington Works emissions occur for approximately 350 days/yr while the other sites' emissions occur for 10-100 days/yr. Releases of APFO to the Ohio. River from the DuPont Washington Works Plant were modeled using the Probabilistic Dilution Model (PDM Beta Version 4.0 Beta June 11, 1999, US EPA Office of Pollution Prevention and Toxics) and a constructed Microsoft Excel spreadsheet model. APFO release data for 1996 were used in both modeling exercises." The PDM indicated that APFO concentrations of 1.0 MAPFO/I would be exceeded about 50%ofthe time during the year. APFO `concentrations of in the river would exceed 0.1 jg APFO/l 90%ofthe time. during the year and 10 ug APFO/l about 2.2% of the time during the year. Average annual APFO concentrations in the Ohio River calculated by using a Microsoft Excel spreadsheet was 0.423 ug APFO/L. Modeled AFPO concentrations in the river ranged from a low of 0.199 jig APFO/L in March to a high of 0.965 ug APFO/1 in September, which correspond to high and low river flows, respectively. Average Ohio River flows and volume data calculated from the US Geological Survey was collected at the Belleville Dam and used in the spreadsheet model. The Belleville Dam is on the Ohio River 13 miles downstream of the Washington Works Plant. This river flow data is the closest location downstream from the plant where this type of information is available. In 1999,a drinking water sample obtained from GE plastics, Washington WV, immediately downstream on the Ohio River from DuPont Washington Works showed 0.55241g/1 APFO. *ReWpoRrtBEeMrSt,E-"0M5o4d-e0l0i.ng Releases of Ammonium Perfluorooctanoate ino the Ohio River", DuPont Internal `Confidential Business Information Redacted Pages . RVeovliusnetdarJyanUuEaIrPy,2A0m0m1onium Perfluorooctanoate In addition, samples obtained in January 2000 from three different wells at the Lubeck Public Service District, downstream of Washington Works on the Ohio River, showed 0.8y1g/l, 0.44yug/l and 0.313 ug/l APFO. Subsequent samples in April, May, and August 2000, showed a maximumof 0.59 jig/l and a minimum of 007g. C. On-Site Land Releases Chambers Works treats APFO containing waste in a wastewater treatment system. Engineering calculations andjudgements and limited measurements of specific sources in the past estimate that approximately 30% of the APFO in the `wastewater treated is adsorbed on to a carbon media that is landfilled on site. `These land releasesareestimated to be 8,000 Ib in 1999. Prior operations have resulted in measurable APFO concentrations in three: landfills operated by the Washington surface water measurements in 1999 Works in and 2000 West Virginia. ytd range from At Letart' 2.23ug/l to landfill, 3240ug/l, with an average of 13924g/l. Groundwater measurements taken during the same time period at Letart landfill range from 60.3ug/1 to 17400pg/l, with an average of 2537ug/l. At the "local landfill", the groundwater concentrations range from 0.0464g/1 to 39)g/l with an averageof 8.83j1g/l. Surface water samples at the "local landfill" range from 0.54j1g/l to 87g, with an average of 18.5ug/l. At Dry Run landfill, there are limited measurements of groundwater and surface water, with the maximum concentration in groundwater of 151g/l and the maximum concentration in the permitted outfall of 200ug/l. Tn 1990, samples o1f99s2u,rfsaacmepwlaetserinwtehree"tuapkpeenr"anadndsh"olowweedr"copnocnendtsranteiaornDsrays Rhiugnh laasnd1f.i6lmlgm/Ie*a.suIrned 220ug/l and 230g), respectively. Samples taken in these locations at Dry Run landfill have since shown lower concentrations. In 1999, a RCRA Facility Investigation was completed for Washington Works `agnrdouwnadswastuebrmictontceednttoraEtPioAnsReofgiAoPnFIIOI in at WJuansehi1n9g9to.n WTohreksre.port contains data on "MTahpesovafltidhietyloanfdftihlelselo1c9at9i0onasnaalnydsesspeccainfnicotmboneivteorriifniegdlsoicnacteiotnhseamnedtrheosdulutsseard foarvaainallbylseisu,ptohne rseaqmupeslte. stcecchunriaqcuye,oftthheecrheisnuolfs acurstnoodtyk,ntohwen.sample quality controllqualty assurance procedures, and therefore the # Report was submitted to Martin. T. Kosch, Remedial Program Manager, EPA Region 1, Philadelphia. `Confidential Busines Information Redacted 7 Pages VRoeluvntdarSyaUuEaIrPy,0A0r7mor Pefsorssctasote D. Transfers to Off-site Locations `Washington Works: EstToi talm Annua alRt elee asesdor [oT chenion gTra] n; (Ib. 1999 UHanzdaerrdgoruosunWdasItnjeecLtainodnfill I 0 [Recydleorresvery | mmo VI. ON-SITE WORKPLACE EXPOSURE A. Information on the Number of Employees Potentially Exposed `The tables below describe the number of workers that may be exposed to APFO in year 2000 during their normal work activities for each of the three sites where APFO is used or APFO containing product is processed. Fos | [T 0 o`m Washingto on Wowrkes [y063% [0o25.1s ]1 1 fe--1 20 -- -- bse -- 117] Routine worker activities that have potential for exposure: > Handling raw material APFO > Handling raw dispersions containing APFO > Maintenance of polymerization reaction systems. > Polymer dryer operation and maintenance > PackoutofPTFE and co-polymer dispersion products > Operation and maintenance of APFO recovery systems * Transferred to Chambers Works facility (see section B and C above) Confident Busines TtormatonRedacted Fase --e--e ---- e--------------------eeeee VReovliusnetdarJyanUuEaIrPy,2A0m0m1onium Perfluorooctanoste Parlin Plant HousDay --[__ -- Daywyr [" <0Tioioo [100250 [os---- 77 Tr fos 1 fBa e T ---- T T 1T 7 [1 Routine worker activities that have potential for exposure: > HandlingofPTFE and Co-polymer dispersion products > Operation and maintenance of blending facilities > Pacokffoiniushted product NwohteerethtahteaAt PnoFOticmoeuilsdtshuebmlaitmeer.iaTlhhearenfdolreed,atthtehree PiasrlliittnlePlpaotnetnattiaalnfeolreevxapteodsutreempteorature: airbome APFO at this facility. All exposure potential is through skin contact during handling of the polymer dispersion containing <0.25% APFO. materials, all of which contain <1% APFO with most `Spruance Plant HousDay [7 Dawyr [T <0ioi00 Ti00250 [cos-- 7 1 fe1 ast <0 ps11 I Ce---- 111] Routine worker activities that have potential for exposure: > Handling of PTFE and Co-polymer dispersion products > Operation and maintenance of fiber coating facilities > Operation and maintenance of sintering rolls > Packaging of non-sintered product. N<o0t.e9%thaAtPtFhOeP,TwFitEhamnodstcoc-onptoaliynmienrg daipsppreorxsiimoantperloydu0c.t3s%uAsePdFOat.the Spruance site contain B. Information on the Exposure Levels of Washington Works Employees Since mostofthe processing done in the US with APFO and APFO containing intermediates and products is done at Washington Works, DuPont's airborne industrial hygiene data is concentrated at that site. The limited measurements of airborne APFO concentrations at the other sites where APFO containing products are used have shown much lower levels (mostly non-detectable) levels of APFO. The data in the table below Confidential Business Information Redacted Page? . -_-- VReovliusnetdarJyanUuEaIrPy,2A0m0m1onium Perfluorooctanoate raerfeleacctommobniintaotriionng odfoncheeomviecralthoepelarsatt5oryaeanrdsmaatiWnatsehnainncgetownorWkoerrksp.ersTohnealssaammpplleesr.esults Year| Sample| Type | #of Samples | Minimum Concentration | Maximum | Concentration| Mean| (mpb)| Standard Deviation (mp pb) [1999 Partial [7100| <001 | 058 shift [8| 00l | 078 |0061 0151 | [0103]0145 | [1997] (mostly [100 |" <00i | 24 68 Jo.a46] 0378 | (1995 hours) [73 [N | 046 [D 0067]0063| tPhaarttihalasshbiefetnaiprrsetarmepalteesd awriethtaskoedniautmthheydrraotxeiodfe/2e0t0hymlLe/nmeignlyucsoiln/gmeathTaennoalx. cTolhleecAtPioFnOtuibse ddeersiovrabteidzifnrgormeatgheentt,ubceosnvuesritnignmgetthheanAoPlFicOhtyodirtosgmeenthcyhlloersitdeer., which After also serves as a workup, the methyl e`sTtheermiestqhuyalnteisftieerdoufspienrgflaugoarsodcehcraonmoaitcoagcriadpihs euqsueidpapsedanwiitntherannalelsetcatnrdoanrdc,apatnudreatdelteeacsttor. three calibration samples Precision is estimated to are prepared to cover be +/- 10% relative. the concentration rangeofinterest `oTnhleydaatvaeraybofveew sshaompwlaevsearbagoevse ctohnesTisLtVe.ntlWyhbeerleowretshueltAsGaCreHaIboTvLeVorofn0e.a0t1romgt/hem'T,LVwi,ththe. eenvgeinnteiesriinnvgecsotnitgraotlesd)atnodrceodrurceecttihveeeaxcptoisonur(eadldeivteilosnaisl upnedresrotnaaklepnr.otOelcdtievredeaqtuaifprmoemntthoer f1r9o80m'rsescehiovwinhgitghheerAlPeFveOlsaosfaexppoowsduerre.toIrnetcheeiveianrglyit1a9s90a'ns,aqWuaesohuisngsotlountioWno.rkTshisswcithcahnegde swhaosulddonbee tnootreeddutcheattihne ptohteen1t9i9a7l tfiomreexppeorisoudr,etdhuersiintge hwaansdlstianrgtionfgtuhpe dnreywpAowPdFeOr.reIctovery ffaacciilliittiieess.mOapyerhaatviengcoanntdrimbauitendtetnoatnhceehdiigfhfeircullteiveeslsasosfoAciPaFteOd iwnitthhethpeersstoanrat-luspaomfptlheesse during that year. `nToatskinsdpieccaitfiivce moofneimtoprlionygeedaetxapaonsdurweiapnedmaorneitnoortipnrgedsaetnateedxihsetr.e.HoTwheevseers,atmhpelseedsaatraeatraeken to identify areas where additional exposure controls may be necessary. Engineering controls to reduce exposure consist of the following: > R`emaocntoimoenrscyosntceemnstraarteiocnlsosed systems with continuous ambient monitoring for > > `VTehneilpaotliyomnersydsrtyeemrss aorpeeriantsetaulnledderwhneegraetiavierbporrensescuornecteontcroanttiaoinnsAaPreFsOigannifdicant other materials. > Recovery systems are in place to reduce airborne emissions. 7 mpb= moles per bilin. 0.56mpis equivalent to the ACGIH TL of 0.0lmg/n Confidential Business Information Redacted ) Pages / . RVeovliusnetdarJyanUuEaPry,2A0m01monium Perfluorooctanoate Personal protective equipment that workers regularly wear consist of the following: > > ISmafpeetryvisohuosesglaonvdessiwdeh-esnhihealdndslaifnegtyAgPlaFsOsessoilnutaillonasroears.aqueous dispersion products. > Chemical protective of splashes of APFO coveralls and goggles or face shields containing solutions is present. when the possibility > hAiarvleinheigrhesepixrpaotsourrsoerpcoaternttriiadlg.e respirators where monitoring has shown to MAetaWsausrheimnegnttosnoWfobrlkoso,dbfllouoordisdeerleuvmellsevhealvseofbeAePnFtOakhenavperiboeretnom1e9a8s1u,rbeudt sairnecoef1l9i8m1i.ted AvaPlFueOienxapsosseusrseinpgoetexnptoisaulrteheto1A99P5F,O.198A9-s90u,mm1a9r85y,oafndre1s9ul8t4s voofleumntpeleoryseaemspwliitnhgiedveennttifsieisd itnimteh,eatnaabllyesibseloofwt.reDnduseoftodsaitganiafriecadnitffjicoublta.ssTihgenmdeantta minovtheemteanbtledbuerlinogwtphriisorpetroio1d99o5f are ofofrAePmpFlOoyineebsloiondclsuedreudmincatnhebe19c9o5mpsaarmepdl.ingThdeateantsiorethdaattcaosmeptaorfisbolnosodofcornecleantitvreatlieovneslsis available upon request. Year #of Samples | Minimum Concentration| (ppm) Maximum Concentration | Mean Concentration ppm) ppm) [[1o 980s00T 23 77 047 | | 7 4s5s |0 311s3 || [C8 oos s T Tr[ 9 oo 1 [ 0 |a iy0 [|o3" am || * TThhiissiinnddiivviidduuaallcwonassiswtoernktliynghaisnhaodbthtehahtighhaesstAPblFoOodecxopnocseunrteraptoitoenntoifalAaPtFthOesiimneceoAfPtFheOsaspmepclief.ic seammpplloeyseweesrbeltoaokden.serTuhmisleevmepllwoaysee4.ldepfpamn. APFO exposure potential assignment in 1991. In 1995 this Confidential Business Information Redacted Pages -_-- 3 i sii iil5 J I | | TG BW 5 | iEg | | | | ; 9 : 2 [wil he ) wll [i HH] | || iz SL fi | | [2i2)[iin ) it J aa| weet 3 fn 2g) i [i J i | 43