Document oe13b3Nyg1vv0MMaOZwBXpEB7

HOAGLAND LONGO MORAN, DUNST & DOUKAS, U P A T T O R N E Y S at LAW 40 Paterson Street New Brunswick, NJ 08901 Tel: (732) 545-4717 Fax: (732) 545-4579 www.hoaglandlongo.com Michael L. Lazarus Of Counsel mlazarus@hoaglandlongo.com PLEAXIHNITBIIFTFS WCD-246 July 3, 2013 NBLL80eYee0vawyhET,YMKhPoiahArrgdikIla,lLAniNp,v(sHEYen&sAqu1R.eK0,0D21n21CigtOhsbPFeYlrogoT,rOLLFPOLLOW) Re: KDOouacreknFezitliegNNSo.or:,.:SteM5v9eIn6D5(-8NL8-J24)8-v7Ms3.-LW1L2hittaker Clark & Daniels Dear Ms. Kagan: redexompcueormvteerdneEptfnsrocowrlmtosilsleoacdrfchDhapinlrve.geaeMsaeanondlfyiinnsoeedfnattdhntoedociruDmomrep.e.innFiMtiostznygrse.eaqrpauoledlsotgaeindedsbdfyooruytbohtuevdaefertylearymmduucyehrtteohvaditeiwsaanbyoiltfihtyi4n.gmIcohoranevtaebianrenecdkeeiirvnebtdohxethesees the holidFaeyelwfereekeetnodc.ontact me to discuss and be assured there is nothing here that required attention over MEccn:LcLlo:smumrAeelsl Defense Counsel of Record New Brunswick, NJ New York, NY - Buffalo, NY - Philadelphia, PA * Clinton, NJ Wall, NJ Hammonton, NJ /// _____ s r r 7 W & ' CP* T / ? s * e f /& j^s- H P A^> o vier tc 0 ,j~ 9 * t > ./ ^ C z& T T r f f Afo ? P f J f a A s //p/Po&'JF t f s `X.:/f y * y J k , ^ A*Z /P-O Date ATTN: 7%c LAB REPORT NO. J / / Produc t 2*& rZ ; Rema r k s g. 4 ^ / ^ ; 5V 9 // A '-- ? / 9 fT> J /, . S/i V 3/ 9 7/ LABORATORY REPORT /S C s 7 2 c c / C r 2-J~- S C ? tu' /teeCPc C S w *** A44>4 r >r4 n y j - Z> 72 < C ' 7 -7-//J ^ ,,, / / w / /, 7. 777 / < f > 7 ? 7/ / V / /j~ 72<7y 4 t~ ~2'Z7/J] -I A r Tfs> 7 CM ^ 7 y 7-70 7 / 2FV J / 9C W * n f- 7^t t'/ZAZ- -h n - A 7~ / / / ? - A Whittaker, Clark & Daniels, Inc. waiter c. mecrone associates, inc, CONSULTING: ULTRAMICROANALYSIS MICROSCOPY * SMALL PARTICLE PROBLEMS SOLID-STATE CHEMISTRY 19 October 1973 S1WMM0ou0arh.n0tihtaRtCagPakeolyreoarl-Rii,nd.TfCgiKeeelclardShrat,knmriNeacmenaetwdlesSDJeearrnvsiieceyelss, Sac. 07080 Dear Ray: woAAfattttshrarecaohmluseogdohlaaitnrLeea,pltyrhzAeeesldleInnbbduty.itvxoid-nrueaaywl aednrifeafrlayanscaitsliyosznheedtoebtcsyofnloigfrihrymtomueriscttriwmoesaclvoteepsytaoolfcntslhaye.mqpSuaalemnst,pitlye G SsaDTanao,mdmEsp1upClalm,een;sldmeaGspFas,rp.eirIzr,eePcaKtaimahrbaetonluoerdnefatsLtsmuh;le(oti~nsutl:rn-t2ethms%neoooo)fcltithIhtrnereerySmwsafooomoutuliliplrdteeleshasa(a5smIv-b1eape0nstl%eotdos)bsLiwetwaewcnaradaselsltdefroadeautlelcn"cedeftsiqebiundIrnaoSInuSnatsa.m"a.m.n..piy.np.l.el.e.s.s..G.B, doIItfrisywcmoaauserd.haeadWpv.eleeaawnsuyilrlqehutoeolsdtsieothenesysoaaubmoaupgtlaetihsneuysneetsitrleeyrsoduualtyas,danvpdisleetaousems tcehoeanttytatohcuteryIaccnoalnSletbeaweguarets. Sincerely yours, eRLnBecfM:loM:sbubAre3s591 SLeunciyorBR. eMsecaCrrcohneMicroscopist 7iCH:G* ," CMiC, '.5L=. CH e7'CP0i\ Samples for Walter McCrone Associates A ----#1615, from lot #7470, location 209 B ----#141, from lot #7283, location 116 C -- #128, from lot #7439, location 216 / D ----#2450, from lot #6816, location 112 E -- -- #4608, from lot #7333, location 216 F --- #4473, from lot #7554, location 511 G ----#4615, from lot #6040, location 210 H -- #150, from lot #7596, location 410 I----#4767 (#767T), from lot #233, location 300 j --- #4720(#2620), from sample sent by Pioneer Talc Co. K -- >-#3371, from sample submitted b y Mr. Cooper #57, from.sample.submitted by Mr..Cooper Anne DePrimio CiREGISTERED M A H cT l ASBESTOS CORPORATION LIM ITED Head Office 1940 SUN LIFE BUILDING -1155 M ETCALFE STREET, M ONTREAL, QUEBEC. C AN A O A, H3B 2X6 R EG . C A B LE A D D R ESS: "AM A SCO LIM " - T E L E X 05-25532 October 22, 1975 Whittaker, C l ark and. Daniels Inc. 1000 Coolidge St., South Plainfield, N.J. 07080 TJ.S.A. ATTENTION: Mr. C.U. Driscoll P r e s i d e n t ______ Dear Sirs: We wish to hereby confirm our cable dated October 20th, 1 9 7 5 1 a copy of which is enclosed, advising our decision to terminate our representative's memorandum of agreement w i t h you, and confirm that as our cable advice was dated October 20th, 1975 and taking the required 90 days' notice into consideration, our.agreement, t h e r e f o r e .: terminates January 20th, 197'6. This decision is the result of a careful study of our present and future representational needs, bearing in mind particularly the reduced fibre availability brought about b y the loss of our King-Beaver mill and our need in the face of rising costs to reduce our selling expenses and concentrate on sales to house accounts ;.... ... ' As your account has been relatively .inactive over the past few years, I am sure you understand our position and will he mutually relieved' at our decision. I w i s h to take this opport u n i t y to thank, y o u for. the efforts you have expended on our behalf over the years, and wish you also the best of success for the future. Sincerely yours, ` ASBESTOS CORPORATION LTD. ASJ/cp Enel. AAAKBPXLJ C F-BALL-1 Gctober 5 , 198/ stocker* Fcher & Sucker CDoauvoidsciorlam idtu shl-jawE a tj, 10 Executive Driv est Orange, MJ 07052 8Ks Donald Hacaulay . Ceiotex Corp., et ais. Dear David Einsatacirorsoedg aitsa raie srxocpy aDie Csileatdt ainn*abeorvse i asittaenrd,arddu- lyaabsiegautoe sd . Aise enclosed is a coy of eut Product bulletin ymi hve remuastes. haak you foc you? efforts in ths saattec. ......... Vary fcruly yours, WHITPAKEB, CLAM & DANIELS, IMG. GEJnDcilloasfeu res bcc; Mibe A rgyelan George J. Oippold Executive Vies President AAAKBPXLL CF-BALL-14 S A U L J. Z U C K E R U 9 0 M 9 8 4 ) M O R R IS R. Z U C K E R IR W IN L. F C H E R ROGER C. W ILS O N PAUL J. SODERM AN DAVID C , B E N D U S H Z u c k e r ,F c h e r a n d Z t j c k b r A P R O FE S S IO N A L CO RPO RATIO N COUNSELLORS AT LAW lOO EXECUTIVE DRIVE WEST ORANGE,H1W JERSEY 07053 (301) 736-0444 TELECOPIER (201) 736-4011 September 2 9 r 1987 Mr. Mike Argyelan % Whittaker, Clark & Daniels, 1000 Coolidge Avenue South Plainfield, NJ 07080 Inc. R e : Macaulay v. Celotex Corp. et a l s . Dear Mr. Argyelan: Enclosed please find copy of draft answers to standard asbestos interrogatories to be filed on behalf of Whittaker, Clark & Daniels in the above matter. I would ask that you review these answers as carefully as possible, particularly those regarding whether or not anyone in your Company has ever testified con cerning asbestos, and whether or not you know of any other company to which Whittaker, Clark & Daniels might have sold as bestos in the past. I would also ask that you provide us with another copy of the "Product Bulletin", referred to in answer B 8 , wich was annexed to the interrogatories filed on your behalf in early 1983 in the case of Sylvester v. Whittaker, Clark & D a n i e l s . I must emphasize the necessity for a timely response regarding these interrogatories because of the potential for a trial of this matter on October 13, 1987. In addition, I believe that the sooner I am able to forward these answers to plaintiffs' counsel, the sooner and more likely we are to be able to get out of this case before trial as I mentioned to you in my letter of last week. Please also notice that I have enclosed a certification page at the back of the answers to interrogatories which has been left blank intentionally so that you may determine who is most quali fied, or you most want to answer these interrogatories. Simply have your secretary type the name below the signature line and have the appropriate person sign on the line. If you have any questions or need any assistance, please do not hesitate to call me. ZxJCiER, EaCHBH AND ZlJCKEH September 29, 1987 ... Page No. 2 Re : Macaulay v. Celotex C o r p . , et a l s . I have also enclosed several sheets of yellow paper. If you find that any of the answers are not completely accurate, or need to be changed or modified in any way, please make the necessary corrections on the yellow paper and return same to us, together with the answers to interrogatories. As always, I will keep in touch and advise you of any and all pertinent developments as they occur. Very truly yours, DAVID C. BENDUSH For the Firm D C B :mm fine . SAUL J. ZUCKER flOl-td4) M O R R IS R. Z U C K E R IRWIN L. FACHER ROGER C. WILSON RAUL J. SO D E R M A N OAVID C. 0EN D U 5H t Zckbb, Facher a n d Zucker A P R O FE S S IO N A L CO RPO RATIO N COTXNSEX.X.ORS A T L A W lOO EXECUTIVE DRIVE WEST ORANGE,NEW JERSEY 07052 (201) 736 0444 TEEECOPIER (201) 736-4011 September 28, 1987 Garruto, Galex & Cantor, Esqs. Att: Jane B. Cantor, Esq. P. O. Box 308 East Brunswick, NJ 08816-0308 R e : Donald Macaulay v. Celotex C o r p . , et a l s . Dear Ms. Cantor: The defendant, Whittaker, Clark & Daniels, hereby provides answers to the standard set of defendant interrogatories. This defendant does not answer Group A since no jurisdiction defense is being raised by it. The following constitutes the answers to Interrogatories. Bl. George Dippold, Vice President Whittaker, Clark & Daniels, ......South.P l a i n f i e l d ,.New.Jersey ......... ................... r.............. (A) George Dippold, Vice President of Whittaker, Clark & Daniels, South Plainfield, New Jersey? Clarence Clark, 80 Celestial Way, Juno Beach, Florida (former employee of Whittaker, Clark & Dani els) . B 2 . Marketing and Distribution of functional pigments and colors. B 3 . 1890. B4{a)Yes. (bl) Whittaker, Clark & Daniels distributed asbestos p r o ducts for Asbestos Corporation Limited of Thetford Mines, Quebeck, Canada. (2) The relationship began sometime during the 1930s, the exact date of which is unknown and there are no records available to establish the exact time when the relationship began; it terminated sometime in the late 1960s or early 1970s, again with no records available to be more specific as to the date of termination. (3 and 4) the following are a list of the officers and directors of the corporation: Fred Roesch, chairman; Dick Light, president; George Dippold, executive vice president; Bill Hobson, vice-president; Clarence Clark and Clarence Dris coll, directors; Mike Argyelan, secretary-treasurer; Florian J. Hailer, Jr., vice president; Julia R. Pabst, assistant secretary. Z u Ckjbk, Pa c k e r akhd Z u c k b h September 28, 1987 ... Page No.2 R e : Donald Macaulay v. Celotex Corp., et als. B5. None. B 6 . No. B 7 . No. B 8 . Yes, see Product Bulletin annexed hereto. B 9 . No. BIO. No. Bll. Yes. Bl2. Yes. Bl3. Yes, the minutes are in the custody of Mr. Mike Argyelan at the company headquarters in South Plainfield, New Jersey. B 1 4 . Yes, Whittaker, Clark & Daniels has distributed asbestos. B15. Whittaker, Clark & Daniels did not use asbestos in any of its products but merely sold it in the containers in which it was r e ceived from Asbestos corporation Limited. B16. No. .......................... ........... ...................... B17. N/A B 1 8 . (a) This defendant believes that it commenced distributing asbestos sometime during the 1930s. <b ) Sometime during the late 1960s or early 1970s. (c) Generally throughout New Jersey, but there are no records available to accurately show the locations where the product was sold. B19. No. (a,b,c and d not applicable). B20. N/A B21. No. . B22. Yes." a limited one; (a) in the laboratory; (b) see attached list; (c) for general use; (d) not a formal one. Z uCk h r , Pa c k e r a n Z u c k b r September 28, 1987 ... Page No. 3 Re : Donald Macaulay v. Celotex C o r p . , et als. B23 . No. B24 . No. B25 . No . B26 . The only awareness was an academic awareness which was gained by reading newspapers, magazines and the like. B27 . No . B28 . No. B29 . No. B30 . N/A B31. N/A B32 . N/A B33 . No . B34 . NO. B35. NO . B36 . This defendant generally became aware of the problems dealing with asbestos through the media and other readings during the late 1960s and early 1970s. B37 . This defendant has no information with respect to causal rela tionship between asbestos and disease or illness. B38 . N/A B39 . Not to the best of our knowledge. B40 . No. B41. N/A B42 . N/A B43 . All persons named in these answers to interrogatories and any other party's interrogatory answers. B 4 4 . To be supplied. Z ucbjer, Fa c h e h ANTO Z UCK.BR September 28, 1987 ... Page No. 4 Re : Donald Macaulay v. Celotex Corp., et als. B4 5 v - This defendant has no independent knowledge, but shall rely u p on claims asserted by other defendants involved in this litiga tion . B46 This defendant has no such knowledge, but shall rely upon proofs adduced by other parties to this litigation. B47 . This defendant has no such knowledge, but shall rely upon proofs adduced by other parties to this litigation. B48. No. B49. This defendant does contend that the plaintiffs should have been aware of the dangers of working with asbestos if such dangers existed. The information should have been imparted to them by their employers or by those who manufactured the asbestos products. B50 . This defendant has no such knowledge, except to state that as bestos dust has been known to cause certain problems and that the use of respirators have been available to all people working with the product. Cl. No. (a) As stated above, Whittaker, Clark & Daniels carried asbestos for resale to other businesses beginning sometime in the 1930s ........ and terminating in the late 1960s or early 1970s. (b) Asbestos Corporation Limited, Thetford Mines, Quebec; (c) The asbestos was only sold to other companies, and was not utilized by Whittaker, Clark & Daniels. (d) Do not know. C2 . ies. (a) South Kearny, New Jersey, only for the distribution of as bestos fibers; (b) See answer to Cla; (c) This defendant does not now, nor has it ever, produced any asbestos products. C3 . This question cannot be answered by the defendant since this defendant only distributed the raw asbestos fiber to other companies. C4 . N/A n /a C6. Inasmuch as this defendant does not have any records at the c u r rent time, this question cannot be answered definitively. How ever, Quigley Comapny has claimed that asbestos fibers were sold by Whittaker, Clark & Daniels to it and Quigley has not yet furnished Whittaker, Clark & Daniels with any records as to the amount sold and when. in O Z tjCIOKK, FacHEK AN ZtICitEK September 28, 1987 ... Page No. 5 Re : Donald Macaulay v. Celotex Corp., et als. Cl. See answer to C 6 . C 8 . No. C9. Yes. (a) Raw asbestos; (b) Essentially because it was not a large part of our business and because there were increasing reports that the use of as bestos could be dangerous; (c) The late 1960s or early 1970s. C 1 8 . No. C 1 9 . No. C20. No. C 2 1 . NO. StICKJBIt, F a c h b b a n Z u c k e k September 28, 1987 ... Page No. 6 Re : Donald Macaulay v. Celotex Corp., et als. I certify that the foregoing statements made by me are true. I am aware that if any of the foregoing statements made by me are wilfully false, I am subject to pun.' AAAKBPXLK ... T2H-8lO code_______ t _____ * rd ^ Pu rch a se R ec o r d > ^ wt. per gal. ^ 1 1jjVi grr (ToiT^^P MATERIAL) DATE ORDERED ORDER NUMRER SUPPLIER QUANTITY ORDERED ^A/A- '^W hli, faker--.i ark & Daniels DO 'Ohufh-^trei 1 9 ,0iraw Y*oork,. N"eeuwf 'Y-rmlT'^^ 0007 ^ v / ?/ /t r PRICE W / ( * . c/) , V k d REMARKS jjj--.***& V>_, "Z* <,/ f'-'A *% `h h t # M 3 7 b'xjfrk A i/'s/t' 4 /. 1,, -)ahliibhi i M14iw tt ,/ % /77- im* VOcu . ?/ *= . o 'f W * .0%(# .fc Mi.,* * T O N 46# 9 5 / * (3) loco* /-LI il ) / 'Vf - *A//7/ fly Vc(]73ht tPrIi/m 'I"?' . b , H - t rff^/K So, Me u L & % s r fL'i'n Sir: N r J Vo/Ck. rfy faooj ifyn- - 77?- O WtJfW wtft'-nfU&r* fA s /4t-K-''ir Srio-Ck-ff j/r/zs /9? J^tn> yvit l a v 1 n-f-i' ,Mt 'Zf Sj.- rj-T-4. 6k /<bC*f*>N vv/rt\1t-t-~y7>C.t\& TuhJ PKite } 0 0 ^ j/'f/zs ~Ek N*r&-#&%<?,wupTMr C ^ e t f & k M>? y/b/itXCNff o ^ E T A M 6 > * 6A ~ / ? J CODE. T21H-3316 C a rd #1 Pu r c h a se MATERIAU- #1^.01 A sbestos F ib r e C a m d U n rede / 7K R eco rd W o r t h I4.- 206O DATE ORDERED 00E* NUMBED SUPPLIER ouA N Ttrr ORDERED RRfCK R/ NO. rntlS H T OuAwrmr rcckivcd DATS KlCtlVIO LJ f'W f Wbi t t a k e r - C la r k & D f c u i e i s# c . 100 Church Street 19687New York , New Yor k t'/ /Sr .ci*)/ nn PI p tfl's/u/. WT. PER G Al__ REMARKS d. , *VY3>' ,tj9/ '//< f WHITTAK 2 260 W est Bra M SS AAAKBPXLH A L B A T E X -- Substitute for Zinc Oxide. LIM E-- Powdered, Lump, Vienna. A L U M IN U M SILICATE-- Natural, High and LIM ESTO N E-- Ground, Agricultural, Graded. Low Alumina. A L U M IN U M STEA R A T E-- High, Medium and Low Gel. A SB ESTO S-- Shorts, Fibre, Powdered. A T O M IT E -- Natural Calcium Carbonate, Wet Ground. A Q U A L IN E BLUE BARIUM CARBONATE-Precipifated. B A R IU M S U LFA T E-- Natural, Precipitated. BARIUM STEARATE B A R YTES---Off Color, Prime White Water M A G N ESIU M C A R B O N A TE -Lig h t, Heavy, U.S.P., Technical. M A G N ESIU M H YD RO XID E-- Medical, Pow dered, Paste. M A G N E S IU M O X ID E -- Light, Heavy, U.S.P., Technical. M A G N ES IU M S ILIC A TE-Lo-M icro n , U.S.P., Ground, Fibrous. M A GN ESITE-- Powdered. ' / M A G N E S IU M S T E A R A T E-- Powdered. M A R B LE-- Powdered, Granular. Floated. BENTON ITE-- Volclay, KWK, High and Low G el. Powdered, Granular. B LA C K S -- Lamp, Mineral, Oxide. B L A N C FIXE-- By-Product, Direct Process. BLU E---Phthalocyanine, Ultramarine. C A LC ITE-- Powdered, Granular. C A L C IU M C A R B O N A T E -- Natural, Precipi tated, Commercial, Technical, U.S.P. CALCIUM HYDROXIDE-Powdered. CA LCIU M OXIDE CALCIUM STEARATE C A L C IU M S U LFA T E-- Anhydrous, Natural. C H A L K -- Lump, Pellets, Prepared, Cliffstone, Whiting, Precipitated, U.S.P., French. C L A Y S -- Colloidal, English, Domestic, Ball, M A G L IT E M -- Magnesium Oxide for Neo prene. M IC A -- Water and Dry Ground, Scrap, Block, Sheet. O C H R E-- Domestic, French Type American. O P T IC A L R O U G E -- White, Red. PARIS WHITE-- Powdered. P H T H A LO C Y A N IN E: BLUE (Aqualine, Regaline). . PLA STER PARIS-- Common, Gauging, Dental, Orthopedic, Potters, Casting. PUMICE STO N E - "V A L E N C IA " A L L A M E R IC A N -- Powdered, Granular, Lump. P Y R O P H Y LLIT E-- Powdered, Lump. Q U A R T Z -- Powdered, Graded. Modeling, China. ' C LIFFSTO N E W HITING -- Dry and Wet Ground. " C O L O R S -- Natural Earth, Lo-Micron. CO SM ETIC C O L O R S -C e rtifie d D & C , Lo- RED O X ID E-- Pure Copperas, Venetian, Span ish, R E G A L IN E BLU E-- Resinated. ROTTENSTONE-Powdered. R O U G E -- White, Red, Black, Green. Micron. C RO CU S M ARTIS-- Venetian Red, CHROM IUM OXIDE GREEN C R A Y O N S -- "Clover" Brand, Metal Workers. SERIC1TE-- Powdered, Micaceous. S IEN N A S -- Raw, Burnt. SILEX-- Powdered, Granular. . ` C Y C L O N O X -- Polishing Abrasive.............. ... .. TrSIUCA^Sqnd/-Ouat;tzf.Amorphous,..Diatoma- -. ceous. DEN TAL PLASTER S LA T E-- Gray, Powdered. D IA T O M A C E O U S EA R TH - -N atural. Pow - S O A P S T O N E -- Powdered, Granular, Blocks, dered. A ir Floated, Lo-Micron, Crayons. E A R T H C O L O R S -- Natural, Lo-Micron" S O L A R S H A D E -- Green House Shading. FELDSPAR-- Powdered, Graded. STEA R A T ES-- A l uminum, Calcium, Magnesium, FIBROUS T A L C -- Powdered, Lo-Micron. Zinc, Barium. FILTER A ID S -- Fullers Earth, Talc, Magnesia STEATITE-- Powdered, Block, (Lava). Carbonate, Pumice, Quartz. - STEARIC A C ID -- Impalpable Powder, Flake, FILTERIN G E A R T H S -C la y s , Fullers Earth; U. S. P. FLINT-- Powdered, Graded. FLU O R SP A R -- Powdered, Graded. F O R M A L D E H Y D E DUST-- Agricultural. FO SS IL FLO U R -- Infusorial Earth, Diatoma ceous Earth, Kieselguhr. FULLERS EA RTH -- Powdered, Granular. FUSE FILLER-- Pellets. G R A P H IT E-- Powdered. G R O U N D G L A S S -- Powdered, Graded. G Y P SU M --Terra Alba, Powdered. H Y D R A T E D LIM E-- Powdered, High Cal.cium.. H Y D R O M A G M A -- Base' Material for -Milk of Magnesia. . IN FU SO R IA L EA RTH -- Natural, Powdered. IR O N O X ID E - R e d , Btbck, Yellow . K A O L IN -- Washed, Colloidal, A ir Floated. Lo-Micron, Lump, Powdered. . KIESELG U H R-- Natural, Powdered. T A L C -- A ll Grades: U.S.P., Powdered, LoMicron, Fibrous, Steatite. TERR A A L B A -- Domestic, English. T E R R A Z Z O STRIPS THOMASSET D & C COLORS TITA N IU M D IO X ID E -- Purified, Cosmetic Grade. TRIPOLI-- Powdered. UMBERS-- Raw, Burnt. V EN ET IA N RED-- Powdered. V IE N N A LIM E-- Powdered, Lump. V O L C A N IC A S H -- Powdered. V O L C L A Y -- Bentonite-. High G e l; A ir Floated, Granular, KWK. . . " W H ITIN G -- Chalk, Commercial, Gilders, Lime stone, Precipitated,' Natural. . Y E L L O W O X ID E-- Natural. L ES A M IT E-- Controlled Particle Size Cal-, Z IN C O X ID E-- U .S .P . , cium Carbonate. Z IN C S T E A R A T E-- U.S.P., Technical. QUALITY IS OUR FIRST CONSIDERATION For over fifty years, Whittaker, Clark & D aniels, Inc., a dependable source for minerals, colors and chemicals, have rigidly adhered to their slogan " Q u a lify is our first consideration". This, with good service and satisfied customers, has placed us in the high position we occupy today. A list of industries and professions served by Whittaker minerals, colors and pig ments would fill a large book. Suffice to sa y , this comprehensive experience with all industry, this diversification and per spective, adds an immeasurable amount to Whittaker's ability to please Y O U . Here are some who rely on Whittaker's high uniform quality. Agricultural Cosmetic Drug Rubber Foundry Steel Soap Chemical Floriculture! Insecticide Metalworking Dentistry Orthopedic Art Leather Electrical Textile Plastic Furniture Electric Plating Paint Lacquer Glass Ceramic Paper Roofing Food Optical Monument Printing ink Jewelry instrument Medical Porcelain Shipbuilding Welding Steel Fabricating Construction Brick WHITTAKER 3 CERAMIC MATERIALS Aluminum Oxide Antimony Oxide Barium Carbonate Bentonite China Clay Bell Ball Clays Feldspar Flint Fluorspar Fullers Earth Ground Glass Lime Magnesium Oxide Magnesium Carbonate Calcined Magnesite Crude Magnesite ...... r:... .M i c a .:... ;. Plaster Pumice jyrophyllite Sotteastone Kouge Silica Placing Sand Stearates 1Talc Zinc Oxide, Chrome Green Oxide Spanish Red Oxide fled Iron Oxide WHITTAKER,, CLARK & DANIELS* INC. 13, N..260 West Broadway New lork Jo The Technical Service Department has prepared this small booklet on general information on ceramic products which are handled by "Whittaker, Claris & Daniels for the information of their salesmen and sales agents. We feel that it may be of value to you in talking to customers and prospective customers for ceramic materials% that is, whiteware, glass and porcelain enameling.manufacturers ,,.............. Whittaker, Clark & Daniels, Inc CM-2 - 5 0 CERAMIC MATERIALS (White-ware, Class and Porcelain Enameling) ALUMINUM OXIDE - #60? This material is available in less than carload lots. ' Aluminum Oxide is used to prevent pieces from sticking together during firing by electrical .porcelain manufacturers and manufacturers of vitri fied specialties. Steatite insulator"manufacturers use Aluminum Oxide as a part of the body formula. Aluminum Oxide #60? will raise the softening or fusion point in the manufacture of crucible and ' specialized refractory materials ANTIMONY OXIDE - #l6l6 Available in less carload and carload lots,. Antimony Oxide is used in glass as a de odorizer and refining material, and in porcelain enameling as an opacifier where it is generally incorporated in the fritt. A new item in the W. C. Sc D. line and we do not have complete informa tion available as to its complete use in ceramic manufacture. Salesmen should watch for potential customers. BARIUM CARBONATE - #8i Available in less carload lots and carload lots. Barium Carbonate #8l is a basic glaze in gredient used in praqtically all types of ceramic and glazed ware. 'It is used by glass companies to give special properties to glass and especially to optical glass,- Manufacturers of heavy clay products such as bricks, drain tile, etc. use barium Carbonate in small percentages to reduce the tendency of blooming. The amount used is approximately onefourth of one per cent. This material is often used in talc bodies to widen the firing range, and is used as an auxiliary flux by whiteware manufacturers in body formulations. Whittaker, Clark & Danielsfdn CM-3-50 BENTONITE - #h9 Sold in less than carload lots and occasionally in carload lots,, Bentonite ffh9 is used to improve plasticity in art pottery refractories and heavy clay products The amount used is generally under three per cent as Bentonite has a tendency to make casting dif ficult and also a tendency to throw off the fired color Bentonite is an excellent suspending material used in minor precentages in formulations for glazes when required CHINA CLAY - #1353 Sold in carload and less than carload lots, China clay is used in glass body formulations as a source of aluminum #1353 is especially ad aptable because of the small percentages of iron as....Porcelain enamel formulator3 also use China.Clay a source of aluminum. ' Manufacturers of whiteware, including artpottery dinnerware, wall tile use China Clay as a main body ingredient where the percentages used may go as high as twenty-five per cent. The average formulation use of China Clay in this type of ceramic manufacture averages about fifteen per cent #1353 China Clay is recommended especially because of its fast casting characteristics and its excellent fired color Calcining tests show that #1353 China Clay has a better color at 1800P,, than any other Clay used in a similar manner, including English Clays We are having experimental work conducted by the Ceramic Laboratories at Rutgers University on' this material, and because of our work along these lines have a six-month exclusive contract to promote the sale of #1353 China Clay in the ceramic industry "Whittaker, Clark & Daniels, Inc CM4i-50 CHINA CLA - #IU31 and #lU32 Sold in carload and less than carload lot?, China Clays #lU31 and #lii32 are used as a body ingredient in the formulations for art pottery, dinnerware and wall tile. It is used in a similar manner to the #1353 China Clay. The Ceramic Depart- . ment of the University of Georgia are investigating the use of this Clay in all kinds of ceramic man ufacture and -will probably have some definite in formation on the use of China Clay #ll*31 and #lli32 by the end of this summer. Whittaker, Clark & Daniels have had both good and bad report? on casting pro perties of these Clays. CHINA CLAI - #lq Sold in less than carload lots. China Clay #ijl is used the same way as the previous.China.Clays.and.is the.same.as.H..T.... Vanderbilt's ''Peerless'1 Clay. #1353, #1431, #11*32 and #1*1 China Clays are Georgia Kaolins. CHINA CLAY, ENGLISH - #372 Sold in less than carload lots. China Clay #372 is an English China Clay and is used in the same manner by ceramic manufacturers as are the domestic Clays but is preferred by some manufacturers because of the fired color of the material. Ceramic users buy English China Cfay chiefly for vitrified ware. "EPK FLORIDA11 KAOLIN (CHINA CLAY) - #60? Sold in less than carload lots. This Clay can only be handled by Fnittaker, Clark & Daniels in less than carload shipments. It has much better plasticity than is exhibited by the previous described China Clays, This Clay is between a China Clay and a Ball Clay in respect to its plasticity characteristics and use. Whittaker, Clark & Daniels, Inc. CM-5-50 BELL BALL CLAYS Sold in carload and less than carload lots Hard and fast rules for the use of Bell Ball Clays cannot be established* but in general pul verized Clays are used where a dry mixing process exists. Pulverized Clays are also used for plants making casting bodies who blend directly* eliminating a filter press operation* Crude Clays are used generally where filter pressing is used; that is, wet processing,, Another type of Bell Ball Clay. a controlled dry Clay for silo storage* is used by some large producers due to lower handling and freight rate charges,, General characteristics of Bell Ball Clays can be classified as followsj Dark Ball Clay is the whitest burning; Dresden is the strongest; and the Dark or Universal tend to be the best for casting. Bell Ball Clays are shipped as specified in six gradesa Dark* Dresden and Gray are straight Clay as mined. Universal* Superior and Special are blends of the above clays. All six of these clays are available in crude* controlled-dried or pul verized form. The Crude contains approximately 20% moisture. It Is never shipped direct from the pits. The Controlled-Dried contains approximately 10-12JS 'moisture which is guaranteed according to customer specification. The Pulverized* which is an air floated clay* contains only hydroscopic moisture. Karblite Ball Clay is a specially processed, pulverized clay to have guaranteed low lignite. Whittaker* Clark & Daniels* Inc CM--6r5>0 BELL BALL CLAYS There follows a general suggested list for the industrial uses of Bell Ball Clays, Art Ware ------ ----------------- - Bark Special Glaze -- ---------------------- Dark, Karblite Enamel Ware --------- Dark, Karblite Chemical Porcelain----- 1---------- Dark Dresden Heat Insulators -------- ------ -----Universal Dresden Dark Crucibles -- -- --- ---- r-- -- <-- i-- -- - Dresden Dental Porcelain---- -- ------------ - Dark, Karblite Saggers -------------------------- Sagger Kiln Furniture----------- 1---- <----Dark Stilts, Pins, General . Refractories ---- -- ---- ----- --- Special Dinnerware------------------------- Dark Dresden .v... :..:... v.:.......v... v.".".:..... v.:.Superior.:.... r TShiteware------------------ ------- - Dark Hotel China --- ----------- ------ --- Dark Dresden Superior Wall T i l e --- ------------------------Special Dark Sanitary Ware -------------- ------- -- Dark Special Electrical Porcelain -- --------------Universal Dresden Dark Superior Steatite -- -- ------- ------- -----r----Dresden Universal Terra C o t t a ------- --- *--------- >--- Gray Whittaker, Clark & Daniels, Inc. CM-7-S>0 FELDSPAR - #181 and #330 Sold in less than carload lots Feldspar #181 and #330 are used by glass ascompanies and manufacturers of porcelain,,enamel a source of aluminum The manufacturers of art pottery, dinner-ware and wall tile, use Feldspar as a flux. #181 Feldspar is a 200 mesh material and is. the standard generally used. However, where maximum fluxing is desired #330 Feldspar, which is a 325 mesh material,; should be suggested. Some competitive materials are Nepheline Syenite, which is sold in this area by the EPK Clay Go. of Metuchen, N.J, Multi-Flux, sold by the Foote Mineral Co. of Philadelphia, Pa., and Uni Flux sold by the Great Lakes Carbon Co. These competitive materials tend to have shorter firing range, greater warpage and poorer color than does Feldspar. The users of Nepheline Syenite are particularly liable to have warpage trouble and we suggest the use of #330 Feldspar as our offering to a prospective customer who is in this position. FLINT - See Silica FLUORSPAR - #157 This material is sold in less than carload lots. For porcelain enamel manufacture, Fluorspar #15? is a source of calcium fluoride. Fluorspar because of its calcium fluoride content is used in glazes for increased fluxing characteristics. Fluorspar #15? is used in glass formulations as an auxiliary flux. FULLERS EARTH - #659 This material is sold in less than carload lots. Fullers Earth is used as an absorbent around motors and pumps in practically all plants for good housekeeping purposes. Whittaker, Clark & Daniels, Inc CM-8-50 GROUND GLASS #718 - Sold in less than carload lots #3?it - Sold in truckload lots. Ground Glass is used in refractory coatings, art pottery and novelties as an auxiliary, low temperature flux Ground Glass is desired by a number of customers but is not guaranteed as to uniformity of chemical analysis This type material is currently used by several of our customers manufacturing bodies for hobbyists, and refractory coatings for furnaces and boilers LIMB - #101 This material is sold in less than carload lots In the manufacture of glass, lame is used as a source of calcium, acting as a flux with the silica used in the formulation Whittaker, Clark & Daniels have this material available only In less than carload lots MAGNESIUM OXIDE - #310 MAGNESIUM CARBONATE - #690 These materials'--are sold'in less than carload lots* These materials are used in porcelain enameling formulations and in steatite insulators to increase the Magnesium Oxide content of the body. Some times used in g l u i z .e s as an added source of Magnesium Oxide * CALCINED MAGNESITE - #222 ' CRUDE MAGNESITE"- #1320 f ' ' These materials are sold in less than carload lots* Magnesites are used in glass formulations as a source of Magnesium Oxide ana are used In refractory specialties and refractory coatings to improve resistance to heat shock Whittaker, Clark & Daniels, Inc CM-9-50 MICA - #279 This material is sold in less than carload lots Mica #2?9 is occasionally used in casting difficult shapes The Mica is dusted on the inside of the molds to improve the release of the pieces PIASTER - #122 This material is sold in less than carload lots Plaster is used by all art ware, dinnerware and novelty companies PUMICE This material is sold in less than carload lots. Glass companies who cut sometimes use Pumice. Specific ations.on.mesh.sizes.vary..Pumice.may.be. Suspended by Bentonite in a slurry. PYROPHYLLITE - #16 and #29 These materials are sold in less than carload lots. Pyrophyllite is used in art pottery, wall tile and dinnerware formulations to control shrinkage #16 has a better fired color than # 2 9 but due to the small amount of Sericite in its analysis, it is sometimes found objectionable Pyrophyllite #16 and #29 are used in refractory materials uo improve the resistance to heat shock and also to control shrinkage factor. Pyrophyllite does not wet readily and is therefore difficult to use in a casting body, pyrophyllite is the only ceramic material that ex pands with firing and thus it is used to counteract shrinkage of the other ingredients ROTTENSTOHE - #120 This material is sold in less than carload lots. Rottenstone is used by some glass companies to polish glass after cutting. Whittaker, Clark & Daniels, Inc CM-10-50 ROUGES- - HEP AMD WHITS Sold in less than carload lots. These materials are used by plate glass and flat glass manufacturers for polishing SILICA - #213 and #21? This material is sold in less than carload lots. Silica is used as a body ingredient in art ware, dinnerware, wall tile, floor tile, sanitary ware, etc formulations It is a body ingredient in this type of ceramic work and oftentimes is as much as 3$% of the total formulation Silica #219 is finer than Silica #213 and is therefore somewhat more reactive As a note of information too much Silica in a ceramic formulation causes shivering and dunting These are the opposite effects.cf..r:crazing.or.,....... .. ... .......... ...... ......... HAGI N G 3AM) (SHIGA) - #281 Sold in less than carload lots This type of material is used in the bottom of saggers to prevent the ceramic ware from sticking The general requirements are for a coarse sand of this type,, and the material is used over and over STEARATES - #906 Calcium Stearate #13it? Calcium Stearate .#903 Magnesium Stearate #$)Qli Zinc Stearate These materials are sold in less than carload lots. Manufacturers of steatite insul.ato.rs and ferro magnetic cores use metallic soaps to improve the pressing properties of their product The grade of Stearate used depends upon the individual customers specifications Whittaker Clark & Daniels, Inc CM-ll-SG TALC Sold in carload lots and less then carload lots. The ceramic industry as a whole consumes large quantities of Talc The Talcs selected find their place because of their various chemical and physical properties Manufacturers of steatite insulators require Talcs of low iron, low lime and low aluminum content, and the Talc must have good dielectric properties Whittaker, Clark & Daniels ' Talcs #'li*39, #172? and #1730 are excellent for these purposes W,, C & D Talcs #1*86, #1286 and #1211 are also widely used by steatite insulator manufacturers Ceramic heat insulators, refractory ceramics and kiln furniture require a Talc low in iron and low in lime, but with some aluminum content to give maximum resistance to heat shock Whittaker, Clark & Daniels! Talcs #11, #1*81 and #1*86 are found most .useful.in. this.type.of.formulation ............. ..... Art pottery and dinnerware require Talcs that have good casting characteristics, and should have some calcium in the chemical analysis to give good fired color Y/hittaker, Clark & Daniels8 Talcs # 1*6 3 , #6 1 0 , #783 and #786 are ail excellent for this type of formulation These Talcs are also suitable for wall tile formulations Talcs as a whole increase the resistance to heat shock, improve the glaze fit decrease the tendency to craze and improve the electrical properties of ceramic for mulations The percentage of Tale used in eeramiq formula tions vary from $% to 90%e In general, steatite insulators are made with approximately Q0% Talc in their composition, wall tile formulations carry approximately 1*0$ Talc, and dinnerware and art pottery ceramic items will contain approximately lf$ Talc Several of the Talc items which are handled by Whittaker, Clark & Daniels are used outside of the previous recommendations #5 Canadian Talc is used by some art pottery manufacturers but is not recom mended for this purpose by Whittaker, Clark & Daniels Whittaker, Clark & Daniels, Inc CM-12-5 because the calcium content cannot be guaranteed Our #13 Fibrous New York State Talc is not recom mended by us for use in the ceramic industry because of the selling arrangement existing between the WH Loomis Talc Corp,, and Donald Hagar #160 Maryland Talc is used in sizable quantities for saggers where the iron content is not important WHITING (CHALK) Sold in carload and less than carload lots Whitings are used as an added source of calcium and also as an auxiliary flux* and generally the customer has preferences as to the type of Whiting he will use A large number of ceramic manufacturers still prefer English Chalk Whiting #62 because of its established reputation for our-ity A dry ground Whiting such as V/,, C,, & D #629 Is largely used as a domestic grade and has proven acceptable by many manufacturers ATOMITE #31.9 is used where fine particle size is most desirable Whiting is used in glazes as a flux and is particularly desirable in pinks The specifications of purchase vary accordingly to the preierences of plant ceramic engineers ZINC PU DS - #1*429 and #956 Sold in less than carload lots Zinc Oxide is used in glass as an opacifying agent It Is a common ingredient in glazes* especially If a crystalline effect is desired Zinc Oxide #lij29 is used in ferrite magnetic cores CHROME GREEN OXIDE - #>13 Sold in less than carload lots Chromium Oxide is used to give green ceramic colors and when combined with tin oxide to give pinks0 Chromium Oxide is used in some refractory coatings to raise the melting point Whittaker* Clark & Daniels* Inc CM-13-30 SPANISH RED P U D E - #587 Sold in carload and less than carload lots This material is used by some ceramic manufactuers as a source of iron oxide, Spanish Red Oxide fires to soft yellow and brownish red colors0 RED IRON OXIDE - #2$9h Sold in carload and less than carload lots. The use of Pure Red Iron Oxide #2$9k varies widely as it is mainly for color purposes. This material is also widely used in ferro-magnetic cores as a major body ingredient. Whittaker,, Clark & Danielss Inc CM- lit-50 Whittaker, Clark & Daniels, Inc CM-lS-SO -3- 'Sample , No. of Fibers No. of Fibers With R. 1. Greater With R.I. Less Than 1590 Than 1574 Status With Regard to Pro posed FDA Method Dr. John A. Reffner (U. of Conn.) for Avon Cont'd Montana-I Montana-H Alabama Vermont No. Carolina 0 5,844 Fails chrysotile Passes tremolite 13 9,281 Fails chrysotile Passes tremolite 26 15,125 Fails chrysotile Passes tremolite 41 165 Fails chrysotile ' Passes tremolite 14 11,852 Fails chrysotile Passes tremolite Dr. Tryggve Baak of United Sierra Spiked Italian Montana-I Montana-H Alabama Vermont No. Carolina ' 3,000 1,000 0 0 .0 0 500 ; 2,000 0 0 0 0 0 0 Fails Passes Passes Passes . Passes Passes Passes Richard E. Stevens of Ernest F. Fullam, Inc. for Whittaker- C&D Italian Montana-I Montana-H Alabama Vermont No. Carolina ' 8,250 18,000 29,250 21,825 3,2.25 20,850 1,350 450 5,200 6,075' 675 6,000 Fails chrysotile & tremolite Fails chrysotile & tremolite Fails chrysotile & tremolite Fails chrysotile & tremolite Fails chrysotile & tremolite Fails chrysotile & tremolite Spiked sample was not run. AAAKBPXLF -4- Sample No. of Fibers No. of Fibers With R.I. Greater With R.I. Less Than 1590 Than 1574 - S.tatus With Regard to Pro posed FDA'Method Mrs. Lucy McCrone of McCrone -Associates for Kolmar Italian 53 0 Passes Montana-I 0 0 Passes Montana-H 0 0 Passes Alabama 0 0 Passes Vermont 0 0 Passes *No. Carolina 0 0 Passes Spiked Sample 488 16 Passes *Sample noted to contain some fiber bundles which are rolled up talc plus some non-fibrous tremolite .. The following participants examined their samples but were unable conscientiously to count particles with confidence, therefore, did not report numbers: . Hiss Marie Jones for Dr. G. Cohen - Bristol-Myers Products Research Lab Mr, Salvatore DiBianca - The Mennen Company .... Liberty Mutual.Insurance.Co., Research.Center.- for.Kolmar.Laboratories Mr. John Facq - The Colgate Palmolive Company, Research Center The table reveals strong inconsistency between results obtained by the different scientists applying the method tc the same group of coded talc samples. This inconsistency is the result of problems encountered in the methodologv. 1. The alpha refractive index of talc - one of the two indices exhibited by talc plates standing on edge - varies in.value between .1.539 and 1.5501. This in combination with item 2, below, m ly easily result in the mis-classification of such plates as "fibrous, less than 1.574" snd therefore chrysotile. Dr. Reffuer of the University of Connecticut, in his report to Avon, admits that this factor is paramount -- "counts for chrysotile are high since (talc) edges will often be mistaken for fibrous particles". 2. The immersion method for the determination of`relative refractive index becomes unreliable when applied to extremely small (ca. 1 pm)par tides. This is due in part to the fact that particles around l.PW in width approach the limit of resolution of. the human eye when both size and contrast are considered, especially when applying the Becke line technique prescribed. This will v -5- 2. cause eye fatigue-and resulting errors. Thus, a fine talc shard or plate on edge may be easily mistaken for an asbestos fiber. This applies to both the chrysotile and amphibole - portions of the test. 3. It is quite likely that chlorite - a mineral of varied compo sition commonly found in pharmaceutical grade talc - would , be incorrectly identified as tremolite. Refractive indices for chlorite vary in the range 1.57-1.66^. 4. The examination of a sample of one milligram dispersed on a single microscope slide presents the investigator with a preparation which is too dense for a petrographic study. 5. The method is laborious and time consuming. Dr. Reffner quotes .an analysis time of about five hours per sample and at JOHNSON & JOHNSON the Investigator (D. H. Hamer) estimated at least two or three hours. 6. Dr. Walter C. McCrone in an earlier letter to the FDA suggested that there were relatively few scientists in the country who could use the method effectively. Scientists at Bristol-Myers, The Mennen Company, Liberty Mutual and Colgate-Palmolive had great difficulty in following the method to conclusion. 7. The proposed FDA method implies that all fibrous particles in talc having optical properties similar to those of asbestos minerals are in fact asbestos. This is probably an unwarranted assumption. REFERENCES: 1. Deer, W.A., Howie, R.A., and Zussman, J., Rock-Forming Minerals, Vol. 3, p. 121 (1962). 2. ibid, p. 131. ***************** We have concluded that the method published in the Federal Register does not provide a truly reliable means for the detection of asbestos in talc. It results in both false-positive and false-negative findings. It is also tedious and may consume as much as one half day per sample. The subcommittee urges that the Food and Drug Administration defer finalizing the proposed optical microscopic method and proceed into a Phase II program which would combine FDA and Industry in a strong effort to develop a truly reliable method for measuring chrysotile content in talc. We are confident that the detection and estimation of fibrous tremolite can also be done, if necessary, as a fringe benefit, at the same time. -6 We estimate that a satisfactory method will take at least six months to a year, to develop. We suggest a close liaison between FDA and industry in this all-out effort with updating reviews to take place as frequently as necessary. Review of Alternate Methods The CTFA Talc Subcommittee has reviewed several methods to detect chrysotile and tremolite in talc, including modifications of the optical microscopic method. These are listed with comments.' 1. Optical Microscopic Method - may be used.with some modification. ' Possibly better selection of R.I. liquids and reduction of sample size per slide. 2. X-ray Step Scanning - A good method for detecting tremolite if we could accept about 0.2% as the threshold of detection. It does not distinguish fibrous from non-fibrous tremolite. The simultaneous detection of chlorite makes method impractical for chrysotile. 3. X-Ray Step Scanning 4- Optical Microscopy - Acceptable as in #2 above but the optical method continues to present the dilemma in reliable identification of chrysotile. However, this does not rule out a major revision of the optical method to do the chrysotile identification' and counting. ' 4. X-Ray Scanning - The problem of chlorite interference in the detection of chrysotile is present in all x-ray procedures thus far available. It is reliable for the detection of 1% tremolite (both fibrous and non-fibrous). 5. Differential Thermal Analysis - This procedure is capable of detecting chrysotile at the 1% level, however, it will not detect tremolite. 6. Scanning Election Microscopy - This procedure is not capable of identi fying asbestos. Even with energy dispersive analysis, completely satisfactory identification is not possible. 7. Transmission Electron Microscopy + Electron Diffraction - This appears to offer the best, most reliable method and is probably capable of detecting chrysotile and tremolite (fibrous), both at a level of 0,1%, It is estimated that an installation would cost about $130M +, and is obviously prohibitive for the small manufacturer who uses talc. The amount of talc sample examined by this procedure is miniscule. -7- Suminary ' . ' The CTFA Talc Subcommittee has completed its review of the Optical Microscopic Method for the Estimation of Chrysotile and Fibrous Tremolile in Talc, which appeared in the Federal Register, voi. 38 (No. 188),(p. 27076, September 28, 1973). It recommends postponement of the finalization of the proposed regulation on talc. In addition, a collaborative effort between FDA & industry to resolve a satisfactory method of estimating chrysotile and tremolite in talc, is recommended, with periodic liaison reviews to monitor the project status. A task force of industry experts has been designated to pursue alternate methods. We invite FDA to participate in collaboration with the task force. George *W. Sandiand Chairman CTFA Talc Subcommittee MEMBERSHIP LIST - CTFA TALC SUBCOMMITTEE G. W. Sandland, Chairman (SAC) Bristol-Myers Products Dr. DeWitt Petterson ' Johnson & Johnson Research Center Dr. Murray Berdick (SAC) Chesebrough-Ponds, Inc. Dr. Robert Rolle Johnson & Johnson Research Center Dr. George Cohen Bristol-Myers Products Mr. Fred Roesch Whittaker, Clark and Daniels Dr, Christopher Costello (SAC) Colgate-Palmolive Company Dr. Charles Rowland Avon Products, Inc. (SAC) Mr. Salvatore DiBianca The Mennen Company Dr. Harold Schwarts The Mennen Company (SAC) Mr, John Facq Colgate-Palmolive Company Dr. Joseph Simko Colgate-Palmolive Company Mr. David Hamer Johnson &.Johnson Research Center Mr. Harold D. Stanley, Jr. Pfizer Mr, Alan M. Harvey R. T. Vanderbilt, Inc. Mr.- Wallace Steinberg Johnson & Johnson (SAC) M r . Ray R , Kramistes.. ....~ ..... .. Dr, John.Travers-.-.... -.-.:.. . Whittaker, Clark and Daniels Avon Products, Inc. Mr.' Adolph Maruszawski (SAC) Kolmar Laboratories, Inc. Dr. C. S. Thompson R. T. Vanderbilt, Inc, Mr. Louis D. Murino United Sierra 9 \ Mr. Ronald Yakupcin Kolmar Laboratories Dr. Tryggve Baak United Sierra . December 11, 1973 / r.f s December 10, 1973 TO: MEMBERS OF THE GITA TALC SUBCOMMITTEE 6, SCIENTIFIC ADVISORY COMMITTEE: Attached herewith and submitted for your reading and comments is a finalized submission of the report of the CTFA Talc Subcommittee which we wish to submit to the Food & Drug Admini stratlon. Please read at once and, likewise, call me at once if you disagree with any of the content matter. .. In view.of the.very 'short.'time.left.to.process.this.~...... submission, your immediate attention is of paramount importance. Thank you, Pestle,* ,,eorgp' W. Sandland Chairman CTFA Talc Subcommittee REPORT OF CTFA TALC SUBCOMMITTEE ON METHOD TO DETECT CHRYSOTILE AND TREMOLITE IN TALC. ' December 10, 1973 The Scientific Advisory Committee of the Cosmetic, Toiletry & Fragrance Association, 1625 Eye Street, N.W., Washington, D.C. 20006 at a meeting held on September 2, 1973, designated that a subcommittee be set up to study the optical microscopic method proposed by the Food and Drug Administration. This method was published in the Federal Register of September 28, 1973. The present membership of the CTFA Talc Subcommittee is shown on an attached sheet. . . At the first meeting of the Subcommittee, it was agreed to submit several samples of talc to members who volunteered to apply the FDA proposed optical microscopic methodl The following talc samples were distributed without identification - except for randomly applied and non-duplicated code numbers: Italian Talc Grade #1615 Montana Talc Source P Montana Talc Source F Vermont Talc Grade #66 Alabama Talc No..Carolina Talc.Grade 643 In addition, a sample of Italian Talc spiked w/w with 1% ebrysotile and 0.15% tremolite was sent to each participant. The participants were aware that the sample was spiked, but did not know the percentage of spiking. The attached table summarizes all reports submitted: -2- Sample 'No. of Fibers With R.I. Greater Than 1590 - No. of Fibers With R.I. Less Than 1574 Status With Regard to Proposed FDA Method Mrs. Lucy McCrone, McCrone Associates for Chesebrough Spiked Italian Montana-Pfizer Alabama Vermont * No.Carolina Montana-Ferry 320 120 0 0 0 0 0 16 ' Passes 0 Passes 0 Passes 0 Passes 0 Passes 0 Passes 0 Passes Mr, Harold Stanley of Pfizer Italian /100 Montana-Pfizer *****100 Montana-Ferry 100 Alabama /^lOO Vermont 100 No. Carolina v. 100 >100 > 100 >100 >300 >100 >100 Fails Chrysotile Passes tremolite Fails Chrysotile Passes tremolite Fails Chrysotile Passes tremolite Fails Chrysotile Passes tremolite Fails Chrysotile Passes tremolite Fails Chrysotile Passes tremolite Mr. David Hamer of Johnson & Johnson Italian Montana-Pfizer Montana-Ferry Alabama Vermont No. Carolina 0 1 25 0 0 0 0 0 0 0 0 0 Passes Passes Passes Passes Passes Passes Spiked Italian Dr.- John A. Refiner (U. of Conn.)1 for Avon 632 12,930 220 1,114 Fails Chrysotile Passes Tremolite Fails Chrysotile Passes Tremolite Jack Travers reported that NJOSH has proposed a revised (lower) TLV of 50 meg/cubic meter for crystalline silica. Bob Rolle described the latest results of Round Robin #3 using the CTFA Proposed Optical Microscope Procedure For Detection of Chrysotile in Talc. This is the method intended to be used as a back-up to the DTA method, since DTA can give a false positive for chrysotile when non fibrous antigorite is present. Unfortunately, there was disagreement among 3 very capable investigators, McCrone Associates, Harold Stanley of Pfizer and Dave Hamer of Johnson & Johnson. It was agreed, however, that chrysotile is never found in cosmetic talcs, based on numerous analyses by several investigators. The only discoverer of chrysotile in cosmetic talcs has been Professor Lewin, and his results have been refuted in a repeat testing of the same samples by John Stuart at FDA, The committee concurred, therefore, that our only courses of action are either to rely only on DTA by itself (without a back-up procedure), or else, based on the wealth of data available, eliminate.the need for a.chrysotile.specification in.cosmetic.talc. Either way, we are confident at this point, that chrysotile won't be found and simply is not present in cosmetic talc. We are still awaiting additional DTA results on talc samples (some spiked) which were sent to Colgate-Palmolive, Mennen, Pfizer, and Whittaker Clark & Daniels. In addition, Jack Travers has submitted a set of samples to John Reffner (V. of Comm) for DTA analysis. Jack Schelz described an inexpensive DTA unit sold by Columbia Scientific Industries costing $3350 without a recorder and about $4600 with a recorder. This instrument was evaluated by Dr. Schelz and was found to he capable of detecting serpentine minerals above the 0.5% w/w level in talc, when used according to the proposed CTFA test method. . It was agreed that we include in the procedure for chrysotile, the latest definition of a fiber as published by OSHA in Field Information Memorandum #74-92, which was sent to OSHA Assistant Regional Directors and Area Directors. This memorandum states that: "In order to be considered asbestiform or fibrous the following criteria will be used by the Salt Lake City Laboratory of OSHA, AAAKBPXLD CF-BALL-6 - 2- A. Particles must appear to be fibrous, rather than as crystals or slivers. B. The maximum diameter of a fiber to be counted is 3 microns. C. The maximum length of a fiber to be counted is 30 microns. D. The length to width ratio must be 5 or more to 1, that is, 5 times or more longer than wide, E. The separate or individual fibers must contain fibrils or the "bundle of sticks" effect, unless they are at a non-divisible stage. A fibril cannot be subdivided and would be counted, if it meets the other criteria. The electron microscope may be used to prove the fibrous nature of the particles. The length to width ratios of 5 or more to 1 is not meant to imply that other particles are not hazardous." .... The.directive.states.at.the.end.that.the above guidance is temporary and may change as a result of findings from an on-going NIOSH study on this subject. A CTFA Talc Task Force comprised of Dr. Berdick, Dr. Estrin (GTFA) , Mr. Lee, Dr. Rolle and Mr. Sandland will meet with Dr. Robert Schaffner, Mri Eiermann and their designated personnel at FDA on Friday, February 7, 1975. It is planned to propose the 0.5 to 1.0% limit for each fibrous tremolite and chrysotile in cosmetic talc. Our CTFA Task Force developed methodology will be submitted in latest form as part o the proposal. A preliminary meeting at CTFA Headquarters will be held in the morning and the meeting with FDA is scheduled at 1:00 P.M. A report of this meeting will be submitted to the members of the CTFA Talc Subcommittee. Allan Harvey reported that he will attend a meeting on Tuesday, February 11, 1975 which has been called by Dr. Raymond E. Shapiro of FDA who is heading up a Subcommittee on Asbestos Protocols. This subcommittee was assigned the job of reviewing all existing data with respect to the biological effects of orally administered asbestos, with particular reference to carcinogenesis, and if necessary of - 3- developing appropriate protocols for studies to elaborate on any data deficiencies in this area. At the meeting of February 11th, the subcommittee members will discuss a working draft which has been furnished to them to provide a basis for comment and discussion. A paper entitled "Is Short-Fibered Asbestos Dust a Biological Hazard?" by Paul Gross, M.D., Charleston, S. C. was discussed. Here Gross states there is evidence that asbestos particles which are submieroscopie in size (<5 microns)elicit only a macrophage reaction in the lungs of monkeys. Similar results resulted in several other animals including rats and hamsters when submicroscopic asbestos was injected intratracheally and intra-ab dominally. There being no further business, the meeting was adjourned. i W. Sandland Chairman, CTFA Talc Subcommittee D E FIN IT IO N : Talc is a white, odorless or very slightly earthy, finely powdered, native, hydrous, mag nesium silicate, sometimes containing a small portion of aluminum silicate. TEST SPECIFICATION METHOD C o l o r ................................ O d o rle s s ..................................... Iden tificatio n ............................ Slip ............................................... L u s t r e .......................................... Carbonates ................................. W3ter-Soluble Iren Screen Test Alkalis and Acids .Water Soluble Substances . . Acid-Soluble Substances . . . Loss on Ig n itio n ....................... Arsenic {as A s }............................ Lead (as Pb)................................. As specified by the buyer and showing no change after heating As specified by the buyer Positive: Close match to CTFA Spectrum--IR with no indication of foreign materials As specified by the buyer Do. No effervescence Passes test 100% through 100 mesh 98% minimum through 200 mesh Finer grades: as specified by the buyer Neutral to litmus paper 0.1% maximum 2.0% maximum 5.0% maximum 3 ppm maximum 20 ppm maximum Heat 1 to 2 g at 200 C For 5 minutes C T FA G 3-1 USP X V III, page 703 Observe reaction for a' fsTve::cence during digestion in Test for Acid-Soluble Substances USP XV111, page 703 C T F A C 6-1 USP X V III, page 703 See Test for Reaction and Sol uble Substances, Do. USP X V III, page 708 Do. C T FA F 1-1, Parts I-A and 11 C T FA F 2-1, Parts l-A and i! t T M -- -- COSMETIC,TOILETRY AND FRAGRANCE ASSOCIATION, INC. 1625 Eye Street, N.W., Washington, D.C. 20006 The Cosmetic, ioiietry and Fragrance Association, Inc. 1133 15th ST R EET, N.W., WASHINGTON. D.C. 20005 202/331-1770 T E LE X 89-2573 Jam es H. Merritt Prsident Norman Wee PFre,.siEdsetnrt--o,ScPiehn.Dce. TALC TASK FORCE MINUTES A meeting of the Talc Task Force was held on February 7th, 1975. After a pre-meeting at the CTFA Offices, the Task Force reconvened at the office of Dr. Robert Schaffner at the Food and Drug Administration, 200 C Street, SW, Washington, DC. Those in attendance were: Mr. George Sandland, Bristol-Myers (Chairman) Dr. Murray Berdick, Chesebrough-Pond's Mr. George Lee, Johnson & Johnson Dr. Robert Rolle, Johnson & Johnson . Dr. Norman Estrin, CTFA . ' ` Those.in attendance.from.the Food and. Drug Administration were . Dr. Robert Schaffner Mr. Henry Davis Mr. Heinz Eiremann Dr. William Horwitz Mr. Ronald Yates _ .` ' Mr. Sandland opened the meeting stating that the objective of the Task Force meeting was to give a status report on its activities and at the same time ascertain the status of work at FDA in this area,' Dr. Schaffner responded FDA was still interested in development of satisfactory methodology and D.r. Horwitz noted briefly his work in this area. Mr. Sandland called upon Dr. Rolle'to give a report on CTFA progress. Dr. Rolle reported on the development of a Differential Thermal Analysis procedure for serpentine followed by an optical microscopy procedure, with detection limits between 0.5 and 1%. For amphiboles like tremolite, an x-ray.diffraction method, fol lowed by dispersion staining optical microscopy has been . developed; this procedure allows determination of whether the FEB 2 4 1975 6 - W . SANDLAND The Cosmetic, ioiletry and Fragrance Association, Inc. 1133 15th S T R E E T , N.W., W ASHINGTON. D .C . 20005 * 202/331-1770 T E L E X 89-2673 ' Jam es H. Merritt Ptttidem Norman F . Eslrin , Ph.D. Vie* Ptetident--Selene TALC TASK FORCE MINUTES A meeting of the Talc Task Force was held on February 7thr 1975. After a pre-meeting at the CTFA Offices, the Task Force reconvened at the office of Dr. Robert Schaffner at the Food and Drug Administration, 200 C Street-, SW, Washington, DC. Those in attendance were: Mr. George Sandland, Bristol-Myers (Chairman) Dr. Murray Berdick, Chesebrough-Pond's Mr. George Lee, Johnson & Johnson - Dr. Robert Rolle, Johnson & Johnson . Dr. Norman Estrin, CTFA . ' Thohe in attendance from the Food and. Drug.Administration were: . Dr. Robert Schaffner Mr. Henry Davis Mr. Heinz Eiremann Dr. William Horwitz Mr. Ronald Yates . ` Mr. Sandland opened the meeting stating that the objective of the Task Force meeting was to give a status report on its activities and at the same time ascertain the status of work at FDA in this area. Dr. Schaffner responded FDA was still interested in development of satisfactory methodology and Dr. Horwitz noted briefly his work in this area. Mr. Sandland called'upon Dr. Rolle' to give a report on CTFA progress. Dr. Rolle reported on the development of a Differential Thermal Analysis procedure for serpentine followed by an optical microscopy procedure, with detection limits between 0.5 and 1%. For amphiboles like tremolite, an x-ray diffraction method, fol lowed by dispersion staining optical microscopy has been . developed; this procedure allows determination of whether the 'FEB 24 1975 G. W. SANDL/,NO material is fibrous or not. Dr.. Rolle noted successful com pletion of round robin tests with detection levels between. 0.5 and 1%. Dr. Rolle observed that he has been unable to obtain a single naturally occurring sample containing chrysotile. Dr. Berdick questioned the need for a regulation on chrysotile since no sample has yet to be confirmed as containing this material. Mr. Eiremann responded that he sees no problem with a regulation covering both amphiboles and chrysotile, since "if chrysotile is not there, you should have no problems." Dr. Estrin and Dr. Berdick objected, stating that Mr. Eiremann was proposing regulations for the sake of regulation, and has not considered the wasteful tax on resources that would arise from inclusion of a standard for chrysotile. Dr. 3erdick and Dr. Estrin concluded that if a regulation is not necessary, it should not be proposed. , Dr. Schaffner responded with a suggestion that CTFA send in a letter with documentation, showing the extent of tests andresults which would support a recommendation about the inappropriateness of a regulation for chrysotile. It was noted that Professor Lewin was the only scientist to ever have.mentioned.chrysotile in his report and the lack of confirmation of his results by other scientists. Dr. Schaffner asked for a progress report on Professor Lewin*s activities, and stated that FDA will speak to Dr. Lewin shortly concerning his progress. Mr. Sandland noted that CTFA specifications for Talc published as part of- the CTFA Standards, are up for revision. He reported that the new specifications will add a tremolite specification and the methodology for continuous scanning x-ray diffraction, but*added that CTFA would not expect to include a specification for chrysotile. He added that chrysotile has never been found in Cosmetic talcs from either European or dosmetic sources. FDA was asked for its present timetable, and responded, it is ese- awaiting results from the Franklin Institute and have arrived at no definite time schedule for either a food or a cosmetic regulation. Mr..Sandland proposed limits of 1% for tremolite, stating that based on the OSHA limit of 2 fibers per cc in an 8-hour day.pro posed for 1976, one would arrive at a safety factor of 48,-000 if such a limit were adopted. .. Mr. Eiermann questioned this calculation on the basis of his understanding of the OSHA limits for short and long-term exposures. AAAKBPXLE 3 Dr. Schaffner added the political inadvisability of citing'mine- worker standards for cosmetic talcs, and advised that xt would be more meaningful to have animal studies with talc than statistical estimates. Mr. Lee responded by noting animal work in progress. Mr. Eiremann then proposed "non-detectable" terminology rather than numerical limits. Mr. Yates noted briefly that there was no progress yet on enrichment for chrysotile and that he was pessimistic about the possibilities in this area. . Mr. Lee offered participation of the CTFA Talc Subcommittee in evaluating any methods developed by FDA. There being no further business, the meeting adjourned. Norman F. Estrin, Ph.D. Vice President - Science NFE:mp 2/17/75 d 9 Telephones: New Jersey (201) 659-4412 New Y o rk (212) 227-3618 P.O. BOX 529 -- 77 RIVER STREET ~J4ololcn, YJ. 07030 .' Plant: Metuchen Road South Plainfield, N . J. 07080 (201) 754-4880 February 16, 1970 Mr. Robert G. Smith, President Whittaker, Clark & Daniels, Inc. 100 Church Street New York, New York 10007 - - Dear Bob: We have been reviewing the situation of Metropolitan Talc Co. and its future operations here in this office, and believe that because.of.the.recent.developments;.that.serious.con-.:. sideration should be given to the raising of price on all grades of Canadian Talc currently sold. While our initial estimate of the situation seemed to indicate a more gradual approach to the problem, several things have occurred which we believe make it reasonable to increase prices almost imme diately. The large loss sustained last year by Metropolitan wa^scaused by failure of prices to meet the costs of producing at South Plain field. As you are well aware we have received the initial order from Johnson & Johnson of New Brunswick, for 1100 tons of #1615 Talc to cover the period of February 23rd through June 15th. They have indicated great concern to us that if Shower to Shower should meet with good market approval, they might have to in crease this tonnage and wonder about our abilties to supply. We have assured them that with the existing business we have in hand, we could take care of between 2000 and 2500 tons on an annual basis. However, with Ponds and the other 1615 customers and Johnson & Johnson's business and with th possible additions of either Cheramy or Mennen, or perhaps both, we must look ahead to our production capabilities. It is our opinion here that we should announce a $5.00 increase on all new business on and after March 15th to March 30th at the latest. Of course, where we have accepted business on Canadian Talc for future deliveries at a (Continued on page 2) AAAKBPXLC CF-BALL-5 Page 2 given price, we must honor these commitments. Nestle-LeMur have ordered 300 tons of 4602 at $70.00 per ton, approximately half of which they have already received. However, after the balance of this order has been delivered, we would advise them of a price increase of $5.00 per ton. While we do not know the ultimate effect of this increase on customers such as Kentile, I believe we are in a position to accept their possible loss without seriously jeopardizing the picture of Metropolitan Talc Company. We would appreciate your thoughts on this matter together with Larry's and Mr. Clark's. Please let us know if you think that this is a wise move. , Very truly yours, CHARLES MATHIEU, INC. DRF:Is ^ Donald lif. Ferry President Code No. Product D escription Uses . 141 T a l c , A lp in e U S P " B . C . " P r e s s &Aerosol ) -- G enerally accepted as standard ) p re ss powder. Good liquid su s pension. 643 T a lc , North C aro lin a 200 mesh 1615 T a l c , A . G . I. " B . C . " ) ) Excellent quality, fa ir color ) Ci? -4-' nn. /rr 'c ) D om estic ground Italian 2450 T a lc , North C aro lin a ) S a m e as 643 but better co lo r AAAKBPXLB CF-BALL-4 Code No. Product Description U ses I ESTABLISHED I9S 0 <201) 561-6100 CABLE "SLEINAD" PRODUCT DATA-i ULTRAMARINE BLUE USED IN THE RUBBER INDUSTRY Ultramarine blue isused extensively in the rubber industry. There are several key uses. It isused to aid in the whiteness of a white rubber, example on a whitewall tire. It isalso used for a full color, such as the trademark on a well known brand of basketball shoes. It could be used for hot water bottles, rubber thread, bottle stoppers, color for latex in carpeting and an assortment of mechanical rubber goods. Generally speaking the percentage isranged from 1/10% for whitening of the white rubber to approximately 4% for a full color. Reasons for using ultramarine blue: Non Bleeding - That is, alkali resistance - especially in latex Heat Stability . .Easy Dispersion Characteristics... ..... ........... ..... .... Rich Red Clean Ultramarine Color Light Fastness Chemically Stable Compatibility -Except in acidic conditions Non Toxic Note, comparative figures on phthalo versus ultramarine blue in rubber. In rubber 10 to 12:1 stronger than ultramarine blue whereas, normally 20:1 in some other media. For new business the recommended ultramarine blues for Rubber Industry are the #5008 red shade #5021 for the green shade. These are available - Stocked inSouth Plainfield, N.J. - Chicago, Illinois Not for Distribution lOOO G Q OLID15E S T R E E T S O U T H P LA JN F IE LO N J 0 7 0 8 0 05146125 <201 l 5 6 1 .6 1 0 0 C A B L E ` S L E IN A D ' PRODUCT DATA WHITTAKER METALLIC SOAPS When a fatty acid (such as Stearic) is combined with an alkali such as caustic soda the resultant product isknown as a soap. When the soap is made with Stearic Acid it is known in chemistry as a Stearate. This soap, or Stearate, is soluble in water and has been in domestic and industrial uses for years. A number of years ago the chemists found that by replacing the sodium content with a metal such as Aluminum, Zinc, Calcium, Magnesium, or Barium the resultant product was completely insoluble in water. These new products were called Metallic Soaps or Stearates with the name of the metal used as a prefix, i.e. Aluminum Stearate. With this discovery a whole new field of uses were opened up. By employing different methods of production it was found that different grades of metallic stearates could be made. As a result of this we have been able to make a specific Stearate for almost any purpose. Some Stearates, for example Aluminum, were found to possess properties that were not associated with any other compounds. When treated with solvents, like petroleum oils, or for that matter any other oil, animal, vegetable or mineral,.or with.waxes, they formed gels. It.was also found. that by regulating the amount of free-fatty acid in the finished Stearate the type of gel and its durability could be controlled or changed. In this respect also the gel forming properties could also be increased or decreased by the amount of metallic base incorporated into the Stearate. Through these means we are able to make Stearates to fit almost any demand of industry. Stearates possess remarkable waterproofing properties. They can be incorporated as a dry powder when the material is mixed; when dissolved in suitable solvents they can be applied to concrete, stucco or plaster as waterproofing. Certain Stearates possess lubricating properties. These are used for mold lubrication in the plastic industry, artificial leather industry, rubber industry and in wire drawing mills;applied as a dry powder which can be dusted into the molds before they are filled. U.S.P. Stearates are widely accepted in the cosmetic industry because of their adhesive or clinging characteristics and their ability to lessen sheen. Among numerous cosmetic uses, Stearates are ingredients inface powder, hand creams, lotions, body dusting powder, medicinal powders and dressings. Continued.. ..... JOOO C O O L ID G E S T R E E T SOUTH PLAINFIELD N J 0 7 0 8 0 I .il <Z01> 6 6 1 .6 * 0 0 C A B L E - S L E I N A D ' 2 PRODUCT DATA WHITTAKER METALLIC SOAPS Like pigments, in general Stearates are composed of clusters of individual particles whose ultimate size isone micron or less in diameter. When examined by the microscope, they appear colorless and transparent. Their refractive index ranges between 1.36-1.61. Although they are a little heavier than water with specific gravities ranging between 1.007 and 1.230, they are so water repellent that they float even in boiling water. Some Stearates have a greasy or unctuous texture, while others feel dry and willnot stick together when compressed. The melting points reveal several interesting features of the Stearates. Some of them, like Zinc Stearate, fuse to a thin liquid within a narrow temperature range. Others, like Aluminum Stearate show an initial softening point and become viscous liquids up to a much higher temperature. Some will not fuse at all but will char and decompose. TOOO C O O L I D G E S T R E E T SOUTH PLAINFIELD N J 07Q S0 I 66TAW*H*P l0 f2 0! I 561-6100 CABLE "SLEtNAD ' PRODUCT DATA-i GLOSSARY OF WC&.D METALLIC STEARATES ALUMINUM STEARATE A metallic soap used inpaints, varnishes and lacquers to give special properties which may be summarized as follows: 1. To thicken oilsand organic solvents 2. To aid in suspension and deflocculation of pigments 3. To impart water-proofness 4. To impart flatness to organic finishes 5. As a surface active agent when itisused as an oil-in-water emulsifier USES Waterproofing, ingredient of lubricants, cutting compounds;cements, flatting agent; cosmetics and pharmaceuticals. GRADES AVAILABLE "KEY" DESCRIPTION 908 Aluminum Stearate Aluminum tri-Stearate high infree fatty acid. Low gel characteristics permit use of this material with minimum bodying. 909.Aluminum Stearate Hi-gel di-Stearate for paint, ink, etc. BARIUM STEARATE Barium Stearate combines lubricating characteristics with good heat stabilizingproperties. Its unusual melting characteristics recommend itfor use where high melting points are desired. USES Waterproofing agent; lubricant; packing for bearings. GRADE AVAILABLE "KEY" DESCRIPTION 902 Barium Stearate High melting point lubricant for rubber and plastics. Continued 1000 COOLIGE STREET SOUTH PLAINFIELD N J OTOBO ESTABLISHED<S0 PRODUCT DATA 2 CALCIUM STEARATE A metallic soap used inpaints, varnishes and lacquers to accomplish the following purposes: 1. To facilitate wetting of pigments, thereby improving gloss 2. To aid in suspension properties without causing excessive bodying 3. To harden lacquers and varnishes which are used as sanding sealers USES Waterproofing, flatting agent inlacquers: also used in varnish, paints, enamels, plastics;lubricant; emulsions; cements; wax crayons. GRADES AVAILABLE "KEY" DESCRIPTION 1345 Calcium Stearate - All-purpose; exceptionally fine uniform particle size. 2284 Calcium Wettable Stearate Water dispersible. 2307 Calcium Food Grade Stearate - High bulk material. Provides great covering power and isa most efficient conditioning agent. Can also be offered under Kosher label by special arrangement. LITHIUM STEARATE Lithium Stearate isconsidered a very efficient lubricant for powdered metal operations. In addition, itsoxygen-scavenging effect promotes the sintering rate innon-ferrous parts. Extra care must be taken when using Lithium Stearate with brassparts, since an excess of stearate can cause some surface discoloration. GRADES AVAILABLE "KEY" DESCRIPTION 1083 Lithium Stearate High degree of lubricity. Sometimes used in greases. Continued lOOO COOLIDGE STREET SOUTH. PLAINFIELD. N J 0 7 0 8 0 IM F ] , i[201I i B5 61 -6 1 0 0 CABLE 'S LK INa D", I . ------ PRODUCT DATA- MAGNESIUM STEARATE A metallic soap used in paints, varnishes and lacquers to give special properties. They are used to aid in suspension and deflocculation of pigments, to impart waterproofness, to form water-in-oU emulsions and to serve as an external and internal lubricant in tableting water colors. USES Dusting powder, flatting agent; in medicines; stabilizer and lubricant for plastics. GRADES AVAILABLE KEY" DESCRIPTION 985 Magnesium Stearate U.S.P. Standard U.S.P. material (Light Density). Highest degree of lubricity. Recommended for most uses. 2311 Magnesium Stearate U.S.P. U.S.P. Food Grade (Heavy Density)...... :.:.:... :. ZINC STEARATE A metallic soap used inpaints, varnishes and lacquers to impart special properties which may be summarized asfollows: 1. To aid in suspension properties with only slight bodying 2. For hardening lacquers and varnishes which are used in sanding sealers 3. For controlling the flow of enamels formulated with rutile-type titanium pigments 4. To aid inflocculating and as an anti-settling agent inzinc chromate primers USES Medicine; cosmetics; drying lubricant inrubber; waterproofing agent; lacquers; plastics;powder metallurgy. GRADES AVAILABLE "KEY" DESCRIPTION 695 Zinc Stearate U.S.P. Most commonly used, all purpose cosmetic grade. Has a very fine particle size and tends to be quite fluffy. Continued...... . lOOO C O O L ID G E S T R E E T SOUTH PLAINFIELD, N J 0 7 0 6 0 " J C d Y A ftU S K E p l 903 Zinc Stearate 904 Zinc Rubber Grade Stearate 1349 Zinc Stearate 2271 Zinc Wettable Stearate 2288 Zinc Stearate 2302 Zinc Heat Stable Stearate 2304 Zinc Hi Temp Stearate 2310 Zinc Stearate 2313 Zinc Stearate 420! t 56!-6tOO CABLE-SLEJNAD' PRODUCT DATA-i Recommended "lacquer grade." Standard lubricant and dusting agent for rubber application. All purpose grade. Aqueous products. Stir-ingrade developed for lacquer manufacturers. Heat-stable grade. Especially developed for polystyrene. Used where a lower bulking material is desired or where ease of dispersion isimportant. Special "non-agglomerating" product for surface treatment applications and for rubber.. if904 not satisfactory. Non-blooming stir-ingrade for sealer lacquers. Shows excellent suspension. Higher apparent density (lower bulk value) than 904. Freer-flowing and useful where itis desirable to apply a thicker, but uniform, zinc stearate coating to uncured rubber sock. 1O0O COOL1DGE STREET SOUTH PLAINFIELD N J 070 8 0 i-fsiiye STEARATES FOR PAINT, LACQUER AND PRINTING INK ALUMINUM STEARATE - ; Historically, Aluminum Stearates have been used for suspension in leo resinous paints. While there are other types of suspension aids now on the' ___________ - --...m _ * _____________ ..................................... - --i _ . j . * _ -i ? _ c t f f 11 i f * - -- ..r . Stearate based on the:weight of pigment is the recommended level. - MAGNESIUM STEARATE Magnesium Stearate is. used as a flatting a g e n t forpaints, varnishesand lacquer. You would use it in place oif the Aluminum where there ..was a concern, as to the:increase in .viscosity .in aging. In other words, the Calcium daes i not increase: viscosity as much as fhe Aluminum Stearate. Calcium Stearate _v jr can .be used as a .suspensionagent. Again^itsds, not,;as-;effectxye,;;a;s.the Aluminum-Stearate . > ..........." "*' * - - JTTY i is an ingredient ofjputtv. As an?ingredient in putty, it prevents bleeding and separation of the oils from the solids in the finished canned product. Paint and varnish-removers - as you.know, are-both liquid and paste or cream consistency. Remover - is theAluminumStearatecan be used to body the paint remover and retard:-the evaporation. Printing .inks - 0 ' you will, find here that there is a-higger potential per gallon'..usage for the use of Aluminum Stearate, as a bodying agent. Also used as water proofing . aids in this. area. y LACQUERS Zinc Stearates are used extensively in sanding sealers in the;lacquer_ _ industry^ Zinc Stearates assist in the penetration of ret pores. It is colorless and we particularly recommend our #2310 - this is a non-blooming zinc stearate, stir in.grade. v0i .i:'-f1 ,30kb t! fi Fhenolics Calcium Stearate Zinc Stearate Polystyrene Polyethylene #1345 #904 ' . - There is very little usage of Stearates here, occasionally someZinc for lubricity. -."--^"' Pblprdpiene^ ^ . .^ ........... .............. 1-------------- -- Calcium Stearate ,, #1345 ', Zinc Stearate . #2304 - recommended to`improve pigment , , dispersion ; ABS^xesins .. - -r - t --- Polyesters Zinc Stearate #904 - ' - . . CVailncyilum' Stearat*e* * ' #2286. , '` '` : This is a very specialyzed area of Stearates. I am going to list below recommendations, however, you will find with most- viny1-manufacturers that . they use what are known as vinyl stabilizers Vinyl stabilizers are in actuality metallic soaps both in 1iquid and powdered form. ' Inpractically .. .11.cases" they a r e .blends of several metals ,, Primarily ,- Bariura, Cadmium.. ; and Zincs xtfith some use of leads a n d s o m e o f C a l c i u m . While::these are . technica1.1y,Steaxates^^hey--are-marketed-as--vinyT.^stabili-zers-and^i-t--is---- :--- a very, very?specialyzed area. In raany-cases the stabilizers are custom mixed by ...the manufacturer for the, specific requirements ;o f t h e particular vinyl plastic manufacturer. Your competition in this particular field vjouic. . be Nuodex, Argus, division of -Witco, Ferro, and/Advance -, division of - Carlyle Chemical, however, for the record, here again is a rundown of . .possible recommendations. . .. * In rigid, vinyls: .. -- '. " . 1 ;; ___ ,,Calcium .Stearate_____ . #1345_______ . !* ...... ......... ..... _.i 'Z~...l^IiPlasti3bls---- ,------- ;------- --------- --^-- -- -- --- --- -3-- ;-- -3 - . Aluminum Stearate #907 - used as a =vicosity ^modifier :4 Aluminum Stearate #914 - used as a '.pre-gel i n ;OOP Plasticizers i ....... Vinyl"'Film * ", #2314 Cadmium Stearate-serves as a~light ... j . .. . -stabilizer . - Barium' #902 for .long. term.,heat I - Zinc . #2304 for early.-color,.hold -, ; As I mentioned earlier by and large these are blended by the chemical manufacturers. I trust this will give you a start on your Stearate ! rograra. , . . . * `; ,j ; i\ STEARATES The people making Stearates would be Parsons-Plytnouth, division of C o m Products, Witcd Chemical, Harshaw, Mallinckrodt, Nopco trade name Metasap, liuodesr divisioti o^J!enn&ct> and American Cyanamida .d f aIo dweoxuHldy hiomhaagsi^nLe rtehaeio n a l office and warehouse facilities throughout the Southeast and Nopco, who make some of their Stearates in Cedartown, Georgia. Overall, Witco is probably the strongest on a national basis. You will find the other people popping up in various areas. American Cyanamid is probably the smallest and generally make very little effort on their Stearate marketing. There is one other Synpron, from. Cleveland, who are known primarily as price cutters. Whittaker Stearates are manufactured to our specifications in Newark, New Jersey. I have put together a cross-index showing the Whittaker Stearates and the competitive numbers. . yu asked specifically for general rundown on usage in the plastic industry the following should give you a good starting.base. ensive "use^ in plastics. ~Zinc", Calcium and-Aluminum are. used as internal and-external'lubricants. T h e y a c t a s mold release agents, general processing,aids, catalysts, scavengers, flatting agents, stabilizers -and gelling agents. The main usage is as a lubricant; to- .improve .melt flow but more important to aid in mold release. Calcium, Magnesium and Zinc Stearates serve these purposes. Zinc-is used because of its inherent high lubricity. One would use Magnesium or Calcium when the need for^higher-melting .point justifies a sacrifice in lubricating efficiency.-- ---------------- -- .....-- ---- The point of lubricity is not only for better finished plastic .product but to minimize wear on the metal molds. The Stearates are added to the mix in mostreases and is usually about 1% Stearate based on the weight of the resin, however, this can vary from 3/4 to 1% to 2%% depending on demands. I will list below the various types of plastics and suggested Stearates to be used. _____ ^STABUSHED1800 Dry Oil } Product Bright- Absorption Through i Number ness (Rub-Out) 325 Mesh Hegman Fineness pH Specific Gravity (201)561-6100 CABLE "S L 6 IN A D " PRODUCT DATA -- Descriptions Applications ! . 5 86 22 98.00 1.5 9.8 2.80 Crypto Crystalline G-1-2 CCMO 91 32 96.00 7.7 2.70 U S.P. Lo-Soluble Salts ) G " \! 128 89 29 89.00 7.7 2.70 U.S.P. Lo-Soluble Salts V Pencil & * 141 9 2 + l 38 100.00 5.0 7.7 2.70 U.S.P. Lo-Soluble Salts J Toy Coatings ?! 150 67 29 95.00 2.5 9.0 2.78 Feathering-Sanding I 367 60 24 96.00 2 9.6 2.90 Low Cost-Off Color j 399 92 + 50 100.00 6.0 8.7 2.70 Easy Dispersing S 462 84 35 99.00 3.5 8.5 2.85 Lo-Soluble Salts cn con 88 26 99.00 2.5 9.5 2.80 Crypto-Crystalline I 971 87 26 99.00 3.0 8.7 2.76 Platey 8-9 8-9 G-4-6-7 G-8-9 G-2 G-1 ! 1196 87 36 100.00 5.5 8.5 2.65 Low-Micron G-3-4 js 1313 92 + 34 99.00 3.5 9.0 2.88 Soft - Platey I1i! ' ` !? G-1-5 1 1726 90 ! 1731 91 42 100.00 4.5 8.0 2.58 Soft -Platey 38 100.00 6.0 8.6 2.70 Easy Dispersing G-1-5-7 G-1-3-4-6 ITM I 2131 1I 2610 i 2620 2755 j 2789 60 87 92 84 92 89 27 99.00 2.0 9.3 2.80 Platey Low Color 26 99.00 3.0 8.3 2.70 Platey 51 100.00 6.5 8.8 2.70 Platey - Low Micron 28 100.00 4.0 9.0 2.70 Fine White 50 100.00 6.0 8.5 2.70 U.S.P. Low Micron Easy Dispersing 29 98.00 3.5 8.5 2.76 Platey G-1-3-6-7 G-1 G-4-6-7 G-1 G-4-6-7 G- j 2794 92 27 99.99 4.0 8.3 2.70 Platey G-1-3-6 j 2798 92 39 100.00 5.5 9.5 2.70 Low-Micron G-1-3-6 J 4404 88 40 99.80 5.5 9.5 2.70 Platey G-1-5-7 jI 4416 86 40 99.90 6.5 9.5 2.70 Platey G-1-5-7 * .........**---- - CODE FOR APPLICATIONS G GENERAL 1 EXTERIOR PAINTS 4 VISCOSITY AND GLOSS CONTROL 7 INTERIOR PAINTS 2 CAULKING-PUTTY S INTERIOR EMULSION PAINTS 8 AUTO PATCHING COMPOUNDS 3 PRIMER-SURFACER 6 SEALER AND UNDERCOATS 9 ASPHALT EMULSIONS The above information has been carefully prepared and we believe it to be entirely correct. However, it is furnished gratis for your guidance only and is without guarantee. WHITTAKER, CLARK 6 c DANIELS, INC. 1000 COOLIDGE STREET SOUTH PLAINFIELD, N.J. 07080 TELEPHONE: 201-561-6100 i `AH W H ITTA K ER , C LA R K & D A N IELS, IN C. M A R K ET IN G GUID E for WC&D M A T E R IA L S ( Ju lia R . Bonechi AAAKBPXKY CF-B LL-1 Rubber ~ high loading with little lo ss of so ftn ess, elongation or resilience Putty ca u lk s and se a la n ts (low b in d e r demand and good co lo r) Joint cem ents P a p e r (high brig htness and d u ra b ility on aging) A dh esives and carpet backing Precipitated - C o sm etics, pharm aceuticals, paper C A LC IU M H Y D R O X ID E - p la stic s, cem en ts, am m onia reco ve ry in gas m anufac. tu re , hard rubber p ro ducts, food additive a s a buffer neu tralizin g agent C A L C IU M S U L P H A T E - f i l l e r in p a in ts, m o ld s, polishing p o w d ers, nutrient supplem ent, dyeing and ca lic o p rin tin g , m etallurgy (reduction of z in c m in e ra ls) - U S P grade used in tablets as binder f ille r C H A L K (W hiting) - E n g lish w hitings have long been noted fo r q u ality and c o n s is tency of classificatio n - freedom from hard p articles renders them n o n -a b ra siv e to m ild s t e e l. P a p e r - low a b r a s iv e n e s s of w h iting fin d s p a r t ic u la r u se when good cutting p ro p e rtie s a re im p ortant, e a sy to d is p e rs e , good d u ra b ility in fille d p ap e rs, foam ru b b er, oil and alkyd based p ain ts, ad h e siv e s, linoleum C L A Y (K A O LIN ) - C alcined - paints, in crease titanium efficiency Hydrated - paper filling (sm oother, w h iter, b rig hter, m ore opaque sh eet), paper coating (sm o o th n ess, high g lo ss, high b rig h tn e ss, good o p acity , e a s y w a te r d is p e r s ib ilit y ). C e ra m ic s - (p la sticity and low shrinkage) Rubber - reinforcem ent, im parts stiffn ess, tear resistan ce, h ard n ess and abrasion re sista n ce E le c t r ic a l insulation - calcin ed c la y reduces tack in ess and im proves p rocessability Reinforced p la stics (in therm osetting polyester) C O L O R S - Lam p b lack - th is pigment p o s se s se s excellen t heat re sista n c e and is p erm anent to lig h t, a c id s and a lk a lis . T h e ir p h y sica l and FU N CTIO N A L PIG M EN TS M AJOR REASO N S FO R U S E A LU M IN A - Calcined - ceram ics (brake lin e rs, nose cones, kiln furniture, burner elem ents, cru cib le s, e tc .) H ydrated - extender and f ille r pigm ent in a d h e siv e s, rubber, in k, paints, paper, p lastic, co sm etics and d e n trifice s. D esirable p ro p e rtie s a re p u rity, high b rig h tn e ss, a v a ila b ility in subm icron s iz e s , f ir e retardant c a p a b ilitie s , good d is p e rs ib ility , low co st, and rein forcin g q u a litie s. A s a s p a c e r fo r titanium dioxide. T ab u lar ~ re fra cto rie s, e le ctric a l, in sulato rs, kiln furniture, p la stics, sta ir treads, silicone, rubber fille r. A N H Y D R O U S C A L C IU M S U L P H A T E - f ille r in r e s in compounds of p o ly e ste r/ fib e rg la s s type and a s an extender in com bination with high strength p rim e pigm ents in paint s y s t e m s . A s a nutrient in d ieta ry fo rm u la tio n s, A s a f ille r in the p rep aration of p ill and tablet coatings, etc. i ! i B A R IU M S U L P H A T E - used in paints s p e c ific a lly in d u s tria l. A lso see B A R Y T E S and B L A N C F IX E B A R Y T E S - u n d e rco a ts and p r im e r s (good build and holdout), c h e m ic a l r e s is t a n t co a tin g s. F lo o r coatings - linoleum and com position flooring (highly re s is ta n t to a b ra sio n and heavy tr a ffic conditions) R ubber - im p arts w eight and film toughness C e ra m ics - glass 'j ;i ; B E N T O N IT E - G ra n u la r - w aterproofing of po o ls, ponds and b asem ents, p u rification flocculation of liquids ; j Powdered - refracto ry (lining), foundries (binder), d rilling mud, cem ents and p lasters as p lasticizin g agent. "" U . S . P . - c o s m e tic and p h a rm a c a l a p p lica tio n s - b a c te r ia co n tro lle d B L A N C F IX E - used as pigment extender fo r paints and printing inks W a te r p ain ts - good o p a c ity , in e rt to a lk a lie s - lig h t and heat photographic paper - use as substrate for d yes, f ille r for rubber, linoleum o ilclo th , r e s in s , p o lym eric fib e rs and storage battery plates , C A L C IU M C A R B O N A T E - d ry ground and w a te r ground - p ain ts, su rface coatings and p la stics (low binder demand, reduces chalking ra te , color re ta rd a tio n of tin ts , in c r e a s e s m old r e s is ta n c e ) good im pact r e s is t a n c e ; e le c tric a l c h a ra c te ris tic s make them valuable fo r the m anufacture of a r c ca rb o n s, b ru sh e s, and r e s is t o r s . T h e ir high tinting strength and hiding power (alm o st com plete absorption of v isib le light) en hances th e ir use in such products a s b lackb o ard s, leath er goods, cra y o n s, and cem ent, as w e ll as p ro tective and decorative coatings, in k s, and p la stics U ltram arin e B lue - p la stics - u ltram arin e blue and violet a re used in p la s tic ap p licatio n s a s co lo ran ts - th e ir re s is ta n c e to light and heat as w ell a s in solu b ility m ake them highly acceptable ........ .... -......A ls o e a s e o f -dispersion-^-- --------------- - .... . ................... . .......... Prin tin g ink - reg u lar as w ell a s sp e c ia lly treated ultram arin e fo r lithographic and off-set inks (hydrophobic & oleophilic) Paint - ease of d isp ersion - heat stab ility - clean bright co lo rs acid resistan t grade available for sp e cific paint form ulas La u n d ry pow ders and b le ach e s - good a lk a li s ta b ility - good r e s is tance to ch lo rin e and peroxide (in the c a se of b leaches) excellen t d isp e rsio n . O ther uses - rubber paper coating - p lastic flooring - sugar manu factu re - crayons (wax) - pencils - leathercloth - roofing granules C o sm etic - organic - these a re ce rtifie d by the F D A as meeting p u rity standard s fo r use in drugs and c o s m e tic s . R e ferred to as c e rtifie d D & C c o lo r s . U sed in co sm e tics only and not around . the a re a of the e y e s . Do not confuse with F D & C co lo rs used in food. C o sm e tic - Inorganic - these a re p urified iro n oxid es fo r u se in makeup products, lo tio n s, powders and tab lets. U ltram arine blue, iron blue, chrom ium green hydrate, chrom ium oxide, carbon b la c k ,a r e a ls o found in th is categ o ry C R A YO N S - "Clover Brand" soapstone crayons are a natural cut talc for use by m etal w o rk e rs to m a rk ste e l w ith a b ility to w ithstand heat of an acetylene torch without destroying m a r k s . C U S T O M B L E N D IN G - co n tro lled blending of d ry w hite pigm ents to cu sto m e r sp e cifica tio n . T h is does not include c o lo r s , fra g ra n c e s , p h a rm a ceutics o r toxic substances. Exam p le: S te a ra te & T a lc blend Controlled density blends of calcium carbonates, etc. F E L D S P A R - P o rcelain insulators C e ra m ic products - d innerw are, pottery, plumbing fix tu re s, flo o r and w all t ile , e tc. P o rcela in enamel - such as enam el f r it s , enam el bathroom fixtu res, ranges, etc. ........ G la s s products - window g la s s , plate g la s s , fib e rg la s , g la ss bl o c k s , gla s s - t ub ing , g la s s b o ttle s, e t c . ---------------- _ _ ------------ - Foam latex - f ille r in carp ets and fu rn itu re padding . A b ra siv e C le a n e rs - Bon A m i, cake soap , window s p ra y s , etc. P la s tic s applications such as P V C , epoxies and p o lyesters FLIN T - a graded o r powdered quartz used w here a controlled p article siz e is required as an abrasive o r inert fille r ' F U L L E R S E A R T H - F ilte rin g operations (to d e c o lo riz e , c la r if y , n e u tra liz e , d eo d o rize, and rem ove taste) o ils d istilla te s p etro latu m s, vegetable o ils , pesticide c a r r ie r , refining and reclaim in g o il H YD R O M AGM A - is a trade nam e of M erck & Company for m agnesium hydroxide p aste fo r use in m anufacture of m ilk of m ag n e sia KA O LIN - a lso re fe rre d to a s c la y o r alum inum s ilic a te . Used in pharm a ce u tics o r co sm etics as a m edicinal kaolin suspension agent o r f i l l e r in powders o r ta b le ts. A v a ila b le in N . F . and b a cte ria con trolled state. M AG L I T E - a trade name of M e rck & Company fo r th e ir sp e cia lty grades of m agne.sium oxides fo r th e ir use in neoprene ru b b e r, p la s tic s , - paint, adhesives, o r steel. M A G N ESIU M C A R B O N A T E - the technical light grade is sold under trade name " M a g ca rb ". P u rifie d grade m eets N . F . sp e cifica tio n in light and heavy density. M A G N ESIU M H Y D R O X ID E P O W D ER - purified grade fo r use in an tacid, te ch n ica l g rad es fo r use in p la s t ic s . Sold under M e rc k trade nam e "M arinco" .M A G N E S IU M O X I D E P O W D E R - in lig h t and h e av y g ra d e s f o r p h a rm a c e u tics U S P quality. Tech n ical grades see M aglite. M A G N ESIU M S IL IC A T E (T a lc) - P ap er - talc products produced from appropriate o re s and ground to optimum p a rtic le s iz e provide h ig hly useful high brightness fille rs for paper m anufacture. P artia l replacem ent fo r titanium dioxide. Th e hydrophobic nature of talc m akes the u ltra fine grades efficient pitch a d so rb e rs. | ........... P ain t - ta lc pigments a re n o rm ally self-su sp en d in g in paint v e h ic le s . T h e y a s s is t in keeping asso cia te d pigm ents a lso susp ended . T a lc d isp e rse s with rela tiv e ease in m ost paint v e h ic le s . C e rtain ta lcs im part flatting effect that can be used to control g lo ss of enam els --- fepee i f i c a lly U f a f t Q - l o ^ m i c r o n M a g n e s i u m S i l i c a t e S . F . ) . B o t h ______ a c ic u la r and platy ta lc s im prove bonding p ro p e rtie s, film toughness and d u rab ility of p ain ts. P laty ta lc s are e sp e c ia lly p rized in m etal p rim e rs due to t h e ir e x ce lle n t sanding p ro p e rtie s - in top co ats due to th e ir contribution to b urnish re s is ta n c e and good s c ru b a b ility . T ra ffic Paints - latex paints - house paints - industrial undercoats and stru ctu ra l steel p rim e rs . C e ra m ic s - ta lc im proves the d ry p re ssin g and other operations used fo r form ing ce ra m ic bodies - p erm its fa ste r firin g schedules at low er tem peratures. j! j i P la s t ic s - ta lc is a rein fo rcin g f ille r in p la stic com p ositions | E le c tric a l w ire insulation, sheeting, re frig e rato r gasketing, vinyl asbestos tile ' ; C o s m e tic s - the u tilizatio n of ta lc s in co sm e tic s ranges fro m dusting powders (200 m esh) to m icro -fin e talc designed fo r aero so l a p p lic a tio n . ; ; Rubber - dusting of unvulcanized rubber to prevent su rface sticking M A R B L E (F lo u r-D ,u s t) - th is pigm ent is s im ila r ly used to C a lc iu m C arb onate (as p revio u sly reported). It is actually ground m a rb le , a m etam o rp h ic, highly c ry s ta llin e , carbonate ro ck that is eith er high ca lc iu m o r dolom ite in n atu re. Used in p ain ts, putty, c a u lk s , a d h e siv e s, and joint cem en ts, M ICA - w a llp ap er and coated pap ers (im p arts a s ilk y o r p e a rly lu stre ) ; \ : { ; ! : N acreous pigments - m ica is used as a flake substrate fo r coating with v a rio u s m etal oxid es to obtain p e a rle sce n t e ffects in v e h ic le s . Rubber - dusting to overcom e tack in ess (mold re le a s e ), d ry lu b rica n t - in tir e production (vulcanization) | : P ain ts - e x te r io r (re d u ce s penetration) red u ces running and sagging. P rim e r s & m etal coatings - to reduce m o istu re penetration Alum inum paints - to rep lace a portion of the alum inum flake S e a le rs (reinforcing action) T r a f f ic paints - w e a ra b ility , good ad hesion, reduced crack in g W allboard and joint cem ents - reduced shrinkage and cracking Texture paints - reduced cracking adds stab ility and firm n ess M astics - P la stic s - Block fille rs M IN E R A L C O L L O ID - A lb ag el h y d ro -p u rifie d inorganic co llo id ap p licab le in the m odification of aqueous s y s te m s . T h e se products a re useful in the p rep aratio n of dilute w a te r su sp e n sio n s and to obtain the g reatest degree of v is c o sity and thickening with the m inim um of so lid s. A lbagel P re m iu m - is s p e c if ic a lly prepared to m e e t the U . S . Pharm acopoeia specification fo r bentonite. Albagen - hydro-p urified inorganic colloid of lim ited reactivity. T h is product has unique c h a ra c t e ris t ic s . Its lo w er alkaline reaction a s s u r e s a m ore uniform constant b eh avio r. It overcom es objectionable use of products which release considerable amounts of fre e sodium ions w hen h y d ra te d . T h e lo w e r pH range is an attractive consideration. T h e se co llo id s a re used a s e m u lsifie rs in c r e a m s , film fo rm ers and b in d e rs, a s a penetrant, dem ulcent and pro tective co llo id , d e ssica n t, acid n e u tra liz e r and buffer - foam s t a b iliz e r . C la rifie s ^ sorbent - lubricant - thickener . Bentolite " L " - low iro n , low v is c o sity , white ca lciu m bentonite, excellent white firing ce ra m ic p la stic iz e r. Gelw hite - low v is c o s ity suspending agent for aqueous sy ste m s. Gellant, th ickener, em ulsion sta b ilize r. Excellen t color - catalyst P Y R O R H Y L L I T E - th is is ch e m ic a lly a c la y but has the appearance and physical properties of ta lc . The principal use is as a c a r r ie r for ag ricul tu ra l to x ica n ts. T h is product is a lso used in w a te r p ain ts, d ry w a ll p lastics and as a f ille r for p la stics. Q U A R T Z (S ilic a ) - see cry sta llin e s ilic a for applications S E R E C I T E - low grade m ica used fo r dusting. M ain ly is used in som e of the applications reported fo r m ic a . S IL IC A - Amorphous - Paint - Hat paints, u n d ercoaters, paste wood fille rs (easy brushing im proved adhesion) flo o r paints, deck paints (good w e a r re sista n c e and an tislip ) P la stic s - (p olyester and epoxy) Ela sto m e rs (polyurethane, silico n e rubber ) ad hesive, to iletries ___________________(toothpaste I__________ ,______ ________________________________________ ______ C e ra m ic s - g la ze s, e le c tric a l r e s is to rs , in secticid es (com patible carrier) C ry sta llin e - latex paints - increased sheen, uniform ity, improved burnish re sista n ce , excellent flattening c h a ra c te ris tic , excellent w eathering, brushing and leveling . U nd ercoats - h a rsh textu re im p a rts tooth w hich a s s is t s in bonding T ra ffic paints - (w ear re sista n ce ), silico n e elasto m ers (sem i reinforcem ent, rubber sealan ts, coatings, adhesives S O A P S T O N E (T a lc) - is a greenish gray c o lo r. It is ch aracterized by a soapy feel. ' S T E A R A T E S - the function of m e ta llic ste a ra te s depends upon th e ir p hysical and ch em ical p ro p e rtie s. M ost of the m any u ses of these compounds can be attributed to one o r m ore of the following b a sic c h a ra cte ristic: 1 . G e llin g actio n in hyd ro carb o n so lv e n ts and p e tro le u m , v e g etab le, and anim al o ils . 2 . S u rfa c e active and related e le c tric a l pro perties 3. Vaster repellant ch a ra cte ristics ' . 4. Lubricating action 5. P la sticizin g action 6. Covering and adhesive q u alities P la s t ic s - P h en o lics - z in c and ca lciu m stea rate a re used in phenolic molding compounds. P o lystyre n e - in .polystyrene zin c stearate acts a s a lub rican t and color dispersing agent. Polyethylene - im proved mold re le a s e and le s s down tim e Polypropylene --a s a lub rican t and pigment d isp e rsan t A B S - m agnesium and calcium stearate for A B S molding compounds Rigid P V C - calciu m stea rate - internal and external lu b rican t, prevents sco rch in g in pipe extru sio n P la s tis o ls - alum inum ste a ra te - g elling p ro p e rtie s e ith e r to m odify v is c o s ity o r to form p la stig e ls. C a lc iu m s te a ra te - v is c o s it y m o d ifie r and m old r e le a s e - good heat stability Reinforced p o lyester - calciu m and zin c stearate to fa cilitate mold re le a s e , le s s m achine down tim e - m in im ize su rfa ce bloom p re v e n t-lo ss -of-adhes ion--------------------------------------------- ------------------- P a in t, v a rn ish and la cq u e r - in coatings alum inum s te a ra te aid s in susp ension of asso ciate d pigm ents and control flow - effective a s flattin g a g e n ts . In san d in g s e a le r s th ey w eaken the film to make it e a s ie r to' sand and lu b ric a tin g the sa n d p ap e r to p re ve n t it from gumming up. W aterproofing - m e ta llic ste a ra te s are highly w a te r repellent and th e ir fine p a rtic le s i z e , high bulk and la rg e s u rfa c e a re a m ake them efficien t waterproofing agents. Cem ent w aterproofing, waterproofing cordage o ils and m asonry coatings Rubber - z in c ste a ra te is a good lu b rica n t fo r ru b b er com pounds. It is .an.e ffe ctiv e dusting agent to.p re ve n t uncured s to c k fro m ......-...... stickin g together. Being soluble in rubber at elevated tem p eratu res it w ill be absorbed in the ru b b er during the fin al c u r e . M etallurgy - zinc stearate as a lubricant C o sm e tics ~ zin c stearate is w id ely used throughout the industry in face pow ders, p r e s s c a k e ,. dusting powder, c re a m s and m akeup sp ecialties. Food - .a s conditioning agent to prevent caking and to in su re fre e flow of hygroscop ic p o w d ers. A s a lu b rican t o r die re le a se agent in tableting p re sse d ca n d ie s. P h arm aceu ticals - tableting lu b rican t. Z in c stearate as a nutrient in d ie ta ry food su p p lem en ts. G en eral use in textile com pounds, wood p re se rv a tiv e s, a r tific ia l le a th e r, c ra y o n s, w a x e s, in k s, s ilk sc re e n and m askin g , b ric k s , tile , adhesive paper coatings TA LC see listing under M AG N ESIU M S IL IC A T E T E L L U R IU M - a seco n d a ry vulcanizing agent in rubber T E R R A A L B A - see listing under C A LC IU M S U L P H A T E TITA N IU M D IO X ID E - purified g rades m eeting specifications fo r C T F A , N F and U S P . F o r use in p h a rm a c e u tics, c o s m e tic s , food products. TR IP O LI - a b ra siv e com pounds, fuffing com pounds, buffing w h e e ls, scouring soaps and pow ders, polishes (hard n ess) suitable p a rticle shape and p o ro u s, auto polish . V O L C L A Y B EN T O N IT E - see listing under B EN T O N IT E W HITIN G - see listing under C H A L K Z IN C O X ID E U S P - fo r use in p h a rm a ce u tics and co sm e tics TALC USE ENCYCLOPEDIA AmIbpteobiinlmsrieasurashasirviertooeedgdssia:ctblaasyiolnlhylfea,osrrdstateulsrcmteaibesbllEriunaavsgsneeidnvdspectthsfeot.ortupgagilivahnestemitxhcetserteatfmhlinaaeatllllywohyoisgsuo.hlfdt Typical TaGPlcorswa:nduelraerd:: 6216786, , 12640008, 486, 3016 Amradatehn.eysityvpese:s of adhesivesTtaolciniscruesaesde athsea sfpirlleeardining Typical Talcs: 11, 367, 399, 2407, 2426 "After-Shave" Powder {cosmetic): See "Face Powder Agricultural Dusting: See "Insecticides' ATarltcC(awrhviitneg,s:green, grayU,seblmacaks)sivWe oBndloecrkst.oonr eL. ava AarenrsdtistPotaonrttecederuyct:oe cfriraiznigngt,emtBopoerderyadtucucoreme.mpooniesntut rteo einxcpraenassioen Typical Talcs: 786, 783, 610, 1772 AtortpirfeicvieanltFsltoicwkeinrsg: and tUo seexdtetonddtuhset tthinetisntgamcoenlorsso. as Ainrgt isf ui crifaalc eF.r u i t : Used as a filler and for dust Typical Talcs: 5, 618, 1600, 2401 Aritthifiacsiaal fLileleatrhaenrd(palsasatidcuvstiinnygl caogeantitn.g) Used 'Topical T aDlcuss:ting: F iPLlloeowr-:Mdeircerdo:n 2346276, 150: types: 11, 1648, 2407, 53,991,3201,3. 06,1489,02401 AspshuaplptliCeodawtinitghsg(upaariannt)t:eed ignitjion loInses ritffrilelqeur.estCeadn. pppical Talcs: 367, 470 1367, 1371 Asphalt Packing: Inert filler 'Topical Talcs: 470, 1367, 1751 ApsopwhadletreRdotoaflicngfo: r pound. garner specificatio backinICngo.earrtsfeiltl^elrc for and surfacing, parting com n. Generally processed to cus- (pppical TaGPlcorswa:nduelraerd:: 396473,, 11776513, 1769 ^fephalt Shingles: Inert fill er and parting com- p&und. Topical Talcs: 1076, 1372, 1769 /jjsphalt T iles: Inert filler and parting com* paund. typical Talcs: 367, 470 iBeanbt.y PSoewledcetersd: on basis Uofsepduraistyt,hesopfrtinnecsispaalndincgorelodr. 11T77y35p65i.,ca2l40T6a,lc6s4:7, 7, 4611,, 11262225,, 84,546,186, 437,661, 60204,27, Bieanrtbienr pSouwpdpeliress. (cosm etic): Principal ingred' Typical Talcs: 4, 5, 618, 2401 Battery Boxes: Inert filler. Typical pyrophyllite: 29, 15 wtBoiimtthuemar.ingouuasraCntoeaetdiniggsn:itioInnelrotssfililferre-quceasntebde bsyupcpulsied Typical Talcs: 9, 367, 470, 1367, 1836 SBeoldeyctPeodwodnebrsa:sis of purUityse,'dsoafstnpersins caipndalcionlgorre. dient. T7162y6,p,i2c44a02l7-T, aS6le4ce*3s:,157,Py23ro2p, h41y,6llli1,t6e425, , 2445046,, 21460063,, 11622042,, /I'g%rK> ^ Boiler Coverings: Used as filler. Typical Talcs: 367, 9, 150 Book Binders: Dusting tp dry pastes and inks Typical Talcs: 406, 11, 1514, 2402, 637 l "'j^2#iTalcs: f-^ ^ B a c k i n g s : Inert filler and tumbling. 5. 783, 618, 1600 See "Pulling Cable". Filler in pacte to stiffen and ales: 5, 1750, 1163, 637, 2402, Int: See "Surface Coatings". ( jffiqfi1^)O-Smpounds: See "Surfac^ Coatings". See "Refractory Cement". ^xh&r' See ""D""""""""CSWHKHSEARiantolioeerealgenotabfnalcgeklrtbtPrateiiFyIwTrntocrneiiugittIjsc"ssltoart"eaeucnsrWr"rlee"lyiyaltIaau(t"nCrosiresneeer"u)smm,1l"aeiet-ntopctrso.s"r"" i ` jjaTfll 'l ^ not u--fsleodo rbyti lme ,a ne--utcfa. c tu r e rs 1 of vitrified (Meals: and use. Selection depends on customer % 461,ale1s1:, 367, 9 f 232, 454, 4^i2, 618, 150, 5, ?/<? < UJ vCehnetwsitnigckGinugm. (Uta.bSl.ePts. ):is generally spDecuisftiiendg. to p re Typical Talcs: 1, 662, 1755 Cleaning Compounds: Filler and extender. Typical Talcs: 160, 1751, 2402, 2425, 3016 Coated Papera and Paste Board: See "Paper" Coated Wire: See "Wire". Color Pigments: Inert filler and extender. Typical Talcs: 454, 490, 399, 1625 vCeonntfestcitcikoinnegr.y Products: Dusting to pre Typical Talcs: 1, 662, 454, 1625. iCnogorkeidnigenWt taorein(ccereraamseicr)e:sistance to hUeaset dshaoscka. body Typical Talcs: 486, 11, 481, 1736 Cordage, Twine: Lubricant and filler. Typical Talcs: 5, 367, 783, 11, 2401 Cork Products: Dusting molds, lubricating. T16y0p0i,ca6l6T2,alc1s6:25, 1750, 460367, 483, 367, 150, 9, 1, ^meticst """"""SS"""RPLLBBBFCeeeeaooaioaarqncubtder""iuegabyyoAFiCmeednaPPPf"arstcsookoPe""eSwqw\rpjIu-"wdPddSpeeeohdprrrweal"""irved"ese"rP" owder" Crarykooinnngss:u- nadlel rs"taSnpdeacrida.ltCieSLseO"e.V"ESRoaj;Bpsratonndef"o(rTmalect)al /earns (cosmetic): Used as a filler or extender. Topical Talcs: 1, 662, 122, 1625 n Mid teaxl tSenudpeprli.e s: Investment casting, as a filler ^p /fe iac ad ul sTtianlgc sp:o w d er, U.1S5.0P, . 13, 118,6662, 1222, 1755 * '{-^^nkdrnteeocrfrwebaaosrdeey t(tesonedimneicn-rcpeyoarstcoeeclrareaisnzisect.aenracme itcosb):eat sChoocmkpaonndent "Typical Talcs: 786, 783, 610, 1772 ^?^#uwgds:ers anCdalriqriueirdsa,ndLduilbureincat notf icnhteambliceat lms ainnupfialclstu, re. i/f$y0p2i,ca1l 7T5a5,lcs1:222, 1640,45243,2,66l2j,.031,62651,8,122,40469,0,2427 aaDcsucstootrindugisn,eg.Mtoiscceulsltaonmeoeurss: pe. cifications;Cvaanrybewsiudpelpylied T17y3p6i,ca3l 9T9a,lc1s*1.53, 367, 41,, 51,62157,501,60106,0,64234,016,771,3687, pEolneecntrtictoalimInpsruolvaetodrsi:-electric propertAiess.a body com Typical Talcs: 486, 1211, 1736, 2786, 5486 Enamel: See "Surface Coatings". Engraving; Dusting Typical Talcs: 643, 1603, 486, 11 Exter minating; See "Insecticides". Fabricated Plastic Products; Used as filler. Typical Talcs: 399, 461, 4, 1648, 2403 Face Powder: * Major ingredient. T24y2p7i,ca1l7T29a,lcs1;600, 7, 1614,0,1612155,3,1620460,6,1611620,3,6487., 618 Fats (edible): Filtering Typical Talcs: 662, 1, 1755, 647 Felt: Used as a filler. Typical Talcs: 150, 783, 367, 5. Fertilizer: Used as carrier and diluents. Typical Talcs: 367, 1750 /) fik>re Board: Used as filler. Ep Vf 1i c15a3l Talcs: jS 367, 13, S43, 1648, 1750, jfZz$^tL'teenrds ,allMtyispceesllaonfeporuosd:ucts. Used to fill and / T#o0p3i,ca1l 1T53a,lcs5:,. 367, 17510,, 12642051,, 329490,8,49206,761,60128,36677, jQ^fsletrnattiiaoln:oils and drugs.Used to filter perfum es, Topical Talcs: 454, 162Ej, 1,, 2407, 2426 fy/tiishing (textiles): F ille r, dusting to dry inks. f'y pical Talcs: ^42 150, $77,| 486, 164S, 2441, j ^oors, Magnesite: Used as filler. ^pical Talcs: 367, 175Q, 9, 1153. ods: Yi/pical Talcs: P23o5li,sh4i5n6g,!;?g1r6a3i5n s . / Dusting of confections.: * 'Topical Talcs: 1, 662, 1625, 1755 Extenders Topical Talcs: 1, 662, 399 j^otw ear (rubber and plastic): F iller and dusting. Topical Talcs: 367, 17S0, 1603, 399 Foundries: Used as dust m o l d facing, parting compound for core and lubricant. Typical Talcs: 367, 160, 1153 Fungicides: C arrier and diluent. Typical Talcs: 150, 367 GrersaipshtainteceC rtouchibealet ss:hockA. s an extender and to increase Typical Talcs: 11, 486 Greases: Lubricant extender. Typical Talcs: 367, 11, 1153, 399 Gray Iron Casting: See "Foundries". Gutta Percha: Inert Filler. Typical Talcs: 367, 399, 2405 Hats (felt body): See "Felt" . HcoematpoInnseunltautosersd (toceirnacmreicass)e: resistancPe rtionchiepaatl shock. Typical Talcs; 11, 486, 1772, 1736 Hobbyist (ceramic): See "Art Pottery". Hospitals: Pharmaceutical --see "Drugs' Talcum for dusting gloves and rubber sheets. T24y2p7ical Talcs: 454, 399. 662, 1755, 2406, ,jj ( printing): Filler and extender, Topical Talcs: 1514, 484, 399, 40, 1736, > 7 76 ^n-offs et: 4, 2403 n saeicrtpilcaindeesd: usting, em uUlssieodnassanda rhrainedr aspndradyilduuesntt- 'yi/pical TaSNWClcoeoseunr:sttththreeaerrlnan:s::tern: ,'22319967,75,01, 96,02,92,3263576,27401 l su lk e d W ire; See "Wiri )U sulation: Filler apd extender. '/ ^fpical Talcs: 367, 175 sulators (ceram ic): Major component part of body. 'ypical Talcs: Block or Lava - to be machined. Heat Insulators - --Typical Talcs: 486, 11, 481 Electronic Insulators '7"yp ical Talcs; 486, 121 1, 1736, 2786, 5486 Q ew elry: See "Precision Casting". <9$ Lava TaSlecm(wi-hgietme, sgcraerevne,dgfrraoym, bcolamckp)a.ct Block iKniclnreFasuernrietusriset:ance to hUeaset dshaoscka. body component to Typical Talcs: 11, 486, 461 Lacquers: See "Surface Coatings". Latex: See "Rubber", ALanavdvaaiflraIebnelseufrlooantmolyrslia:nmliinmaittieoUdnssqeuodarBnftllioatciwekss..or MLauvsat bTeaclco.mpact Lead Pencils: Filler and lubricant. Typical Talcs: 367, 150, 406, 8 Leather (artificial): Filler and dusting. Typical Talcs: 150, 232, 618, 5, 2401 Leather (natural): Lusting, sizing. Typical Talcs:* Linoleum: 232, 367, 399, 5,' 2401 Filler and dusting. Typical Talcs: 1750, 367, 618 Liquid Powder (cosmetic): See "Face Powder" Lotions (cosmetic): Typical Talcs: 1625, 1600, 1755, 12 Lubricant: Typical Talcs: 367, 1600, 1625, 11 fiVj($&B.bl& Iron Casting: See "Foundries" A y jicin e : See "Drugs". ,% t4 i Finishing: See "Abra*iives". //2^`-/ealvs:aInTsaolmc.e cUasseeds tocacCnaabrrveveehdmeafortdo1 jmlasrcdooefnmeinpdat.rcitcaBtleocdke- /^ ds: Dusting an 1lubricating. T/ 1^i.iical Talcs: 367, 1750, 11, 5. . uments (polishing): See "Abrasives" /Vi tician Supplies: Dusting po wder. T^ical Talcs 454, 1600, 1625, 4, 2403 Lubricant In nailing m achines '7/ical Talcs: 367, 150, 11, 1153 Cloth: F iller and dusting. Tjff ical Talcs: 367, 399 Q jb} See "F iltr; ttion". ^cfaoCmapkoe nMenatk.e-up (cosm etic): Used as princi- '7 V ic } cQ, a l 1 T 22 al 2, c s1: 1625, 1755 , 1602, 454, 829, See "Surfa :e Coatings". Oi iPma pp oe rr t a( fnicl lee.r ) : Color and softness being of T24y0p3i,ca3l6T7,alc1s7:50, 1153, 349896, 1731, 7, 643, 4, 1736, Paper Board: Filler Typical Talcs: 367, 1750, 232, 1153 iPsapgeernearnadllyP aimstepoBrtoaanrtd. (coated): ' Coating - color T17y3p6i,c a2l 4T04a,lc s2:424 399, 1731, 1625, 490, 1600, Parting Compounds: See "Dusting Agents". Paste: Filler and Extender. Typical Talcs: 367, 150, 5, 2401 Pencils: See "Lead Pencils". Perfumes: . See "Filtration". Petroleum Refining: See "Filtration". Pharm aceutical: See "Drugs". Phonograph Records: Filler Typical Talcs: 406, 677 Pitch: See "Asphalt Compounds" Plastics: Filler, dusting, polishing. Typical Talcs: Filler: 367, 399, 11, 130 2T4u0m8,bli2n6g76{polishing): 1600, 643, 1153, porcelain Insulators: Body component. typical Talcs: 481, 1211 Alo-etdteucrey :tendency to crazeC.omponent part of body to 'Topical Talcs: 783, 78$, 610 <pMJhrieoxccekids. iwo nitha npdl aCs teenrtrtiofuignaclr eCaassetiRn ge sCisotamnpcoeuntod:h e a t fypical Talcs: printing Inks: 380, 486, 11 t See "Ink". s/-tboilnleingto Cgaivbele:added slipU. tility cjompanies use soap 'J'ypical Talcs: 367, 15j)ji Putty: Im proves slip under ]cnife. 'T'ypical Talcs: 150, 11 1153. RReesfirsatcatnocrey tCo ehmeeant ts:hockC. ompon ent m aterial to increase ' Typical Talcs: 481, 11, 486, 1772 Rmeaftrearciatol rtioesin(ccreeraasmeicr)e:sistance to heaCtosmhpoocnke. nt body /'ypical Talcs: 11, 160 481, 1736, 486 O f) Rice: Polishing. Typical Talcs: 235, 456, 1635 RsuopopfliCeodaaticncgosr:ding to cuFsitollmereransdpedcuisftiicnagtio-ng. enerally Typical Talcs; SPGeorewan"duSelpraeerd:c:ialt41ie38s63"8, , 417307,1 1768, 160 Rouge (cosmetic): T12y2p2i,ca7l, T1a7lc5s5: 399, 1731, 1625, 1606, 643, ftRaoulrcbdbdueesrp:tienngd.s uTphoen stheelecptriTooapnlecortniisethsuesoepfdrtohaepsefarinfgairllalpedrreoadonufdct. Typical TaHHGIADFLMMFFMM1lnc6oiaaleuadsoaleas0otobelrshun:lcte3vidtldtsrnelhnxiswe,iasnsgea:csP:tigeaqn::esvFr:anuidoelcrd(iosdnasW:o(huSlssrecooGiiaertn14333lfenseo3tt16660gi:)dso6,77n76:;a:7d,,,,gnD6,s)d3:7o31:1116171l6171Cl76,,,735,s.,0a:,60:,b31741,31l1951,8e97169056:95710,13,,0511,,940,,6,23211,17395745911729,500,,1,,07,52,4,34341061002116716481,,,3266311971590,' SSSSTTT1T17op7yuuhiil55fornrbrete05gnete:sh,Pgiasc:ed2eratao4:ilan2dcn7dS:uducTntFsudo:braiimnegs::: 111111,,,464750746,,,4318926922, 413066607,3,1,1661010,533,1339193,, 643 438637,,11775500,,191, 367 % rgeears:e resistance to hUeaset dshaoscka.body component to "Topical Talcs: 486, 11, 60, 1736 `Vis i n g Compound: Typical Talcs: 367, 150, 11, 1153 /rbkbiunigldimnge:tal - all stanCdLaOrdVEsiRzeBs.rand Crayons for patting in manufacturinPgrpevroecnetsssjwhEitextsehnodeesr firnompoloisilh. Topical Talcs: 399, 5, 6 8, 2401 Delustering * Topical Talcs: !fI S^Lde F asten ers: 399, 1600L 643, 1731 Tumbling ; 'Topical Talcs: / Ei. T o p ica l T i c : 1373, 1750, 2408, 2676 F iller an4iExtender 5, 130, 2405 c^u ary , Cast: Dusting of molds and filler. Spaotcawotuemerspma(cactcafhrovinermdes):.an(dWchaitrevB,eldogcrekeeiotnhr,eLrgarbavyya,hTabanlldaccokur.seb}dy in Steam Pipe and Boiler Covering: Filler Typical Talcs: 36?, 1750, 5, 2401 SpotenaetnitteofInbsoudlyattoorsgifvoer dEil-eecletrcotnriiccsp: ropertieMs.ajor com Typical Talcs: 1211, 486, 1736, 2786, 5486 Steel Castings: See ''Foundry". Steel (polishing, stainless): See "Abrasives". SURFACE COATINGS: nAigosntpitahisoalnftinlCoeoslyas.tignrgosu:nd as uUssueadl taaslcas f-illmerus-t gheanveeralolwly Recommended Talc: 1367 oseCoxfarttuephlntkeitionfinignb, rcCoiasouumslakpninonaeugtcunecdresoss:moapfryoitusinndpgsar.erdtiicelnet atoTndaaltchl,iemboietiecl daaubse Typical Talcs: 367, 1836 tCaolclosrfoinr Osuils:pension purSpoomseestimaneds feoxrtelonwdeedr wcoitsht. Typical Talcs: 2130, 648, 399, 2405 wfEoghrgiccshohenteltlrnodEllntioanmggeitvhlsee: smofatttUoersfecfdehceateswsytihtehfiolemuxt.teenmdpinlogyipniggmaegnetr,$ 'lOC 1 "7 * ! ( t ) sEfeonnlcaemsc.helarUancdteerricsotiact:s whicThalgcisvear^emuosoethd,fosranfdloawblecosnur- Recommended Talcs: 1731, 399, 1767 dj<2E,uaxrutaseberiilooirtfypHcaohrutasicrealePctadeiirnsittssrtiib(cwusthioiotfeno,auntssioimdceoelhotaorelucdss)e: apiadinints.Bthee- //0y6p5i,c a1l 1T04a lc s : 233, 971 , 2405, 463, 1060, C olored E xterior Paint: 5, 232 , 1767, 2405 jsy7i3lsactzeainunclgkyinCcgohmacorpamocuptneodrusins:dt isc saT.nhde tsael cms ;aat er er i aulsse da rfeo rs itmh eiilra rc o n Recommended Talcs: 462, 367, 150, 1065, 1767, 2405 7j%ert F iller: T>0y6p5i,ca1l 7T67a,lcs1:641, 5, 36379,9,64187,$11,10140,602,4025130, 462, R7/it,.atterwioalrl FplaaitntWoafllloPwaisnidt:e sheen Used in long: oil RExeccoelmlemntensodleedeTxtaelncsd:er u3s9e9d, w17it3h1t,ita1n03iu0m, 2c4a0l5ciu-m flat faints. eA,/ifitoehtseeir:stianngcreeOdtoniedtnheteesp.drtoynfeilfmlatasn,d 3a9ji9dsreinduscuesspesnosmioenmofar ,-LfoaxceqtuaelrcsSuarrfeacinetrrso:ducedNetoedgtiovibeslispa.nded and there- -r*-- t 1-,t,,i aon an*, k n . 300. 1030. f?b7 fvMielmehtiacflloePr,reitmhaseeysresSannuederfdinagcseoarmns:ed pclleaatyn tcaulcttitnoMg.laedned wsliitph tsouitthaei Typical Talcs: 36?, 677, 399, 1767, 1030 Sofomtheistatylcpse amlsaoteirmiaplrove the adherence characteristic~ Recommended Talcs: 1767, 399, 1768 rMeqiluiteasrty. Specifications: Information upoi tcPhoaempuepsrluisLahlaecgdql.uosesrsy: finish iSs odneqseitrimedes- athlioswiesr esahseielyn athcar Typical Talcs: 399, 406, 677, 1731, 1090 Protein Emulsion: Filler and extender. Typical Talcs: 11, 1641, 2405 ptPouuttittmyy:ptorohvoeGldkenoniieilirhaignll;ytwhhaeemsnmaapaslpsllytaoimnmgo.uinnitmoifztealbcleiesdiunsgedanidn Typical Talcs: 462, 367, 1090, 2405 Resin Emulsion: Filler and extender. Typical Talcs: 11, 1104, 1641, 2405 fSsToaaarnnlddcthiisnneggaorScethhuuearsrfreaaidccnetgertrsorei:dsitimeicnpstasNrw' tiehneeidacthhsayenafrsioeanrngmfdorieuundlngaid.eaninntdtpogloagtoyidvetcaulectatssi T10y3p0i,c a1l 7T68a lc s : 461, 462, 618, 399, 1767, 'x . SpGehlreoesgnsamlCloeotnnetr-rotrole: d7u5creeagdloinsUgs .sferoampp9ro0xriemadatienlgy o1n/460o%z. Recommended Talcs: 399. 1731 ftaThanoicdsytuttEhyrneeparreesmfoeodflre:sesuiUrrfe.aSca.ellPc.inotagatrIilnencdgssioeamnrts5e rtteoocyboeemnomafmeknendlosew,dnmfpoaurnruit-y Recommended Talcs: 1, 173i fWaonrodmofduolFraitclilloeenar:nfowr ifpiilnlign.g pIrnocpoerrptioersatteo tparlecvienntthsihs rtiynpkeing Recommended Talcs: 367, 461, 1060, 1767, 1768 wWshrreiinennkklleae.ndFihneislph:control oEthmeprlocyhataralcctteorigsitvicesuonfiftohrem Typical Talcs: 399, 1731 Sreuqrugeicsatl.: Heart operations. Data on * Textiles: Filler weighting. 2T4y5p0ical Talca: 643, 11, 1648, 2441, 2442, mTialete, riWalaltlo (rceedruacmeicte):ndency t<j>! craze.Component body Typical Talcs: 786, 71^83, 610, 463. T ires and Tubes: F illerjai nd dusting. Toilet Preparations: See specific type. Tumbling Compounds: See "Abrasives' dVuinstyilngR.esins: Used both as a filler and for Typical Talcs: 399, 367, 461, 2424, 2404 Wall Board: Filler Typical Talcs: 367, 17SO, 1153, 2408, 2676 Wall Tile (ceram ic) See "Tile". Wboethldicnogl;d and hot m etaSl otoaplsatyonoeutCcruatytionngs ptoatmteranrks. pCoLpOuVlaErRsiBzerasn. d Metal W orker's Crayons - all Wmhaitteewriaarleto(creerdaumceictse)n: dency to crazeC. omponent bad} Typical Tales: 786, 783, 610 iWn irrueb(binersualnadtiopnlaasntidc ccooaatitningg):s. Also Ufosredduasstiangf.ille Typical Talcs: 406, 677, 11, 399 Wire Drawing: Lubricant in drawing. Typical Talcs: 367, 150, 1153 Zippers: Used to tumble. Typical Talcs: 1373, 2408, 2676 TALC BY SPECIAL PROPERTIES Best Color OiHlLAoigwbhsorption: pHHL: oigwh SliHp:igh BuHLlkoi:gwh LoP-Maritcicrolen Size U.S. P. Fibrous 1625 454 1602 2427 3994 ' 17315 1414360 11534 1605 416320 1153 1625 1602 643 454 3994 27555 1301 2755 399 1731 1755 2755 662 13 233 I KAM*HE0 I*** iH H H M S i M B S , lit i o n 9C14TOO CALLS' "&LINAO" ---- -P R O D U C T DATA MAGNESIUM SILICATE TALC The designation "talc" covers a wide range of natural products. The given theoretical formula for talc mineral (hydrated magnesium silicate) corresponds to a weight ratio of magnesia (MgO) to silica (Sio2) of about li2 but in actual practice this ratio may reach or exceed 1:1. For reporting purposes, talc, soapstone, steatite and Asbestine are considered^ as a group. Soapstone refers to a talclike material of variable composition containing sufficient impurities to prevent its use in applications requiring white color or chemical purity. Steatite refers to a particularly massive compact form of talc and differs from soapstone in terms of its relative purity (Soapstone may only contain SO% talc). To qualify as a steatite grade talc, it must contain less than 1.5% CaO, 1.5% Fe203, and 4% A1203. Asbestine is a fibrous form of talc that is mined in the northern section of New York State In view of the many composition variables associated with talc, it understandable the talc of commerce may not always contain the mineral talc a major constituent although this is usually the case. It also explains many grades of talc that are offered as commercial pigments to Industry, j The types and amount of mineral impurities associated with talc are more less indicative of the areas from which they are mined. Montana deposits . very nearly pure talc. New York talcs commonly contain only about 20% to of mineral talc. Vermont talcs are high in magnesite, Texas talcs run high dolomite, and California talcs vary in associated mineral content depending their relative softness or hardness. i " The five principal United States talc mining districts are California, Nevada, Montana, New York and Vermont. Texas, North Carolina, Georgia and Alabama, although not listed among the top five, are significant in talc mining. The purest talcs that approach theoretical purity, are characterized by the whitest color, and command the highest price. Pure talc is the softest known mineral, exhibits hydrophobic surface properties, and has a slippery feel. Although pure talc is the standard for softness of 1 on the mob scale (diamond-lQ) commercial products may be less soft due to the presence of impurities or associated minerals such as calcite, tremolite and silicious materials. Magnesium is the eighth most abundant element in the earth's crust, the sixth most abundant element in the sun's atmosphere, and in the form of magnesium silicate is the second most important component of meteorites. AAAKBPXKZ CF-BALL-2 continued.... W-16 IOOO C O O L tO G E S T R E E T S O U TH P LA IN FIE LD . N J 0 7 0 8 0 I Magnesium Silicate Talc (continued) (ISI j5 # U 0 0 CABLE `SLEtNAD* PRO D U CT DATA-i Page 2 The color of natural talc is white, gray, yellow, or a greenish shade and is characterized by a silvery or pearllike luster. Xt occurs in veins and/or masses formed from preexisting mineral aggregates. The entire talc vein can seldom be completely extracted because of ore dilution with detrimental adjacent rock. Discounting minor yearly fluctuations the consumption of talc domestically'produced has grown at an annual rate of 4% since 1960 and this trend is expected to continue. About 40% of the talc sold in the past has been low cost and low quality product. Industry is looking more and more to the better grades of talc and their controlled physical and chemical characteristics. Talc is probably used in a wider variety organic coatings than any other single extender pigment. This widespread utilization of talc pigment is well justified. Talc pigments are normally self-suspending in paint vehicles. Moreover, they assist in keeping associated pigments also suspended. Whatever settling occurs is generally soft and readily redispersed (platy talcs are especially effective for antisettling behavior). * Talcs disperse.with.relative ease in most paint vehicles. Certain grades are especially useful for incorporation in aqueous systems. Since talcs chalk more readily than most extenders, they are frequently used in a compromise pigment combination (for instance with ground limestone) to provide controlled chalking (self cleaning exterior paints). Most paint-grade talcs possess both a high specific surface area and a fairly high oil absorption capacity. Although these properties limit the amount of talc that can be incorporated in a paint, their presence in moderate amounts contribute to improved rehological properties (antisettling, brushability, satisfactory leveling and antisag). Certain talcs impart a flatting effect that can be used to control the gloss of enamels (high-purity Montana talc is reported as ideal for this purpose). These talcs are generally lo-micron grades with a top size below 25 microns and readily dispersible stir-in extender pigments producing Hegman fineness values of 5 and above in high-speed paint mixing equipment. In wall paint formulations their use results in improved brushability and clean-up. The finest lo-micron talcs produce excellent flatting, good low-angle sheen, and good resistance to burnishing. In primers they exhibit excellent suspension, holdout, and sanding properties. continued... W-106 tOOO C O O L IO G E S T R E E T SOUTH PLAIN FIELD. N J 07 080 I '2 0 !! # '4 1 0 0 CAULE`SLEWEDPRO D UCT DATA Magnesium Silicate Talc (continued) Page 3 Both acicular and platy talcs improve the bonding properties, film toughness and durability of paints. Of the two, the platy talcs are claimed as more effective in upgrading the physical properties of a paint. Platy talcs also appear superior to fibrous talcs in improving the water and humidity resistance of a paint film (less permeable due to physical configuration). On the other hand fibrous talcs are preferred for imparting better blister resistance. It is stated that talcs are equal or somewhat superior to other extenders in resisting corrosion influences. The platy and granular talcs like the lo-micron grades are especially prized in metal primers due to their excellent sanding properties and in top coats due to their contribution to burnish resistance and good scrubability. All talcs exhibit outstanding holdout properties. However, the platy grades are by far superior. The relatively coarse grades are utilized where residual surface roughness (tooth) is desirable such as for wall primers, undercoaters, and texture paints. Talc is commonly used in white linseed oil house paints, traffic paints, latex paints, industrial undercoats, and structural steel primers. Talcs tend to be commodity pigments in that products from different manufacturers are frequently used interchangeably. However in view of the many grades of talcs offered, the formulator should carefully evaluate the effect of the replacement talc on the performance of the end compositions before committing himself to this substitution. Talcs are supplied in a broad range of particle sizes and distributions. further diversifications arise from the fact that, depending on the talc source/ talcs vary greatly in particle shape. Thus the talc pigment may be predominantly acicular, fibrous, granular, or platy. The method of reducing the crude ore to pigment particle size has little to do with the talc particle configuration, the origin of the talc being all important. In view of this situation, it is understandable that a talc manufacturer may stock as many as 70 standard grades of talc for sale to industry, all of which are designed for definite end uses. It also suggests that consultation with the technical personnel of a talc manufacturer is in order when a customer introduces talc pigment into his product. It is the policy of Whittaker, Clark & Daniels to make available talc products especially designed for use by the paint industry at strategic points throughout the country. Thus industry can have the advantage of not only a ready supply of a selected product, but also a product that is economically desirable. - W-106 IOOO C O O L ID G E s t r e e t SO U TH PLA1NEIEL.D- N J 0 7 0 B 0 f l o t ' 5 141100 C A L C ` UEINA0* "--PRO D U CT DATA-! 399 MAGNESIUM SILICATE S.F. Mo. 399 Magnesium Silicate is a low micron magnesium silicate (talc) which has been produced by Whittaker, Clark s Daniels for a number of years. This talc has gradually grown to become the standard of comparisons for all low micron talcs. Mo, 399 Magnesium Silicate is ground from a Montana ore and is extremely white in color. It is used in various ways in the paint and printing ink industries, . The popularity of Mo, 399 Magnesium Silicate S.F, has increased considerably with the increased popularity in the use of new manufacturing facilities for paint products. Mo. 399 Magnesium Silicate S.F. is an ideal pigment, not only for its original intent of use in production enamels and other paints for sheen control, but because of its fine particle size and particle size distribution uniformity from lot to lot, bag to bag, Mo. 399 Lo-Micron Magnesium Silicate is an ideal pigment for formulations which are processed on high speed dispersors and/or sand mills. No. 399 Lo-Micron Magnesium Silicate still retains its popularity as a formulating tool for sheen control where the sheen of the finished enamel must be uniform on all parts of assembled item. Representative of this type of work would be metal cabinets, bicycles, various heavy toys and any and all sundry items which are produced in individual pieces and assembled on any assembly line. The reason for this is that most paint batches of enamels when they come down for final inspection vary somewhat in the degree of gloss and the item which is to be coated with this enamel must naturally have and maintain a uniform gloss or when the assembled parts were finally put together in the finished product, it would be rather a sorry looking manufactured piece because of variations in gloss from part to part. Mo. 399 Magnesium Silicate S.F. is used at this point in the manufacture of enamels to bring the gloss to a uniform standard and is introduced by the paint manufacturer either by sprinkling into the finished batch and dispersing under the mixing paddles or by having the Mo. 399 Magnesium Silicate pre-wet in some diluent or solvent that is already in the formula and introducing it at the end of the batch make-up in this form so that there are no possible opportunities for any talc particles to agglomerate and cause trouble either in the straining or in the final finish by showing speckiness. W-106 continued lOOO C OOUOGE STREET SOUTH PLAINFIELD. N.J 0 7 0 8 0 I I* i l o t i 501-6100 CA*LE-SLCtNAO * BBS PRO D U CT DATA-i 399 Magnesium Silicate S.F, (continued) There are several talcs which are sold in this category, but No. 399 Magnesium Silicate S.F. is by far the most efficient both from a standpoint of the reducing of the gloss of the paint by the nonsettling characteristics and also by the ease of dispersion and the slight increase in viscosities attributed to the introduction of Magnesium Silicate S.F. to the formula. There are some specialized purposes for some of the competitive low micron materials which might act as substitutes for No. 399 Magnesium silicate, but in general use none of the competitive materials make a satisfactory overall substitute for No. 399. No. 399 Magnesium Silciate S.F. is also widely used in plants where it has been introduced (first as a sheen control item) as a formulating tool in the manufacture of quality satin egg shell and flat enamel paints for general trade sales. One reason for this is that formulations made with No. 399 never lose nor change the gloss readings which were obtained on the dried films when the enamel was first made. This is really quite a problem in the manufacture of this type of trade sales goods because on standing, egg shell and flat enamels generally increase in sheen unless No. 399 Magnesium Silicate is used as the sheen control item. 399 MAGNESIUM SILICATE S.F, Material Begman Test viscosity Glossmeter Reading 399 6+ 1/4# 1/2# 1 1/4# 1/2# U 100 KO 105 KO 120 KU 78 50 37 1731 6 99 101 112 84 70 54 W-106 tooo COOLIDG STREET SOUTH PLAINFIELD. N J O7OB0 <O H S-10O CA8LE -SLEiNAO' PRO D UCT DATA BARYTES Functional Applications Paints - A major utilization of barytes in paints is in the formulation of Industrial undercoats and especially industrial primers. The nodular structure of the barytes particles and their low oil absorption or oil demand permit the formulations of primers possesssing good leveling and excellent build properties with associated good enamel holdout As a result, subsequent top coats exhibit outstanding gloss. The chemical inertness of barytes also recommends its use in designing chemically resistant coatings that must withstand the attack of acids, alkalis and corrosive gases. Due to its high index of refraction (for an extender pigment), barytes functions as a weak white pigment in water paints and provide a moderate degreee of hiding power. In oil paints it is essentially transparent, but because of its low tinting strength, it offers a good extender base for the incorporation of both white and colored pigments. Barytes is occasionally employed to improve the dispersion properties of certain inorganic pigments. In.floor.coating's.it.densifies.the.coating.and.imparts wear resistance. Barytes is also used in flat interior wallpaints. Barytes in some formulations effects the speed of dry semigloss latex paints, imparts a harder film without loss of gloss. Flooring - Barytes is commonly used in the manufacture of linoleum and composition flooring. It readily disperses in most binder systems to yield flooring products that are highly resistant to abrasives and heavy traffic conditions. Rubber - High loadings of barytes can be readily incorporated with elastomers to provide dense elastomeric products. Such heavy rubber of reasonable toughness are occasionally desirable where weighting is necessary. Ceramics - A coarse grade of barytes is used in the glass industry where the fluxing action of the barium sulphate is utilized to reduce the melting point of the glass melt. The high index of refraction of the barite also imparts a degree of sparkle to the glass. Well Drilling - A fine grade of barytes is used in the formulation of oil well slurries and drilling muds. During the drilling operations the ground rock and debris that accumulates must be removed. This is done by first suspending this accumulated material in a slurry of barytes. The high density of the slurry prevents the settling of the rock particles. The suspension of the drillings or residual in the barite slurry is removed by pumping. Also the addition of barytes tends to sufficiently weigh the water slurry above the drill to prevent gases from blowing out through the casing walls. W-106 1000 CO O LiO CC S T R EE T SO U TH P L A IN F IE L D N.J 0 7 0 8 0 AAAKBPXLA CF-BLL-3 M A RKETIN G G U ID E FO R C O SM ET IC - PH A RM A CEU TICA L. IN D U STR IES GLOSSARY O F TERM S B A C T E R IA C O N T R O L - o r the indication " B ,, C . " designates that the product w a s p ro ce sse d in som e w ay to e lim in a te o r control b a cte ria o r m old p re se n t. WC&D control is u su a lly 0 colonies of gram positive type b acte ria and le ss than 100 co lo n ies p e r gram of m old. A n y d iscu ssio n on th is su b je ct o r c o r respondence m ust be handled through o u r lab o rato ry not by sa le sm e n o r sa le s desk personnel. C . T . F . A . - denotes a s p e c ific a tion, stand a r d , o r tes t method to c o ntro l p u rity to co sm e tic in d u stry re q u ire m e n ts. C . T . F . A . stands fo r C o sm e tic , T o ile trie s and F ra g ra n ce A sso ciatio n , (fo rm e rly called T . G . A . ) . D & C C O L O R S - m eans org anic c o lo rs c e rtifie d fo r use in c o s m e tic s , m o stly lip stick and cannot be used around the e y e s. Th ese co lo rs a re a ll d isp ersib le and not w a te r so lub le a s a re F D & C (food c o lo r s ). W e do not s e ll food grade certified co lo rs. . F . C . C , - Food C h e m ica l Codex is a com pilation of stan d ard s fo r food grade chem icals. F . D . A . - Food and Drug A d m in istratio n - a federal departm ent charged w ith setting co n tro ls og food and c o s m e tic s and reg ulate m any o f o u r p ro d u cts. ...F o r .e x a m p le ,..th e y.c e r t if y o u r D .& C .c o l o r s ....... ........................... ............................ .... ..... F , D . & C . - Fo o d , D ru g & C o sm e tic - these a re c e rtifie d c o lo r s f o r u se in Food products and a re u su a lly w a te r so lu b le . T h e y a re a lso used in co sm e tics and drugs but we do not s e ll this type c o lo r, G R A S - a term not now gen erally used but m eans "generally regarded as safe" because of past history of safety. N . F . - stands fo r a sp e cifica tio n co n tro l lis te d in the National F o r m u la ry another so u rce of control fo r the p h arm aceutical in d u stry. T h is so u rce of inform ation is quite the sam e as U . S . P . but ruled by a d ifferent group. P ro d u cts can be liste d a s both N . F . and U . S . P . S o m e m a te r ia ls a r e liste d a s N . F . and not U . S . P . o r v ice v e r s a . O S H A - stands fo r Occupational S a fe ty and Health A c t. T h is is a federal departm ent resp o n sib le to control sa fe conditions fo r w o rk e rs . T h is would re fe r to.dust, asb esto s, a rse n ic, lead, o r other lim its of harm ful substances a s re la te s to ou r p ro d u cts. , continued G lo s s a ry of T e rm s - continued U . S . P , - a notation in the nom enclature of a product indicating a sp e cifica tio n standard liste d in the United S ta te s P h arm aco p o eia to control products fo r use in drugs but also used by other in d ustries such as cosm etics o r foods. G E N E R A L AND CO N TIN U IN G G U A R A N T Y - is a method we use fo r -custom ers v :-a-check m eets specifications - th is letter elim in ates the n e ce ssity of sending co n firm a tio n on e a ch and e v e r y sh ip m e n t. C E R T IF IC A T E O F A N A L Y S IS - a ce rtificate stating our product m eets stan d ard s requested such a s U . S . P , C . T . F . A . , N . F . o r even o u r own s p e c if ic a tio n . S e n t on re q u e st o n ly . INDEX B la n c F ix e - B a riu m Sulp h ate, P re cip ita te d " F re n ch White" Bentonites - M ineral Colloid - Powdered - G ran u lar U . S . P . and T e ch n ica l - C alcium Carbonates - Precipitated U . S . P . Chalk & C a lcite C alcium Sulphates - Anhydrous, Hydrous N . F . C la y - see Kaolin C o lo rs - "Thom asset C olors" - C ertified O rganic for lipsticks P u rified Inorganic Pigm ents " B . C . " , Lo -m icro n F u lle rs E a rth - Powdered - G ra n u la r H ydro -M ag m a P aste - M agnesium H ydroxide in w a te r Kaolin - C olloidal - Airfloated - Lo -m icro n Dom estic - English - N . F . Dim e - Hydrated N . F . M agnesium Carbonate ~ Lig ht, H eavy, N . F . M agnesium Hydroxide - N . F . Powdered and Paste M agnesium Oxide - Lig ht, H eavy U . S . P . . M ica - W ater Ground cosm etic grade, B a cte ria Controlled M ineral C o llo id s - Albagel - Albagen - Bentolite U . S . P . and T e ch n ica l - Soapstone --see T a lc S te a ra te s - Alum inum , M agnesium , C a lciu m , Z in c , U . S . P . T a lc - D O M E S T IC , A labam a, North C a ro lin a , M etropolitan, T e x a s IM P O R T ED , Italian, F re n ch , Korean S p e c ia l g rinds fo r bath p ow d ers, p re ss pow ders, tab let-coatin g s, a e ro so ls, lo-m icron U . S . P . , C . T . F . A . , B acte ria Controlled, Tech nical Titanium Dioxide - Purified C . T . F . A . , U . S . P . , N . F . - B a cte ria Controlled W ater d isp ersib le, O il dispersible Z in c Oxide - U . S . P . Code No. Product Description 604 A lum ina, Hydrated "Hydral 710" , 1 m icron 614 A lum ina, Hydrated C --331 617 Alum ina, Hydrated 619 A lum ina, Hydrated C-33 . 639 A lum ina, Hydrated C-31 647 A lu m in a , H ydrated " H yd ral 705" '4. m ic ro n Uses ) ) ) ) ) A s abrasive > ) Toothpaste - Skin Products ) ) etc. ) ) controlled p article size ) ) ) ) ) Code No. Product Description Uses 1525 B a riu m Sulphate im ported ) "Blanc Fixe" ) ) Bulk D ensity control 2278 B ariu m Sulphate Imported ) W hite F ille r - som etim es "Blanc Fixe" ) r e fe rre d to a s " F re n c h W hite" 49 Bentonite, Tech n ical Grade 344 Bentonite, Tech n ical Grade 30-40 m esh G ranular 670 Bentonite U . S . P . 5 m icron ) ) ) ) ) ) ) 4430 Bentonite "B en to lite H " ............................... . 4439 Bentonite "Albagen" 4444 Bentonite U .S .P . "Albagel P rem iu m " 4446 Bentonite "Albagel Regular" ) ) ) ) ) ) ) ) ) ) Not recom m ended fo r co sm e tic o r pharm aceutical u s e . Use for filtration and waste control L.ow cost U S P M ontm orillinite . U se fo r fa c ia l m ask -g ellin g and su sp en sio n -G rit free-H igh G el type H igh G e l- e x c e lle n t w hite.c o lo r M ineral colloid of highest quality and purity fo r food, co sm etics and pharm aceutical uses. Code No. Product D escrip tion U ses 64 C alciu m Carbonate, Precipitated ) U S P - English - Dense ) 76 - 86 l b s . /c u. f t . ) ) 300 C alciu m Carbonate, Precip itated ) U S P , Light 12-13 l b s . / c u . f t . ) 2048 2064 ) Calcium Carbonate, Precipitated ) U S P . he a v y m i x __________________ ) ') C alcium Carbonate, Precipitated ) U S P , extra heavy ) ) 2090 C alcium Carbonate, Precipitated ) USP ) ) 2923 C alcium Carbonate, Precipitated ) 2924 H eavy, 23-29 Ibs./c u.f t. . C alcium Carbonate, Precipitated U S P , e x tra lig h t 14 I b s . / c u . f t . ) ) ) ) Toothpaste, tab lets, c a p s u le s , c o s m e tic m ake -u p __________ products. C o n tro ls d en sity in tableting 2925..C a lc iu m ..C a rb o n a te ,..P re c ip ita te d ..) U S P , medium 13-15 I b s . / c u . f t . ) 2931 C a lc iu m Carbonate Food G rade (codex) ) ) ) C a lciu m Carbonates - controlled density prepared to cu sto m e r's specification are also available. 164 .C a lciu m Sulphate Anhydrous 255 C a lciu m Sulphate N . F . ' Hydrous " T e rra Alba" 256 C alciu m Sulphate N . F . Hydrous "T e rra Alba" ) N utrient in food and ) beverages ) ) ) U se a s a b in d e r in ) tablets, e tc . ) ) 115 F u lle r s E a rth 110 m esh (co arse) 2829 F u lle rs Earth "M in --U -G e l 400" ) ) Attapulgate Typ e ) used fo r absorption, ) filtration, fille r, ) etc. Code No. Product D escription 347 K a o lin , En g lish Colloidal N . F . White 825 K ao lin , M edicinal 2462 K a o lin , W hite Dom estic "Hydrite #121" 2747 Kaolin . Colloidal Fine N.F. - B.C. 2749 K ao lin , Colloidal N.F. - B.C. 802 L im e (C alciu m Oxide) C h em ically Hydrated 309 M agnesium Carbonate Light - N . F . 320 M agnesium Carbonate Heavy - N . F . 314 M agnesium Hydroxide Paste Standard V iscosity 370 M agnesium Hydroxide N . F . Powder fifi310 M agnesium Oxide Heavy - U SP 311 M ag n esiu m O xide Light - U S P 280 M ic a , W ater ground, white Cosm etic Grade B . C . U ses ) ) U S e fo r suspension lotions ) ) facial talcum powders )' ) face products -- ) ) cre a m s, lotions )___________ ___ ____________________ ___________ ) Internal absorption ) ) pharm aceutical lotions ) and cre am s ) ) ) Antacid - B u lk agent ) ) .............. ..F r a g r a n c e .re te n tio n ............... ) ) B u ffer - Conditioning agent ) M ilk of M agnesia base ) and A ntacid ) )' ) ) U se in A n ta cid s ) ) ) ) ) Use for slip and glitter ) in powders & m akeup products Code No. Product D escrip tion U ses 907 Alum inum S tearate Standard Medium G el 2285 Alum inum Stearate Non gel ) ) ) ) ) A lso available ) ) in ) ' L u b rica n ts & G el ) Low and High G el ) 1345 C alcium Stearate ) . 2307 Calcium Stearate ) ) "Food G rade", also "Kosher") 905 M agnesium S te arate USP ) ) ) 2311 M agnesium S te arate U S P Food Grade ) ) ) Both C alciu m and M agnesium Stearates are used for m aking tab lets, M agnesium Stearate is usually preferred for this. 695 Z in c .S te a r a te .U S P ) Pharm aceutical T ab lets. Lends ad h e sio n to.p o w d e rs ....A n ti-c a k in g body agent in shaving c re a m s and lo tio n s. *y tesad, s?KXMesfe Timg John sr. Ifthm * tte arols tSHter S&racas, JBT Fmbtru&ry il I S M '<sar foto* &e* fMUi CSs?ical Ce JQc " psrit Claim e&S bast -fail, *e ser noti fiad bg the? tax a M M p r In fcfce tew <# m m fe#t ?3ol mk aoe **,t stato ta* mt stnmtal natica* ta Etmr P-* Suits had g a m ma/mtar&S* Xi: m s o.r c g g a r t m t t g te etlutt a hid fk>r ihm parcel r a t a i m d bg Garbai* and tm quit c i i s sed m s the s a i t -of t&a Taws sf Si&m accepting ear after* The> e n d o s s docs^emt i s w t to tos .fer to u r xac&rds* parsemai85 sM- car h m t rogars eus# thmnk &>a $t goar past cervices. Vary trai g g&ars, emm inc* m/val S.ti&O&Uite ' bec: Mr. P,G. bight Voucher File M.T. Viscardi, sg* S& pBrVi nSggf iae l,d *, j N g J g 0&7*08c1 3* S. ' t e u s t t , i r * Sscratrg^Trassnrsr AAAKBPXLI CF-BALL-11 COUNCILMEN JO SEPH J.D UN D O N HENRY LESPER A N CE L TOWN/OF DIANA f DO RAN E/.'. W A U G H , SUPERVISOR VIV1A/N H IL L , TOWN CLERK HARRSSVh I e , NEW YO RK 1304 COUNCILMEN FRANK MANTLE g eo r g e p ie r c e ,jr . Clark Minerals, Inc, p.u. Box 205 Carthage, N.Y. 13619 / December 30 1985 i< ; . 1 I Dear Sirs: I r eceived your check in the amount of $3 ,7 0 0 , 0 0 and enclosed find receipt 5for same, i Your Quit claim deed, will , sent as soon as possiulCa )31>nk you. Very trux^- ,vqurs, -5 ^S' i $ w d. Vivian L. Hill Town Clerk T o w n .o f .D i a n a .. QUIT CLAIM DEED TAX SALE TOWN OF DIANA '/ !l.P THIS INDENTUREmade P* =Cr> BETWEEN THE TOWN OF DIANA, a Municipal Corporation of the State of New York, party of the first part and CLARK MINERALS, INC. A corporation with an office and principal place of doing business in Carthage, New York, party of the second part, WITNESSETH, the Town of Diana, the party of the first part, in consideration ofThreeThousand Seven Hundred and 00/100 Dollars ($3700.00), / lawful money of the United States, and other good and valuable consideration paid by the said CLARK MINERALS, INC., does hereby remise, release and quit claim unto the said CLARK MINERALS, INC., their heirs and assigns forever, ALL THAT TRACT, PIECE OR PARCEL OF LAND, situate in the Town of Diana, County of Lewis, and State of New York, assessed on the tax roll of the Town of Diana in the year 1982 to CARBOLA CHEM. CO., INC. and bound and described on such tax roll from the description furnished pursuant to law.thereof as set forth in the Notices of Sale prepared therefrom and duly published pursuant to law as follows: Carbola Chem. Co., Inc., tax map no. 034.00-01-02.100. N. SIDE NYS RT. 3. Coded 322, vacant land, containing Thirty and Fifty hundredths (30.50) acres of land, more or less. Said property having been sold at Tax Sale and bid in by the County of Lewis, State of New York and conveyed to the Town of Diana by said County pursuant to Chapter 896 of the Laws of 1945 and recorded in the Lewis County Clerk's office on November 4, 1985, in Liber 462 of Deeds at page 253. This conveyance is made pursuant to a resolution of the Town Board of the Town of Diana, Lewis County, New York, adopted on December 11, 1985. It is further agreed that this deed, executed by virtue of said resolution of the Town Board of the Town of Diana, shall be executed and conveyed upon the condition and covenant that the Town of Diana shall in no event be or become liable for any defects in the title so conveyed or for any cause whatsoever and that no claim or demand of any nature shall ever be made of the Town of Diana arising from such sale or any proceedings leading thereto. TOGETHER with the appurtenances and all the estate and rights of the party of the first part in and to said premises. TO HAVE AND TO HOLD the premises herein granted unto the party of the second part, CLARKS MINERALS, INC., it successors and assigns forever. IN WITNESS WHEREOF, the party of the first part has hereunto set its hand and seal the day and year first above written. THE TOWN\ QO FF DD IIAANNAA* \u u X ->' f, B y. ' Doran Waugh,'"Supervise STATE OF NEW YORK COUNTY OF LEWIS ) )SS . ) ^v\y>vV- On this /C day of 1985, before me, the subscriber, personally came DORAN WAUGH to me personally known and being by me duly sworn, deposes and says; that he resides in the Town of Diana, New York, that he is the Supervisor of the Town of Diana, State of N e w York, the Municipal Corporation described in and which executed the above instrument; that he knows the seal of said Corporation; that the seal affixed to said instrument is such corporate seal; that it was affixed by order of the Town Board of said Corporation and that he signed his name thereto by like order. :-t> t.-* DOROTHY L VMUH Noiary Public in ite Sist- o r r a w YerS Riso in Lewis County State Fife No. 25*4173350 Q f Bi&CemnitesiPii BsgijesMax, 3 0 .1 & L . nji reco rded Page . ' 7 5 ................. 6 --- ' m i i Bas ; Ctette cou^w > := VillageTown of . ,,U t )l.a.jrt Received of G fl-tfK General Receipt ,H i He. fl.i, r .. --!r,iV-. 1 jxa .19-liL $ X X l C. ,V 'hi f i d 1i h a t n r J C : t if -*.?V h i rl n P 7 < ' C* \ Oy, For ^ tip f%\ Rv e. t ~ M . *i .. .-r ' DISTRIBUTION: L i U0 t '1-A ; ^ V\\ FUND CODE AMOUNT !,V!' '-------- ----- X X DOI LARS Ki'i- 0 ;i+ . h e -- ca - / ' 2 , s C , `>Z) f'r / J lc-> M iile id 1 V /!' /!/ .. Ry i vs- -U W lUlimion Law Book Co., Roohcstar, N. V. 14609 l' l _____ G t j y ^ ________________________________ t Jefferson National Bank Mrs. Judith A , Condino Outer Washington Street Water-town, NX 13601 ,7isn o 1 8 , 1 9BS i Dear Mrs. Condino; ` In reply to your letter, of June 11, 1385, the hone! which we executed with Carbola Chemical in the amount of $256,000,00 was satisfied in. March, 1983, . - Very truly yours, .C L ARK M l N M m Z S , m e JHB/mcl J, it, Bennett, Jr; Secretary-Treasurer H U B E R T C . STRATTON (1027* 1978} HOWARD H. CAMNON 0 9 7 -fB 7 9 ) ANTON H. ZAHM 11947-1084) WILLIAM F FITZPATRICK 11929-1984) C H A R L ES A, S C H O EN EC K , J R . TRACY H. FERGUSON L Y L E W. HORNBECK C H E S T E R H. KING, J R . N. E A R L E EVANS F R A N C IS E . MALONEY FRANCIS O. P R IC E * JA M ES E. WILBER H EN RY R, MCCARTHY RAYMOND W. MURRAY, J R . J O S E P H J . LAWTON, J R . G EO R G E C.SHATTUCK L E S L I E H. DEMING JOHN J. OEE JOHN A. BEA C H * C H A R L E S T. BEEC H IN G , J R . WILLIAM P. BURROWS JO H N M. F R EY E R * R O B E R T W.XOPP C H A R L E S T. MAJOR JOHN S . FERGUSON RO BERT E, MOSES ARTHUR E . eONGIOVANNI* WILLIAM L. BERGAH ANTHONY R. PITTARELLI FRAN CIS E . MALONEY, J R . W ALLACE J , MCDONALD * J A M E S D. FITZPATRICK STEPH EN UJOHNSON JA M E S , MACKIN DAVID N. SEXTON GARY R. GERMAIN THOMAS S. EVANS H. DEAN H E B E R L IG , J R . THOMAS J . GROOMS RICHARO L , SMITH J A M E S P. MCDONALD S . PAUL BATTAGLIA STEPH EN J . VOLLMER L- LAWRENCE TULLY PA U L M. S A N S O U C Y * GARY M. CLARK RICHARD C . H EFFERN RICHARD D. HOLE G E O R G E H. LOWE JO H N D. ALLEN DAVID M. F ELLO W THOMAS E. M YERS L O U IS P- DiLORENZO CARL ROSENBLOOM Bono, Schoeneck 6c King ONJE LINCOLN CENTER SYRACUSE, NEW YORK 13aO S-i335 (3 15) 422-0121 111 W A SH IN G TO N A V E N U E ALBANY, NEW YORK 1 2 2 10 -2 2 80 (510) 452-7421 216 WASHINGTON STREET WATERTOWN, NEW YORK 1 3 6 0 1 -3 3 8 9 (315) 7 8 8 -3 3 2 7 PYLON PARK 5 3 0 1 NORTH FEDERAL HIGHWAY BOCA RATON, FLORIDA 3 3 4 3 1 -4 9 9 0 (3 0 5 ) 997-0411 1167 T H IR D S T R E E T 5 0 U T H NAPLES, FLORIDA 3 3 9 4 0 - 7 0 9 8 (813) 2 62-6812 February 18, 1986 JOHN E.N O A KES OF COUNSEL DAVID L . DAWSON BARRY fl. KOGUT M. C ATHERIN E RICHARDSON DAVID R . SHERIDAN JOHN GAAL J O S E P H ZAGRANICZNY THOMAS R . SMITH ROBERT K .WEILER THOMAS D. KELEHER R. DANIEL BORDONl JA M E S N. S E E L E Y RONALD C. BERGER R O B E R T C- ZUN DEL, J R .* TH AD O EUS J . LEWKOWtCZ ANN R .P U R D U E JO S E P H T. ROTONDO EDWIN J . K ELLEY, J R . LARRY P. MALFITANO JOHN H. CALLAHAN JOHN G . McGOWAN EDWARD RYAN CONAN J O S E P H P. VAN D LOO G E O R G E J . GETMAN * JEA N A. MACCHIAROLI DEBORAH H.KARALUNA5 CHRISTIAN B .F EL D E N ** DONALD S . DlBEHEOETTO ROBERT A. L aBERGE WILLIAM R. MORIAHTY MAURA A . FLOOD SCOTT C. SELBACH RICHARD A. REED M ARGARET M .CASSAOY SHE1LAH E . FOLEY PATRICK J . PEDRO ROBERT J. SLYE DANIEL J . VENUTI DIANE E . KATZ DENNIS G . W HELPLEY PA U L F. KING D. FRED GARNER B . ERIN BABIKIAN * JOHN S.W ESTRICK JUD Y A. B ARRIN GER* ALSO ADMITTED TO FLA. BAR ADMITTED IN FLA,ONLY * ADMITTED IN W.VA.QNLY ADMITTED IN CALIF.ONLY Mr. J.H. Bennett, Jr. Wittaker, Clark and Daniels 1000 Coolidge Street South Plainfield, New Jersey 07080 Re : Carbola Chemical Co., Inc. Dear Jack: We acknowledge receipt of your letter dated February 11, 1986 with enclosed copy of Quit Claim Deed from the Town of Diana to Clark Minerals, Inc. It was a pleasure to hear from you. What did our friend Mr. Smith do with all his money? In any event, it is fortunate that Clark Minerals was able to purchase this parcel at a reasonable sum. Please do not hesitate to contact us if we can be of service in the future. As you may or may not know, we recently opened an office in Watertown, New York which is located at 216 Washington Street, Watertown, New York. Best personal regards. Very truly yours, BOND, SCH kECK & KING JHC/lc By : Johm/H. Callahan MEMBER: FNleowridYaoBrkarBar KEVIN M. McARDLE Attorney & Counselor at Law Lo7w65v8ilPlNe.,OorN.theBwSoxtYat1oe2r8kStr1e3e3t67 (315)376-7543 February 4, 1986 Clark Minerals, Inc. Carthage, New York 13619 Re: Town of Diana to Clark Minerals, Inc. Dear Clark Minerals, Inc.: Enclosed please find your Quit Claim Deed in the Sale from the Town of Diana to yourself. If you have any questions or comments, please feel free to con tact me immediately. Very truly yours, / amh Enclosure JEFI ARSON NATIONAL LANK OUTER WASHINGTON STREET WATERTOWN, NEW YORK 13601 (315)788-8800 June 11, 1985 Clark Minerals, Inc. Natural Bridge, NY 13665 RE: Carbola Chemical, Inc. Gentlemen: Please advise if the bond which you executed with Carbola Chemical on December 19, 1980, in the amount of $256,000 has been satisfied. If you have any questions regarding this request, do not hesitate to contact me at 788-8800. Very truly yours, JAC/bt (Mis.) Judith A. Condino Manager/Assistant Treasurer Offices: Antwerp, LaPargeville, Lowville, Philadelphia, Waddington and Watertown, New York Member Federal Deposit Insurance Corporation Member Federal Reserve System CHARLES A.SCHO EN ECK, JR . WILLIAM F. RTZPATRICK TRACY H. FER G U SO N L Y L E W. HORNBECK C H E S T ER H. KING. JRN. E A R L E EVANS FRANCIS E , MALONEY FRANCIS O. PRICE * JAMES E. W ILBER* ANTON H.2AHM HENRY R. MCCARTHY RAYMOND W. MURRAY, J R . J O S E P H J . LAWTON, J R . G EO RGE C.SH ATTUCK L E S L IE H. D E K 'NG JOHN J . D E E JOHN A. B E A C H CH AR LES T. BEECHING J R . WILLIAM P. BURROW S JOHN M .FR EYER R O B E R T W. KOPP ARTHUR E.BONGfOVANNl * JOHN S , FERGUSON C H A R L ES T . MAJOR ROBERT E.M O SES WJLUAM l . b e r g a n ANTHONY R . P IT T A R ELLI FRAN CIS E. MALONEY. J R . Wa l l a c e j . Mc Do n a l d JA M ES O. FITZPATRICK ROBERT J. HUNT* STEPH EN L . JOHNSON JAM ES E.MACK'N DAVID N. SEX T O N * GARY ft. GERMAIN THOMAS S . EVANS * H. DEAN H E B E R LIG .JR . THOMAS J . GROOMS RICHARD L . SMITH JAM ES p. McOONALD * STEPHEN J . VOLLMER 5- PAUL BATTAGLIA L-LAW RENCE TULLY PAUL M .SAN SOUCY GARY M .CLARK RICHAPO C-H EFFEPN RICHARD D. HOLE Geo r g e h . low e T. PETER POETZSCH JOH N D. ALLEN OAVIO M -PELLOW THOMAS E. MYERS LO UIS P. DiLORENZO CARL ROSENBLOOM B ond, Schoeneck & King OWE LINCOLN CEJiTEB SYRACUSE, NEW YORK 1320^-1355 (3151 422-0121 TELEX 6 4 6 -5 9 0 III W A SHINGTON AVENUE ALBANY, NEW YORK 12210-2200 ( 518) 462-7421 PYLON PLAZA 5 4 5 5 NORTH FEDERAL HIGHWAY BOCA RATON, FLORIDA 3 3 4 3 1 -4 9 9 0 (3 0 5 ) 997-0411 1167 T H IR D S T R E E T SOUTH NAPLES, FLORIDA 3 3 9 4 0 -7 0 9 8 ( 813) 262-6612 August 27, 1984 JO H N C . KINNEY M947-I97-4I H U BERT C . STRATTON II927-I97B1 HOWARO H. CANNON '1927-19701 DAVID L.DAWSON THOMAS J . VALENTI BARRY R. KCK5UT M .CATHERINE RICHARDSON DAVID R. SHERIDAN JOHN GAAL J O S E P H ZAGRAN'CZNV CH APLES H-GRUNDNER THOMAS ft. SMITH JO SEPH R. COOK * RO BERT K.W EILER THOMAS D. KELEH ER R. DANIEL BORQONI JAMES N .SEELEY RONALD C. BERGER ROBERT C-ZUN D EL.JR.* DAVID A . RIGG S TH AO D EUS J . LEWKOWICZ LUCIA M. IZZO LAURENCE G.BO USO UET ANN R . PURDUE J O S E P H T.HOTONDO EDWIN J . K E L L E Y , J R . LARRY P.MALFITANO JOHN H.CALLAHAN JOH N G . McGOWAN RONALD G. HULL EDWARD RYAN CONAN J O S E P H P. VAN DE LOO G EO RG E J.GETM AN JEA N A. MACCHIAROLI JA N E T N. B L IS S DEBORAH H. KARALUNAS RYNA E . M EH R ** CHRISTIAN B. FELDEN ** DONALD S. DiBENEDETTO ROBERT A. LABERGE WILUAM R. MORIARTY MAURA A. FLOOD 'ALSO ADMITTED TO FLA. BAR ADMIT7ED IR FLA.ONLY Mr. Joshua H. Bennett, Jr. Whittaker, Clark & Daniels, Inc. 1000 Coolidge Street South Plainfield, New Jersey 07080 Re: Clark Minerals, Inc. v. Carbola Chemical C o ., I n c . Dear Jack: Enclosed is our bill for professional services rendered in obtaining a discharge of mortgage from Carbola Chemical Co., Inc. It is unfortunate that Ed Smith dragged us through the mud, but, the matter has been resolved favorably to Clark Minerals. I apologize for the delay in sending this bill to you, b u t , it has been a very hectic summer. Thank you for referring this matter to us. As always, it is a pleasure to be of service to you and your company. Please do not hesitate to contact us for any further assistance that you might need. Very truly vours, BOND, SCI^OE^ECK & KING JHC/lc Enclosure By : BOND, SC >ENECK & KING ATTORNEYS AT LAW ONE LINCOLN CENTER SYRACUSE. N. Y. 13202 1RS. NO. 15-0528062 August 30, 1984 Whittaker, Clark & Daniels, Inc. 1000 Coolidge Street South Plainfield, New Jersey 07080 Re: Clark Minerals, Inc. v. Carbola Chemical Co., Inc. F O R PROFESSIONAL SERVICES RENDERED through July 31, 1984 including numerous telephone conferences and correspondence with client, mortgagee, County of Lewis County Clerk, counsel for Royal Bank & Trust Company and Monroe Abstract & Title Corporation; ix a m ined law re: p o t e n t i a l action to compel mortgagee to issue IWiptihrae of m o r t g a g e : examined documents from client re: satis faction of mortgage held by Carbola Chemical Co.,.Inc.; prepared .discharge of mortgage; conducted out-of-office conference with dent -^f Carlapla Chemical and O b t a i n e d execution of dischage jrtgageg R e c o r d e d d i s charge of mortgage with County of Lewis County Clerk; and examined Abstract of Title for verification that discharge of m o r t g a g e was rec o r d e d ....... ..................... $500.00 DISBURSEMENTS T e l e p h o n e ................... $13.08 Recording Fees for M o rtgage D i s c h a r g e .... . 9.00 22.08 $522.08 Accounts Are Payable Within 30 Days I. ; ; V - Sandra A. Melville William H. Kissel Attorney at Law 61 Main Street Lake Placid, New York 12946 518-523-19B0 May 30, 1984 Joshua H. Bennett, Jr. Whittaker, Clark & Daniels, Ine. 1000 Coolidge Street South Plainfield, NJ 07080 re: Discharge of Mortgage Carbola Chemical Co., Inc. Dear Jack: Thanks very much for the copy of Mr. Callahan's letter and the attachments. I am glad that this matter has finally been resolved and I only wish that I could have been more help to you but, as I mentioned, I haven't seen Ed or done any.of.his.work.since.the.closing ............................. ' Sincerely, i '. tA W H K :mam William H. Kissel CHARLES A SCHO EN ECK.JR WILLIAM F. FITZPATRICK T RACY H. FERG U SO N L Y L E W. H O FN BEC K C H E S T E R H. KING, J R N. E A R L E EVANS F RA N C IS E . MALONEY F RA N C IS D. P R IC E JAM ES E.W ILB E R * ANTON H ZAHM H e n r y r . McC a r t h y RAYMOND W MURRAY, J R J O S E P H J . LAWTON, J R . G EO RG E C.SH ATTJCK L E S L I E H- DEMING JOHN J . DEE JOHN A. BEACH CH A R LES T. BEECHING, J R . WILLIAM P. BURROWS JOHN M .F R E Y E R * RO BERT W.KOPP ARTHUR E BONGIOVANNI JOHN S . FERGUSON C H A R L E S T. MAJOR RO BERT E. MOSES WILLIAM L .8 E R G A N ANTHONY R. PITTARELLI FRAN CIS MALONEY, J R . Wa l l a c e j . Mc Do n a l d J A M E S D. FITZPATRICK RO BERT J . HUNT STEPH EN L JOHNSON JA M E S E . MACHIN * DAVID N. SEX TO N GARY R GERMAIN THOMAS S EVANS * H. DEAN H E B E R L IG .J R THOMAS J. GROOMS RICHARD L. SMITH J A M E S P. MCDONALD * STEPH EN J . VOLLMER S . PAUL BATTAGLIA L. LAW RENCE TULLY PAUL M .SA N SO U CY* GARY M .CLARK RICHARO C . H EFTERN RICHARD D. HO LE G E O R G E H. LOW E T. P E T E R POETZ5CH JOHN D. ALLEN DAVID M .P E LLO W THOMAS E. M YERS L O U IS P. OiLO RENZO CARL ROSENBLOM B ond, Schoeneck 8c King ONE TJSTCOI.K- CENTER SYRACUSE, NE"VSTYORK 13203-1355 (3 IS ) 422-0125 TELE* 6 4 6 -6 9 0 <ll W A SH IN G TO N A V E N U E ALBANY, NEW YORK I2 2 I0 -E 2 8 0 <518) 4 S 2 -7 4 2 I PYLON PLAZA 5 4 5 5 NORTH FEDERAL HIGHWAY BOCA RATON, FLORIDA 3 3 4 3 1 -4 9 9 0 0 0 5 ) 997-0411 H67 THIRD STREET SOUTH NAPLES, FLORIDA 3 3 9 4 0 - 7 0 9 8 {813) 262-6812 May 16, 1984 GEORGE H. BOND. J R .(1936*1973} JOHN C KINNEY (1947-1974 I H U BERT C STRATTON <1927-19781 HOWAPO H. CANNON <1927-1979 DAVID L.DAVYSON * THOMAS J . VALENTI BARRY R.KOGUT M CATHERINE RICHARDSON DAVID R . SHERIDAN JOHN GAAL J O S E P H ZAGRANIGZNY CH A R LES H. GRUNONER THOMAS R. SMITH JO S E P H R COOK * RO B ER T K WEILER THOMAS D XELEH ER R. DANIEL BOROONI JAMES N SEELEY RONALD C BERGER ROBERT C ZUNDEL,J R r DAVID A. RIGG S T H A D D EU S J LEWKOWICZ L U C IA M. IZZO LAURENCE G. BOUSOUET ANN R. P URDUE JO S E P H T. ROTONOO EDWIN J K E L L E Y , J R . LARR Y R. MALFITANO JOH N H-CAULAHAN JO H N C MeGOWAN RONALD G. HULL EDWARD RYAN CONAN J O S E P H P VAN DE LOO G EO R G E J- GETMAN JEA N A . MACCHIAROLI J A N E T H. B L IS S D EBO RA H H. KARALUNAS RYNA E .M EH R * CHRISTIAN B. F E L D E N * ALSO ADMITTED TO FLA.BAR * ADMITTED IN FLA.ONLY Mr, Joshua H. Bennett, Jr. Whittaker, Clark & Daniels, Inc. 1000 Coolidge Street South Plainfield, New Jersey 07080 Re: Discharge of Mortgage Carbola Chemical Co., Inc. Dear Jack : I have received confirmation from the Lewis County Clerk's Office that the Discharge of Mortgage has been recorded. In addition, Monroe Abstract & Title Company was instructed to update the Abstract of Title to your property which would reflect the recordation of the Discharge of Mortgage. We obtained the original Abstract of Title from the Royal Bank and Trust Company in New York City. Enclosed is a copy of the Abstract of Title which demonstrates recordation of the Discharge. I am pleased that this matter has been brought to a successful conclusion. If you have any questions, please do not hesitate to contact me. As always, it is a pleasure to be of service to you and your company. Very truly yours, JHC/lc Enclosure Sheet A National Abstract Corporation a corporation organized under the laws of the State of New York, hereby certifies. That upon examination, by means of the General Alphabetical Indices thereto, of the records kept in the Lewis County Clerk's Office of Deeds, Contracts, Leases, Mortgages, Homestead Exemptions, Notices of Pendency of Action, Foreclosure by Advertisement, GeneralAssignments, Insolvent's Assignments and Wills, arid also from an Examination of the Loan Commissioner's Mortgages the following were found: No. A CarboXa Chemical Inc of Natural Bridge, N.Y to Clark Ninersls Inc of Natural Bridge, N.Y. Warranty Deed (with lien covenant) Dated Dec. 19, 1980 Ack'd Dec. 19, 1980 Consideration Sl.OO&c Recorded Dec. 22, 1980 Liber ij.li| of Deeds cp U4.8 J! For particulars, reference may be had to the record thereof. T 0i N A L For particulars, reference may be had to the record thereof Sheet B No. C Carbola Chemical Co Inc Postponement & Subordination of Watertown, N.Y. Dated June 2, 1981 and Ack'd June 2, 1981 The Royal Bank and Trust Recorded June 22, 1981 Company at ip:38 o'clock P. M. Liber 2 U 4. of Mtgs cp____ For particulars, reference may be had to said record. No. D Clark Minerals Inc of Natural Bridge, N.Y. Warranty Deed (with lien covenant) Dated June 22, 1981 to Ack'd June 22, 1981 County of Lewis Industrial Consideration $1.00&c Development Agency of Recorded Juns 22, 1981 Lowville, N.Y. . at ip:3 8 o'clock P. M. Liber 2pl8 of Deeds cp_ For particulars, reference may be had to said record. No. E County of Lewis Industrial Mortgage Development A.gency Dated June 1, 1981 to Ack'd June 22, 1981 The Royal Bank and Trust Amount $1,000,000.00 Company Recorded June 22, 1981 at ipr3 8 o'clock P. M. Liber 214 of Mtgs cp___ For particulars, reference may be had to said record, sheet C No. P County of Lewis Industrial Lease Agreement Development Agency Dated June 1, 1981 j and Ack'd June 22, 1981 Clark Minerals Inc June 22, 19&1 : Recorded June 22, 1981 : at lp13 8 o'clock P. M. : Liber 14.18 of Deeds cp___ Par particulars, reference may be had to said record. No. G County of Lewis Industrial Assignment of Lease Development Agency Dated__________, _ _ _ j to N a The Royal Bank and Trust 0I Company Ack'd June 22, 1981 Recorded June 22, 1981 at li.:38 o'clock P. M. Liber I4.I8 of Deeds cp_ For.particulars,.reference.may.be.had.to.said.record. s Acknowledgement and consent of Clark Minerals Inc by No. E t agreement of lease forms a part of said instrument. v 0 R P 0 R A Affidavit I 0 of Sworn to June 22, 1981 Recorded June 22, 1981 Paul V* Porte at i|:38 o fclock P. M. Liber Ul8 ofDeeds cp__ For particulars, reference may be had to said record Sheet D A N D FURTHER, That uponsuch examination as aforesaid, no conveyance orinstrument, executed by or against eitherofthefollowingnamed persona, was found recordedin aidoffice, indexed againstsaidpersons, oreitherofthem, within theperiodduring which searchwas made assetopposite thevrrespective names, viz: Clark Minerals Inc. from Dec. 18, 1980 to June 22, 1981 County of Lewis Industrial) : from June 21, 1981 to June 22, 1981 Development Agency ) Royal Bank & Trust Company from June 21, 1981 to June 22, 1981 H > 7 I O H 3 3 0 0 -4 O 5 ar J</>O > r > 2 O ------1 > 2 j 6 N affecting thetitletothepremises in No. D herein oftheforegoingabstract, except asinsaidabstractsetforth. And that upon examination of the Judgment Dockets kept in said office, there is no Judgment, Transcript of Judgment or Decree,which remains undischarged and appears to be a lienupon saidpremises, docketed against / Clark Minerals Inc from June 22, 1971 to June 22, 1981 County of Lewis Industrial ) : from June 22, 1971 to June 22, 191 Development Agency ) Royal Bank & Trust Company from June 22, 1971 to June 22, 1981 except as insaid abstract noted, and upon examination oftheDockets orIndices thereto,kept in,said office,no Sheriff's CertificateofSale since Dec. 1 8 , 1980 ' Orders appointing Receiver's since Dec, 18, 1980 Collector'sBonds within thethree years lastpast, Federal Tax Liens since during the six yrs . last past ConditionalSalesContracts ofgoods and chattels affixedto real estatewithin the three years lastpast, . Notices ofLiens forPublic Welfare Relief since March 15,1931, Criminal Surety Bond Liens since Jam iary 5,1936 Mechanic'sLiens within thetwo years lastpast, docketed or recorded in said office, executed by or docketedagainst theabovenamed persons or either of them which affect the titleto the premises described in No- D herein - - - - - - - - - - - - - - - - - except as insaid abstract noted, IN WITNESS WHEREOF, the said National Abstract Corporation has caused its corporate signature and seal tobehereuntoaffixedbyits Vice Pres ident duly authorizedthereto, this 22nd day of Jun8 j?8l, at l+:lj-0 o'clockP .Id. NATIONAL ABSTRACT CORPORATION. By .t ' ;i , t - g ; .. 1 " ~ .A . A . . \\ CHARLES A SCHOENECK, JR. WILLIAM F. FITZPATRICK TRACY H. FERGUSON L Y L E W. H 0R N BECK C H E S T E R H. KING, J R . N .EA R LE EVANS FRAN CIS E MALONEY F R A N C IS D. P R IC E * JAM ES E W ILBER* ANTON H ZAHM HENRY R MCCARTHY RAYMOND W. MURRAY, J R . J O S E P H J LAWTON, J R . G EO R G E C.SHATTUCK L E S L I E H. DEMING JOHN J- DEE JOHN A. BEACH C H A R L E S T. BEECH IN G . J R . W ILUAM P. BURROWS JO H N M. F R EY E R R O B E R T W. KOPP A R T H U R E BONGIOVANNI* JOHN S. FERGUSON C H A R L E S T. MAJOR RO BERT E. MOSES WILUAM L.BER G A N ANTHONY R. PiTTARELLI FRAN CIS E . MALONEY, J R . WALLACE J . MCDONALD J a m e s d . F itzpa trick R O B E R T J . HUNT STEPHEN L. JOHNSON JA M E S E. MACKIN DAVID N SEKTON GARY R. GERMAIN THOMAS s. EVANS* H.OEAM KEB ER LIG , J R THOMAS J- GROOMS RICHARD L SMITH JA M E S P. McDONALO STEPHEN J . VOLLMER S .P A U L BATTAGLIA L. LAW RENCE TU l LY PAUL M. SANSO UCY * GARY M.CLARK RICHARD C . HEFTERN RICHARD D. HOLE G EO R G E H. LOWE T. P E T ER POETZSCH JOHN D. ALLEN DAVID M. PELLOW THOMAS E . MYERS LO U IS P- DlLORENZO CARL ROSENSLOOM Borni, Schobneck & King ONE XTNC-OXiN CENTER SYRACUSE, NEW YORK 13SOS-1355 (315.) 422-0121 TELEX 6 4 6 - 6 9 0 Ml W A SH IN GTO N AVENUE ALBANY, NEW YORK 12210-2280 ( 513) 462-7421 PYLON PLAZA 5 4 5 5 NORTH FEDERAL HIGHWAY BOCA RATON, FLORIDA 3 3 4 3 1 -4 9 9 0 ( 3 0 5 ) 97-0411 1167 T H IR D S TR E ET S O U TH NAPLES, FLORIDA 3 3 9 4 0 - 7 0 9 8 (613) 2 6 2 -6 8 1 2 G EO RGE H BOND. JR .I9 3 6 -I9 7 3 ) JOH N C KINNEY (1947-1974 I HUBEHT C-STRATTON (I927-I97SI HOWARD H-CANNON 0 9 2 7 -1 9 7 9 DAVID L . DAWSON * THOMAS J . VALENTI BARRY R. KOGUT M .CATHERINE RICHARDSON DAVID R SHERIDAN JOHN GAAU JO SEP H ZAGRANICZNY CHARLES H.GRUNDNER THOMAS R. SMITH JOSEPH R.COOK ROBERT K.W EILER THOMAS D KELEH ER R DANIEL BORDONl JAMES N SEELEY RONALD C BERG ER RO BERT C 2U N D EL.JR * DAVID A. R IG G S T H A D 0 E U 5 J- LEWKOWIC2 LUCIA M I2ZO LAURENCE G. BOUSQUET ANN R . PU RD U E JO S E P H T ROTONDO EDWIN J . K E L L E Y , J R . LARRY P. MALFITANO JOHN H. CALLAHAN JOH N G . McGOWAN RONALD G HULL EDWARD RYAN CONAN J O S E P H P. VAN DE LOO G E O R G E J GETMAW JEAN A.MACCHIAROL! JAN ET H. BLISS D EBO RAH H. KARALUNA5 RYNA E . M EHR * * CHRISTIAN B. FELDEN * April 5, 1984 ALSO ADMITTED TO R.A. BAR * ADMITTED IK FLA.ONL1 Mr. Joshua H. Bennett, Jr. Whittaker, Clark & Daniels, Inc. 1000 Coolidge Street South Plainfield, New Jersey 07080 Re: Discharge of Mortgage Carbola Chemical Co., Inc. Dear.Jack : This letter follows up our phone conversation of this afternoon. Enclosed are copies of the following documents: 1) A Discharge of Mortgage executed by Edward R. Smith, President of Carbola Chemical C o . , Inc. This pertains to the mortgage previously held by Carbola Chemical on property owned by Clark Minerals, Inc. in Diana, New York; 2) ' A copy of the Promissory Note between Clark Minerals, Inc. and Carbola Chemical. At the b o t t o m of the addendum to this Note is a signed acknowledgement by Edward R. Smith, President of Carbola Chemical indicating that the original Note has not been located, but, the Note has been paid in full. . I will take the necessary steps to record the Discharge of Mortgage and insure its documentation on the Abstract of Title to the property. Page 2 Mr. Joshua H. Bennett, Jr. April 5, 1984 If you have any questions, please contact me. Very truly yours, BOND, SCHjZpNECK & KING JHC/lc Enclosures JoVn H. Callahan That CLARK MINERALS, INC., a New YorK corporation witn oxxices at Natural Bridge, New York, obligor is held and. firmly bound unto CARBOLA CHEMICAL CO., INC. obligee in the sum of Two Hundred Fifty-Six Thousand and no/100 ($256,.000000..0000)) DDollars, lawful money of the United States of America, to be paid to the said Carbola Chemical Co., Inc. well and truly to be made it binds itself, its successors or assigyis firmly by these presents. December Dated the Nineteen Hundred and Eighty day of bounden Clark Minerals, Inc. its successors or assigns, shall well and truly pay, or cause to be paid, unto the above named Carbola Chemical Co., Inc. Two Hundred Fifty-Six Thousand and no/100 ($256,000.00) with interest at the rate of 8 1/2% per annum, payable as follows: $107,500.00 plus interest accrued on the outstanding principal balance on April 1, 1981; $107,500.00 plus interest accrued on the outstanding balance on April 1, 1982; and $41, u00.0 0 plus interest accrued on the outs balance on April 1, 1983. ng Ob)icor sh cr i of e time after if ifrr g c x p t i & p t y i t g m t * that tin- whole of /aid principal sum shall "become due at the option of the said obligee its legal representatives or assigns after default in the payment of any installment of principal. . or of interest for thirty days, or after default in the paym ent of any fax, water rate or assessment which m ay be levied or imposed upon the premises described in the mortgage accompanying this bond for thirty days after notice and demand. it t idtf agrtth that the said obligor will "keep the buildings on the said premises described in the said mortgage insured against loss by fire for the benefit of the mortgagee therein. All of the covenants and agreements in the mortgage covering premises therein described and collateral hereto, are hereby made part of this instrument. See Addendum to Note 3/h Printin' oi The obligor has caused its corporate seal to be hereunto affixed, and these presents to be signed by its duly authorized officer the day and year first above written. C l a r k M i n p r a l s . __ I n c . 7 i Josmia H. Bennett, Jr. _rb/ ss.. ,rj V-V, r?? TIT, i.-obimgfeityp e r d o n a l i ] / 2C:/cw-jolu'm'l ,aiac.h o;..'Lh/cin js b y v i e d u l y U t n o^ : J u o m ,u * * d i d d -ep o sc a n d s a y 1 h a t thf u ile resides i n c o nProsi denct e s . r , l e i ir-, "Jc-ix. iU'^y /' u av',\o1f u Chli aehrkc xMefrunierrds, ltsh, ^ v. * >; f"i a i h'e is aIbnocv.e I n s t i a m e n i ; i n a i h o f sa-id co rp o r u t con; o r n i i n a i he s i g m d h i s mime iiw r c io b y li k c o r i n . Law Of f ic e s Apruzzese & McDermott A Pr o f e s s io n a l C o r p o r a t io n In depend ence Plaza S 500 pr in Mo gfi r e r is ld, NA.vJe. n0u7oe st (SOU 46 7 -JJT 6 V. lyrj TO:./Hi.ik-d.Lzs-'t., Ar4$e-?c/u.t%i . HmpEeaRrislEoinnIgTal/i1tnSwo-t-ie-t-h. Tooutgteatktihnigs tthoeytoimu eprtoomwprtilte^wyeouarae ec.- f l u $M?3. JEFFERSON NATIONAL BANK W A T E R T O W N , N EW Y O R K 13601 CHARGEWE YOUfi ACCOUNT __CCi__ m m OFFICE _ D E P A R 'i ..NT h r , r a rh o la C h e m ic a l C r\ T n r , | 506 6 ACCOUNT NUMBER T R .C O O E r4 / 2 4 / 8 1 . PREPARED BY_ ,,A P P R O V E D BY Clark Minerals Inc. % Whiiaker, Clark & Daniels, Inc. G 20 5.S F -3 PA R T lOOOCoolidge St. S. UNE 1 1 5 .0 7 1 . 2 9 _ AM O UNT Vp n 506 00 30B "1 /OO 1 1 50 7 1 21/ PHONE: (315) 644-4443 VENDOR .0 1 3 0 4 5 'K? rtiiiuiiiii MUIKS ''ERALS, INC. NATURAL BRIDGE, N Y 13665 001382 "SD A T E ; 03 -Sb -f^ i Ovi/\ ''JP `(j| *****120,122.50 I C co. m e.TO THE ORDER OF assola chemical *eWffeArTsElmR--TkONWaN(tj-,ioNnY0a1l30B60a1nk 1677 STATE street ATtKT0.*N NY 136 V I / i:oa 13 l LESS: SO& 00 30fl &n* ZOO 120122 50/ ADDENDUM TO NOTE BETWEEN CLARK MINERALS, INC., OBLIGOR AND CARBOLA CHEMICAL CO., INC., OBLIGEE DATED: DECEMBER IJ, 1980 Obligor shall have a right of offset under this Bond in the event that any claim should arise under the Uniform Commercial Code - Bulk Transfers Act (UCC Section 6-101 et. seq.) or under the provisions of the New York State Tax Law with respect to sales tax liability arising from transfers in bulk (Tax Law Section 1141). If such a c l a i m is as s e r t e d against O b ligor, O bligor shall promptly notify Obligee. Obligee may contest, at its own expense, the validity of any claim. If Obligee does not contest the claim in a timely manner, or if the claim be finally adjudicated against Obligor, without opporunity for further appeal or without further appeal being taken at Obligee's request, Obligor shall set off from the next payment due Obligee under the bond the full amount of such claim, any interest or penalties added to such claim, and r e a s o n a b l e e x p e n s e s incurred b y Obligor in c o n n e c t i o n .w i t h such claim, including reasonable attorneys* fees and disburse ments. Should the sums eligible for offset exceed the amount then due and owing under the Bond, Obligee shall indemnify and save harmless Obligor from any liability or liabilities in connection with such claims pursuant to the Bulk Sales L a w or above stat e d section of the Tax Lav:. S uch i n d emnity shall include all reasonable expenses incurred by Obligor in contesting or defending any such claims, including attorneys' fees and disbursements. C iav AAa fa-L--, ('. JQNOuoHatalNirfyiGePd.uMibnlciOGc,rOiSoWntaA.tCNsoo.fNNoe.w47Y6or5lt003 . MU ___ __ . /!> 1 / l\n m J U liM e iil5 lh e 3 f |I r c s e u t 6 . T h at CARBOLA CHEMICAL CO., INC. TUTBLANX does hereby certify that a certain Indenture of M ortgage bearing date the 19th day of December Nineteen. H undred an d Eighty m ad e an d executed by CLARK MINERALS, INC., a New York corporation with offices at Natural Bridge, New York to CARBOLA CHEMICAL CO., INC., Natural Bridge, New York to secure paym ent of the principal sum of Two Hundred Fifty Six Thousand and 00/100-------------------------------------D ollars, and interest, an d duly recorded in the office of the Clerk of the County of Lewis N. Y., in Liber 212 o f M ortgages, ofxsE/stiaiii p age 183 , on the 22nd d ay o f December N ineteen H undred an d Eighty I S PAID, and does hereby consent th a t the sam e be discharged o f record. The said m ortgage h as n ot been as signed, icxKKfdy.usifotkyaistx 3n Blthtpas m ifyim if, the party of the first part has caused its corporate seal to be hereunto affixed, an d these presents to be signed by its duly authorized officer this day of N in eteen H undred and- CARBOLA CHEMICAL CO. , INC. y j Edward R. Smith, President & in lf u f mtt fo r k sisrtg s f \ / ` On this ft-fK day of N ineteen Hundred, an d Eighty-four ^ before m e personally cam e EDWARD R. SMITH to m e personally kwonm., veho, being by m e duly t i f o n i. did depose an d say ttr.it ' resides in 'watertown, New York in..!'.. . thc Fresiaent Cartola Chemical Co., Ine. ih e rporti fio?! deserti^-: in. and u Lirh cxecufec . ; > 0; cn : iby. knows th sedi o f sa id corporation ; (h ai t h sedi ajnxe.c to sa::., lu strin i,c u i <v scc:thJ// : -vr' v ! ;/j 1 .' ' '' ; ' ti or-: an d t il di he sisiicd nani e ; Jot-m e b,/ : CHARLES A.SCHOENECK, JR. WILLIAM F. FITZPATRICK TRACY H. FERGUSON LYLE W. HORNBECK C H E S T E R H. KING, j p . N .E R LE EVANS F R A N C IS E.M ALONET FRANCIS O. PRICE JAM ES E WILBER ANTON H ZAHM HENRY R , MCCARTHY RAYMOND W- MURRAY, JR J D 9 E P H J . LAWTON, J R . G EO RG S C.SHATTUCK L E S U E H. DEMING JOHN J. DEE JOHN A -BEACH C H A R LES T. BEECHING, J R . WILLIAM P- BURROWS JOHN M -fR EY ER * R O B E R T W. KOPP ARTHUR E . BOHGIOVANNI * JOHN S . FERGUSON C H A R L E S T. MAJOR RO BERT E. MOSES WILLIAM L . BERGAN ANTHONY R. PlTTARELLI FRAN CIS E . MALONEY, J R . W A LLA CE J . McDNALD J A M E S D. FITZPATRICK RO BERT J . HUNT* STEPH EN L-JOHNSON J A M E S E . MACKIN DAVID N, SEXTON * GARY R. GERMAIN THOMAS S . EVANS H. DEAN M ESERUGrJR . THOMAS J . GROOMS RICHARD L . SMITH CARL E,M . WORBOYS JA M E S P. MCDONALD STEPH EN J . VOLLMER S . PA U L BATTAGLIA L . LAWRENCE TULLY P A U L M. SANSO UCY GARY M .CLARK RlCHARO C. HEFFERN RICHARD d . Ho l e G E O R G E H. LOWE T. P E T ER POETZSCH JOHN D. ALLEN DAVID M. PELLOW THOMAS E . MYERS L O U IS P. DfLORENZO CARL ROSENBLOOM B on, Schoenbck 8c Kino ONE U N C O I/N CBjNTBR SYRACUSE, N W YOHK 13SO-13S5 [3 1 5 )4 2 2 -0 1 2 ! TELEX 6 4 6 - 6 9 0 III W A SH IN G TO N A V E N U E ALBANY, NEW YORK I22IO -22Q O (5 1 8 )4 6 2 -7 4 2 1 PYLON PLAZA 5 4 5 5 NORTH FE DERAL HIGHWAY BOCA RATON, FLORIDA 3 3 4 3 1 -4 9 9 0 f3 0 5 ) 997-04N 1167 T H IR D S T R E E T S O U TH NAPLES, FLORIDA 3 3 9 4 0 - 7 0 9 8 (813) 2 6 2 -6 8 1 2 January 27, 1984 G EO R G E H B O N D -J P .11536-19731 JOHN C . KINNEY {1947- 1974 I HUBERT C. STRATTON (I9B7-I97B! h o w a r d H .C a n n o n (1927-19791 DAVID L- OAWSON THOMAS J . VALENTI RARRY R.KOGUT M. C ATH ERIN E RICHARDSON DAVID R .S H E R ID A N JOHN GAAL J O S E P H ZAG RAN ICZNY CHARLES H.GRUNDHER THOMAS R SMITH JO SEPH R. COOK RO BERT k. W EILER THOMAS 0. KELEH ER R. DANIEL BORDONI JAMES N .SEELEY RONALD C. BERG ER RO BERT C.ZU N D EL.JR,* DAVID A . P 'G G S TH AO D EUS J . LEWKOWfCZ LU CIA M. IZZO LAURENCE G. BOUSOUET ANN R. PUROUE J O S E P H T. ROTONDO EDWIN J . K ELLE Y , J R . LARR Y P. MALFITANO JOH N H. CALLAHAN JO H N G . MCGOWAN RONALD G. HULL E dw ard ryan conan J O S E P H P. VAN D E LOO G E O R G E J . GETMAN JO SEPH P. KUBAREK JEA N A. MACCH1AR0LI J A N E T H. B L IS S DEBORAH H. KARALUNAS 'A LSO ADMITTED TO FLA. BAR Mr. Joshua H. Bennett, Jr. Whittaker, Clark & Daniels, Inc. 1000 Coolidge Street South Plainfield, New Jersey 07080 Re: Discharge of Mortgage Carbola Chemical Co., Inc. Dear Jack: '.... I .acknowledge receipt.of.your.various.materials.in reference to this matter. We have located Edward R. Smith. He is currently residing at 1106 State Street, Watertown, New York. An associate in our office, John McGowan, knows Mr. Smith personally and has dealt with him in the past in other legal matters. I decided that it would be worth our while to have John contact Smith to see if he would voluntarily agree to executing the discharge. John had no trouble reaching Smith and he assured John that he would execute the discharge as soon as he received it. With the hope of saving additional legal expense, we will give Smith one last chance. Today, by separate cover, the discharge of mortgage was mailed out to Smith for his execution. We have also asked him to return the mortgage note with the stamp that it has been paid. I hope Smith has not misplaced this note over the course of time. I will keep you advised of all future developments. Please do not hesitate to contact me if y o u have any questions. Very truly yours, BOND, S C ^ E N E C K & KING JHC/lc PHONE: (315) 644-4443 lR K b SSH*flSl NATURAL BHffi(0iE1055fIM665 2225 VENDOR DATE B AMOUNT oisoos 03*30-83 ^ l * ! * * * ^ r48B 00 8S ! ? Jefferson Natio: TO THE ORDER OF WA|ERTOWiy r c-o.cakbqu c h e m i c a l , i N c . J^n-os 1106 STATE STREET n'ATERTOWW NY 13S0I 5 02- 11136 5 2 13 iIE.5Si: 506 00 300 &' i''OOOMiUBSOOi'1 Jack Iknnctt h s ujtfc f C ^ M - j / r / i . ' ^ / / i s* <f (fs'r'r7**ur^*K p r--------- s&s iHnUteitnf/g:s'ws e/rv/si c e s / i n c /triJTyC/Jh. / ^ P ea^i * /&M>Kr' 'i, l' 1*. y'iij U J> T / William H. Kissel Attorney at Law 61 x J t s s Main Street Lake Placid, New York 12946 518-523-19BQ December 8, 1983 Mr. Jack Bennett Whittaker, Clark & Daniels, 1000 Coolidge Street S. Plainfield, NJ 07080 Inc. Dear Jack: In response to your letter of November 18, 1983, I, unfortunately, have not heard from, seen nor been in touch with Ed Smith for the last six months, other than m y letter to him of August 10, 1983. in fact, I have had very little to do with Ed for about the last year and a half. I wish I could be of some help to you regarding this matter but I am afraid I have done all I can. Sincerely, W H K :m a m V-. OsL^-.William H. Kissel from the desk of JA CK B EN N ETT / / - /P'cfJ FEMVFFMRMJPBCrrarlihhoieaencawaemalnruihclndnvornerreaickeiosliiipnnrceitrdesteFdXtiBsLHcJ.A..JJ,.T.MkCMFGW....DH..MugNAVTeThMaeV.rDlaibeienasatapDslerrcscshrtdlaruweakoriiyemnaorzareomsazno<vdgiUbeen)itiek)rcs,tn,ehJ(,i)I)Jr,UI!IJ2)h.()h5,().i()i()6(3) )(4) Ba r r y Ma k e l i Le w is Ms Le f k o w it z I2) ALSO D.C. BARI1) ALSO N.Y. BAR 12) ALSO CONN. SAH (3 ) ALSO PA. BAR (4) ALSO MD, BAH IS) ALSO CALIF. SARIO) Law Offic e s A pruzzese & M cD ermott A Professional Corporation Independence Plaza 5 0 0 Morris Avenue P:0. Box 329 S pringfield, N.J. o7obi (201) 467-177G July 27, 1983 1730 P ennsylvania Av e.,N.W. Wa sh S d ite ington ,ioD.oGo.2000a 1 20 2)30 3 -7 31 0 521 F ifth Avenue Shite 1700 New York, N.Y.10017 1213) 602-064-1 T l c o p ia s : (soi) 4 9 7 - 3 0 1 2 In REPLY PLEASE REFER To F lu , No William H. Kissel, Esq. P. 0. Box 1980 Lake Placid, N.Y. 12946 _ ' Re: Clark Minerals, Inc. with Carbola Chemical Co., Inc. Dear Mr. Kissel: This is to confirm my telephone request to your office regarding cancellation of the second mortgage held b y your client, Carbola Chemical Co., Inc., upon the property in Diana, Lewis County, New York. As I understand it, the mortgage was paid in full as of April 1, 1983 and our client is still awaiting return of the mortgage papers with the Bond marked "paid and cancelled" and with an appropriate satisfaction piece for recording of record. I believe you will agree these papers are now long overdue, after repeated requests, and we would request that they be forwarded to us without further delay within ten (10) days from date hereof. Your cooperation in concluding this matter will be greatly appreciated. MTV:jrc cc : M r , Joshua H Bennett, Jr VF binacnehn tX.JM. cADb ruz erm zoetsteU)U()2) MFrearnrcitist AT..MVaissctarrod(ii)(2) JF a r m es F. e d e r ic kMuTh. Dp ha yn (i) ser , III EMiawuoroicde JJ. .HNeeerllvitgaaone,nJ, J r r.(o.()I)(6> R ic h a r d G. Ma r ia n i Melvin L.G elade P h il ip B. Wh itco m b Bo n n ie H. Da n se r Ch a r l e s F. Wa s k e v ic h , J s . jo iw Ba r r y Marell Le w is H . Le f k o w it z o ) ALSO D.C. BAR 11) ALSO N. Y. BAR (S) *Tan rnuv n a l s o p a . b a r (4) ALSO MD. BAH/5) ALSO CALIF. BAR(S) Law Of f ic e s A pruzzese & M cD ermott A Professional Corporation Independence Plaza 5 0 0 Mo rris Av en u e P.0. Box 329 Sp r in g fie l d , N.J.ozosi (201) .*0 7 -1 7 7 0 July 27, 19S3 173W0aPsheninSngustyitolevna,inoD.ioaGo.A2v0e0.0,N6.W. 1202)393-7315 521 Fifth Avenue New YS uoritke, 1700 N. Y. jooiz (2 1 2 ) 0 0 2 - 5 0 4 4 T e l e c o p ie r : (so i) 4 ? - o i2 In Repl y P l e a s e R e f e r To Fil e N o . William H. Kissel, Esq. P. O. Box 1980 Lake Placid, N.Y. 12946 Re: Clark Minerals, Inc. with Carbola Chemical Co., Inc. Dear Mr. Kissel: This is to confirm my telephone request to your office regarding cancellation of the second mortgage held b y your client, Carbola Chemical Co., Inc., upon the property in Diana, Lewis County, New York. As I understand it, the mortgage was paid in full as of April 1, 1983 and our client is still awaiting return of the mortgage papers with the Bond marked "paid and cancelled" and with an appropriate satisfaction piece for recording of record. I believe you will agree these papers are now long overdue, after repeated requests, and we would request that they be forwarded to us without further delay within ten (10) days from date hereof. Your cooperation in concluding this matter will be greatly appreciated. Very truly yours. MTV :jrc cc : Mr. Joshua H. Bennett, Jr. ss ( O ^ / C (y L Q ] u e ^ ^ ^ ^ t / fia ^ / u t c ,. I i i f r o m tlie d ^ i k : o f M SM M TT T . V ISC A B D J July 27, 1983 TO Joshua B. Bennett, Jr. Rei Clark Minerals, Inc. with Cartola Chemical Co., Inc. Dear Jack: Have the items in Raul Lapin Saifter 's letterofApril 24, 1981 been taken care Of? ... Kindly advise. PSForm3811, Dec-U SSENSE* space I on reverse. ------- (CONSULT POSTMASTER FOR FEE S ) 1. The following service is requested (check one). S Show to whom and date delivered.................... -- >$ Show to whom, date, and address of delivery.. -- /? !i -n^ rBe Fs tSrTicRte1dCTdeElivDerydfeeelisivchearrgeyd in additio.n to * the return receiptfee.) t o t a l $_ : 3. ARTICLE ADDRESSED TO: , ///AoT>j?TH/a/ MspJY'-rAHJ/ 4 type o f SERVICE: I article number REGISTERED INSURED g CERTIFIED EICOD " ^ ^ ^ h ta in signature o t'addressee or agent) ~ Jhkve received the article described above. SIGHATUBE Addressee Authorized agent No, V - X : <)'[) neCEiPl FOR CERTIFIED MAIL N9 INSURANCE COVERAGE PROVIDED-- HOT'FOR NTERNATONAL #161!. (Saa Reverse) STICK POSTAGE STAMPS TO ARTICLE TO COVER FIRST CLASS POSTAGE, CERTIFIED MAIL F E E , AND CHARGES FOR ANY SELECTED OPTIONAL SERVICES, (see front) 1. If you want this receipt postmarked, stick the gummed stub on the left portion of the address side of the article, leaving the receipt attached, and present the article at a post office service 2 window or hand it to your rural carrier, (no extra charge) . If you do not want this receipt postmarked, stick the gummed stub on the left portion-of the address side of the article, date, detach and retain the receipt, and)mail the article, . 3 If you want a return receipt, write the certified-mall number and your name and address on return receipt card, Form 3 S .ll, and attach it to the front of the article by means of the gummed ends if space permits. Otherwise, afix to back of article. F.ndorse front of article RETURN RECEIPT REQUESTED adjacent to the number. : . ... 4. If you want delivery restricted to the addressee, or to an authorized agent of the adrf'fe'S&e. endorse RESTRICTED DELIVERY on the front of the article. I V; ' 5. Enter fees for the services requested in the appropriate spaces on! the front of this receipt. If return receipt is requested, check the applicable blocks in `item 1 of Form 3811. 6. Save this, receipt and present it if you make inquiry. > G r o `I 7 9 c. (a p D d I Z P UB `W IS rterwo t *n cnaidiuirid Hinoe ' n gTPTh*Vf!-)S>r;.!<M?HaVaTa3ilHf3'>OiDVli0IM00AX .! .1 .3Mhi3>T "H T f Oi Nani3d usqumuorjosctfpe .psrssnbsHidtajSHUiniaH,,appicajjopuj ,S|lUljad>|3i[Pt*91|t0Wxi*tqlolWtra<g]s<s>s|l*'PjtiHiioV ,,-- 'ssjsai iqi-uot pat 'c'! 'r tusii iisidmop . ' c r -MiJisqaaedsaqiuispopatfpire'ssiJppi'iuieujnoMuuj OQES`30VlS0d dQ / iN3WAVd dlOAV 013Siy . \ SNOUOnaiSNI H30N3S aiVAiarf yoj ahvn3<i ; * , \ SS3NISnS IVIOIddO L ; ao/tMasivisodSHXVisaaiiNn .... _ ......... sJtttria-mmteKrtdSowtwaanxted, WSR*trSeme1i3tt63h1 m r c h 2$, i m i Dean K i dBrnawclnomtod tIh#e Cohredcekr SoofC2a2r2h$e,l-a dCahtemdicKaelrcCho*2,2-Tec1*222* to r $44*423*00* hof braovtehamet hooeuenestoeaIcndocnmlduodmretgsoarttggheaegnefointne&oetlenpdpa2xs3soa*p4no8tr5lg*o8f 0mt htihneetspedrreipnsatci*idp aeKlndiol lfr c$2t4ma2r,m8k8idn6*d6tlog8 s- #fc y<n:r earliest convenience* Tbheaaitsirpyeorusonwaol?$remgoabrdfsatrotrgaoitt***? omro ts th'is m tt.o t* Se a il s*f ear. SiBGOteZy*.... -......... ... ;. Hsxsrximi, ce&mt & m a i m s , i k g * 3* H* Bennett, Jr* Vice President j-h s /b c i S.neloimxa . . . . '' '. 'Certified Bail, Return Receipt 'Requested 'hacs .Mr, i?. G, Light ' Mr, m * C* Arggelan , Dick: Just as soon as we receive tJae paid note, I will arrange- to take the- necessary steps to renews this restriction from the records of the Lewis County Recorder, is. Lowville, -Mew fork* TOTALLY OR PARTIALLY EXEMPTED REAL PROPERTY TOWN OF DIANA DIANA, NEW YORK J ^ $ / Pan- , 1982 To Whom It May Concern: This is to certify that Assessment Roll/s show the property or properties assessed as follows: Township Diana Lot No. 896, 908, and 909 Description Northside N.Y.S. Route 3 Name County of Lewis I.D.A. (Clark Minerals Project) Assessed Valuation $400,000.00 Exempt The current Tax' and Assessment Roll shows the said property to be.exempt.in.the.amount of $400,000.00.under Section 874 of the General Municipal Law. - adley Farr Assessor Town of Diana Mr. John Richards The Royal Bank & Trust Company 68 William Street New York, New York 10005 Dear John: With respect to the Consolidated Financial Statements For the years ended December 31, 1980 and 2981, which were forwarded to you in a separate envelope, we certify that the executive officers of this company have reviewed the terms of the Guaranty between Whittaker, Clark 8 Daniels, Inc., The Royal Bank and Trust Company, and The County of Lewis Industrial Development Agency. As such, we have made a review of the transactions and conditions ox the company during the fiscal years with respect to which such financial statements were delivered and that review has not disclosed the existence, during the accounting periods covered, of any condition or.event.which constitutes an "event.of default* specified in Section 1.04 of the Guaranty. Further, to the best of my knowledge, no event or condition exists as of the date of this letter which would constitute an "event of default.* Further, to the best of our knowledge, no transaction has occurred with respect to the agreement which would, in of itself or in conjunction with other transactions, jeopardize the nontaxable status of the Bond. Very truly yours, W I T T AKER, CLARK S DANIELS, INC. RGL/mcl H. G. Light Executive Vice President CHARLES A. SCHOENECK, JR. WILLIAM F. FITZPATRICK TRACY H. FERGUSON L Y L E W. H O RN BECK C H E S T E R H. KING, J R . N, E A R L E EVANS FRANCIS E . MALONEY FRANCIS O. PRICE JAMES E . W ILBER * ANTON H.ZAHM HENRY R. MCCARTHY RAYMOND W. MURRAY, J R . JO S E P H J . LAWTON, J R . G EO RGE C.5HATTUCK L E S L IE H. DEMING JOHN J . DEE JOHN A.BEACH CH A R LES T. BEEC H IN G , JR . WILLIAM P. BURROW S JOH N M. F R E Y E R RO BER T W.KOpP ARTHUR E , BONGIOVANNI JOHN 5 . FERGUSON CH A R LES T. MAJOR Bond, Schoeneck & King ROBERT E.M O SES WILLIAM L . BERGAN ANTHONY R . FATTARELLI* FRAN CIS E . MALONEY, J R . WALLACE J . MCDONALD* JA M ES D. FITZPATRICK RO B ER TJ.H U N T* STEPH EN L. JOHNSON JAM ES E.M ACKIN * DAVID N. SEXTON * GARY R. GERMAIN THOMAS S .EV A N S * H. DEAN H E B E S LIG .JR . Thom as j . g ro om s RICHARD L . SMITH C A R L E . M .W OPBOYS JA M E S P. MCDONALD STEPHEN J . VOLLMER S . PAUL BATTAGLIA L. LAWRENCE TULLY PA U L M. S A N SO U C Y * DAVID PATRICK O'HARA GARY M. CLARK RICHARD C .H EFF6 R N OWE IlN C O L l C E N T ER S Y R A C U S E , 3ST3TW Y O R K 1 3 3 0 0 - 1 3 5 5 111 W A S H IN G T O N A V E N U E A L B A N Y , N EW YO RK 12210 -2 2 S O (51 8) 4 6 2-7 42 1 PYLON PLAZA 5 4 5 5 NORTH FEDERAL HIGHWAY BOCA RATON, FLORIDA 3 3 4 3 1 -4 9 9 0 (3 0 5 ) 997-0411 (167 THIRD STREET SOUTH NAPLES, FLORIDA 3 3 9 4 0 -7 0 9 8 (SI3 ) 2 62 -6 B I2 May 14, 1982 G EO RG E H. BOND, JR .I9 3 6 -I9 7 3 ) JOH N C . KINNEY 11^47-19741 HUBERT C.STRATTON N97-I&78J HOWARD H. CANNON /I927-I979) JOHN D. ALLEN RICHARD D .H O LE DAVID M. PELLOW PAULA LAPIN S ElF T EP THOMAS E . MYERS LOUIS P. DiLORENZO RO BERT D. E SSIG DAVID L , DAWSON THOMAS J.V A LEN TI * BARRY R. KOGUT M .CATH ERIN E RICHARDSON DAVID R. S HERID A N JOHN GAAL JO S E P H ZAGRANICZNY CHARLES H.GRUNONER THOMAS R. SMITH JO S E P H R.COOK ROBERT K.W EILER THOMAS D-K ELEH ER K ER RY J , HANLON R. DANIEL BORDONI JAMES N-SEELEY RICHARD P. SMITH MURRAY N CAPLAN E LIA M. D E SR U IS S EA U X RONALD C. B ER G ER ROBERT C.ZUNDEL, JR . DAVID A. R IG G S THADD EU S J LEWKOWICZ LUCIA M.12ZO LAURENCE G .BO USQ U ET ANN R .P U R D U E iO AOMITTEO TO FLA, BAR Mr. Michael C- Argyelan Controller Whittaker, Clark and Daniels, 1000 Coolidge Street South Plainfield, New Jersey Inc. 07080 Re: Clark Minerals, Inc Dear Mike: E n c l o s e d .p l e a s e .f i n d .a .c o n f o r m e d .c o p y .f o r .y o u r .f i l e s .o f .o u r . opinion letter to Lewis County Industrial Development Agency and the Royal Bank and Trust Company.as required by Section 3.6 of the Lease Agreement between Clark Minerals, Inc. and The Agency. Today I mailed out the opinion letter and the Certificate of Project Completion Date to the Agency and the Bank. We did not issue this letter sooner because we were waiting for the New York State Secretary of State's written search report verifying that the appropriate UCC-1 Financing State ments were on record. Thank you for your cooperation and patience in this matter. If you have any questions, please do not hesitate to contact me. Very truly yours, BOND, SQIjlOENECK & KING 7 JHC/lc Enclosures fj6hn H. Callahan CH A R LES A.SCHOCNECK, JR . WILLtAM F, FITZPATRICK TRACY H. FERGUSON LYLE W.HORNBECK C H E S T E R H, KING, J R , N .EA R LE EVANS FR A N C IS E . MALONEY FRANCIS 0 . PRICE JAM ES E. W ILBER* ANTON H.XAHM H EN RY R . MCCARTHY RAYMOND W. MURRAY, J R . JO S E P H J.LAW TONtJ R . G EO R G E C.SHATTUCK L E S L I E H. DEMPNG JOHN J . DEE JOHN A. BEACH CH A R LES T. BEECHING, JRWILLIAM F. BURROW S JOHN M .FR EYEP R O B E R T W. KOPP ARTH UR E.BONGIOVANNI* JOHN S- FERGUSON C H A R LE S T, MAJOR Bond, Schoeneck & Kintg RO BERT E . MOSES WILLIAM L . BERGAN ANTHONY fi.P ITTA R EU J * FRANCIS E.MALONEY, J R . W A LLA CE J . McDONALO * JA M E S D. FITZPATRICK RO BERT J . HUNT* STEPH EN L.JO HNS0N J A M E S E.M ACKIN DAVID N, SEXTON GARY R. GERMAIN THOMAS S . EVANS H.DEAN h e b e r l ig . j r . THOMAS J . GROOMS RICHARD L . SMITH C A R L E . M .W ORBOYS J A M E S P.MCDONALD * STEPHEN J . VOLLMER S .P A U L BATTAGLIA L . LAW RENCE TIJLLY P A U L M. SAN SO U CY * DAVID PATRICK O' HARA GARY M .CLARK RICHARD C .H EFFER N O N E LIN CO LN C E N T E R SYACTTSB, N E W 1TOEK 1 3 2 0 2 -1 3 5 5 (315)422-0321 111 WASHINGTON AVENUE ALBANY, NEW YORK 2 2 1 0 -2 2 6 0 (516) 462-7421 PYLON PLAZA 5 4 5 5 NORTH FEDERAL HIGHWAY SOCA RATON, FLORIDA 3 3 4 3 1 -4 9 9 0 (3 0 5 ) 997-0411 U67 THIRD STREET SOUTH NAPLES, FLORIDA 3 3 9 4 0 - 7 0 9 6 (613)262-6612 G E O R G E H . BOND, J R .1 1.936-1973.) JO H N C . KINNEY 119 4 7 - 19 74J HUBERT C.STRATTON (I9E7-I970) HOWARD H.CANNON !I927*J979) JOHN D.ALLEN RICHARD D. HOLE DAVID M .PELLO W PAULA LAPIN S EIFT ER THOMAS . MYERS L O U IS P. D iLORENZO ROBERT D .ESSIG DAVID L. DAWSON THOMAS J . VALENTI * BARRY R. KOGUT M. C ATH ERIN E RJCHARQSON DAVID R. S HERIDAN JOHN GAAL JO S E P H ZAGRANICZNY CHARLES H-GRUNDNER THOMAS R. SMITH JO S E P H R, COOK RO BERT K.W EILER THOMAS D.K ELEH ER K ER R Y J . HANLON R. DANIEL BORDONf J A M E S N. S E E L E Y RICHARD P. SMITH MURRAT N CAPLAN e Ua m. desruisseaux RONALD c . BERGER ROSETRT C.ZUN DEL, JR . DAVID A. R IG G S THADDEUS j . lew kow icz L U C IA M-IZZO LAURENCE G SOUS0UET ANN R .P U R D U E ALSO ADMITTED TO FLA, BAR M a y 14, 1982 The Royal Bank and Trust Company New York, New York County of Lewis Industrial Development Agency Lowville., New Y o r k 133 67 Re: $1,000,000.00' -- Principal Amount County, of Lewis. Industrial .............. De v e l o p m e n t .Agency.... ..... :...... Industrial Development Bond (Clark Minerals, Inc. Project) Series 19 81 (the "Bond")_________ Gentlemen: We have acted as counsel to Clark Minerals, Inc., a New York corporation, (the "Company") in connection with the purchase by the Royal Bank and Trust Company (the "Bank") on June 23,. 19 81 of the Bond pursuant to a Bond Purchase A g r e e m e n t (the " A g r e e m e n t " ) , dated as of June 1, 1981, among the County of Lewis Industrial Development Agency (the "Agency"), the Bank and the Company. Unless otherwise provided, the capitalized terms used in this letter shall have the same meanings assigned to them in the Agreement. Pursuant to Section 3.6 of the Lease dated as of June 1, 1981 b e t w e e n the Company and the Agency, we are required to issue an opinion describing any adverse changes in the' title in the Agency to the Project and whe t h e r all The Royal Bank & Trust Co. County of Lewis Industrial Development Agency May 14, 1982 Page 2 equipment purchased or installed in and made part of the P r o j ect subsequent to the date of the' Series 1981 Bond and to and including the- Project Completion Date, December 31, 1981, is secured by a lien and security interest in and to the Project in favor of the Bank. . Monroe Abstract & Title Corporation has made a continuation search of title in the Lewis County Clerk's Office from June 23, 1981 to- December 31, 1981. This continuation also included a search for UCC-1 Financing Statements against all equipment p u r chased or installed as part of t h e Project from June 23, 1981 to December 31, 1981The results of this continuation are reflected in a letter dated January 27, 1982, from Edmund W. Romocki, Vice President of M o n r o e A b stract &. Title Corporation, to u s . A copy of this letter is annexed. We also conducted a search for similar UCC-1 Financing Statements that were filed with the New York State Sec r etary .o f .State's.Office.immediately.following the c l o s i n g . This search showed that the financing statement between the Agency and the Bank, which was mailed to the Secretary of State for filing, was not on file with the Ne w Y o r k State. Secretary of State. To remedy this, a new, financing statement identical to the one executed on the date of the closing was executed by the Agency and the C o m pany and was filed with the New York State Secretary of State on M a rch 9, 1982. Based upon the foregoing, we are of the opinion under existing law that as of M a rch 9, 1982: 1. There has been no adverse c h a n g e in the Agency's title in and to the Project, except for Permitted Encumberances. The Royal Bank & Trust Co. County of Lewis Industrial Development Agency May 14, 1982 Page 2 2. All Equipment p u r chased or installed in and made a part of the Project subsequent to the date of the Series 1981 Bond and to and including the Project Completion Date is secured by and subject to the lien and security interest in and to the Project in favor of the Bank. Very truly yours, BOND, SCHOENECK & KING /' '- By: Stephen L. Johnson SLJ/lc Enclosure P A IL R. MOONAN MONROE ABSTRACT & TITLE CORPORATION 333 EAST ONONDAGA STREET SYRACUSE, NEW YORK 13202 J O Hi , iNt uC.ti Mr*r G J U IR 'icf- E Pr e t i t i e n l J.U.OH J. KRICANO Srntftr P iee-P retid+ nf Telephone (315) 472-4761 KUMI Nil W. ROMOCK1 PATRICK F.KELLY Pi< e ^ P r m i d e u t t ROSEMARY K. LANE ROBERT M. CHARD , 4 * s i t t a n t i ' i e e - P w i d m t s 4* Associate Title O fficers DOROTHY L OBR1ST . iiii.iKinr i i c e - P r c s i d f O I F.I.MNE M. lock Asiistatit Treasurer LOUIS BENZ NANCY L. ROSTERS MICHAEL P. YOUNG YVONNE A. HAYES MARGARET KARAFILOPULOS Bond, Schoeneck & King January 19, One Lincoln Center Syracuse* New York 13202 19 8 2 OTHER OFFICES ROCHESTER BUFFALO ALBANY LYONS BINGHAMTON SCHENECTADY GENESEO BELMONT CORTLAND RALLSTCIX SPA Attention; John Callahan* Esq. . Dear John: RE: T.I. 21,299-S ' Pt Lts 8 9 6 * 8 9 7 * 9 0 8 & 9 0 c Great Tract No. 4 M a c o m b 1 . Purchase* Town of Diana .............................. ;.................. '.Lewis.County ............ v. Lewis Industrial Dev.Agenc: - The Royal Bank & Trust _____ Company The title in the above captioned matter was continued in the Lewis Coun t y Clerk's office* from June 21* 1 9 8 1 to December 31* 1 9 8 1 and nothing further was found; said continuation also included a search for financing statements against personal property. We are enclosing our invoice in this matter. Very truly yours MonrOe Abstract & Title Corporation Vice-President EWE :jms Enel. CHARLES A .SCH O EN ECK,JR. WILLIAM F. FITZPATRICK TRACY H. FERGUSON LYLE W .HORHBECK C H E S T ER H.KING, JR . N- E A R L E EVANS F RA N C IS E . MALONEY FRANCIS D. PRICE JAM ES E. WILBER ANTON H.ZAHM HENRY R . MCCARTHY J A M E S M. SU LLIVAN , J R . RAYMOND W. MURRAY, J R . JO SE P H J . LAWTON,JR. G EO R G E C . SHATTUCK L ES L IE H.DEMING JOHN J . DEE JOHN A. BEACH CHARLES T.B EEC H IN G ,JR . WILLIAM P. BURROW S JOHN M. FREYER R O B E R T W. KQ PP ARTHUR E.aONGIOVANNl * JOHN 5 . FERGUSON C H A R LES T. MAJOR Bcxnt), Schoeneck & King ojne mrcoisr c e n t e r RO BERT E. MOSES WILLIAM L . BERGAN ANTHONY R. PiTTAHELU FRANCIS E.M A lO N Ef, JR . WALLACE J.M CDONALD Sy r a c u s e , i s w t o s e is s o s (3)5)422-0121 JAM ES O. FIT2PATRICK RO BERT J . HUNT STEPH EN L.JOHNSON JAM ES E . HACKIN' DAVID N. SQCTON * GARY R.GERMAIN THOMAS S .EV A N S * H . DEAN HEBERLIG, JR . THOMAS J . GROOMS RICHARD USM ITH C A R L E . M .W ORBOYS J A M E S P. MCDONALD * STEPHEN J . VOLLMER S .P A U L BATTAGLIA L . LAWRENCE TULLY PAUL M .SANSOUCY * DAVID PATRICK O'HARA G ARY M. CLARK RICHARD C .H EFFER N III WASHINGTON AVSNUE ALBANY, NEW YORK 12210 (518) 462-7421 ONE FINANCIAL PLAZA FORT LAUDERDALE, FLORIDA 3 3 3 9 4 ( 3 0 5 ) 467-7105 1167 THIRD STREET SOUTH NAPLES, FLORIDA 3 3 0 4 0 (613) 262-6B I2 GEO RGE H. BOND, JR ,(I9 3 6 -I9 7 3 J JOH N C . KINNEY 11947-19 7 4 1 HUBERT C. STRATTON H927-I97B> HOWARP H.CANNON il& Z7-1979} JOHN D. ALLEN RICHARD D. HOLE DAVID M .PELLO W PAULA LAPIN SEJFTER THOMAS E , MYERS LOUIS P. DiLORENZO RO BERT D. ESSIG DAVID L . DAWSON THOMAS J . VALENTI * BARRY R.KOGUT M. C A T H ER IN E RICHARDSON DAVID R . SHERIDAN JOHN GAAL JO S E P H ZAGRAMCZNY CH A R LES H.GRUNDNER THOMAS R. SMITH CAROLYN F. RYCZEK JO SEPH R. COOK RO BERT K .W EILER THOMAS D .K ELE H E R K ER R Y J . HANLON R . D AN IEL BOROON1 JA M E S N. S E E L E Y RICHARD P. SMITH MURRAY N. CAPLAN ELIA M. D E SR U IS S EA U X RONALD C . B ER G ER ROBERT C .ZUNDEL, JR. DAVID A. R IG G S TH AD D EU S J . LEWKOWICZ CARLA A . AMUSSEN LUCIA M.IZZO LAURENCE G. 30U50UET ALAN J . KN AU F* ANN R , P U RD U E ALSO ADMITTED TO FLA. BAR July 21, 1981 Mr. Jack Bennett, President Mr. Richard G. Light Executive Vice President Whittaker, Clark & Daniels, Inc. 1000 Coblidge Street South Plainfield, New Jersey 07080 Dear Dick: I enclose the original Title Insurance Policy insuring Clark Minerals, Inc. as owner of the leasehold on the property in the Town of Diana. Please safeguard this policy. I expect to be receiving a binder of closing documents from Ken Bond in the near future and will forward it to you upon receipt. Best regards. Very truly yours, BOND, SCHOENECK & KING PLS/ldw Enclosure Paula Lapin Seifter Miss Kathryn Paulsen Jefferson National Bank Washington Street `Batertows, Mow York .13601 December 23, 1980 Peer Kiss Paulsen; Regarding* Account No* 506-003-08-6 This letter will- confirm cur instructions to you last Wednesday ana Friday, December 1-7 and 19 to issue the following cashier's check to he charged against the above., account number in the name Clark Minerals, Inc*: Check Mo * Payee ' Amount 30748 30747 31035 Internal Revenue Service Mew York State Unemployment Insurance New York State Tax Commission . . $. 644*20 $1,672.64 $3,828.51 Thank g&u very much for all of your help last Friday* It was very MscE appreciated. , Very truly yours, ' WHITTAKER, CLARK 8 'DANIELS, ISC, JHB/ep . bcc; M.C. Orgyelan' R.<3. Light J. 17. Bennett, or* Vice President COPY For . JEFFER S O N \TQNAL BANK 50-1165 WA Me OaUrNeT cIhS aDr EgDi nUgC TyEoDu rO Na cYcOoUuRn tB aO sO Kp -, Se r N.Y.,_ Si tOe mTsHAbTe lOoUwR. APClCeOaUs Ne TsSe eMtAhYa tAGtRhEeE. N? 14408 CHARGE i .. .-'-y '/ /Vi v v A m t. o f C harge ACCOUNT NUMBER APP'D BY ENTR'D BY z>i . I ; r P U R C H A S E R 'S R E C E I P T - R T N F R Y O U R R E C O R D S Clark Minerals, Ine. A, i __jL J e f f eWrAsToEnRTONWaNt.iNo. nY.a13l60B1 a n k PAYABLE TO r& -_ * ftafc X 31035 50-1165 yu 213 Three.Thousand.Eight Hundred.Twenty-eight.and.51/IGfi CASHIERS CHECK FOR-- MEMORANDUM :0 5 13 U 6 5 5 i : D D L 0 0 0 0 i ?n JEFFERSON ATIONAL BANK 50-116F `3 N?- 14407 __________________________________ _ N . Y .,___________/ ^ - / /' ,19. WAMeOaUrNeT cIhS aDrEgDinUgCTyEoDu rO Na cYcOoUuRn tBOa Os KpSe rSOi t eTmHsATb eOlUoRw .ACPClOeUaNs Te Ss eMeAYt h Aa tGRtEhEe. F o r ^ <? ^ =, ? rv " V i 7' } V 7.3 (-4 _____________________________________________________________________:____________________________________________________________ ; .? AMT. OF ___ CHARGE s// /: n-, ' z . .) J ______________............................ _________________________________________ C harge ; v - . v 7 account number A PP'D BY ENTR'D BY - P U R C H A S E R 'S R E C I P T - R E T A I N F O R Y O 'J R R E C O R D S Clark Minerals* Inc* ' ff } Jefferson National Bank f W ATERTOW N, N. Y. 13601 30747 3' f W 50-1165 213 PAYABLE TO $W ptfi 1675.64 CASHIER'S CHECK MEMORANDUM P U R C H A S E R 'S Clerk Minerals, Ira?. R E C E IP T - RETAIN FO R YO U R { } Jefferson National Bank L __ L W ATERTOW N, N. Y. 13601 RECORDS ' payable to In |tq fi4 ljK v j3 R U e Sex|v 30748 50-1165 CASHIER'S CHECK MEMORANDUM 2 iS zo >22 D E P O S IT E D WITH JE F K . -SON NATIONAL BANK Deluxe T R 3 THIS IS YOUR RECEIPT W HEN MAKING A DEPO SIT A T A T E LLE R S WINDOW. A LW A Y S OBTAIN AN OFFICIAL RECEIPT. Checks and other items are received for deposit subject to the provisions of the Uniform Com m ercial Code or any applicable collection agreement, 1388f>5I)aS219S P U R C H A SER '? C la rk M in e rals, Ir<c R E C E IP T - R E T A IN F O R Y ^ 'JR R E C O R D S Jefferson National Bank W ATERTOW N, N. Y. 13601 \ C'J 1 LI nJ i A A 30749 50-1165 X' 'Sstys 213 1388.85 y;-'-f "ir M . MEMORANDUM CASHIER'S CHECK : 2 13 u & 5 S i : o o i 0 0 0 0 1 ? C ER TIFIED CH ECK R EG ISTER N?JEFFER SO N NATIONAL BANK M.'.t s r t o un 13601 2042 DATE CERTIFIED 1 - 2 --- L 9 ~ j J --------- DATE O F I M A K E R _ _ C 1 P-rk ^ . n e r f s . I n . , . ACCOUNT NO. .5.0.6, ,.0.0 .3 0 6 6 .S2.98 chec^ w 'favoh o f L i T L i l S l v V.feO O.S-- 5 e T v l OB . FEE 5 - REQUESTED BY _____ ___________-- .3------------r------------------- -CERT1FIED BY------51 9 ------------CHARGE S ____6 .2 9 6 . AT TH E R E O U E ST O T T H E B A N K EXA M IN ERS; W E W ILL FE T A IH TH E C H EC K W H IC H T H IS V O UC H E R C O V E R S W H E N ............. PRESENTED FOR PAYMENT. SHOULD YOU REQUIRE TH E CHECK. IT WILL. BE HECESSARY TO PRESENT TH IS VOUCHER, Re c e iv e d C a n c e l l e d c h e c k a s c o v e r e d b y a b o v e Item o n - A. E. KARTELLCO., XEEKE,H-H. A5940Q s i 0 fentQQ 30fl-- [Liil- v -o o Q Q O o a g q a ,'1 JEFFERSON ATIONAL BANK 50-116r 3 , WAMeOaUrNeT cIhS aDrEgDinUgCTyEoDu rO Na cYcOoUuRn tBaOsO Kp Se r SintOe.myTsH.,A_b_Te_l_Oo_Uw_R_._A_P_Cl_CeOaUs Ne TsSe eMtAhYa At GtRhEeE. N? 1-, 4408 "T"--' -A*.' //;.',, / A; K-`ACV'"i .. / CHARGE V:. . ________ ...5.Q /PB.jpa-&n* ACMh T. o f arge account number APP'D BY ENTR'D BY ,0000 3 a-----s--`'pfoe\-*5'___!_._'______ Jefferson National Bank WATERTOWN, N. Y. 13601 JeffeWrAsToEnRTONWaNt,iNo.nY,a1l360B1 ank Z a O ru >O > 2n ru BK & <\ Om "fl Ol/i LM mCmP rrt W Oo -J Ci i_n O CP [X] N, 'N -1rrt O O LM O D3 CP O X > m Q m O .-Ni O f\ O O IL i i !O I O iii> \ 03 i ru i n 103 03 jo i LM CT) O m ! *5- o> rr CHARGE JEFFER SO N ATIONAL BANK 50-116 3 N? 14407 N .Y .,- ,19, *-' . -v V:PWAMeOaUrNeT cIhS aDrEgDinUgCTyEoDu rONa cYcOoUuRn tBOa Os KpSe rSOit eTmHsATb eOlUoRw .ACPClOeUaNs Te Ss eMeAYt h Aa tGRtEhEe, 'V, V '7 ., -.Fc- 7 V? ... ACMhTa.rOgFe JVV / i/- 7 'iP r y r: y v'2 -f -M. ACCOUNT NUMBER 50 6 3 0 &'i- - A PP'D BY /: ENTR'D CBeY> ,1'DO a .,,IW_____ _ CHECCEKRTRIEFIGEIDSTER JE FFE R;SO N NATIONAL BANK Ijg ite rtu u n t NY * 13601 ~~ N? 2041 DATE CERTIFIED T7-T9-BT DATE O F CHECK. 12*19"80 CHECK NO. I l l ACCOUNT NO. M A K E R ......................... '...v...... C lark M inerali In c. FCOHRECCKERINTIFFAIEVDOR OF B fris 'otar xprfccrs- 5 Go 00308 6 ..... $ 5 5 4 , 2 0 FEE $. n/a REQUESTED BY- , CERTIFIED BY-- CHTOATRAGLE PART ETSHEEN TREEDQ UFEOSRT POAFYTMHEENTD.ANSKH OEXUAL MD IYNOEUR SR,EWQEUIWRIELTLHREETCAHIENCTKH. EITCWHIELCLKBWE HNIECCHE STSHAISR YV OTUO CPHREERSE^ Nd VTfTe!HR%ISWVHOEUNC H'ER. 554.20 r e c e i v e d C a n c e l l e d C h e c k a s c o v e r e d b y A b o v e It e m o n ______________ ___________________________________ ________ ________ _____ A. E. KARTELLCO.. KEENE. H. H. A 5940B sicSOigpeGO 3 0 a-- ---------------I<M3-00D0 5 5. gD  % e e )& // /Ois V o / J> p ^ /70 /j /y//rv /A*/ /S /O /j . /$ y / 4.y # /J/7 /7.0 4/.P / P .7 3 /f / / o Vo/_b / / / /Aw// ^Xf^tT/ //> Od- c & '<3e</d44i^i * d / y & e / tcsceg- ^ / P - ^ ..... c f a & ~r J d tid jU t a & M z t, * " 3 &. t v *//4 y c i - f u ^ //y t t u t u 44*JT&y// \coo^ x4^ ]/UP&aut^L M / y jf/ Jf # ?? /U4 i yJ> , 74. i 2M M / y r T f'T 3 4 4 ///vT y 4 & c c s e b d u * t y -4)2///i' * l & t ^ c + C c e d L / j[,/oyr f& t/u T ' $/; f /fy , y s f / y t A p . C & t U t & u t 4<&SfC- /yy * ** 4 /f* r , y .fr m i _ </c C t& sit a ^ a & * -s& tM 6 ? .................... ; : i t w ' .........../ T r f t o ' ti.................X .... r ^ `, w i Jb /P V SO h- >y J U Si ' <-lbci ^ l'J 4*y titM&J 2 S 7 7 $ - ( TABLE OF CONTENTS 1. Purchase C o n t r a c t ' . 2. A s s i g n m e n t of Contract 3. Deed 4. B ond 5. M o rtgage 6. Timbering A g r e e m e n t 7. Certified C o p y of Resolution to M o r t g a g e - Whittaker, Clark & Daniels, Inc. 8. Certified C opy of Resolution to M o r t g a g e - Clark Minerals, Inc. . 9. Resolution of B o ard of Directors of Carbola Chemical Co., Inc. . 10. Resolution of Shareholders of Carbola Chemical Co., Inc 11. Bill o f Sale . 12. Sales Tax B u r e a u Notification of Sale, Transfer or Assignment in Bulk 13. Casual Sales T a x Return 14. Letter A g r e e m e n t R e g arding Removal of Personal Property 15. Escrow A g r e ement ' 16. Insurance Binder 17. Letter A g r e e m e n t Regarding lis pendens i 18. Statement of Sale 19. Guaranty December 19, 1980 Carbola Chemical Co.. Inc. Natural Bridge. New York . , ; re: Sale of Lewis County property to Clark M i n e r a l s , Inc. Gentlemen: - . This letter shall constitute our guaranty to you as follows: 1. Y o u are about to lend Two Hundred and fifty Six Thousand ($256,000.00). (the "Loan") to Clark Minerals, Tnc., with offices at Natural Bridge, New Y o r k (the "Borrower"). The Loan will be evidenced by a bond of the Borrower in that principal amount and will be secured by a mortgage of Borrower (the loan documents) covering certain premises situate in the Town of Diana. Lewis County, New York (the "Premises"). 2. To induce you to make the Loan and in consideration of your doing so, the undersigned unconditionally guarantees to you and your successors and assigns the full and prompt payment when due of all sums payable under the Loan documents and the full and prompt performance and observance of,all the other covenants, conditions and agreements to be performed or observed by the Borrox^er under the Loan documents. 3. This guaranty is and shall be construed to be an absolute and unconditional present and continuing guaranty of payment and not merely of collection, and the liability of the undersigned is the liability of a surety aTMd is no way conditioned or contingent Carbola Chemical Co., Ine. Page Two pon any attempt to collect from the Borrower or upon any other condition or contingency. This guaranty shall continue in full force and effect u n t i 1 all su^s be com in.0- due under the Loan documents have been paid in full and all covenants of the Borrower under the Loan documents have been fully performed. 4. Our obligations under this guaranty shall remain in full force and effect without regard to any amendment or modification of any of the terms of any of the Loan documents or any substitution or release of any s e c 'ri^y u^den the L o a n documents whether or not we shall have had notice of these circumstances. 5. W e waive notice of acceptance of this guaranty, p r e sentment.and.protest.under.the.L oan .document's.a v>d.ai 1.o t h e r ..... . notices to which we may otherwise be entitled. 6 . This guaranty shall be enforceable as to b o r r o w e r 's obligations under the loan documents despite borrower's discharge in b a n k r u p t c y <~>r despite adjustment of such debt, liabilities or obligations in insolvency proceedings or pursuant to any other compromise with creditors. . 7. A n y ommisions or delays bv you in exercise of any'right hereunder shall not act as a waiver and the singular or partial exercise of any such right or rights shall not preclude any other or further exercise ("hereof. " 8- T his gnarantv cannot be changed or terminated orally. 9. This guaranty shall be binding upon our successessors and Carbola Chemical Co., Ine. Page Three assigns and shall inure to the benefit of your successors and assigns. Very truly yours, WHITTAKER, CLARK & DANIELS. INC. BY Frederick F. Roesch President STATE OF NEW YORK ) COUNTY OF JEFFERSON) ss.: .On ^he 19th dav of S c o m b e r , '|9 8 0 s before me personally came FREDERICK F. ROESCH, to me known, who be^ng by me duly s w o r n , d 1'd denose and say that he resides at ` ''UlAU.ku'.vn iim that he is the President of.W h i t t a k e r . Clark & D a n i e l s ,M n c the corporation described in and which executed the foreciQ"g instrument ; and that he signed his name thereto by order of the Board of Directors. o M -" N ) n Notary Public ft f PAULA LMMN SOFTER ^ . N m ,m v |l;!~ ,1,, * - " W 7 M 4 OO c lin My ^ rC - M-c, 30, J rv CHARLES A.SCHO ENECK, JR . WILLIAM F. PITZPATRICK TRACY H. FERGUSON L Y L E W. HORNBECK C H E S T ER H. KING, JR . H E A R L E EVANS F R A N C IS E . MALONEY FRANCIS D. PRICE JAMES E. W ILBER* ANTON H.ZAHM HENRY R . MtCARTHY JA M E S M. SU LLIVAN , J R . RAYMOND W.MURRAY, JR . J O S E P H J . LAWTON, J R . G EO R G E C.SHATTUCK L E S L I E H. DEMING JOHN J . D EE JOHN A . 6 EACH CH A R LES T. S EEC H IN G , JR . WILLIAM P. BURROWS JOH N M. F R EY E R R O B E R T W. KOPP ARTH UR E- BOHGIQVANNl Bond, Schoeneck & King JOHN S.FERGU SO N C H A R L E S T, MAJOR R O BERTE.M O SES WILLIAM L . BERGAN ANTHONY R. PlTTARELLI * FRANCIS E.M ALO N EY,JR . Wa l l a c e j . McDo n a l d JA M E S D. FITZPATRICK STEPH EN L.JOHNSON J A M E S E . MACHIN G ARY R . GERMAIN THOMAS S . EVANS * H. DEAN H EBERU G , JR. THOMAS J . GROOMS RICHARD L . SMITH CARL E.M .W O RBO YS j a m e s p. McDo n a l d STEPH EN J . VOLLMER S P AUL BATTAGLIA L . LAW RENCE TULLY PAU L M .SANSOUCY DAVID PATRICK O' HARA O N E X J tfC O Iiir C JB U TE R S Y R A C U S E , N E W Y O R K 13303 III WASHINGTON AVENUE ALBANY, NEW YORK I22IO (516) 462*7421 JOHN A. BEACH RESIDENT PARTNER ONE FINANCIAL PLAZA FORT LAUDERDALE, FLORIDA 3 3 3 9 4 (305) 467*7105 ROBERT J . HUNT RESIDENT PARTNER 1167 THIRD STREET SOUTH NAPLES, FLORIDA 3 3 9 4 0 (813) 262- 6612 DAVID N. SEXTON RESIDEN T PARTNER G EO R G E H. BO ND, J R . (1936*1973) JOHN C- KINNEY (1947-1974) H U B E R T C . STRATTON 11927-1973) HOWARD H. CANNON (1927-19791 GARY M. CLARK JOHN O ALLEN RICHARD D. HOLE DAVID St. PELLOW PAULA LAPIN SEIFTER THOMAS E.M YERS RANDOLPH E. PARKER LO UIS P. DiLORENZO RO BERT D. ESSIG DAVJD L . DAWSON THOMAS J . VALENTI * BARRY R, HOGUT M. CATH ERIN E RiCHARDSDN DAVID R . SHERIDAN JOHN GAAL JO S E P H ZAGRANICZNY C H A R L ES H- GRUNONER THOMAS R. SMITH CAROLYN F. RYCZEK RICHARD C-H EFFERN JO SEP H R.COOK RO BERT K.W EILER THOMAS D .K ELEH ER K ER RY J . HANLON R. DANIEL BORDONI JA M ES N. S E E L E Y RICHARD P. SMITH MURRAY N.CAPLAN ELIA M. D ESR U ISSEA U X RONALD C . BERG ER ROBERT C .ZU N D EL.JR. 'ALSO ADMITTED TO FLA. BAR March 9, 1981 Joshua H. Bennett, Jr. Vice President Whittaker, Clark & Daniels, Inc. 1000 Coolidge Street South Plainfield, N.J. 07080 Dear Jack: ......I.think that.in.the.binder of documents. I sent you after we closed I may have omitted the guaranty which Whittaker gave to Carbola of C l a r k 's obligations under the purchase money mortgage. I am enclosing an extra copy of the guaranty, as well as an amended table of contents for the binder in the event that the document was omitted from your copy. . Please let me see a copy of your commitment with the Royal Bank once it is finalized. I will be in Florida from March 12th through 21st. However, if I am needed for any reason my office will know where to find me. Very truly yours, BOND, SCH0ENECK & KING PLS/jb enes Paula Lapin Seifter Bon. Schoeneck Sc King C H A R L ES A. S CH O EMC C K . J B . WILLIAM F. FITZPATRICK TRA C Y H. FERG U SO N L Y IE W-HORNBECK C H E S T E R H- K ING, J R . N .EA R LE EVANS FRAN CIS E . MALONEY .. FRANCIS O. PRICE * JA M E S E. WlLEff * ANTON H. ZAHM H E N R Y R. HcCARTHT J A M E S M. SU LLIVAN , J R . . - ' RAYMONO W.MURRAY, J R . J O S E P H J . LAWTON, JR . G EO R G E C . SHATTUCH L E S L I E H . DEMING JOHN J.O E E JOH N A. BEACH C H A R L E S T, B E E C H IN G , J R . WILLIAM p. BURROWS JO H N M. F R ET ER RO BER T W.KOPP ARTHUR E.BONGIOVANHI * JOHN S . FERGUSON C H A R L E S T . MAJOR RO BERT E . MOSES _ . WILLIAM L . BERGAN ANTHONY R. P lTTARELLi * . . FRAN CIS E- MALONEY, J R . W A LLA CE J . McOONALD JA M ES D. FITZPATRICK .. _ STEP H EN L . JOHNSON JA M ES C.MACKlN * GARY R . GERMAIN ^' -THOM AS S . EVANS * H.O EAN H E8ER LIG , JR. THOMAS J. CROMS . . RICHARD L . SMITH CA R L C . M. W ORBOYS J A M E S F l McOONALD * STEPH EN J . VOLLMER S . P A U L BATTAGLIA L . LAWRENCE TULLY PA U L M. SAN SO U CY DAVID PATRICK O' HARA ONE IIN CO LN CEN TE SY K ACtJSB, K B V YOHK 13202 (3151 422-0121 H WASHINGTON AVENUE ALBANY, NEW YORK 12210 (518) 462-7421 JOHN A-BEACH RESIDENT PARTNER . . .... ONE FINANCIAL PLAZA FORT LAUDERDALE, FLORIDA 3 3 3 3 4 (3 0 5) 467-7105 RO B ER T J . HUNT RESID EN T PARTNER 1167 THIRD STREET SOUTH NAPi.ES, FLORIDA 3 3 9 4 0 (S I3) 262-6912 DAVID H- SEXTON RESIDEN T PARTNER G E O R G E H. BOND. J R .;i& 3 6 - IS 7 S ) JO H N C . KINNEY 11947-1974) H U B E R T C . STRATTON I927*I9TB> HOWARO H, CANNON. 11927-1979) GARY M. CLARK JO H N D. ALLEN RICHARD D. HOLE DAVID M. PELLOW PAULA LAPIN S EIFT E R Th o m a s e . m v e r s RANDOLPH e. P A R K ER ..---t LOUIS R DiLORENEO R O B E R T D. E S S IG DAVlp L. DAWSQN THOMAS J . VALENM * - CARR Y R. kOGUT M, CATHERINE RICHAPDSON Da v id r . S h er id a n JOHN GAAL J O S E P H ZAORANICZNY CH AR LES H-GRUNDNER THOMAS R. SMITH CAROLYN f. p y c z e k -- RICHARD C -H ErFER N . JO S EP H R-COOX - RO BERT K.W EILER - THOMAS D. KELEHER . K ER RY J . HANLQN R .O A N IE L HORDONI _ . JAM ES H .SEELET RICHARD P. SMITH MURRAY N.CA PLAN E LIA M. D ESR U lS S C A U * ROHALO C.BER G ER RO BER T C.ZU N D EL,JR. ALSO ADMlTTED TO FLA. BAR February 27, 1981 Merritt T. Viscardi, Esq. Apruzzese & McDermott Independence Plaza 500 Morris Avenue P. 0. Box 329 Springfield, N.J. 07081 ..... . Re: Clark Minerals, Inc. - purchase of 350 acres, Town of Diana, New Yo^x from Carbola Chemical Co., Inc. ____ Dear Mr. Viscardi: I hope you will excuse ray delay in sending this letter to you but, as you are aware, there have been a few outstanding matters which we have first sought to clear. In your capacity as corporate counsel to Whittaker, Clark & Daniels, Inc., you have asked for confirmation from us that all requirements of the purchase agreement have been satisfied. The closing of the above transaction took place on December 19, 1980 in Watertown, New York. A binder of closing documents is enclosed for your file. Clark Minerals purchased 35Q acres of land in the Town of Diana, New York. The seller resrved title to an adjacent 30 acre parcel but conveyed its mineral rights to Clark Minerals. In connection with the con veyance of the 350 acre parcel, the seller reserved firewood cutting rights as described in a timbering agreement affecting the northeasterly quadrant of the premises. Merritt T. Viscardi, Esq. February 27, 1981 ' Page 2 ' '` ' " .... All personalty was conveyed by full warranty b ill of - - -.sale.. -The applicable New York- State sales tax was- p aid and, remitted to the State at the time of closing, along with a casual sales tax return. - - :r -- ' The Sales Tax Bureau was notified of the sale in con nection with the bulk sales provisions of the New York State Tax Law, and has recently issued its release. In our opinion, - the Uniform Commercial Code- Bulk Sales Act did not apply because, .. ' ....... 'th sale included no inventory, but set-off provisions w e r e -- -- included in the mortgage note to protect against any claims which. might be asserted under the Act. __ Clark Minerals gave the seller its note for the sum of $256,000.00 secured by a mortgage on the property. The mort gage provides for its subordination to a later mortgage of up . to one million dollars to be given to the bond purchaser when the anticipated IDA financing is completed. As to the status of the proposed f i n a n c i n g t h r o u g h the Lewis County Industrial Development Agency, enclosed are '.... ;.. '.v.... copies.of.minutes.of.t h e .Agency, along.with.a.memorandum.of... ... inducement and intent which evidences the Agency's willingness to issue industrial revenue bonds in the principal amount of not more than $1,000,000.00 for the purpose of paying the costs of reconstruction and equipping of the plant. These minutes and memorandum of inducement and intent incorporate by reference the original inducement resolution of the agency dated October 29, . 1980, also enclosed. All funds expended after that date in the - equipping and reconstruction of the plant will be eligible for reimbursement from bond proceeds. Until the company receives a satisfactory loan commitment, there are no steps that can be taken toward a closing on the industrial revenue bonds. . ' You have asked for the current status of the matter concerning Francis Costanzo, a 10% shareholder of C a r b o l a Chemical. As you know, he has raised a question as to whether Carbola's failure to give him a proper notice required by the New York Business Corporation Law may give rise to a claim by h i m against Carbola. M r .'"Costanzo 's attorney wrote to Whittake r putting it on notice of his claim. A copy of his letter is enclosed, along with the notice of shareholder's meeting sent to Mr. Costanzo and his response to the corporation. . ...... - I have spoken with Mr. Costanzo*s attorney .on two . " occasions. I informed him that the allegations in the second paragraph of his letter dated January 23rd were factually incor rect. No rights owned by the corporation were retained by the Merritt T. Viscardi, Esq. February 27, 1981 Page 3 majority shareholder in his individual capacity. This is evi denced by b u r '-timbering agreement" which is - included in your closing' bindery''-and to.nwhdch -the ^attorney.Vs -letteE addresses . cio-s-i itself. .- . A meeting between the parties to negotiate a buy-out of Mr. C o s t a n z o * s interest in the corporation was held on Fri day, February 6th, in Watertown. Thus far, there has been cooperation between the parties. If, however, an agreement can- -not be reached,-- a suit- wi-1-1 -likely be commenced naming. Clark . Minerals' 'a"s a" stakeholder... If ho "suit "is brought and the matter .is-not-otherwise, determined, in--the.-next few weeks, a p p r o p r i a t e __ and timely action..should .be taken to ensure, that the April, mort-g gage payment can be made by Clark Minerals without exposure to Mr. Costanzo. - -- Monroe- Abstract & Title Corporation has issued a fee title insurance policy numbered 21,697-3 dated December 22, 1980 in the amount of $715,000.00. A copy of the policy is enclosed for your file. The policy insures that title in fee simple is vested in Clark Minerals, Inc. subject only to the matters indi cated as exceptions. The amount of coverage was arrived at by adding $300,000.to the.purchase.price.of.the.property,.that.sum... representing Dick Light's estimate of the amount to be expended on permanent improvements to the property. We had hoped to be able to omit the franchise tax excep tion and the two judgments from the list of exceptions in the title policy prior to sending this letter. While the franchise taxes owed by Carbola were, in fact, paid to the State at the time of closing,- we have been unab-le to get a current franchise tax search from Albany to verify this. The two judgments have, in fact, been paid but remain open of record because the satis factions forwarded by the seller's attorney for filing were '- returned by the County Clerk because of unacceptable signatures. We will have these matters cleared shortly axid will forward an amendment to the title policy to you at that time. If a suit should be brought by Mr. Costanzo and Clark Minerals is made a party to it, solely in its capacity as stake-, holder, the title company wiTl not defend and the suit will have to be defended at Clark's expense. If, however, a suit should be brought by Mr. Costanzo which attempts,.to affect the title, . the title insurance will cover the claim and our firm will defend the claim at no charge to Clark. A copy of our letter agreement dated February 23, 1981 with the" title company to this effect .. ...... is enclosed. '- Merritt T. Viscardi, Esq. February 27, 1981 Page 4 .. . . ..Based u pon the enclosed policy of title insurance issued by Monroe, we are of the opinion that the requirement's of the Agreement dated N ovember 17, 1980, as amended, have been complied with so as to vest good title to the premises in Clark Minerals, Inc., subject to those matters excepted in the policy. If you require any further documentation for your file apart from the enclosures or, if you have any questions, please advise^. We-will,, .of course,- k eep you apprised of. all developments. Very truly yours, BOND, SCHOENECK & KING PLS/wp cc: Richard G. Light Joshua H. Bennett, Jr. Paula Lapin Seifter BAodaorpdteodf--TNitelwe UYnodrekrwSrtiatteersTFitolermAssociation MONROE ABSTRACT & TITLE CORPORATION POLICY OF TITLE INSURANCE The MONROE ABSTRACT & TITLE CORPORATION, in con sideration of the payment of its charges for the examination of title and its premium for insurance, insures the within named insured against all loss or damage not exceeding the amount of insurance stated herein and in addi tion the costs and expenses of defending the title estate or interest insured, which the insured shall sustain by reason of any defect or defects of title affecting the premises described in Schedule A or affecting the interest of the insured therein as herein set forth, or by reason of unmarketability of the title of the insured to or in the premises, or by reason of liens or incum brances affecting title at the date hereof, or by reason of any statutory lien for labor or material furnished prior to the date hereof which has now gained or which may hereafter gain priority over the interest insured hereby, or by reason of a lack of access to and from the premises, except ing all loss and damage by reason of the estates, Interests, defects, objec tions, liens, incumbrances and other matters set forth in Schedule B, or by the conditions of this policy hereby incorporated into this contract, the loss and the amount to be ascertained in the manner provided in said condi tions and to he payable upon compliance by the insured with the stipula tions of said conditions, and not otherwise. I n W i t n e s s W h e k e o f , the MONROE ABSTRACT & TITLE COR PORATION has caused this policy to be signed and sealed on its date of issue set forth herein. CONDITIONS OF THIS POLICY j -oittmaDshaSguetoeefuetincsvinsetltenetiismiisdtso,tonioiiptnnafoweetOntrixthhsmnohtoeneemi,.otctf"hoetiendhnkidseribuinsty,irinoeodtsdnophr(iu.ssafoe"rtc)leotriothidcefbrWeyrputmhhioithanetisressseaihrusntepaee,rcvsoerldseeludsieiroducgvbycefntiy,schseieeaedttoeshnsspattodo,elhessrrsriweosmsau,thrwiipvenaoh"oinscnviolelniouvtocsshdreyfuuseer,crlsweactpchdewtheahe"eersdeisertnieoestaconrmtlsmutauuotasldhcyrei"ernhdnieenhgipaynIse,rnssut,ewsersiaraetigehetnndnnhsidd"st M(bo) n rWoeh eArebvsetrr atchte t & e Trmit l e" thCios r pcoomraptiaonny. " is used in this policy it means upa(cpsee)tpedenWaitlnhjhuetharreiisssvdeepirxcopttliihiocreeynd,t.aeitrfmtmere"adfininssapltohsdeietitfoeinnrmaolifndaeattlielornma"pipnoearatil"osfnionroalflayfatdeceroteuthrrmte iotnifmedceo"mtios itt(hnudect)-elupWdrreionahpgleerspreutrvyocehprienbtrshutuyeirl.detiednrgmhsera"entihndeiampsrpedrmoesvisceermisb"eenditssiunthseeSdrcehoinendtuwhleihsicAphoboliyfcylt,ahwiist cmpoonelasicntiya lt(ehese)s cooWthuenhrtewyreiisvneerwinthdhiiecchatteeprdrmo, pr"eercreotcyrodrienddseudinr"edtihs ehueosrfeefdiicneinloieftsh.tihse proelciocyrdiint gmoefafincse,r uonf Section Two. Defense ana Prosecution pci(nloaasl)iuimcrTye,ohdifsintictoalemll opaarcntiinyocnwusmilolb,rraaptnrcoitecsseoendwoinnt gcesoxscftoe,pudtneeddfeedinndotnthhiesa atcdohofutenciSetttsruiatlioloctewstssnorerhcleaoirntseittnu,egnrmedtsaehtiren.hrteae(tribone)bowyrhidinceshfuerinetddc,oaonnrysiduaepcrtosinodnoeosrirruTapnbhrdloiesecretcoeoadnmipynprgeacvnoreyevnleatsnthiaoannrlgtl rhtoeoarve ptfan(urncraono)mdmsiteehIycneaourtnfeotayebltlyhmdoceerapatiiesednnerretsmsmafueiiwrinntensdhdao,e.tiritrtoehtdneoethftiuheinssneserduperotiethnlhdie,cerysaeahninrcadet,liqloagusntiievriceoetussrriteoopprratotolipcloeeinrtere,mdtaihisitnetsogsn,oratiwhabgnilnhsedtncaaaaoinmldmldeptahoapoenpprrypeetoaihtnlroes, pctt(ohoademn)tyhlpoTeasonhsfeyexfa.rnptoerymnotvspittshehiocoaisnfteisctwholoihfssosthcmooisrmaypspeaabcynetmyiolienasn,hbtsalehlolaftlhdlteehsereuemrfevoniirvttietroneeptacahmeyesmosiaunernnsytut roibenfydtrhotehicrsiostvpoeocrotlihimncigys S ectio n T h ree . aNboleculanidmerftohrisdpaomliacgyesexscheapltl ianrtishee oforllboewimngaicnatasiens: esLOhv3iaiaScrbt6ee8idloirtoy' irnAteejrreiecssteetsdthefrroeumi(nna.d)tehWre hpwerhreeimchitsheetshreeorhianfsrsoumbreedesnommaaeyfipnaahrlet doderitsepuromnsdisnievasitsdieoeddn, u(bpo) nWahleieren othreirnecuhmasbrbaenecne naotfinexalcedpetetedrminintahtiisonpoalidcvye. rse to the title, ssabt(ieocrolalc)nldnotcWufhseoruethrsnetiatoanrhntiesenduetirbhnxteegcehdneeieptenhfttsiseeittutdaloroeteifebndhjtoehtashcreshtiaiisibnolnlepntseehourntlareoievcsrdeytet,hjcpaeoeouncrndrttestwirtdutlahheacee.bntrreeteedctaothhuiansetshegiebnooeosjfeuudndraefgadamdifeteeihfnsneatictalnttodewroehrtoreairtirsdnimnecbgiurenmeotaonf ismosms(nuaadreioitb)ndifrwjsfateefgWthmacicaeocttghorunteeeritaotorlsgaenhuatasogatrostheeafcec.pibhnotrehiairiennodrensggiruneianrgtladhistehnujeonucerfdeefriidogecnirefessurmdusiurhnoabepaclrdyostug'bnmsaareegbecthffeasruiaeutnasnasaetecinlednedtodoetfentorrhteoeaiestarnrtmcdteeecoeixrenhffecpeaasectasttpitoftmibreninoendoemttrnohttihgneteaabhgpetetfheriieiietninslmnaevalsipanustdleodorieseldi,tdcttehhooyreearr; jssa(uhenesca)dtulilfrWtiihhetyedhaveotbreifeetlcbaetaehmueessnoheiarnftolisglnfuaahraglealeyddvoeesdfnheebactteehltelrenomhrianirnviesneeujcedruncemtedtehg'bdsaortetabisnayttcthaeeettdehnreoaoertjpleoiercnaxottnicpeoeornptesotseeotddbfienlitenhmtnhetdaehdeitprseitrlepaoemonnldwiitscheayiesst. iaon(nnfors)dttwrWeutahxmrehcrreeeaenprnettsteyhcdta,holenilantghaiaanitnihvsniieunssrtgbepedtocehloneisvchayeian.nlflsianunhartaesl vddienebtteerrrecamagnuaisnsrfedaetrirotooefndtaoittnhldeeaenfoetyrictotlwefoasirrnurcsianuhncrtuecydomvtbhebrenyaranenacotnesf cts(aaugkur)eesendWoibshfyenarcoeotdnteehdnfeeetmictitlnnesoadutriroteionndcaauenmfsudtballtiretaanwhocaarfsrndibnoetfteeornerexstfchitenepaolterlesydtaaditnpeetaetorhrrtmisitinhnpteeeodrrleeicostyhtf.athat aktsehnebebienen ttNia(hhn1fociet)seuicrminclfasrobteiumrhmcraieepnsdiafcpcnoetioy,rnm.ordfsepaemasmtnutolacyvighn,eegasnsfoatssetnuhircycaehhl;lcalvdoaaieirrnmifsge{ec2ort)erocorfseoruibvrietienldiwmcaunbiatmoihilntiobittcuryaeatinnvotcaohfebleulaewnnwtuiaartnhriltilidtleneyegnreatdhtschsiodruinstemysfeepencoddttlaibcyooyysfr tiaipStIctfopcfhVnnhoounoorraeOeeormtympccuwqpmUeateoprurlniCarseiebpaoegtoeraenjotsondthpdeltyioryOicctirt'ontfseFethIsonangj,uetooulnn.honcisturdtadiitehhuhnoaibirmiefDces.simimnsyfeulmemfeoiaevrctrltitytevoycahoiahcdtyin,lmiiceiisssodfe,o,pifncirhfscsaItpoaoeuuynonwinargmrmcmsyoneihehcovcpobympisasfeciaryafsnuhosncaanetcgsnrlnyhiiyheaslnsaye.outihc,sthmpearrhuppqietliaseriruulppaeptorhertllndedoceceeasoov,brerhatsitfseydaoohimosrncisrneisonrteenareo>hgrieaytrsneawbstuoponiypbcintcrrrdneolhieatetsihpsjaianttduuneneronhdserodgoyeiuelaptnitiadricicmoasgtycaeetulstecdupeodfes,ti,faufidinhitiolagcsnastanunihnlmfskenlmdo,emunnyoorrncmaocawerriyotwtnipadotgnatnaospalnraeuchpnrfasdogdork,efoeifteegcfnrfrhteipdeee,goceclebrieernotodsystnscrhiitah,cudnttehanaahlcoosegieilldhesslrrfll, _rShpfaoeelorycyltmtiehaidboeelnbneinyFi.fsitouovhrrr_eee.a_dJiLnnOdusSnuSwrdeeidlrl.a(itannlhl)oseustTtrtaepehtdraiumsytioscntorhoymelfitcptifoahgesneiatssytsiopwoanofnilldilaccnpayary.alrylioec,TwodihnuainnsoascndeCedlsboiotmyiimroptnpaahontittssyooerdcstnhhoeeoamynlllpoeatsnhmnsoe,yt mhciutaaudimtoo((nnoahn1gbeenppracastosrd)aott)eyuubyeaiiisinoglme,rnusernoiIinnsnensnwtnnotbcriehtsvhdggh,reietieiosieatnroonrrsehvsilnravmsttvglhaoeyeceeecbehfaterunemrscioyyltnxestdltlmiiobtsstacapnohcutyrbayopab,gaooftecenssagiytnfhtleanovarhiicatacintygstaeehwngyhtbvfag,ledieuhteeaiihoieunduaatonloenmreunnmstigrrtrinxuaddeiooasnpnstttrellhdneieoueicisersotaarenntuldrhaeeniabletdtrsbcelth.bi,iedeteaeymliylod-airnseidhtifencoySd,tnaiiopcshssemf,uragtltruoroshdbcautdmeisrltnihtnitieeuaeesiheteciaidtmrctnsyedseahvahhcbto;aeteeraoseyofirnbarorlhuovdmwfueedinralaonittauslphnndllrrtltanu(aaiat.ai2sssecodanltmhiho)ovrotnneycaiesaasroar,o'tovsmslsstlefunl,muteoflroaneoaolearpyntrtisstternsroaeiasohstoodybtnnaataetnaftindhtylirnhlcmhldiy,meeatoilthoe.sprayahatifeitirpgansnwmdecavelhtfdacTyohmopoeetoomatheeorrthovoehrebltpiueifbioicesestcnsarnyousetyfuynsthctncnoauwy;iloehvrtiitrommneaoehosepwofgebysrecd,pourroailtrhalvlaahoe(rniiiieninine3ecucntocmtsydyhydgy)sesef a(mc)ouLnitaboiflitthye tpoecaunnyiacroyllianteterraelsht oolfdesur cohf ctohlilsatpeoralilchyosldhearllinnottheexpcreeemdistehse. sciild(imneedueslencp)udesforieAsenoteedhgsirdlseiiasonIpannncamaduybtommhmdeuehibenosarnbitralnttufngshsrcoauesegmrfreseeemtaodehndfe,eoenippnttiarsnbossysyueimuntctrahteehfndndoiatetsroscfatethnciemnoodxdina(mnciCsfdneopegopSaarntcnntotshodyi(rten1adspu)putauurerntoldoptiedocssaeefreoyByreycnm.dutcoietIhnoirnningssstssgtsis,udpbmaeaaoconnlatrBiddidcdoaeyina(cnsl2fkalsoo)tho,erwCarilcaopflonvprucetirrhoeronee)sr # dd(iaety)iosnWtshheoerfnetahlfiiatsebrip.loitlyichya, sthbeeelnossdeofirnditaemlyafgixeesdhianll abcecopradyaanbclee wwiitthhitnhethciortny Section Six. Co-inasnurdance Apportionment ttIa(hhnafeets)eudrIrInaensstdeuettrbhoeeeffdcooterhmmvtihesae.nkspteaostlhicacaonyt-,iinaamsnuppdrraeoorrvtnietlaomyl etilhnnoetstshseuxaobttcesceneuvqtreushneetan,rftettihetnoer iatsioobbcInmhhmenfeefeanhlptptoylhtbaholrualoeosoifmtnsnersofctndoeoopoetctofuthosouhfntleabnttiathptcioyhntfyetpfaehig,tlscpxteyhIhespoonpeueIerrstoocntonuilCihfpsmdiorcruoeectnpopyhrmddorveresoboopditpfdpvsefpaouiaeoionnrnlrarmlryogssintcstuiesdhsoyatfunaeoeo.nsctnsarhttetoiohtwmxtnnotahecohcelpreeynitsrecituohedodhhomvyunesefesfnsetem'aodwxtnoenfrcfeserreyeenemtndeehtpstp.doseyrtafowIiaorpcnTnatmefeeicchnaerutotetdlithhrucoyireilennfneosongtsdpsartsspoeeugo,borgfmgerylaosirtcncpitehoenatydrgihfnbgosaetlsctoutiphheepsrmoCeeahrldoltetoilaoeivcdmomnnyiafsgcppsoiosahaopptusnhannleintydlnyessrtl aPtaSntwhpmroceophetonvlenuayidtvdpnyuaetptloldepluwy,eeaBhhrntoiooyc;cfwhealtaneohnenvtsexyudseimrpsl,aoptrerestroidhsomsfviaiinoitfstdgnh,etesehatdo,hteuaaetsmtffhuodosoerroaftuehttngeiiaemmtorloi,peoinefrfgsnootutivfchcnoeothisrdhs-i,eepncpndoosooocul-cliueiricncscamyusynnubr.carorreeanatnnndpecccrxeeewocvoeafpiesofsrdiroosnvuonoaicnsstheiloissqhlhnhouuosasiwnldsls,danhnrttaeehoilddnetl actpo(henbefilnd)sst,dhaIepitsfhnoletlopitscohplsylaeoircisscwyspe.reeslesrshme,taaelibdlsxleicibvsslueihdseaecidrvdoeemapfodpfrifeouvcitimetsridinapbgtrlaaeonovdainensemtsooeetontrtstlsemevpdamoalruraoeaedntebeoua,sftuipbnsnrasdooeietdqpruaeaseineltnadptoeaftbnroaatsstateiphis,daeriacnpdsedaaletrisef, o(cn)iyCalfatuesretsh"e (ian)s"uraenddsh"a(lbl )h"avoef tahciqsusireecdtiothneaipnptelyretsot omfotrhtegamgeorptgoaligcoiers. tltstsa(oohhuhndsearac)stanlehlnosIectthhfnhhe,aecoeelloatcrldnotahihdvmnbteaihesytvoriueloieuirntantnehgibbsrtmeleteoetohehinfrentalositpistahunarbtirsotmhsheiuvledieriipset,dyoilrenosupldissf.nocsoulylbeirri,cessyyassdthunabeeyafgdeonrialreonobretsssyhamusertaegsroennhdrotemattalhhhbleteoteeehhltrrdawwosvcdpheoeeroamoonlnbepfpoetoaethaahnrnmitpeysiprfo,oiocnuxtphorenotimodtisloifpcopncaytfouinhnmryioegsnpfuslaaatouInnhnnsrdyest Section Seven. Assignment of Policy or its endorsement o f Imsothfhfoiatstrlhhltgpeeioaniglmniuectroeyeer,.rtegttsoahPtgirseitonhvespwiusoiirbltoeihecndonyueibsftmiytmca.otoayhnfdissebesneupintcocalotieshcfssyesitgihvriniseasetdteachsoamstmoitgapnonaaefunneadaysl iomipmtonnhrffseseeouNumnvIrrstniebeeudsweddofeufrfdirYctaihictnneorfeoncoarmckenrcsyupseBoffiranfoetfnoiafrciaietitnrehahsodnenircssyofypcSofesoprtoecTnaricfotvifcteticeitlocoheyenoneaetcfUdniinicfsrnnNouechdgruaaeemstmolwirlrowasnottfYrtahtfoineitoosecrtrhhrfeksaetcshvolofieeaimanolsebnpdsadilbialsaygienswt.tneuhyyimmatohlIebteffonndethotthefagdnoinoersrStaeyhunmopicptsloteieiehrldaecriaebsciunrnyitmdlto.ioeitsnynfotshadttnahetrfhvcouneeeerrt Scection Eight. tTbfrethauensosurifbnoeogsrruadsirieuindcoahntesrhitagolhl tasenxyttmeoo(craeuetn)ahmttueiTsabihsrynicuigisoicnhtmhgctoospifimannonlsptofyetasr.rstnuehymuseTtneshdhinoneeatfssrlulrtihtragtheeoshidstitsnmhpwseosaiultoyierhcexytdbtrr,e.aeenbsntpesreefosecqufrtubraeertnshodytegeradspethtaeaoytdlo.-l tooaofi(inrnfbrfoogy)nmtpthhtrsIhseiiufthsoehcoarhetlibcihltnolyleiasminguecooonprtifrnteaodosnotpfuhfyrrmreetteghvhuodlueeenireantdiginmrtsneaarsoontgauhfrtetretohegtmrpihdaisrneo.goosrerpvtumgoirfodaloreireogdrcdtmeyfgerfasorsrugomtehcehmlaheilsiialnnrascescicirunnloteesrgmaaenssddapoii.onnapnggenoyHvootr'eshottrinewotraoneifptgvbfheeoheeercfrtsrt,woitnonhttihhcfsaereee]epsamlvlursiieabaaeomlbbrddioiidiillgsfiiibetyttayyyys Section Nine. Misrepre sbeenfotraetitohne issuance orfAouefnnstthpyorieursuceftnpaatiotnrloluusicwreaeyen,srtytosabhtymedamilatslhcteeelvnoroitisaniedlmsuafatrnahdeyciedst,,mbtpyooaortlemtihrcaiaeynat.yleinrfissaauuclprteip,ndroqe,ruswisariiionetnhys Section Ten. No Waiver of Conditions Tscuhenhdadisleel rlbciaeotbhmlieilapibtatyelneryomhresmwreaoauyfivntedthaeaikrsneaypnaopdnlriyoschyvaiaslwpliophnnreoottohpfterhirteahrtoieesrbpynaococltitoiconyint. PCttrShheooeieslcnstittriiciscrcsyooatumnecaEdtpnnEactltneoieyrvoieefitnnst.hrtieesrsmppeosAmAtchllntiuaalcystnyotad,ftcohbstotceheihotoahennilbrenlsdarsisbautoeisceroredtenirddovpseon.irecnommecoaseteryhedrdeaehitcnnaoptdgviroesehonravesoavidstgeioaoimrimnnnsasercyitrgoognhtbfehntdrsiitesnhciignotscifooaanmpagnocapdwltiiaincionbtysnyhe.t lVMecSihosaeetadlncriistigsfdieiaoolsactnratiaetToneriwnndotechnaulsanmevnwdeb.etrhar enrcepenoTevdstdl,aahsicl.tiioeesydxnaopdlctyfeoainplttbiehgtcy,eyosrwfiuefinascircsilhettvrtrupeaeoomnlsirltdieaecantnygeotdsenosnlthrcyatsar.xeelwelmaCshtae,ihelnnsnagtaon.sdgstcheueoIsselfvysmemitnrhsaeseiIyungntrnrtbseeee,edcrdvoewierfbndfnayetiietncnertggar POLICY TITLE INoSfURANCE TMITOLNEROCEOR&APBOSRTARTAICOTN OFFICES BUFF1A30LPOE, ANRELWSYTORRE EKT14202 TRWOCEHNETSYTMERA,!INNESWTRYEOERTKW1E46S1T4 THREE THSYIRRTAYC-UTSHER, ENEEWE. YOONROKND13A2G02A STREET COR, JAALMBEASNSYT, RNEEEWT Y&OMRAKI1D2E20N9 LANE BINBAGNH5KA9-E6M1RTSCOOTNUR, URNTSETSWTBRYUEOILERDTKIN1G3901 p nTHuInRyTY2-7F1.OTUAROWNSIL. LNIEAWM YSOTRRKEE1T4489 SCHENE6C08TSATDAYT.ENSETWREYEOTRK 12305 GENE2SNEOO,RNTHEWSTYROEREKT 14454 BELMONPT.O, N. BEOWXY9O5RK 14813 COR5TCLOAUNRDT, NHEOWUSYEOPRAKRK13045 COBUARLTLSHTOOUNSESP-A.MNrEMWASYTOERRKS1T2R02E0ET DAILY RECORD SIR SCHEDULEA 1. Name of Insured Policy No. 21,300-S Clark Minerals, Inc. AInmsuoruanntceof * 1 ,500,000.00 Date of Issue June 22, 198 l 2. The estate or interest insured by this policy is leasehold vested in the insured by means of Lease Agreement between County of Lewis Industrial Development Agency and Clark Minerals I n c . , dated the 1st day of June, 1981 and filed for record in the Office of the Clerk of the County of Lewis, State of New York on the 22nd day of June, 1981 and recorded at 4:38 P .M._ 3. The premises in which the insured has the estate or interest covered by this policy is described as follows: SEE SCHEDULE "A" ATTACHED SCHEDULE "A" PARCEL I ALL THAT TRACT OR PARCEL OP LAND situate in the Town of Diana, County of Lewis and State of New York, and further described as follows: BEGINNING at a concrete monument found in the northerly highway limits of N . Y.S. Pvoute 3, said concrete monument is situate North 71 54' Nest along the northerly highway limits of N.Y.S. Route 3, a distance of 7 2 5 . 1 feet from a concrete monument found at an angle point in said highway limits, said last mentioned concrete monument is situate North 73 17' West along the northerly highway limits of N.Y.S. Route 3, a distance of 109.8 feet from a concrete monument found at an angle point in said highway limits, said last me n t i o n e d concrete monument Is situate North 82 0 9 1 West along the northerly highway limits of N.Y.S. Route 3, a distance of 88.3 feet from the intersection of the northerly highway limits of N.Y.S. Route 3 and the westerly margin of lands now or formerly owned by the Penn Central Transportation Co., said point of beginning also being the Intersection of the northerly highway limits of N.Y.S. Route 3 and the most easterly property line of the parcel of land conveyed b y Adelaide B. Montondo to Miguel Rodriguez by deed recorded in the Lewis County Clerk's Office In L i b e r .337.at.Page.48.on.September.19 >.1973;.. ............. thence North 35 33' East along the Rodriguez easterly property line a distance of 1 6 6 . 3 feet to an iron pipe found; thence North 56 10' West along the R o d r i g u ez^northerly property line a distance of 2 0 8 . 6 feet to an iron pipe found; thence South 32 49' West along the Rodriguez westerly property line a distance of 2 2 8 . 3 feet to a rod found in the abandoned centerline of the former State Highway; thence in a generally northwesterly direction along the abandoned centerline of the former State Highway a distance of 2 5 7 - 5 feet to an iron pipe found in the most southeasterly corner of the parcel of land conveyed by International Talc Company, Inc. to Richard W. Lozo and Carol Lozo by deed recorded in the Lewis County Clerk's Office In Liber 314 at Page 443 on 2/18/71; thence North 33 38' East along the Lozo easterly property line a distance of 1 6 0 . 0 feet to a rod found; thence North 56 28' West along the Lozo northerly property line a distance of 125.0 feet to an Iron pipe found; SEE SCHEDULE "A" (Continued) NOTHING IS TO BE WRITTEN ON THIS PAGE SCHEDULE "A" (Continued) thence South 33 38' West along the Lozo westerlyproperty line, passing through an iron pipe found at 141.9 feet and continuing a total distance of l60.0 feet to a point in the centerline of the Old State Road; thence in a generally northwesterly direction along the centerline of the Old State Road a distance of 5 2 5 . 3 feet to a point; thence North 5 53' West pas s i n g through an iron pipe found at 2 7 . 6 feet and continuing a total distance of 864.6 feet to a point; thence North 5 06' West passing through a stump at 1147.4 feet and contin u i n g a total distance of H 5 8 .O feet to a point; thence South 85 4o' 30" West a distance of 581.4 feet to an iron pipe found; thence North 3 16' 30" West a distance of 1764.0 feet to a nail set in a tree; thence North 7 55' 30" West a distance of 563-5 feet to an iron pipe f o u n d ;........................ thence South 45 19' East a distance of 2533.9 feet to an iron pipe found; thence North 42 24' East a distance of 1434.6 feet to an iron pipe found; thence South 47 57' 30" East a distance of 5120.8 feet to an iron pipe found; thence South 50 01' West a distance of 894.6 feet to an iron pipe found in the northerly margin of the land of the Penn Central Transportation Co.; thence in a generally southwesterly direction along the Penn Central Transportation Co. northerly margin a distance of 1 2 8 6 . 7 feet to a point, said margin being 40 feet northerly of and parallel to the centerline of the existing tracks; thence North 5 8 5 4 ' West a distance of 2036.3 feet to a point; thence South 31 06' West a distance of 1366.3 feet to a point in the northerly margin of N.Y.S. Route 3; thence North 71 54' West along the northerly marg i n of N.Y.S. Route 3 a distance of 260.6 feet to the point of beginning. SEE SCHEDULE "A" (Continued) NOTHING IS TO BE WRITTEN ON THIS PAGE SCHEDULE "A" (Continued) CONTAINING 351.01 acres of land more or less. TOGETHER with a 100 foot Right of Way along the existing railroad siding which crosses the 30.45 acre parcel which is to be retained by Carbola Chemical Co., Inc., said Right of Way Is as shown on the map titled "Survey Map of the Land of Carbola Chemical Co., Inc,, N.Y.S. Route 3, Town of Diana, County of Lewis, State of New York", prepared by Bernier, Peck & Gozalkowski, Watertown, New York and dated December 11, 1980. PARCEL II TOGETHER with mineral rights excluding sand and gravel in and to the following described parcel of land: ALL THAT TRACT OR PARCEL OP LAND, situate In the Town of Diana, County of Lewis and State of New York bounded and described as follows: BEGINNING at a concrete monument located at the intersection of the northerly highway limits of N.Y.S. Route 3 and the westerly margin of lands now or formerly owned by the Penn Central Transportation C o .; thence along the northerly limits of N.Y.S. Route 3 the following three courses and distances: (1 ) North 8 2 0 9 ' W e s t , 8 8 . 3 feet; (2 ) North 73 17' W e st , 1 0 9 . 8 feet, (3) North 71 54 ' W e s t , 464.5 feet; thence North 31 06* East, a distance of 1 3 6 6 . 3 feet to a p o i n t ; thence South 58 54' East, a distance of 2036.3 feet to the northerly margin of lands now or formerly owned by the Penn Central Transportation Co.; SEE SCHEDULE "A" (Continued) NOTHING IS TO BE WRITTEN ON THIS PAGE SCHEDULE "A" (Continued) thence North 82 38' West along the northerly margin of lands now or formerly owned by the Penn Central Transportation Co., a distance of 821.7 feet to a point; thence in a generally southwesterly direction along the northerly margin of lands now or formerly owned by the Penn Central Transportation Co. , a distance of 1143.4 feet to the point and place of beginning, containing 30.45 acres of land, more or less. TOGETHER with an easement for ingress and egress in and over the parcel just described as may be reasonably necessary to exercise the mineral rights, such ingress and egress to be carried out in a manner that minimizes to the extent possible disruption and interference of the interest of Carbola Chemical Co., Inc.TM.__ _ . ..... ... .. .... NOTHING IS TO BE WRITTEN ON THIS PAGE SCHEDULEB The following estates, interests, defects, objections to title. Hens, and incumbrances and other matters are excepted from the coverage of this policy: 1. Defects and incumbrances arising or becoming & Hen after the date of this policy, except as herein provided. 2. Consequences of the exercise and enforcement or attempted enforce ment of any governmental war or police powers over the premises. 3. Any laws, regulations or ordinances (including, but not limited to zoning, building, and environmental protection) as to the use, occupancy, subdivision or improvement of the premises adopted or imposed by any governmental body, or the effect of any noncomphance with any violation thereof. 4. Judgments against the insured or estates, interests, delects, objections. Hens or incumbrances created, suffered, assumed or agreed to by or with the privity of the insured. 5. Title to any property beyond the lines of the premises, or title to areas within or rights or easements in any abutting streets, roads, avenues, lanes, ways or waterways, or the right to maintain therein vaults, tunnels, ramps or any other structure or improvement, unless this policy specifically provides that such titles, rights, or easements are insured. Not withstanding any provisions in this paragraph to the contrary, this policy, ubnelloesnsgiontghetrowaibseutetixncgepotwedn,erins.sures the ordinary rights of access and egress 6. Title to any personal property, whether the same be attached to or used in connection with said premises or otherwise. 7- No title or interest is insured to any land within the lines of any highway or road entering into, running through or abutting upon the premises. 8 . This policy is written upon the express covenant that any contract to sell, or application to mortgage, all or any portion of the insured premises shall provide for acceptance by the vendee or mortgagee as the sole title evidence, a title insurance policy issued.by.any title.company.licensed.to.do business.i n .. New York State, which policy shall contain this same covenant and be issued without exception as to any alleged right of any Indian or tribe of Indians and be issued at the then applicable rate. This Corporation agrees upon application to re-issue its policy with the same covenant included therein. 9* The exact acreage of the premises described in Schedule "A" h e r e i n is not insured. This policy excepts rights to any gold and silver in subject premises, if any. 10. Rights to firewood and ingress and egress to cut same as p r o v i d e d in unrecorded Agreement between Carbola Chemical Co., Inc. and Clark Minerals Inc., dated December 19, 1980. 1 1 . Survey of Leo F l oyd Gozalkowski, dated December 11, 1980 and red a t e d June 17, 1981 discloses the following: (a) Overhead utility lines with power poles cross south westerly corner. (b) Electric Service for well house enter New York State Route #3- SEE.SCHEDULE "B" (Cont'd) NOTHING IS TO BE WRITTEN ON THIS PAGE SCHEDULE "B" (Cont'd) 12. Terms and Conditions contained in Lease Agreement between County of Lewis Industrial Development Agency and Clark Minerals, Inc., dated June 1, 1 9 8 l and recorded June 22, 1981 in the Lewis County Clerk's Office at it: 3 8 P.M. 13. Mortgage made by Clark Minerals Inc. to Carbola Chemical Co. Inc., which mortgage is given to secure the sum of $256,000.00, dated December 19, 1980 and recorded December 22, 1980 in the Lewis County Clerk's Office in Liber 212 of Mortgages, Page 1 8 3 . 14. Mortgage made by County of Lewis Industrial Development Agency to The Royal Bank and Trust Company, which mortgage is given to secure the sum of $1 ,0 0 0 ,0 0 0 . 0 0 dated June 1, 1 9 8 1 and recorded June 22, 1 9 8 1 in the Lewis County Clerk's Office at 4:38 P.M. 15. Assignment of Lease from County of Lewis Industrial Development Agency to The Royal Bank and Trust Company, Ack'd June 22, 1 9 8 1 and recorded June 22, 1981 in the Lewis County Clerk's Office at 4:38 P.M. .16.... Einancing Statement.f r o m .County.of.Lewis.......... Industrial Develop. Agency to The Royal Bank and Trust Company, filed June 22, 1 9 8 1 in the Lewis County Clerk's Office at 4:38 P.M. as Pile No. 81132 4 ... ... NOTHING IS TO BE WRITTEN ON THIS PAGE ABodaorpdteodf--TNitelwe UYnodrkerwSrtaitteersTFitolermAssociation MONROE ABSTRACT & TITLE CORPORATION POLICY OF TITLE INSURANCE The MONROE ABSTRACT & TITLE CORPORATION, in con sideration of the payment of its charges for the examination of title and its premium for insurance, insures the within named insured against all loss or damage not exceeding the amount of insurance stated herein and in addi tion the costs and expenses of defending the title estate or interest insured, which the insured shall sustain by reason of any defect or defects of title affecting the premises described in Schedule A or affecting the interest of the insured therein as herein set forth, or by reason of unmarketability of the title of the insured to or in the premises, or by reason of liens or incum brances affecting title at the date hereof, or by reason of any statutory lien for labor.or.material..furnished prior.to.the date.hereof.which..has now gained or which may hereafter gain priority over the interest insured hereby, or by reason of a lack of access to and from the premises, except ing all loss and damage by reason of the estates, interests, defects, objec tions, liens, incumbrances and other matters set forth in Schedule B, or by the conditions of this policy hereby incorporated into this contract, the loss and the amount to be ascertained in the manner provided in said condi tions and to be payable upon compliance by the insured with the stipula tions of said conditions, and not otherwise. I n W itn ess W h e r e o f , Hie MONROE ABSTRACT & TITLE COR PORATION has caused this policy to be signed and sealed on its date of issue set forth herein. : CONDITIONS OF THIS POLICY aotitmDsSsahgurteoeeeeuitcnsvfnnselitteetinnismsdiotsui,otnioiiitpnnoofaweenntOtritxhhosmhntoenemei,otc.t"fhoetiendhnkidseribiunsty,riinoeodtQpdsnhr(ifou.ssae"lrtc.)iroetcothidfebyeWrrputhimihonthtaeisrsesseiau'rnhsterpca,eeevolsrdudeslesiediroucgbveycfntyis,chseieeteaodthesnpsosattdeo,eslhrsrersiwasomsu,twhriiopvneah"noinscoivlleniooustvcshfrudeyusecerlr,csaewtepwcdhteheah"edesriesnertiteoescaonmrltusumtatuoadhslcyreie"nrnhdeigienbpna,yisertnswsu,eesrsriiaateegethnnhdsnniddt"s M(bo)nroWehAerbesvterractthe&teTrimtle"tChoisrpcoormatpioann.y" is used in this policy it means pau(peese)ptedenWaitlnhjhuetharresiissvdeepirxcoptltiihiocreeynd,t.aeiftrmtmere"adfniinssapltohsdeietitfoeinnrmaolifndaeattiielornam"pipnoeatatil"osfnionraolflayfatdeceroteuthrrmet iotnifmedce"omtios tti(nuhdcet)elupWdrreionahpgleerpsreutrvyocehprienbtrshutuyeilr.detidenrgmhsera"entihndeiampsrpedrmoesvisceermisb"eenditssiunthseeSdrcehoinendtuwhlehisicAphoboliyfcylt,ahwiist cmpooenlasicntiys lt(ehese)s coWothuhenertrwyeviisener witnhhdeiicchtaetrpemdro, p"reerecrctoyordridenedsdu"irneidsthuehseoerfdefiicnienloitefhsi.tsheporleiccoyrditinmg eoafnfisc,erunof atcodDPShotufreeencoIcfeSttsttersiieuantoloclcoisenwttusesstnorTieaorhcwlnneaoidrntoseitt.n,uegnrmedtsaehtiren.hrteeaicp((ntrilobaoneasl))biuiomcwyrTyreh.iohddincifessihnftuiecrtionaeltemlddlc,poaoaoarnncnrtysiiyinoduacnwepcusrotmisilnoolb,drnroaeaposrtnriroicrutTaecpsnbsehrdloeoiensedwcorietncnteooagdcenmsoixpynscprfgteoeac,vpunordetneyveenldedfatsenethdinaionnandrolgttlntirhnotehoaesrave tpfan(urcnarono)mdmisteehyIceaonurtnfeotyeabtlyhmoldereacptiiaedennsrerstemmfauseiriinntenwsddaoh,.tireittohrdteneoetftihuhenisnesserdueprtitehonhdel,eircseayhainncadr,tleiloaqgsntuieviicoretuesrsrietopoprtarotoliclopeinretee,rdatmiihstnsoeigtns,oraiwabtghnlnheidstnaaacainmoldldmeatphopoaepprnrpeeytoaihnlrets,o pttc(ohoademn)tyhlpoeaosTnsfehyxfae.rntoepymnrotspvttheihscoaiisofteincstwhlooihssofsctmohoriamsyppsaaheynecmytliioeasnnhbt,aleslolhftahdlteelheresemufeornvirttiivtroneeetacphmeaesyosmiaunrnesytnutroienfbdytrhoeitcrshotivpsoeorctliihoncimygs Section Three. aNboleculanidmerftohrisdpamoliacgyesexscheapltl ianritshee oforllboewminagincatasiens: smsbtmisoseusLsa(((nioeuaavhdberproieiolalitbcia)on))alnddicfrnworsjnafbttetecfeeWgufthhsmacieicWWodaaruleeooctttirghosrunntrtlehhotireiet'ytaaioaontioeeherrlsngnitnasehnrreunAdattueeeaeoesiagtrorjobsnxrthrt.eeeetaretfhcgeichechcd.pbisneeshinteoetereenpetthieariirhsenfidctnoetdrsetnieneisuhgtgtritdsuanfmeelhiouaoernrtgrtalifoeradbethbisnseuhenmhijru(tjeodonunheaencaatrfbh.rncdeeedfs)sretiioticdgeechhiniseiieWbnoreferanesnsuremtpndlusnelesihuopwurhnaooranhbteelprreactlohirerdeaycostsufeirmdgve'ytibcnsmetn,xaeahrehijtapecgasebechotecleefuhnfcearsretuoispauertdthntrdeasnsnwtaiseaeeeetdutoetcitnllehrdhdntaeerdheaeetibn.odorcaenirfrtemeftnnetsortrrescethoeotueiaadittohesmbntrarhnhurtaemeacidtieestsdseetencheoesiinxreinoehoffbpengcpoeamnameosoesajtacftselutupioeatinaodcfrtydafimbderenyinigpenoandvd.fomdaemabaettrfenrolhteeriteiihtftgsnnesnehtdeeaaatbhotcdaepgletietrittttofhrneseideoierepiitonuriesnmlwnhomarenotvtaelssaidhrripasusnirsidtninedemelotrodvieaicsseebldinirtusi,tddtenicttgieemoehhetoooyadrldnneaerrfte;,o, jssa(uhenesca)dtulilfrWtiihhetyeadhveobterifeetlcbaetaehumeessnoheiranftolisglnfuaarhaglealeyddveoesdfnheebacttehletelrenomhrianirnviesneeujcedruncemtedtehg'bdsaortetaibsnayttcthaeeetdtehnreoaoertjpleoiecrnxaottnicpeoeornptesotseeotddbfienlitenhmtnhetdaehdeitpresitrlpeaoemonnldwiistchaeyiesst. ioan(nnfros)dttwreWutahxmrechrreeaeepnnretttseyhdct,aholieanlngthaiaanitinhvsniieunssrtgbepedtocehloneisvchayeiann.lflsainunhartslaevddienebtteerrrceamagnuaisnsrfeadetriortooefndtaoittnhldeeaenfoetyricttolwefoasirrnurcsainuhncrtecuyodmvtbhebrenyaranenacotnesf tcs(auagkur)eesndeWoibshfyenraoceotdnteehdnfeeetmictitlnnesoadutrirtoeionndcaauenmfsudtballrtieatanwhocaearsrndibnoeftteeonrerexstfchitenepaolterlesydtaaditnpeetaetorhrrtmisiitnnhpteeeodrrleiecotsyhft.athataktsehnebebienen ttNia(hhn1foeict)seuicrminclfaosrbteiumrhmcraipeensdaicfpncoetioy,rnm.ordsfepaemasmtnutolaycivgnh,eegsansfoatssentuhiryccaehhlcl;aldvoaaieirrnmifsge(ec2ort)erocrofseoruibvrietienldiwmcaunbiatmoihilntiobittcuryaeaitnnvotcaohfebleluaewnnwtuiaratnhriltilditleneyegnretadhtschisodriunstemysfepeenocddttlaibcyooyysrf XNipfopcScatiftnnhhouToonrraeoeeormtmypccuwqpt,meaeoit-prulrnicarseeibapoetoegeranojotsdntpdehltyioroyiccirtt'ontfesFehtlsonngaj,uetooulo_n.ohcisturdatiltdehhuhniabirimefDces.snius.ymfuelemfeoinrecvratlttteyvoachioyahcdyitn,miliceisissofed,op,irhfncifsacIsaotpoeununoywianrrgmmscmyoenihehcovbcpyompisasecifyarafunsoshcananectgsrnlinyihyhaneslsay.eiutochs,tmhpuerrahqppietirlaesuruiplepaporthertdlldenoeccseae,ovobetrhrasifetsyooadhimorsnrcsnieisrtneenoaerohigareytnsresawbtuoponiypbctcirnrrodnelaihetetsshipjiaattnudeunnerhondsreodgoeyieualtpintiaidcrcimsotagcyeateulstuedeocpdfes,iaf,tufindhiiiltcaosgnastaiunnnhklsmefnmldo,uemnnyoocrornmaacweyrriwotptinadotgnatolapasnnearuhfprcansddogorek,efoitfgeecfrnfhrtpeeiede,oceglcrbeieerootnsdytsnshcrii,ahtcutdeanthnlaahcooeslgeillldhessrrfll, bSpfpfoaeleorycylimtteahidobeenlbeninyFt.fsoituOhvrr-feeea_.dLinnO_udsS_nuS_wdreeidlrl.a(itanlnhl)osesuttTrtapeehtdariumsytioscntrohoymelfitcpiftoaghesneaitsystsiopwoanofnilldilaccnpayayr.alrlyioc,eTwodihnuainnsoacsndeeCdlsobiotmyiimroptnpaahontittssyooerdctsnhoheoemaynllploetasnhmnsoe,yt hmiuumcadittaoo((nnoahg1pneebnprcaastosraod)tt)eyuyubeiiiasingolm,ernuesrnoIininsnesnntwnnotrbceihtshvdggh,reietieisoiaetnroonrrsehvslinramvsttvglahoeyeceeecbefhatreunermcisoyyletxnstdltlmibsisottacaponchutybroapyab,oagofcetnesasgitynfhtleonavharciiatanciytsategehwngyhbvtafg,ldeeihuteaieihoieudaunntaloeonmuernnmstigrrtrinxaudediooasnnpstttrleldhnieeiuoecsieorstaraennutldrhaenebailettdbsrcetlb.hi,ideetaeymelyiload-inrseitdhicenfoydS,tnaiiopcshssem,fugratlrtuoorshdbcaudtmiesrltninhtitieaeeueshetieciaidmtrtcnsyedesahavhhcbto;aetereaosyefoirnboralhruovdmfwueedinarloanittaulsphnnldlrrtltaa(nuaiata.i2ssselocnadtmhiohv)orotnnyecasiaeaorsa,'rtosovmlssstlefuln,umetolrfonaeoaeloarpyrnttissttersnoraeiashostodoybtnanataetfantinydhtlnihrlcmhldyim,teeaoiltohe.aspryahtafiiteirgpawsnnmdecaehtlvdfaTcyohompoeetootmaheoerrthoovehrelbtpiufieiboicessectnsarnyousetyfuynshtctncnoa;uwiyolehvrtiitroomnmeaeoshepfwogesybrced,pourrolatirhaalvhalorn(eiiiieninnei3eucnctocmtsyydydyg)hesesf a(mc)ouLnitaboiflitthye tpoecaunnyiacroyllianteterarelshtoolfdesurcohfctohlilsatpeoralilcyhosldhearllinnottheexpcreeemdistehse. dsciil(nimeedueslenc)pudesforieAesnoetedhgslrdlesIiaosinpannncamaduybtommhmdeuehibenosarnbitralnttufnghssrcaoeusegmrfereseemtaodehndfe,eeonippnttirasnbo6sysyeuimunttcratehehfndndoieattsroscfatethncimenoodxdinam(cni'sdfnCepoegpSoaartcnnntosohtdy(irte1nadspuu)ptauurenrotlpotdiedocsaseefreyoByreycmnd,utociehtInoirnningsstssgstsisu,dpmbaeaaoconnaltBriddidcdoaeyinan(csl2fkalsoo)tho,erwCarilcaopflonpvrucetirrhoeornee)sr |; i\ i: I msmesm* i dd(aeity)iosntWsheohrfeentahflitisearbp.ioliltiycyh, atshebeleonssdoerfindiatmelyagfeixsehdaliln baeccpoarydaabnlcee wwiitthhinthtehicrtoyn ASCepocp-tioinoarsntnuiodrSaninmxc.eent ttaI(hhnfaeets)eudIrrInaensstdeuettrbhoeeeffdcooterhmmtvihesae.nkspteaostlhicacaonyt-,iinaamsnuppdrraeoorrvtnietlaomyl etilhnnoetstshseuxaobttcesceneuvqtreushneetanr,fetttihetnoer iiboobatscImnhhmfeneefeanhlppttoylthbaohlrauloeosoimftnsnersofctndoeoopoetctouftohsouhfntleabntitathcpitoynhtfeytfpaehgi,tlspcxtehyIhseoponpeueIerrstoocntnouiilChfpsmdoircrueocetnoppyhrdomdvrreesooobipdtpfdvfpespaouiaeooinnrnlrmralryogsisntctsuieshdsyoftaunaeoeo.snctnsarhetttoiohtxmwtntonahecohlcepreeynistrecituohdeodhhomvuyensefefnssetem'aodwxtneonrfcfesereryeenemtndeehtptpsd.oseyrtafowiaoirpcnTnatmefeecichnaerutotetdlithhrucoyireilennnfesoongtsdpsartspseouego,obrgmfgeralyoisrtnccpitheoenaytdrgifhnbogsaetlcsotuithpehpsermCeeohardolteltolaoieivdmtonmnyiafgscpspoioshaaopputsnanhnleintlydnyessrlt PaaSntthwpmroceophetonvelnauyidtvdpnyuateptloldepluwy,eeaBhrhtnoioo;cycfwheatlanehonenvtsexyudseimrpsl,apotreretsroidhmossfvaiiioniftstdngh,eteseahtdo,hteuaaemttsffhuodooserraofutehttngeiaiemmtoroii,epoinferfgsnootutvfichconeothisrdhs-i,eepncpdnoosooocul-cliueiricnccsamyusynnurb.carorreenaatnnndpecccrxeeewocveoafpiesfosrdiorsonvuoanoicnsstheiloissqlhhnhouuosasiwnlsdls,danhnrttaeheoIlddentl atpoc(henbfeilnd)sst,dhapIeitsfhnoltleopitscophslylaeoirciswscsype.ree.sle.rssh.me.,t.aa.e.ilb.dslx.le.ici.vbss.l.uieh.d.sea.e.icd.rvd.oe.e.ma.p.fod.pf.rf.ieou.v.ci.tim.tes.ri.idna.pb.gt.rl.aaeo..nov..danie.n.sem..ts.o.eote.o.ntr.ts.t.lsem.ve.p.dam.oa.l.ru.raoe.aed.n.t.ebe.o.ua,.sf.t.u.ip.bnsn..rasd.oo.eie.td.qp..rua.eas.eln.elt.n.dap.to.ea..ftnbr.o.aat.s.tsa.te.iphi.s,.dae..ri.ac.npd.se.daa.l.etrsi.e.f,. o(cn)lyCalfatuesretsh"e(ian)s"uraenddsh"a(lbl)h"aovef tahciqsusireecdtiothneaipnptelyretsot omfotrhtegamgeorptgoaligcoiers. tttssal(oohhhundseaarc)stanlehlonsIetcthhnfhhe,aeoceelloatcrldnotabihdvnmbteaiehsytvorieulieoiunrtantnehgbibsrtmeleteoehtoehinfertnlaoistipstahunartbirsomthsehiuvledeiripiste,dyoilreonuplsdissf.oncsoullybierri,cessyysadsthunabeeayfgdeonrialreonobretsssyahmusertaeg.sreonnhrdotematthalhhbelteoeetehhltrrdwawosvcdpehoeeroamonolnbepfpoetoaethaahrnnmipteysiporfo,iocnutxphorneotimodtisloifpcopncaytfouinhnmryieogsnpfuslaaatouinnhnnsrdyest SoAn0r1efscPisttisoigolenninmc^dSvoee^rnsvteemne. nt ofsmIothhffofitrIstttIhhgpeeianogimluenirceoteye,r.rttetgohsaPitgsrteohinvepwsiousbliiritoecehnnydoeuifbsmtitycma,ooytahfndisbseseeunpicntocaleostisshfcsiyegitvhnireiesasdtatecshostamoimgtanpoaneanfuendasyal oitipommnhnfrfseeseouNumnvIrsrntiebeeudswdedofeufrfdirYctaihictnneorfoencaormcekncrsypeusBoffrianofetfnoiafrciaietitnrheahsodnenircssyofypScofesoprtoceTanricfotvifcetticeiltcooeehynoenaetcfdUniinicfsrnnNouechdgrauaeesmtomlwirlrowasnottfYrthatfoieniotoserctrfhhrkestaceshvolofieemiaaonlsebnpdsadilbailasyginestw.tneuhyyimmatolhIetbfefnondethotthefnagdoinoersSrtaeyhunmopicpstoltieeeihrldaecriaecbisunrnyimtdlt.oieoitsnnyfotshadttnahefrthvcouneeeerrt TtbS,,Mrehaelenc_DssturiifbooneogsnraurdtrsEleiuOndicagHhthserhti,tagolhl tasenxymtteoo(cerauent)ahmttleliTbasrihysniucigsiiocnhthmgctosopfiimannolnospftyetsar.rstnuehymuseHtnesdiihnoneeatfsrslulrttirhitgaeloeslhdstitsnmphwsoesiaultoyiehrcexytdbtr,re.eeabnsneptsreefoscequftrubraetrenhosdyetgeradsepthteaoadyt.lo-l tofiooa(inrnbfrfoogy)ntmpthhtrsIhseiiufthosehcoarehtbliichltnloylieasimnguecooonirtpnrtfeaodsontopufhfyrrrmeetetghvhudoHueeenrnaetdiginmrtsneaarsootngauhrfettretohgemtrpihdaisrnoe.goosrervptumgoirfodaloeriroegdrcdtmeyfgerfasorsrgoumthechemlaheilisialnnrascesiciclurnnoteesrgmaaenssddapoii.onnapnggenoyHvot'oreshottrinewotaroneifptgfvbheeoheeercfrtrst,woitnohnttichhsfaereeelespamlvulrsiieabaaeomlbbrddioiidiillgsfiiibeytttayyyys Section Nine, bMseefniostrraeetpitorhene- issuance oouArfefnnstthpoyriuersuceftnapatiotnrloluusicwreaeyen,srtytoasbhtymdeamiltaslhcteeelvnorotiisaniedlmsuaaftrnahdeyciedst,m,btpoyoaortelmtihrcaiaeynat.yleinrfissaauuclprtie,pndroqe,ruswisariiinoetynhs NSofeocCtWioonandivTiteieronn.s Tuschenhdadilesel rlbciaeothbmleiilapibtatyelneryomhresmwreaoauyfivnetdthae'aikrsneaypn''aopdnlriyoschyvaiaslwpliophnnreoo"tthoptefrhIirebartoieesr'bpyanocolctitioconyint. ttPCrShheoeioesscltniritcictsicroysoatumnecaEdpntEnactlnetoeiyvroeiefitnnst*hrtieesrsmppeosAAtmchlitnluaaclysntyotad,ftcohbstotcehiehotoahennilbrenlsdarsibsautoeisecroredtenirddovpseon.irecnommecoaseteryhedredaehitcnnaoptdvgiroeesohnrvaesoavidsgreioaoimrimnnnsasercytirogognthfbehndtrisitesnhcigiontscifooaanmpganocapdwltiiaincionbtysnhyet. MelcVSihseeataonclrsditigsdiieofolasiancrttiaaeoTtenrinndowtchnauesanmelnvwdbeter.harenrcepenoTevdstld,aahsicl.tiioeesydxnaodpcltyfeoainptltbiehgtcy,eyosTwfiuefnicsiraschiltetvrtrpueeaoonmlsirltdiaeecatnnyegotdesnsonlthrcyatsar.xeelwelmaCshta,eihelnnsnagtaon.sgdstcheeuoIsselfvysmemitnrhsaeseiiyungnrtnrtbseeee,edcrdvoewierfbndnfayetiietncnertggar POLICY TITLE INSURANCE MONROE ABSTRACT TITLE CORPORATION OFFICES BUFF1A30LPOE,ANRELWl sYt Or eReKt14202 TRWO CEHNETSYT EMRA, INNESWT RYEOERTKW1E46S1T4 THREE THSYIRRTAYC-UTSHER, ENEEWE. YOONROKND1A32G02A STREET COR. JAALMBEASNSYT, RNEEEWT Y&OMRKAID12E20N9 LANE BINBAGNH5KA9-E6M1RTSCOOTNUR, URNTSETSWTBRYUEOILERDTKIN13G901 P.OT.HBIORXTY2-7F1,OLUYROWNSIL, LNIEAWM YSOTRRKEE1T4489 SCHENE6C08TASTDAYT.ENSETWREYEOTRK 12305 GENE2SNEOOR. NTHEWSTYROEREKT 14454 BELMONPT.O, N. EBWOXY9O5RK 14813 COR5TCLOAUNRDT, NHOEWUSYEOPRAKRK13045 COBUARLTLSHTOOUNSESP--A,MNcEMWASYTOERRKS1T2R02E0ET DAILY R E C O R D 3XR SCHEDULEA 1. Name of Insured Clark Minerals Inc. Policy No. 2 1 ,6 9 7 -S Amount of $ 7 1 5 yO O O .00 Insurance Date of Issue D e c e m b e r 22, 1 9 8 0 2. The estate or interest insured by this policy is fee simple vested in the insured by means of Warranty Deed with Lien Covenant executed by Carbola Chemical Co., Inc. to Clark Minerals Inc., dated the 1 9 th day of December, 1 9 8 0 and filed for record in the Office of the Clerk of the County of Lewis, State of New York on the 22nd day of December, 1 9 8 0 and recorded in Liber 4l4 of 3. The premises in which the insured has the estate or interest covered by this policy is described as follows: SEE SCHEDULE "A* (Attached) Daily Record Corp.--14R NOTHING IS TO BE WRITTEN ON THIS PAGE SCHEDULE "A" PARCEL I ALL THAT TRACT OR PARCEL OF LAND situate in the.Town of Diana, County of Lewis and State of New York, and further described as follows: . BEGINNING at a concrete monument found in the northerly highway limits of N.Y.S. Route 3, said concrete monument is situate North 71 54' West along the n o r therly h i g h w a y limits of N.Y.S. Route 3, a distance of 7 2 5 - 1 feet from a concrete monument found at an angle point In said highway limits, said last m e n t i o n e d concrete monument is situate North 73 17' West along the northerly highway limits of N.Y.S. Pioute 3, a dist a n c e of 1 0 9 - 8 feet f r o m a concrete monument found at an angle point in said highway limits, said last m e n tioned concrete monument Is situate North 82 09' West along the northerly highway limits of N.Y.S. Route 3, a distance of 88.3 feet from the intersection of the northerly highway limits of N.Y.S. Route 3 and the westerly margin of lands now or formerly owned by the Penn Central Transportation Co., said point of beginning also being the intersection of the northerly highway limits of N.Y.S. Route 3 and the most easterly property line of the parcel of land conveyed b y A delaide B. Montondo to Miguel R o d riguez by deed recorded in the Lewis County Clerk's Office in Liber.337.a t .Page.48.on September .19 ,.1973;....... ,...... thence North 35 33' East along the R o d r i g u e z easterly property line a distance of 166.3 feet to an Iron pipe found; thence Nor t h 56 10' West along the Ro d r i g u e z n o r therly property line a distance of 2 0 8 . 6 feet to an iron pipe found; . thence South 32 49' West along the R o d riguez we s t e r l y property line a distance of 2 2 8 . 3 feet to a rod found In the abandoned centerline of the former State Highway; thence In a generally northwesterly direction along the abandoned centerline of the former State Highway a distance of 257.5 feet to an Iron pipe found in the most southeasterly corner of the parcel of land conveyed by I n t e r n a t i o n a l Talc Company, Inc. to Ric h a r d W. Lozo and Carol Lozo by deed recorded in the Lewis County Clerk's Office in Liber 314 at Page 443 on 2/18/71; thence North 33 3 8 ' East along the Lozo easterly property line a distance of 1 6 0 . 0 feet to a rod found; thence North 56 28' West along the Lozo no r t h e r l y property line a distance of 1 2 5 . 0 feet to an iron pipe found; SEE SCHEDULE "A" (Continued) Daily Record Corp,--14R NOTHING IS TO BE WRITTEN ON THIS PAGE SCHEDULE "A" (Continued) thence South 33 38' West along the Lozo w e s t e r l y property line, passing through an iron pipe found at 141.9 feet and continuing a total distance of 160.0 feet to a point in the centerline of the Old State Road; . thence in a generally northwesterly direction along the centerline of the Old State Road a distance of 525.3 feet to a point; thence N o rth 5 53' West passing through an iron pipe found at 2 7 . 6 feet and continuing a total distance of 864.6 feet to a point; thence North 5 06' West passing through a stump at 1147.4 feet and continuing a total distance of 1 1 5 8 . 0 feet to a point; thence South 85 40' 30" West a distance of 581.4 feet to an iron pipe found; thence North 3 16' 30" West a distance of 1764.0 feet to a nail set in a tree; thence North 7 5 5 T 3 0 " West a distance of 563.5 feet to an i ron.p i p e .found;.... ......... .. . ...... ..... thence South 45 1 9 ' East a distance of 2533.9 feet to an iron pipe found; thence North 42 24' East a distance of 1434.6 feet to an iron pipe found; thence S o uth 47 5 7 ' '30" East a distance of 5120,8feet to an iron pipe found; thence South 50 01' West a distance of 894.6 feet to an iron pipe found in the northerly margin, of the land of the Penn Central Transportation Co.; thence in a generally southwesterly direction along the Penn C entral Transportation Co. no r t h e r l y m a r g i n a distance of 1 2 8 6 . 7 feet to a point, said margin b eing 40 feet northerly of and parallel to the centerline of the existing tracks; thence North 58 54' West a distance of 2036.3 feet to a point; thence South 31 06' West a distance of 1366.3 feet to a p o int in the no r t h e r l y margin of N.Y.S. Route 3] thence North 71 5 4 ' West along the northerly margin of N.Y.S. Route 3 a distance of 260.6 feet to the point of beginning. SEE SCHEDULE "A" (Continued) Daily Record Corp.--14R NOTHING IS TO BE WRITTEN ON THIS PAGE SCHEDULE "A" (Continued) CONTAINING 351.01 acres of land more or less. TOGETHER w i t h a I'OO foot Right of Way a l ong the existing railroad siding which crosses the 3 0 . ^ 5 acre parcel which is to be retained by Carbola Chemical Co., Inc., said Right of Way is as shown on the map titled "Survey Map of the Land of Carbola Chemical Co., Inc., N.Y.S. Route 3, Town of Diana, County of Lewis, State of New York", prepared by Bernier, Peck & G o z a l k o w s k i , Watertown, Nextf York and dated December 11, 1980. PARCEL II TOGETHER with mineral rights excluding sand and gravel In and to the following described parcel of land: ALL THAT TRACT OR PARCEL OF LAND, situate in the Town of Diana, County of Lewis and State of New York bounded and described as follows: BEGINNING at a concrete monument located at the intersection of the northerly highway limits of N.Y.S. Route 3 and the westerly margin of lands now or formerly ov/ned b y the Penn Central T r a n s p o r t a t i o n Co. ; thence along the northerly limits of N.Y.S. Route . 3 the following three courses and distances: (1) N o rth 82 0 9 1 West, 88.3 feet; (2) North 73 17* W e st, 1 0 9 . 8 -feet, and (3 ) .Nor t h 7 1 0 5^ West, h 6 h .5 feet; thence North 31 0 6 ' East, a distance of 1366.3 feet to a point; thence South 58 5^ ' East , a distance of 2036.3 feet to the northerly margin of lands now or formerly owned by the Penn Central Transportation Co.; SEE SCHEDULE "A" (Continued) Daily Record Corp--14R NOTHING IS TO BE WHITTEN ON THIS PAGE SCHEDULE "A" (Continued) thence Nor t h 82 38* West a l ong the northerly margin of lands now or formerly owned by the Penn Central Transportation Co., a distance of 821.7 feet to a point; thence in a generally southwesterly direction along the northerly margin of lands now or formerly owned by the Penn Central Transportation Co., a distance of 1143.4 feet to the point and place of beginning, containing 30.45 acres of land, more or less. TOGETHER with an easement for ingress and egress in and over the parcel just described as may be reasonably necessary to exercise the mineral rights, such ingress and egress to be carried out in a manner that minimizes to the extent possible disruption and interference of the interest of Carbola Chemical Co., Inc. ____________ ____ Daily Record Corp.--14R NOTHING IS TO BE WRITTEN ON THIS PAGE SCHEDULEB The following estates, interests, defects, objections to title, Hens, and incumbrances and other matters are excepted from the coverage of this policy: 1. Defects and incumbrances arising or becoming a lien after the date of this policy, except as herein provided. 2m.enCtoonfseanqyuegnocveesrnomf ethnetaelxwearcrioser paonldiceenpfoowrceersmoevnetrothreapttreemmpisteeds. enforce z3o. nAinngy, blauwilds,inrge,gaunladtieonnvsiroornmorednitnaal npcreostec{tiinocnlu!dai6ngto, tbhuetusneo,tolcicmuiptaendcyto, sguobvdeirvnimsieonntaolrbiomdpyr,oovretmheenetffoefctthoef apnryemnoisnecsoamdpolpiatendceowr iitmhpaonsyedviobylataionny thereof. 4li.enJsuodrgminecnutms against brances the insured or estates, interests, defects, created, suffered, assumed or agreed to objections, by or with the privity of the insured. 5. Title to any property beyond the lines of the premises, or title to areas within or rights or easements in any abutting streets, roads, avenues, lanes, ways or waterways, or the right to maintain therein vaults, tunnels, wrsapimethcpisfstiacnaoldlriynpagnroaynviydoeptshroetvhriastisotsrnuuscchitnutirttehleisso,prraigriahmgtsrpa,rpoohvreetmaosetehnmet,ecnoutsnntalrerasersyin, tsthuhirisesdp.pooNlilciocyty, buenlloenssgiontghetorwaibseutetixncgepotwedn,erisn.sures the ordinary rights of access and egress 6in. cTointnleectotioannywpitehrssoanidalpprerompiesertsyo, rwohtheethrweristeh.e same be attached to or used 7 . No title o r interest is insured to a n y land w i t h i n the lines of any highway or road entering into, running through or abutting upon the premises. 8 . This policy is written upon the express covenant that any contract to sell, or application to mortgage, all or any portion of the insured premises shall provide for acceptance by the vendee or mortgagee as the sole title evidence, a title insurance policy issued by any title company licensed to do business in New York State, which policy shall contain this same covenant and be issued without exception as to any alleged right of any Indian or tribe of Indians and be issued at.the t hen .applicable.rate. T h i s .C orporation agrees u p o n application to re-issue its policy with the same covenant included therein. 9 . The exact acreage of the premises described in Schedule *A" herein is not insured. 10. This poli c y excepts rights to any gold and silver in subject premises, if any. ' 1 1 . Survey of Leo Floyd Gozalkowski, dated December 11, 1 9 8 0 discloses the following: (a) Overhead u t i l i t y lines w i t h p o w e r poles cross southwesterly corner. ^b) Electric service for well house enters from N.Y. State Route 12. Franchise Taxes due the Ne w York State Tax Commission from Carbola Chemical Co., Inc. for the periods 2/28/74, 2 / 2 8 / 7 9 and 2 /2 9 /8 0 . 13. Judgment out of Supreme Court, Lewis County in favor of FMC Corporation Agricultural Chemical Division, Middleport, N.Y. against Carbola Chemical Co. Inc., Natural Bridge, N.Y. in the amount of $8 6 6 . 9 3 5 filed and docketed December 14, 1977. Da i ly Record Corp. ~ 3\ R B SEESCHEDULE "B" (continued) NOTHING IS TO BE WRITTEN ON THIS PAGE Daily Record Corp--: g SCHEDULE"B" (continued) 14. Judgment out of Supreme Court, Onondaga Cou n t y in favor of Smith Transport (US) ltd., 7 0 2 5 Schuyler Rd., Syracuse, New York against Carbola Chemical Co., Natural Bridge, N1 .9 Y7 .9 ,* in the amount of $983*18, .filed and docketed March 23, 15. Mortgage made b y Clark Min e r a l s Inc. to Carbola Chemical Co. Inc., which mortgage is g i v e n to secure the sum of $256,000.00, dated December 1 9 , 1 9 8 0 and recorded December 22, 1980 in the Lewis County Clerk's Office in Liber 212 of Mortgages, page 1 8 3 . 16. Conditions as to mineral rights contained in Deed to Clark Minerals, Inc., dated December 19, 1 9 8 0 and recorded December 22, 1 9 8 0 in the Lewis County Clerk's Office in Liber 4l4 of Deeds, page 148. 17* Rights to firewood and Ingress and egress to cut same as provided in unrecorded Agreement between Carbola Chemical Co., Inc. and Clark Minerals Inc., dated December 1 9 , 1980- _ AGREEMENT | < /, ... > j "/ The date of this Agreement is / , 1980 and the parties are CARBOLA CHEMICAL CO., INC. having an address at Natural Bridge, New York 13665 ("Seller") and WHITTAKER, CLARK & DANIELS, INC., a corporation organized and existing under the laws of the State of New Jersey, having an office at 1000 Coolidge Street, South Plainfield, New Jersey ("Purchaser"). In consideration of mutual covenants, the parties agree as follows: 1. Subject to the terms of this Agreement, Seller agrees to sell and Purchaser agrees to purchase the land, buildings, fixtures, equipment, described in Exhibit A to this Agreement and referred to below as the "Property." Seller shall reserve to itself for the benefit of its designee, Mr. Edward Smith, timbering rights with respect to the Property except for the portion indicated in red on the attached survey (Exhibit "B"). These rights shall be limited to 15 year hardwood cutting rights for firewood with good conservation practices as may be monitored by a New York State forester, and shall be personal to Mr. Smith. The details of these rights will be the subject of a separate letter of understanding between Seller, Purchaser and Mr. Smith, to be executed at closing. Seller shall also convey to Purchaser mineral rights and appropriate access ease ments ("the Mineral Rights") to the parcel to be retained by -2 ~ Seller consisting of 38- acres and indicated in blue on the Survey. 2. The price to be paid to Seller by Purchaser for the Property is $415,000.00 payable as follows: (a) $154,000.00 in certified or cashier's check on the day of closing. Seller acknowledges the receipt of $5,000.00 toward the purchase price, which is non-refundable. (b) The balance of $256,000.00 payable in three payments as follows: $107,500.00 on April 1, 1981; $107,500.00 on April 1, 1982; and $41,000.00 on.April 1, 1983, plus interest accrued on outstanding balances, said payments tr> be secured by a note and mortgage with interest at the rate of eight and one-half percent (8%%) per annum. Seller agrees, at purchaser's option, to subordinate its mortgage to a first mortgage, arranged through the Lewis County Industrial Development Agency, not to exceed $1,000,000.00 the language of such subordination agreement to be in substantially the same form a Exhibit C, attached hereto, and to be acceptable to Seller and Purchaser. Purchaser shall provide Seller with an appropriate bond and mortgage in form acceptable to Seller indica ting the following terms: (i) The Purchaser shall have the privilege of pre payment at anytime after March 1, 1981, without penalty; (it) The mortgage shall be freely assumable, provided that Purchaser will remain fully liable on the bond and any assumption agreement will contain language satisfactory to Seller recitine Purchaser's continued obligation. 3. Seller shall deliver to Purchaser or its attorneys. Bond, Schoeneck & King, with offices at One Lincoln Center, Syracuse, New York, at least thirty days prior to closing of title, -3- an abstract of title covering a period of at least 40 years and beginning with a warranty deed or other source of title reasonably satisfactory to Purchaser, receipted current tax bills and an updated survey of the Property certified to Purchaser or their designee to be corrected by a licensed land surveyor showing a good and marketable title in fee simple to be vested in Seller free and clear of all liens and encumbrances except easements and restrictions of record, so long as the title is not rendered unmarketable and the Property is not restricted from operation as a grinding and mining facility. The survey shall show no facts which would render the title unmarketable. ' 4. Interest, taxes and charges for water, fuel, electricity and sewers which cannot be read by meter on the Closing date are to be apportioned between Seller and Purchaser as of the closing date. ' 5. The transfer of title shall be completed in the offices of Bond, Schoeneck & King, One Lincoln Center, Syracuse, N e w York, on or about November 30, 1980 or at such later date as may be agreed upon by the parties, at which time the Seller shall convey to Purchaser by warranty deed with lien covenant a good and marketable title'in fee simple to the Property and the Mineral Rights together with full warranty Bills of Sale, Assignments of all licenses and/or permits, if any and other instruments of conveyance which are required by Monroe Abstract & Title Corporation to effectively transfer the Property and Mineral Rights to Purchaser. -4- 6. Seller warrants, represents and covenants as follows : (a) At the time of closing it will own the Property in fee simple and will have the power and authorization to convey title to the Property in accordance with this Agreement; (b) The Property is unzoned and no governmental consents, permits, approvals, or certificates of occupancy (including subdivision approval) were obtained to operate the Property or are currently needed to complete this conveyance; (c) The Property, as operated by Seller, complies with OSHA and Federal Mining Safety requirements and Seller has not been cited for any violation of any environmental laws, ordinances, orders, rules and regulations; - (d) Litigation is pending which could result in judgments against the Property. Such judgments will be satisfied by the time of closing; (e) All gas, sewer, water and other utility lines or services used by Seller in the operation of the Property are located on the Property; (f) Except as otherwise provided in this A g r e e ment, the representations and warranties set forth in this paragraph shall be deemed made and effective as of the closing. Transfer of title is contingent upon the representations and warranties of Seller contained in this Agreement being true and complete in all material respects as of the time of closing. -5- 7. Seller authorizes Purchaser to enter the Property prior to closing on the following conditions: (a) Such entry shall be made by Purchaser, at Purchaser's option, to repair, refurbish, remodel and improve the Property as follows: (i) heating system in office to be made operational; (ii) main mill building to be closed in; (iii) additional electrical service to Prope to be established. These changes are called "Improvements" below. (b) If the Closing does not take place for any reason, all Improvements made by Purchaser shall remain the sole property of Purchaser. In such event, Purchaser shall have the option of removing said Improvements without injury to the Property, and such removal shall be accomplished within sixty (60) days after notice from Purchaser or Seller that the Agreement is null and void. (c) Purchaser agrees that it and not Seller will be responsible for safeguarding the Improvements prior to the closing date, and for any damages it may cause to the Property in connection Vfith installation of the Improvements. (d) Purchaser agrees to notify Seller of locations on the Property where Improvements are to be made so that Seller can have a reasonable time to remove or store elsewhere items of Seller's property which can be moved without unreasonable effort or expense. -6- 8. Upon any purchase money mortgage given, Purchaser agrees to pay the usual mortgage tax and recording fee. Seller shall pay the real estate transfer tax. 9. The representations and warranties made by Seller shall survivie the closing and Seller shall indemnify and hold Purchaser harmless for and from any and all damages, claims or losses sustained as a result of any breach of representation or warranty. 10. Except as otherwise provided in Paragraph 7, Seller shall have full responsibility for the Property and shall have all the risks, expenses and benefits of it until the date of closing and passage of title to Purchaser. 11. Seller and Purchaser represent to each other that neither it nor its agents have employed or used any broker or finder in connection with the sale of the Property. 12. This Agreement expresses the entire agreement of the parties regarding the sale of the Property and related matters, and all prior understandings and agreements have no further effect. 13. This Agreement may be assigned by the Purchaser without the prior written consent of the Seller except that if this Agreement- is assigned by the Purchaser, Purchaser shall guarantee in form satisfactory to Seller all obligations assumed by the Assignee with respect to this Agreement. 14. This Agreement may not be changed or terminated orally. The provisions of this Agreement shall bind the successors, assigns and legal representatives of the parties. -7- The parties have executed this Agreement as of the date first written above. CAREOLA CHEMICAL CO., INC. BY -/ ; // -^'4/ J ? , . WHITTAKER, CLARK & DANIELS, BY ^ i&rdScciC' STATE OF IfEW YORK ) COUNTY OF v ' . ) SS. : On this V ) day o f , 198 0 before me personally came EDWARD R. SMITH to me known, who being by me duly sworn, did depose and say that he resides in Natural Bridge, N e w York, that he is the President of CARBOLA CHEMICAL C O . , INC. the corporation.described.in and which executed the above ........ instrument; that he knows the seal of said corporation; that the seal affixed to said instrument is such corporate seal; that it was so affixed by order of the Board of Directors of said corporation, and that he signed his name thereto by like order. STATE OF NEW YORK ) COUNTY OF ss. : Notarjn Public micheie a . s t u n zi Notary Public, State of New York 4609283 Essex County ?^ Commission Expires March 3 0 ,1 9 On this h'i day of <-- , 19 80 before me personally duly sworn came F vk did depose and say >ito that me he known reside who b s in eing by me Mid*lI-et-own i - - - . l v . , . N e w Jersey; that he. is the H - of WHITTAKER, CLARK & DANIELS, INC., the corporation described in and which executed the above instrument; that he knows the seal of said corporation; that the seal affixed to said instrument is such corporate seal; that it was so affixed by order of the Board of Directors of said corporation, and that he signed his name vfphereto by like order. " : / ; / / i, i l i; If'' /*`r. ij C(.d-kA. v i-upu-' -- _______ Notary Public;/ l | AM. ED SCHEDULE "A" PARCEL I ALL THAT TRACT OR PARCEL OF LAND situate in the Town of Diana, County of Lewis and State of New York, and further described as follows: . BEGINNING at a concrete monument found in the northerly highway limits of N.Y.S. Route 3, said concrete monument is situate North 71 54' West along the northerly highway limits of' N.Y.S. Route 3, a distance of 725.1 feet from a concrete monument found at an angle point in said highway limits, said last mentioned concrete monument is situate North 73 17' West along the northerly highway limits of N.Y.S. Route 3, a distance of 109.8 feet from a concrete monument found at an angle point in said highway limits, said last mentioned concrete monument Is situate North 82 09' 'West along the northerly highway limits of N.Y.S. Route 3, a distance of 8 8 . 3 feet from the Intersection of the northerly highway limits of N.Y.S. Route 3 and the westerly margin of lands now or formerly owned by the Penn Central Transportation Co., said point of beginning also being the intersection of the northerly highway limits of N.Y.S. Route 3 and the most easterly property line of the parcel of land conveyed by Adelaide B. Montondo to Miguel Rodriguez by deed recorded in the Lewis County Clerk's Office in . Liber 337 at Page 48 on September 19, 1973; thence North 35 33' East along the Rodriguez easterly property line a distance of 166,3 feet to an iron pipe found; thence North 56 10' West along the Rodriguez northerly property line a distance of 208.6 feet to an iron pipe found; thence South 32 4 g ' West along the Rodriguez westerly property line a distance of 228.3 feet to a rod found in the abandoned centerline of the former State Highway; thence in a generally northwesterly direction along the abandoned centerline of the former State Highway a distance of 2 5 7 . 5 feet to an iron pipe found in the most southeasterly corner of the parcel of land conveyed by International Talc Company, Inc. to Richard W. Lozo and Carol Lozo by deed recorded in the Lewis County Clerk's Office In Liber 314 at Page 443 on 2/18/71; thence North 33 38' East along the Lozo easterly property line a distance of 160.0 feet to a rod found; , thence North 56 28' West along the Lozo northerly property line a distance of 125,0 feet to an Iron pipe found; SEE SCHEDULE "A" (Continued) SCHEDULE " A " (Continued) CONTAINING 351-01 acres of land more or less. TOGETHER with a 100 foot Right of Way along the existing railroad siding which crosses the 30.45 acre parcel which is to be retained by Carbola Chemical Co., Inc. , said Right*of Way Is as shown on the map titled "Survey Nap of the I,and of Carbola Chemical Co., Inc.,- N.Y.S. Route 3> Town of Diana, County of. Lewis, State of New York", prepared by Bernier, Peck & Oozalkowski, Watertown, New York and dated December 1 1 , 1080, PARCEL II TOGETHER.with mineral.rights.exclud in g sand and....... gravel in and to the following described parcel of land: ALL THAT TRACT OR PARCEL OP LAND, situate In the Town of Diana, County of Lewis and State of New York bounded and described as follows: BEGINNING at a concrete monument located at the intersection of the northerly highway limits of N.Y.S. Route 3 and the westerly margin of lands now or formerly owned by the Penn Central Transportation . C o .; thence along the northerly limits of N.Y.S. Route 3 the following thi-ee courses and distances: CO ro 0 (1) .North 09 ' W e s t , 88.3 feet ; (2) North 73 1 7 ' West, 1 0 9 . 8 feet (3) North 71 54 ' W e s t , 464.5 feet thence North 31 06 ' E a s t , a distance of 1366.3 feet to a p o i n t ; thence South 58 54 'East , a distance of 2036.3 feet to the northerly margin of lands now or formerly owned by the Penn Central Transportation Co.; SEE SCHEDULE "A" (Continued) SCHEDULE "A" (Continued) thence North 82 3 8 ' West along the northerly margin of lands now or formerly owned by the Penn Central Transportation Co., a distance of 821.7 feet to a point; thence in a generally southwesterly direction along the northerly margin of lands now or formerly owned by the Penn Central Transportation Co., a distance of 1143.4 feet to the point and place of beginning, containing 30.45 acres of land, more or less. Also conveying an easement for ingress and egress in and over th parcel just described as may be reasonably necessary for party of the second part to exercise its mineral rights, such ingress and egress to be carried out in a manner thatminimizes to the extent possible disruption and interference of the interest of party of the first part The mineral rights herein conveyed shall be exercised in accordance with good and prudent standards of the industry and shall be in rull compliance w 'th all locaL, state and federal laws, rules and regulations. In exercising its mineral rights, party of the second part shall have the absolute and unlimited right to disrupt the sand.and gravel.rights.retained.by party.o f .the.first.part.. If, in the sole opinion of party of the second part in its good faith exercise of its mineral rights, it becomes necessary, party of the second part may render useless the sand and gravel rights retained by party of the first part. SCHEDULE "A" (Continued) thence South 33 38' West along the Lozo westerly property line, passing through an iron pipe found at 141.9 feet and continuing a total distance of lSO.O feet to a point in the centerline of the Old State Road; thence in a generally northwesterly direction along the centerline of the Old State Road a distance of 5 2 5 * 3 feet to a point; thence North 5 53' West p assing through an iron pipe found at 2 7 . 6 feet and continuing a total distance of 864.6 feet to a point; thence North 5 06' West passing through a stump at 1147-4 feet and continuing a total distance of 1158.0 feet to a point; thence South 85 40' 30" West a distance of 581.4 feet to an iron pipe found; thence North 3 1 6 ' 30" West a distance of 1764.0 feet to a nail set in a tree; thence North 7 55' 30" West a distance of 563.5 feet.to an iron.pipe.found;......................... thence South 45 19' East a distance of 2533.9 feet to an iron pipe found; thence North 42 24' East a distance of 1434.6 feet to an iron pipe found; thence South 47 57' 30" East a distance of 5120.8 feet to an iron pipe found; thence South 50 01' West-a distance of 804.6 .feet to an iron pipe found in the northerly margin of the _ ]and of the Penn Central Transportation Co.; thence in a generally southwesterly direction along the Penn Central Transportation Co. northerly margin a distance of 1 2 8 6 . 7 feet to a point, said margin bein g 40 feet northerly of and para]lei to the centerline of the existing tracks; thence North 58 54' West a distance of 2036.3 feet to a point; thence South 31 06' West a distance of 1366,3 feet to a point in the northerly margin of N.Y.S. Route 3; thence North 71 54' West along the northerly margin of N.Y.S. Route 3 a distance of 260.6 feet to the point of beginning. SEE SCHEDULE "A" (Continued) K o n :i N . V . h Oi? i.` ' TO TO E X H IB IT C TunliUv^.-.i Mortgage to secure $ Dated ,19 . Recorded ,19 , in Liber . of Mortgages, at page in County Cleric's Office. Mortgage to secure $ Dated , 19 Recorded ,19 -in Liber ofMortgages, at page- , in said Clerk's office- U n h m t m , Made this in the year One thousand nine hundred and BETWEEN day of of the of of the first part, and , County of n . r. of the of , County of N..r. of the second part, M iiiU 'B B lih j That the said part of the first part, for valuable consideration to paid, receipt of which is hereby acknowledged, do hereby postpone mid make junior and- subordinate the first above described mortgage, of which now the sole owner and holder , and the lien thereof, to the second above described mortgage, held by said paid. of the- second pari, and the lien thereof, and to all advances heretofore made or which hereafter may be made upon said second above described mortgage to the extent of the amount thereof, so that the lien of the said second above described mortgage, including all such advances, shall be in all respects prior and superior in equity, and in fact, to the lien of the- said first above described, mortgage, and, all such advances may be made without notice to said, pari of the first pari. J n SB The said part of the first part ha hereunto set hand, and seal the day and year first above written. it f On this \' day of Nineteen Hundred and before me, the subscnber, personally appeared to me personally known and knovm to me to be the same person in and who executed, the within Instrument, and he acknoivledged to me that he executed the same described ASSIGNMENT Whittaker, Clark & Daniels, Inc., a New Jersey corporation having an office at 1000 Coolidge Street, South Plainfield, New Jersey ("Assignor") hereby assigns as of December 8, 1980 to Clark Minerals, Inc., a New Yor;k corporation w i t h offices in Natural Bridge, New York ("Assignee") all of its right, title and interest in and to a certain agreement of purchase and sale dated November 17, 1980 between Carbola Chemical Co., Inc., as seller, and Assignor, as purchaser, for the purchase of a talc grinding facility in Natural Bridge, N e w York. Assignee assumes as of December 8, 1980 all obligations of Assignor as purchaser under the above described agreement, a copy of w h ich is attached as Exhibit "A". WHITTAKER, CLARK & DANIELS, INC. Dated : A e e 'ft / f t * CLARK MINERALS, INC Sngeitffr unTiith ppurtenan ces and all the estate '1rights of the party of thefirst part in ana tosaid premises. n hattr anit in {dii the premises herein granted unto the party of the Second part, its successors and assigns forever. Anil the party of theprat par covenants as follows: . ffivsl. That the party of the second part shall yuictly enjoy the said premises; >rremit. That the party of thefist part will forever JSarrattl the title tosaid /urniises. efyirii. That, in Compliance with See. 13 of the Lien Law, the grantor will receive the consideration for this conveyance and wilt hold the right to receive such consideration as a trust fund to be applied first for the purpose of paying the cost of the improvement and will apply the same first to the payment of the cost of the improvement before using any part of the total of the samefor any other purpose. S ita tasi o f Hit IStlnrsii 03hm'nf, the party of the first part has caused its corporate seal to be hereunto affixed, and these presents to be signed by its duly authorized officer this V'CX- day of December Nineteen Hundred, and Eighty CARBOLA CHEMICAL CO., INC. Slate rtf ifrtu |htrk j On this SC\ day of December B% Jefferson J Nineteen..Hundred, and Eighty....... . before me personally came f to me personally known, ivho, being by me duly sworn, did depose and say that he, resides in . V.' .. ............ v i ` , the ''S- x,. of Carbola Chemical Co., I n c . that he is the corporation described in, and which executed, the within Instrument; that he knows the seal of said corporation; that the seal affixed to said Instrument is such corporate seal; that it was so affixed by order of the Board of Directors of said corporation; and that he signed his name thereto by like order. Notary Public O ne L incoln c e n t e r SCHEDULE "A" (Continued) thence North 82 38' West along the northerly margin of lands now or formerly owned by the Penn Central Transp or ta tio n Co,, a distance of 821.7 feet to a point thence in a generally southwesterly direction along the northerly margin of lands now or formerly owned by the Penn Central Transportation Co., a distance of 1 1 If3 -^ feet to the point and place of beginning, containing 3 0 - ^ 5 acres of land, more or loss. Also conveying an easement for ingress and egress in and over th parcel just described as may be reasonably necessary for party of the second part to exercise its mineral rights, such impress and egress to be carried out in a manner thatminiinizes to the extent" possible disrupt-ion and interference of the interest of party of the first part The mineral rights herein conveyed shall be exercised in accordance w it h good and prudent standards of the industry and shall be in Full c o m p l i a n c e with all local, tat-e and federal laws, rules and regulations. In exercising its mineral rights, party of the second part shall have the absolute and unlimited right to disrupt the sand and gravel rights retained by party of the first part. .i f ,.i n .the.sole.opinion.of.p a r t y .of.the.second.p a r t .in.its. good faith exercise of its mineral rights, it becomes necessary, party of the second part may render useless the sand and gravel rights retained by party of the first part. r \ /r ' .3W :*s , ` >. ;< A AMENDED SCHEDULE "A" PARCEL I ALL THAT TRACT OR PARCEL OP LAND situate in the Town of Diana, County of Lewis and State of New York, and further described as follows: BEGINNING at a concrete monument found in the northerly highway limits of N.Y.S. Route 3, said concrete . monument is situate North 71 54' Nest along the northerly highway limits of" N.Y.S. Route 3, a distance of 7 2 5 . 1 feet from a concrete monument found- at an angle point in said highway limits, said last mentioned concrete monument is situate North 73 17* West' along the n or t he rl y highway limits of N.Y.S. Route 3, a distance of 1 0 9 . 8 feet from a concrete monument found at an angle point in said highway limits, said last mentioned concrete monument is - situate North 82 0 9 ' West along the northerly highway limits of N.Y.S. Route 3, a distance of 8 8 . 3 feet from the intersection of the northerly highway limits of N.Y.S. Route 3 and the westerly margin of lands now or formerly owned by the Penn Central Transportation Co., said point of beginning also being the intersection of the northerly highway limits of N.Y.S. Route 3 and the most easterly property line of the parcel of land conveyed by Adelaide B. Montondo to Miguel Rodriguez by deed recorded in the Lewis County Clerk's Office in Liber 337 at Page 48 on September 19, 1973; thence North 35 '33' E a s t 'along the Rodriguez easterly property line a distance of 1 6 6 . 3 feet to an iron pipe found; thence North 56 1 0 ' West along the Rodriguez northerly property line a distance of 2 0 8 . 6 feet to an iron pipe found;. ' thence South 32 49' West along the Rodriguez westerly property line a distance of 228.3 feet to a rod found in the abandoned centerline of the former State Highway; thence in a generally northwesterly direction along the abandoned centerline of the former State Highway a distance of 2 5 7 . 5 feet to an iron pipe found in the most southeasterly corner of the parcel of land conveyed by International Talc Company, Inc. to Richard W. Lozo and Carol Lozo by deed recorded in the Lewis County Clerk's Office in Liber 314 at Pag5e 443 on 2/18/71; thence North 33 38' East along the Lozo easterly property line a distance of 1 6 0 . 0 feet to a rod found; . thence North 56 28' West along the Lozo northerly property line a distance of 1 2 5 , 0 feet to an iron pipe found; ' SEE SCHEDULE "A" (Continued) SCHEDULE "A" (Continued) thence South 33 38' West along the Lozo westerly property line, passing through an iron pipe found at l4l.9 feet and continuing a total distance of 160.0 feet to a point in the centerline of the Old State Road; thence in a generally northwesterly direction along the centerline of the Old State Road a distance of 5 2 5 . 3 feet to a point; ^ thence North 5 5 3 ' West passing through an iron pipe found at 2 7 . 6 feet and continuing a total distance of 8 6 if.6 feet to a point; thence North 5 0 6 ' West p as sing through a stump at 1147.4 feet and continuing a total distance of 1 1 5 8 . 0 feet to a point; thence South 85 4 0 ' 30" West a distance of 581.4 feet to an iron pipe found; thence North 3 16 ' 30" West a distance of 1764.0 feet to a nail set in a tree ; thence North 7 55 ' 30" West a distance of 563.5 feet to.a n.iron pipe .f o u n d ;.......... :.. thence South 45 19' East a distance of 2533.9 feet to an iron pipe found; thence North 42 24 ' East a distance of 1434.6 feet to an iron Pipe f o un d; thence South 47 57' 30" East a distance of 5 1 2 0 . feet to an iron P i p e found; 1--( O thence South 50 West'a distance of 894.6 fee to an iron pipe found In the northerly margin of the land of the P en n Central Transport, at ion Co.; thence in a generally southwesterly direction along the Penn Central Transportation Co. northerly margin a distance of 1 2 8 6 . 7 feet to a point, said margin b ein g 40 feet northerly of and parallel to the centerline of the existing tracks; thence North 5 8 54' West a distance of 2036.3 feet to a point; thence South 31 0 6 ' West a distance of 1 3 6 6 . 3 feet to a point in the northerly margin of N.Y.S. Route 3; thence North 71 54' West along the northerly margin of N.Y.S. Route 3 a distance of 260.6 feet to the point of beginning. SEE SCHEDULE "A" (Continued) SCHEDULE "A" (Continued) CONTAINING 351-01 acres of land more or less. TOGETHER with a 100 foot Right of Way along the existing railroad siding which crosses the 3 0 . ^ 5 acre parcel 'which is to be retained by Carbola Chemical Co,, Inc., said Right,of Way is as shown on the map titled "Survey Hap of the Land of Carbola Chemical Co., Inc., N.Y.S. Route 3 Town of Diana, County of Lewis, State of New York", prepared by Bernier, Peck & Go za lk o w s k i , Watertown, New York and dated December 11, 1 3 8 0 . PARCEL II TOGETHER "with"" mineral.rights excluding sand.and..... gravel in and to the following described parcel of land: ALL THAT TRACT OR PARCEL OP LAND, situate in the Town of Diana, County of Lewis and State of New York bounded and described as follows: BEGINNING at a concrete monument located at the intersection of the northerly highway limits of N.Y. Route 3 and the westerly margin of lands now or formerly owned by the Penn Central Transportation Co. ; . thence along the northerly limits of N.Y.S. Route 3 the following three courses and distances: COCOM ( 1 ) North 09 ' Vies t , 88.3 feet; ( 2 ) North 73 1 7 ' West, 109.8 feet, (3) North 71 5 2j , West , ^164.5 feet; thence North 31 06 * East, a distance of 1366.3 feet to a p o i n t ; thence South 58 5^' East , a distance of 2036.3 feet to the northerly margin of lands now or formerly owned by the Penn Central Transportation Co.; SEE SCHEDULE "A" (Continued) FO R M Mo N - Y. BO N D F U L L CO V EN A N T (F kojc X COB'OBATION) TUTBLAN TUTTTJE UW PXRINrTe,sPiDstBeUrSeHdERuS.. s . u rreatrte.. oVTf.pmicokt ? That at Naturai Bridge, New York, obligor is held and firmly bound unto CARBOLA CHEMICAL CO., INC. obligee in the sum of Two Hundred Fifty-Six Thousand and no/100 ($256,000.00) Dollars, lawful money of the United States of America, to be paid to the said Carbola Chemical Co., Inc. its executorsradwm/nisirators, successors or assigns: well and truly to be made it binds itself, its successors or assigns firmly by these presents. . with its seal Dated the day of j December Nineteen Hundred and Eighty .....CSJpf.OTf&tttnir tin vk$tm....................................thatif the above... bounden Clark Minerals, Inc. its successors or assigns, shall well and truly pay, or cause to be paid, unto the above named Carbola Chemical Co., Inc. its -executors,--administrators, successors or assigns the just and full sum of Two Hundred Fifty-Six Thousand and no/100 ($256,000.00) with interest at the rate of 8 1/2% per annum, payable as follows: $107,500.00 plus interest accrued on the outstanding principal balance on April 1, 1981; $107,500.00 plus interest accrued on the outstanding balance on April 1, 1982; and $41,000.00 plus interest accrued on the outstanding balance on April 1, 1983. Obligor shall have the privilege of prepayment at any time after March 1, 1981 without penalty. w ith o u t any fraud or other delay, then the- above obligation to be void, otherwise to remain in full force and virtue-. M t h I t y tte x tb g t x p r t & f ik * & & & .$ that the whole of said principal sum shall become due at the option of the said obligee its legal representatives or assigns after default in the payment of any installment of principal or of interest for thirty days, or after default in the payment of any tax, water rate or assessment which may be levied or imposed upon the premises described in the mortgage accompanying this bond for thirty days after notice and demand. itJ k n h y tg tw fr that the said obligor will keep the buildings on the said premises described in the said mortgage insured against loss by fire for the benefit of the mortgagee therein. All of the covenants and agreements in the mortgage covering premises therein described and collateral hereto, are hereby made pari of this instrument. See Addendum to Note ih i^ n cto i 3$n ^^ ^ obligor has caused its corporate seal to be hereunto affixed, and these presents to be signed by its duly authorized officer the day and year first above written. r l a rlr M in p ra lg , Tn ir. Ry r i ' A A . // Joshua H. Bennett, Jr. A ` B f M t &i Iktrit ) (ffituttlt> Xif Jefferson * itf fSS.. ) On this i Cf day of December , .nineteen Hundred and Eighty before me personally came Joshua H. Bennett, Jr. to me personally Jgnown, who, being by me duly sworn, did depose and say that he resides in "fopot ."lieu that he is the President Vof Clark Minerals, ihc. ' the corporation described in, and which executed, the above Instrument; that he knows the seal of said corporation; that the seal affixed to said Instrument is such corporate seal; that it was so affixed by order of the Board of Directors of said corporation; and that he- signed h is name thereto by like order. .'y i ______ Z cicL /X ., S.i-AA - L Notary Publ'ic / K< r I1 I'-f) ijixtiVJ ,v ,o n ,m e.u u u w n tO N D ,L /ie.fvu vu ;in ffM .m .ou ?u sx> f t -r in c ir a l m a> n t e r E S T . ADDENDUM TO NOTE BETWEEN CLARK M I N E R A L S , I N C ., OBLIGOR AND CARBOLA CHEMICAL CO., INC., OBLIGEE DATED: D E CEMBER /), 1980 Obligor shall have a right of offset under this Bond in the event that any claim should arise under the Uniform Commercial Code - Bulk Transfers Act (UCC Section 6-101 et. seq.) or under the provisions of the New York State Tax Law with respect to sales tax liability arising from transfers in bulk (Tax Law Section 1141). If such a claim is asserted against Obligor, Obligor shall promptly notify Obligee. Obligee may contest, at its own expense, the validity of any claim. If Obligee does not contest the claim in a timely manner, or if the claim be finally adjudicated against Obligor, without opporunity for further appeal or without further appeal being taken at O b l i g e e 's request, Obligor shall set off from the next payment due Obligee under the bond the full amount of such claim, any interest or penalties added to such claim, and reasonable expenses incurred by Obligor in connection with such claim, including reasonable attorneys' fees and disburse ments. Should the sums eligible for offset exceed the amount then due and owing under the Bond, Obligee shall indemnify and save harmless Obligor from any liability or liabilities in connection with such claims pursuant to the Bulk Sales Law or above stated section of the Tax Law. Such indemnity shall include all reasonable expenses incurred by Obligor in contesting or defending any such claims, including attorneys' fees and disbursements. C 1o V K `viivu1f LL C'.cfeeuh C vvtflm CAL-. Cz- ,Iv. ... // . covenant s w ith the m ortgagee as follou-s: ' p rovMideXdS. t* T h a t the m o rtg a g o r w ill pay the indebtedness as hereinbefore " '' 0M IW I, T hat the m ortgagor 'will keep the buildings on the prem ises insured again st loss odamnenoldritvthgedearegilmneivegoe. rrtthg tebha yfegpofoorpilrroi'aecslnii cefyisoerps dr eetthofmea ituuhblemte nismne fpoi_arst toigdoaifgnfeostehur.er iinn;mgs ouatrrhntagedn.acgbeteuhei almdt ; that iandges iobtry , i?wtiihitselol mar esoismwri gtigbnlauligrnasegees saitnghnde That no building on the prem ises shall be rem oved or dem olished w ithout the consent of the m ortgagee . pdmnauoeytenimcJtaeettonaaftttnhprdoerfihodnap.ecntmiipyoaanTntlahdooxa;fr,t toowhtrhfeaeaitmnefwrttoeehrrrtoregdlaseaettgefofeaofeuorslrat ia:adt.ffshtfsefplertrresinswtnmoycdteiiepcnfeataluafnlsotu,dr midnatyahsne;dpoariynamtfeterenerst dtehmiarntdy e ith e tdo r efsi^fnhaaandualayllsytsisbniigensacntofaittmnhel lgere rbtaaheemnifsmodormubeudnoeprrt stlrgiiodvnavueggiredeienthoddgne;ebottmthh,reoeaarstfmpgtheoaorelgrircetdegieieeansfgaaefuitnlaeftorsnu-rdpurrppionorwvngehi-mdeettrihdhue.eeqmrusbeasuntpiyladiinoidnffgsfosuentrsnasguoisrachhidinnesigfntesnlauosrsesasstnaecbtexey,mifsaitersneahtgeooarfrientiihnsnet sh a l3l $bief iehn, titlTe dh atio tthhee ahpopldoeirn tmo fe ntht iso f ma orretgceaigvee,r. in a n y action to foreclose it, ' a n d in d e fa u ltT hthaetrethoef, mthoertmg aogrotgra g eweill pmaay y a plla tya xthe se, saasmsees. sm en ts or w a te r ra tes, moo fref snwettist dh oui nrl yd That the eatfcwekennnsoetswyleexdigset da godmafaoiytnhrstsegt.uaatpghmooenor umrnewotqritutdgheuaisnegt ebofnydiefmbtthtea.iiesl.n.wmciiolalrytfgSuaurgnpeoi.ns..h,arneadq,uwwersihttteeitnjhbeprsetraasntoeny .. be s eircvtegdl f ii ni j .p e r T so h n at notice or by m a a il n . d dem and or request m a y be in w ritin g and. m ay H fn tf;. That the m ortgagor w arrants the title to the prem ises. wrtthheiceelelipcOvoareUseytscmmueoiicefvfhnre.taitmhdovepfTarhnotahavcdeteev,msaicnneaoncssCett,saoomfatsrpneuilcmdisautpnrtrechfoeduavnwtebmdyitthheteotnshtebmicsebtoiaemorfptnogoprar1eltgi3geoaduorgsffeiiwtnrhisageltnl LdafaoinspwrynpitllLhylpeaahwtprho,uteltrdohpsfeoatsthmmheeeoeorftrtfgoipigartaahgsylttoinrottgoof the sam e fo r an y other purpose. ELEVENTH: It is understood and agreed that Mortgagor shall transfer title into the Lewis County Industrial Development Agency in connection with the financing of rehabilitation of the mortgaged premises. Mortgagee agrees, at Mortgagor's option, to subordinate the lien of this Mortgage to a certain first mortgage to be given by the Lewis County Industrial Development Agency to an industrial revenue bond purchaser in a sum not to exceed $1,000,000 and any advances heretofore or to be made and to any extensions, modifications or renewals thereof. M rn '^ n a * o f CARBOLA CHEMICAL CO., INC. (mortgagee) mshaiengordnreteugydnaetgaoboryrafihfitfrsaisxsdteucdaalb,youavsaeneu-ddtwhitrotshirtSecitzesoeenIrdp.fpoofrrfieafiistceeWensrettsahi lettodoTahbbeyee CLARK MINERALS, INC. B i t i i t & f 2Crlt? w o f Jefferson s of On this Eighty t^ day of D e c e m b e r Nineteen Hundred and before me -personally came J o s h u a H. Benn e t t , Jr. to me personally Tcnown, who, being by me duly sworn, did depose and say that thehe resides in President 0f . Clark Minerals, Inc. that he is the corporation described in, and which executed, the within Instrument; that he knows the seal of said corporation; that the seal affixed to said Instrument is such corporate seal; that it was so affixed by order of the Board of Directors of said corporation; and that he signed h is name thereto by like_ order. n , <, ? VfcL. 9:.,yg Notary Public ____ .S T A T E OF N E W Y O R K . ) COUNTY OF JEFFERSON ) b PAULA CPtW 'SCiFTCE ^ %Notsry P;-b!ie in th f Stala VwK n Ov.Pi'-icfls C c. Mo. 6 2 7 2 5 ^ . ^ ^ *** 30, J T K O n t h i s '-P. day of December, Nineteen Hundred and Eighty before me personally came vc.*.-. me personally known, who, being by me duly sworn, did depose and say-that he resides in l-STi Xci- - 'S 'fc-.v-OVAQ. , t h a t h e is t h e '"^cn 1 0 ' ^ of Carbola Chemical Co., Inc., the corporation described in, and which executed, the within Instrument; that he knows the seal of said corporation; that the seal affixed to said Instrument is such corporate seal; that it was so affixed b y o rder of the Board of Directors of said corporation; and that he signed his name thereto by like order. ''AA..V\XZ N o t a r y P u b l i c Ca > \ Ob & A 0 z * .cB S3 r t <0 o Id > Z id 0 _ 0 Kz p uz WWDU< r AMENDED SCHEDULE "A" PARCEL I ALL THAT TRACT OR PARCEL OP LAND situate in the Town of Diana, County of Lewis and State of Hew York, and further described as follows: BEGINNING at a concrete monument found In the northerly highway limits of N.Y.S. Route 3 5 said concrete monument is situate North 71 54' West along the northerly highway limits of'N.Y.S. Route 3, a distance of 7 2 5 . 1 feet from a concrete monument found at an angle point in said highway limits, said last mentioned concrete monument is situate North 73 17' West along the northerly highway limits of N.Y.S. Route 3j a distance of 109.8 feet from a concrete monument found at an angle point in said highway limits, said last mentioned concrete monument is situate North 82 09' West along the northerly highway limits of N.Y.S. Route 3, a distance of 8 8 . 3 feet from the intersection of the northerly highway limits of N.Y.S. Route 3 and the westerly margin of lands now or formerly owned by the Penn Central Transportation Co., said point of beginning also being the intersection of the northerly highway limits of N.Y.S. Route 3 and the most easterly property line of the parcel of land conveyed by Adelaide B. Montondo to Miguel Rodriguez by deed recorded in the Lewis County Clerk's Office in L i b e r .3 3 7 at Page 4 8 on September 19 , 197 3; thence North 35 33' East along the Rodriguez easterly property line a distance of 1 6 6 , 3 feet to an iron pipe found; ` thence North 56 10' West along the Rodriguez northerly property line a distance of 2 0 8 . 6 feet to an iron pipe found;, thence South 32 49' West along the Rodriguez westerly property line a distance of 2 2 8 . 3 feet to a rod found In the abandoned centerline of the former State Highway; thence in a generally northwesterly direction along the abandoned centerline of the former State Highway a distance of 2 5 7 - 5 feet to an iron pipe found in the most southeasterly corner of the parcel of land conveyed by I nternational Talc Company, Inc. to Richard W. Lozo and Carol Lozo by deed recorded in the Lewis County Clerk's Office in Liber 314 at Page 443 on 2/18/71; thence North 33 38' E a s t 'along the Lozo easterly property line a distance of 1 6 0 . 0 feet to a rod found; . thence North 56 28' West along the Lozo northerly property line a distance of 125-0 feet to an Iron pipe found; SEE SCHEDULE "A" (Continued) SCHEDULE "A" (Continued) thence South 33 38* West along the Lozo westerly property line, passing through an iron pipe found at 1 *1 1 . 9 feet and continuing a total distance of 160.0 feet to a point in the centerline of the Old State Road; thence in a generally northwesterly direction along the centerline of the Old State Road a distance of 5 2 5 . 3 feet to a point; thence North 5 53' West passing through an iron pipe found at 2 7 . 6 feet and continuing a total distance of 86*1.6 feet to a point; thence North 5 06' West passing through a stump at 11*17.4 feet and continuing a total distance of 1 1 5 8 . 0 feet to a point; thence South 85 40' 30" West a distance of 581.4 feet to an iron pipe found; thence North 3 16' 30" West a distance of 1764.0 feet to a nail set in a tree; thence North 7 55' 30" West a distance of 563.5 .feet t o an iron pipe.f o u n d ;.............. ............ ... thence South 45 19' East a distance of 2533.9 feet to an iron pipe found; thence North 42 24' East a distance of 1434.6 feet to an iron pipe found; thence South 47 57' 30" East a distance of 5120.8 feet to an iron pipe found; thence South 50 01* West'a distance of 894.6 feet to an iron pipe found in the northerly margin of the ( land of the Penn Central Transportation Co.; thence in a generally south-westerly direction along the Penn Central Transportation Co. northerly margin a distance of 1 2 8 6 . 7 feet to a point, said margin bein g 40 feet n ortherly of and parallel to the centerline of the existing tracks; , thence North 5 8 54' West a distance of 2036.3 feet to a point; thence South 31 06' West a distance of 1 3 6 6 . 3 feet to a point in the northerly margin of N.Y.S. Route 3; thence North 71 54' West along the northerly margin of N.Y.S. Route 3 a distance of 260.6 feet to the point of beginning. . SEE SCHEDULE "A" (Continued) SCHEDULE "A" (Continued) CONTAINING 351-01 acres of land more or less. TOGETHER with a 100 foot Right of Way along the existing railroad siding which crosses the 30.45 acre parcel which is to be retained by Carbola Chemical Co., Inc., said Right,of Way is as shown on the map titled "Survey Map of the Land of Carbola Chemical Co., Inc., N.Y.S. Route 3, Town of Diana, County of Lewis, State of New York", prepared by Bernier, Peck & Gozalkowski, Watertown, New York and dated December 11, lflSO. PARCEL II TOGETHER with mineral rights excluding sand and gravel In and to the following described parcel of land: ALL THAT TRACT OR PARCEL OP LAND, situate In the Town of Diana, County of Lewis and State of New York bounded and described as follows: BEGINNING at a concrete monument located at the intersection of the northerly highway limits of N.Y.S Route 3 and the westerly margin of lands now or formerly owned by the Penn Central Transportation Co.; ' ` thence along the northerly limits of N.Y.S. Route 3 the following three courses and distances: (1 ) North 8 2 09 ' W e s t , 8 8 . 3 feet ; (2 ) North 73 1 7 ' W e s t, 1 0 9 . 8 feet, (3) North 71 54' W e s t , 464.5 feet; thence North 31 0 6 * East, a distance of 1 3 6 6 . 3 feet to a p o i n t ; thence South 58 5*1' East , a distance of 2 0 36 . 3 feet to the northerly margin of lands now or formerly owned by the Penn Central Transportation Co.; SEE SCHEDULE "A" (Continued) SCHEDULE "A" (Continued) thence North 82 38' West along the northerly margin of lands now or formerly owned by the Penn Central Transportation Co,, a distance of 821.7 feet to a point; thence in a generally southwesterly direction along the northerly margin of lands now or formerly owned by the Penn Central Transportation Co., a distance of 11^3^ feet to the point and place of beginning, containing 3 0 . ^ 1 5 acres of land, more or less. Also conveying an easement for ingress and egress in and over tha parcel just described as may be reasonably necessary for party of the second part to exercise its mineral rights, such intrress and egress to be carried out in a manner thatminimizes to the extent- possible disruption and interference of the interest of party of the first part The mineral rights herein conveyed shall be exercised in accordance with good and prudent standards of the industry and shall be in full compliance with all local, state and federal laws, rules and regulations. In exercising its mineral rights, party of the second Dart shall have the absolute and unlimited right to disrupt the sand and gravel rights retained by party of the first part. If, i n.the.sole.op m ion.o f.par ty .of the.s e c o n d .par t.in.its. good faith exercise of its mineral rights, it becomes necessary, party of the second part may render useless the sand and gravel rights retained by party of the first part. CLARK MINERALS, INC. 1000 Coolidge Street South Plainfield, New Jersey Carbola Chemical Co., Inc. Natural Bridge. New York ' Attention: Mr. Edward Smith Dear Mr. Smith: ' Pursuant to the agreement of purchase and sale dated November 17, 1980 between Whittaker, Clark & Daniels. Inc. and Carbola Chemical Co., Inc., this letter shall represent our understanding regarding the firewood rights to be retained bv Carbola Chemical Co., Inc. ("Carbola"). The rights reserved shall be limited to the area indicated on the attached survey. Carbola shall have the right for 15 years from the date the title is transferred to Whittaker, Clark & Daniels, Inc. or its assignee, to enter upon the designated area of the property to cut hardwood for -firewood purposes. Such firewood removal shall be in accordance w i t h good conservation practices as may be monitored by a New York State Forester, and shall be in full compliance with all other state, local and federal laws and regulations. .The.removal.of.firewood and the necessary.ingress t o .and.......... egress from the property shall not disrupt the operation of the talc processing facility or anv other operations in the area excluded from firewood rights on the attached survey, and shall be carried out so as to minimize interference with our interests in the entire narcel. It is understood that these rights shall be personal to Carbola and shall not benefit its successors or assigns. ' It is understood and agreed that all removal of firewood is at Carbola's sole risk. Carbola shall defend and indemnify Clark Minerals, Inc. for any and all liability it may incur for damages to person or property., which may occur as a result of the exercise of the above rights, . -. Very truly yours, CLARK MINERALS. INC. CARBOL INC. BY Edward"' 'Smith,' President CERTIFIED COPY OF RESOLUTION TO MORTGAGE 1/ Joshua H. Bennett, Jr., Secretary of Whittaker, Clark & Daniels, Inc., a New Jersey corporation with offices at 1000 Ccolidye Street, South Plainfield, Hew Jersey, do hereby certify that at a meeting of the Board of Directors of the corporation duly called, held at the offices of ' Whittaker, Clark & Daniels, Inc., South Plainfield, New Jersey, on the 8th day of December, 1980, at which a quorum was present, the following resolutions were unanimously adopted: WHEREAS, the corporation has entered into a contract to purchase the premises described in Schedule A annexed .from Carbola Chemical C o . .Inc. , and.................... ....... WHEREAS, the corporation has formed a subsidiary, Clark Minerals, Inc., to own and operate the facility, and WHEREAS, to induce the seller to take a mortgage from Clark Minerals, Inc., it required that the corporation agreed to guarantee this indebtedness, '' NOW THEREFORE, BE IT RESOLVED that this corporation ratify and confirm the contract with Carbola Chemical Co., Inc. to buy the property described in Schedule A, a copy of which SQntract is attached, and BE IT FURTHER RESOLVED that all of the corporation's rights under the contract be assigned to Clark Minerals, Inc,, who will assume all of the corporation's obligations under the contract, and BE IT FURTHER RESOLVED that this corporation guarantee the indebtedness of Clark Minerals, Inc. to Carbola Chemical Co., Inc. which will be secured by a note and mortgage in the sum of $256,000.00 to be repaid with interest thereon at 8 1/2% per annum on the terms set forth in the contract, and BE IT FURTHER RESOLVED that the form of the assignment and guaranty and all other necessary and proper documents executed in connection with them shall be in a form approved ' by counsel to the corporation, and BE IT FURTHER RESOLVED that the President or any other officer of.the corporation.is authorized to execute and deliver on behalf of the corporation the assignment, guaranty and other necessary and proper documents and to affix the corporate seal to them. . I do hereby certify that the certificate of incorporation and the by-laws of the corporation do not require the consent of shareholders. . WHITTAKER, CLARK & DANIELS, INC. "? L I.f , STATF.OF -NEW JERSEY ) COUNTY OFCVrjqo i,v) ) b ; By : 'I 1 ^ Joshua H. B e n n e t t J r . Secretary On this day of December, 1980, before me personally came Joshua H. Bennett, Jr., to me known and known to me to be the individual described in and who executed the within instrument, and he acknowledged to me that he executed the - ( AMENDED SCHEDULE "A" PARCEL I ALL THAT TRACT OR PARCEL OP LAND situate in the Town of Diana, County of Lewis and State of New York, and further described as follows: BEGINNING at a concrete monument found in the northerly highway limits of N.Y.S. Route 3, said concrete monument- is situate North 71 54' West along the northerly highway limits o f 'N.Y.S. Route 3, a distance of 7 2 5 . 1 feet from a concrete monument found at an angle point in said highway limits, said last mentioned concrete monument is situate North 73 17' West along the northerly highway limits of N.Y.S. Route 3, a distance of 109.8 feet from a concrete monument found at an angle point in said highway limits, said last mentioned concrete monument is situate North 82 09' West along the northerly highway limits of N.Y.S. Route 3, a distance of 88.3 feet from the intersection of the northerly highway limits of N.Y.S. Route 3 and the westerly margin of lands now or formerly owned by the Penn Central Transportation Co., said point of beginning also being the Intersection of the northerly highway limits of N.Y.S. Route 3 and the most easterly property line of the parcel of land conveyed by Adelaide B. Montondo to Miguel Rodriguez by deed recorded in the Lewis County Clerk's Office in Liber 337 at Page 48 on September 19, 1973; thence North 35 33' East along the Rodriguez easterly property line a distance of 1 6 6 . 3 feet to an iron pipe found; . thence North 5 6 0 1 0 ' West along the Rodriguez northerly property line a distance of 2 0 8 . 6 feet to an iron pipe found; thence South 32 49' West along the Rodriguez westerly property line a distance of 228.3 feet to a rod found in the abandoned centerline of the former State Highway; , thence In a generally northwesterly direction along the abandoned centerline of the former State Highway a distance of 257.5 feet to an Iron pipe found in the most southeasterly corner of the parcel of land conveyed by International Talc Company, Inc. to Richard W. Lozo and Carol Lozo by deed recorded in the Lewis County Clerk's Office in Liber 314 at Page 443 on 2/18/71; thence North 33 38' East along the Lozo easterly property line a distance of 1 6 0 . 0 feet to a rod found; thence North 56 28' West along the Lozo northerly property line a distance of 125.0 feet to an Iron pipe found; SEE SCHEDULE "A" (Continued) SCHEDULE "A" (Continued) CONTAINING 351.01 acres of land more or less. TOGETHER with a 100 foot Right of Way along the existing railroad siding which crosses the 30.45 acre parcel which is to be retained by Carhola Chemical Co., Inc,, said Right,of Way is as shown on the map titled "Survey Hap of the Land of Carbola Chemical Co., Inc., N.Y.S. Route 3, Town of Diana, County of Lewis, State of New York", prepared by Bernier, Peck & Gosalkowski, Watertown, New York and dated December 11, 1930. PARCEL II TOGETHER with min e r a l .r i g hts'excluding .sand and... ... gravel in and to the following described parcel of land: ALL THAT TRACT OR PARCEL OF LAND, situate in the Town of Diana, County of Lewis and State of New York bounded and described as follows: BEGINNING at a concrete monument located at the intersection of the northerly highway limits of N.Y.S Route 3 and the westerly margin of lands now or formerly owned by the Penn Central Transportation Co.; thence along the northerly limits of N.Y.S. Route 3 the following three courses and distances: . 0O C\J 1--1 co (1) North 09 ' West, 8 8 , 3 feet; ( 2 ) North 7 3 1 7 ! West , 109.8 feet, (3) North 54 ' W e s t , 464.5 feet; thence North 31 0 6 ' East, a distance of 1 3 6 6 .3 feet to a point; thence South 58 5^' F.ast , a distance of 2036.3 feet to the northerly margin of lands now or formerly owned by the Penn Central Transportation Co.; SEE SCHEDULE "A" (Continued) CERTIFIED COPY OF RESOLUTION TO MORTGAGE I, RICHARD G. LIGHT, Secretary of Clark Minerals, Inc., a New York corporation with offices at Natural Bridge, New York, do hereby certify that at a meeting of the Board of Directors of the corporation duly called, held at the offices of Whittaker, Clark & Daniels, Inc., South Plainfield, New Jersey, on the 8th day of December, 1980, at which a quorum was present, the following resolutions were unanimously adopted: WHEREAS, the corporation is to purchase the premises described in Schedule A annexed from Carbola Chemical Co., Inc. and desires to finance the purchase by giving a note and mortgage to seller in the sum of $256,000.00, NOW THEREFORE, BE IT RESOLVED that this corporation purchase from Carbola Chemical Co., Inc. the property described in Schedule A and finance the purchase by giving to the seller a note and mortgage in the sum of $256,000.00 to be repaid with interest thereon at 8 1/2% per annum and on the terms set forth in the contract between the corporation and the seller dated November 17, 1980, and, . BE IT FURTHER RESOLVED that the form of the note and mortgage and all other necessary and proper documents executed in connection with them shall be in a form approved by counsel to the corporation, and BE IT FURTHER RESOLVED that the President or any other officer of the corporation is authorized to execute and deliver on behalf of the corporation the note, mortgage and other necessary and proper documents and to affix the corporate seal to them. I do hereby certify that the certificate of incorporation and the by-laws of the corporation do not require the consent of shareholders. CLARK MINERALS, INC STATE OF NEW JERSEY ) COUNTY OF ) SS On this 2.3 day of December, 1980, before m e personally came Richard G. Light, to me known and known to m e to be the individual described in and who executed the within instrument, and he acknowledged to me that he executed the same. ..... i }1 ' SCHEDULE "A" (Continued) f thence North 82 3 8 1 West along the northerly margin I of lands now or formerly owned by the Penn Central Transportation Co., a distance of 8 2 1 . 7 feet to a point; , thence in a generally southwesterly direction along \ the northerly margin of lands now or formerly owned ' by the Penn Central Transportation Co., a distance ; \ of 1143.4 feet to the point and place of beginning, containing 30.45 acres of land, more or less. I i | I i fIt I SCHEDULE "A" (Continued) CONTAINING 351.01 acres of land more or less. TOGETHER with a 100 foot Right of Way along the existing railroad siding which crosses, the 30.45 x acre parcel which is to be retained by Carbola Chemical Co., Inc., said Right of Way Is as shown -ion the map titled "Survey M a p of the Land of Carbola Chemical Co., Inc., N.Y.S. Route 3, Town of Diana, County of Lewis, State of New York", prepared by Bernier, Peck & Gozalkowski, Watertown, New York and dated December 11, 1980. 3 PARCEL II TOGETHER with mineral rights excluding sand and gravel in and to the following described parcel of land : ALL THAT TRACT OR PARCEL OP LAND, situate in the Town of Diana, County of Lewis and State of New York bounded and described as follows: BEGINNING at a concrete monument located at the intersection of the northerly highway limits of N.Y.S. Route 3 and the westerly margin' of lands non or formerly owned by the Penn Central Transportation .. C o .; thence along the northerly limits of N.Y.S. Route 3 the following three courses and distances: (1 ) North 8 2 09' W e s t , 88.3 feet; (2 ) Nor t h 7 3 17' W e s t, 1 0 9 . 8 feet, (3) North 71 5*11 W e s t , *164.5 feet; thence North 31 0 6 ' East, a distance of 1366.3 feet to a point] thence South 58 54' East , a distance of 2036.3 feet to the northerly margin of lands now or formerly owned by the Penn Central Transportation Co.; h r- SCHEDULE "A" (Continued) thence South 33 38' West along the L ozo westerly property line, passing through an iron pipe found at l4l,,9 feet and continuing a total distance of 160.0 feet to a point in the centerline of the Old State Road; thence in a generally north w e s t e r l y direction along' the centerline of the Old State Road a distance of \ 5 2 5 - 3 feet to a point; \thence North 5 5 3 ' West passing through an iron pipe found at 27-6 feet and continuing a total distance of 864.6 feet to a point; thence North 5 06' West pas s i n g through a stump at 1147.4 feet and continuing a total dist a n c e of II5 8 .O feet to a point; thence South 85 *10' 30" West a d istance of 581.4 feet to an iron pipe found; thence North 3 1 6 ' 3 0 " West a distance of 1764.0 feet to a nail set in a tree; thence N o rth 7 5 5 1 30" 'West a dist a n c e of 563-5 ..... feet to an iron pipe found; thence South 45 19' East a distance of 2533.9 feet to an iron pipe found; thence North 42 2 4 ' East a distance of 1434.6 feet to an iron pipe found; thence South 47 57' 30" East a d i stance of 5120.8 feet to an iron pipe found; thence South 50 01' West a distance of 894.6 feet to an iron pipe found in the northerly margin of the land of the Penn Central Transportation Co.; thence in a generally southwesterly direction along the Penn Central Transportation Co. northerly margin a distance of'1286.7 feet to a point, said margin b e i n g 40 feet northerly of and parallel to the centerline of the existing tracks; thence North 5 8 5^' West a distance of 2 0 3 6 .3 feet to a point; thence South 31 06* West a distance of 1 3 6 6 . 3 feet to a point in the northerly marg i n of N.Y.S. Route 3; thence North 71 5*1' West a l ong the no r t h e r l y margin of N.Y.S. Route 3 a distance of 260.6 feet to the point of beginning. SCHEDULE " A" PARCEL I ALL THAT TRACT OR PARCEL OP LAND situate in the Town of Diana, County of Lewis and State of New York, and further described as follows: . . BEGINNING at a concrete monument found in the northerly highway limits of N.Y.S. Route 3, said concrete - monument Is situate N o r t h 71 54' West along the northerly highway limits of N.Y.S. Route 3, a distance ' of 7 2 5 . 1 feet from a c o n c r e t e monument found at an \angle point in said highway limits, said last me n t i o n e d concrete m o n u m e n t is situate North 73 17' West along the northerly highway limits of N.Y.S. Route 3, a distance of 109-8 feet f rom a concrete monument found at an angle point in said highway limits, said last m e n t i o n e d concrete monument Is - situate North 82 09' W est a l ong the northerly highway limits of N.Y.S. Rou t e 3, a d i s t a n c e of 8 8 . 3 feet from the intersection of the northerly highway limits of N.Y.S. Route 3 and the westerly margin of lands now or formerly owned by the Penn Central Transportation Co., said point of beginning also being the intersection of the northerly highway limits of N.Y.S. Route 3 and the.most easterly p r o p e r t y line of the parcel of land conveyed by Adelaide B. M o n t o n d o to Miguel.R o d riguez .. by deed recorded In the Lewis County Clerk's Office in Liber 337 at Page 48 on September 19, 1973; thence North 35 33' East a l ong the Rodriguez easterly property line a distance of 1 6 6 . 3 feet to an iron pipe found; thence North 56 10' W est a l o n g the Rodriguez n o r therly property line a distance of 2 0 8 . 6 feet to an iron-pipe found; thence South 32 49' West along the Rodriguez wes t e r l y property line a distance of 2 2 8 . 3 feet to a rod found In the abandoned centerline of the former State Highway; thence in a generally northwesterly direction along the abandoned centerline of the former State Highway a distance of 257.5 feet to an iron pipe found In the most southeasterly corner of the parcel of land conveyed by International Talc Company, Inc. to Richard W. Lozo and Carol Lozo by deed recorded in the Lewis County Clerk's Office in Liber 314 at Page 443 on 2/18/71; thence North 33 38' E ast a l o n g the Lozo easterly property line a distance of 1 6 0 . 0 feet to a rod found; thence North 56 28' W est a l o n g the Lozo northerly property line a distance of 1 2 5 . 0 feet to an iron pipe found; ; RESOLUTION OF BOARD OF DIRECTORS OF CAREOLA CHEMICAL CO., INC. Be it resolved that, the Board of Directors recommends to the shareholders of the corporation that the corporation be authorized to sell approximately 346 acres of land, including all of the mines, mills, plant, offices, buildings and improvements to Whittaker, Clark & Daniels, Inc. or its designee, upon the terms contained in the purchase option dated August 22, 1980 between this corporation and Whittaker, Clark & Daniels, Inc. and upon the basic terms outlined in the draft agreement attached to these minutes or upon such other terms as the Board of Directors may fix. The purchase price shall be not less than $375,000. Be it further resolved that the president of the corporation is authorized to execute all documents necessary to accomplish the above transaction, which represents disposition of substan tially all of the assets of this corporation. CERTIFICATION I hereby certify that the above is a true and complete copy of a resolution adopted by the Board of Directors of Carbola Chemical C o . , Inc. at a special meeting duly called and held on November 12, 1980 at the cor porate offices at Natural Bridge, New York. Edward R. Smith, Secretary RESOLUTION OF SHAREHOLDERS OF CARBOLA CHEMICAL CO., INC. Be it resolved that, upon recommendation and approval of the Board of Directors, the corporation is authorized to sell approximately 346 acres of land, including all of the mines, mills, plant, offices, buildings and improvements to Whittaker, Clark & Daniels, Inc. or its designee, upon the terms contained in the purchase option dated August 22, 1980 between this corporation and Whittaker, Clark & Daniels, Inc. and upon the basic terms oulined in the draft agreement attached to these minutes or upon such other terms as the Board of Directors may fix. The purchase price shall be not less than $375,000. . Be it further resolved that the president of the corporation is authorized to.execute all.documents necessary to.accomplish... the above transaction, which represents disposition of substantially all of the assets of this corporation. CERTIFICATION I hereby certify that the above is a true and complete copy of a resolution adopted by ninety percent of the outstanding shares of stock of Carbola Chemical C o . , Inc. at a special meeting duly called and held on November 12, 1980 at the corporate offices at Natural Bridce. Np w York. FO RM 519 N. Y.--B IL L OF SALE- -mA Corp. T U T B L A N X REGISTERED U. a. PAT. OFFICE TUTTLE LAW PFUNT, PUBLISHERS, nlAlAW, VT. egTSI opfarthteyfirst part, for and in othfethUesneitpedresSetnattes,s,btyo it consideration of the in hand paid, at sum of or before the ensealinlagwafunldmdoenlievyeroyf CLARK MINERALS, INC. Natural Bridge, New York oaonffpatdthhreestoyssledecc,oonandnddppabaryrt,t,thtehsee rperceesiepnttswhdeoreesof its igs rhaenr^tebawynadsckcmonnovwielyesdugmnetdop, hth:aesasaniddpbaaarrgstsaiignnesd all that equipment and personalty as set forth in Schedule A attached, located on the property of party of the first part located in the Town of Diana, New York. pothaf ertths, aeidf pa na dr t ayssi giprnaissttr,tspYaoagfratti,hneisttssoaefscl ulot hcnacednedsspseoaecprrvoesten,rrdsyatnohppdnea-earrslasta,osmsnptieorg oanuWpnsnedatircroartpotnasevtyndhretsenaoaanssninsalsitigsdihwnrefpesahxeranfnoeeordicmb)truyesyttavoohsgeereorrsvel.,edesrasaA.uldeontnmfodtootifshnaaienttishhddtsreeepacwatssooaairntriithdddsy 3ln]prrsrntt o f psNttoheaiianrsltbeyetteooesfnbigtehHnejehud!/fenirrdesburtyendptoaiatrsnatfdfhidxauedsIdlEany,icyWgaaihuoanttsufndeyetdhsstoDhireWeticshszeeeerdmcepoborrefoepr,sfoferitncahetteesr CARBOLA CHEMICAL CO., INC. By J \ State of New York Cboeufonrtey mofe Jpeefrsfoenraslolyn came NiOnentethenis HuVndvre'd and day of December Eighty EDWARD R. SMITH ksotttohhunfheceosmehwacieosrdcerPoppstrcrhieodpoerereorssasporitsaoindeiotrnaeaenallntldisytooeeWnfaksac;lnts;roaaeibwtirndhetnddao,ctwtiowhnnri,ah,tptaoowon,rNaafdebtshweiwoieCsnnhYoags;iorcigarbhbtfnhkoyfeeialxxmdateedechtCuhdhibteeuseydlmsy,nioetacarshdlwameeloaerwfrfnCoitixhto,fhe.eddi,rtnihedtteIoIonndBscsebtap.oyrioaudsrlmeidkIeneaotnsnhfottdra;r,uDdttsmehiarray.eethcnttehtohariiessst rinrsLE fl. ho,ie7 --'*J. " L ctat*orne vois Notary Public 3J-rsCGX COUNT/ - . I. V- 1 3 2 0 2 0 z j1 71 s%z Z v ( 0 0), f < CLARK MINERALS, INC. FIXED ASSET INVENTORY SCHEDULE "A TICKET LOCATION QUAi 1 OFF 1 1 OFF 1 1 OFF 2 1 OFF 1 1 OFF 1 2 OFF 1 2 OFF 1 4 OFF 4 5 OFF 1 6 OFF 1 7 OFF 1 7 OFF 1 7 OFF 1 7 OFF 1 7 OFF 1 8 OFF 1 9 OFF 1 10 OFF 1 11 O FF 2 12 OFF 1 12 OFF 1 13 LAB 1 14 LAB 16 LAB 1 .1 17 LAB Mise 18 LAB 1 19 LAB 1 20 LAB 2 20 LAB 1 21 L A B O F F 2 21 L A B O F F 3 22 OFF 1 23 OFF I O W 5 23 OFF I O W 1 24 OFF GAR 1 25 OFF I O W 1 26 GAR 1 27 GAR 1 28 GAR 1 30 1 31 1 32 Main Mill East 1 33 Main Mill East 2 33 Main Mill East 2 34 Main Mill East 1 35 Main Mill East 1 36 Main Mill East 1 ASSET 6' Executive Desk 5 ' Conference Table Side Chair Desk Chair S a f e ( C o m b i n a t i o n L o c k ) (S a f e C a b i n e t Co.) Pitney Bowes Mailing Machine (no meter) 4100 6483 Wooden Table Composition Top Cardex Files with Transfer Nameplate File f o r 70 Plates Nameplate File with 70 Drawers Check Protector Cole 5' Metal Desk Wooden Chair Bookcase Cole File 4 Drawer File Cabinet Steel Wessota Bench Grinder EM 7 .3 I n c h G as W a t e r P u m p 7 E P M o t o r 10 Tray Victor Cardex File Wooden Kneehole Desk Wooden Chair . U n d e r w o o d A n t i q u e T y p e w r i t e r 12" C a r r i a g e tt3 P a p e r D r i l l 1 2 D S ............................................................................ Balance Scale Christian Becker Glassware Burette Holder Misc. Drill Bits . New Allen Bradley Type N A/C Relays Used Allen Bradley Type N A/C Relays Dodger Bearings 1 7/16* pcs Rock Drill Steel Addressograph Printer Manual Oper. G 2807 pcs Drill Steel Budget Electric Hoist Iton Laboratory Ball Mill Acme Paper Cutter Fairbanks Hearse Induction Motor 75HP 3/4* Electric Drill GE 150HP Induction Motor (needs repair) ft25 4 Tro j a n F r o n t E n d L o a d e r 2% ya r d S / N 3 2 7 1 9 6 6 I n t `1 D u m p T r u c k F r o n t H y d r a u l i c S y s t e m Water Pump 6" on Trailer, Gas Engine Norblow Dust Collectors 1800 CFM - 45HP Motors S Norblow Exhaust Fans Hurricane Mill Pulverizer Micronizer with GE 75HP Motor (not in service - on floor) Schraum Electric 25HP Air Compressor NWD 105 132FM with 25HP Induction Motor S/N 796643 (not in service) 2 Wheel Hand Truck Page 2 TICKET LOCATION QUANTITY 37 Main Mill West 1 37 Main Mill West 1 37 Main Mill West 10 37 Main Mill West 1 37 Main Mill West 1 37 Main Mill West 9 37 Mail Mill West 1 38 Main Mill 1 38 Main Mill 2 38 Main Mill 4 38 Main Mill 2 38 Main Mill 7 39 Su b ,S t a t i o n 3 40 Sub Station 41 S ub .S t a t i o n 9 2 41 Sub ,S t a t i o n 1 41 Sub Station 1 41 Sub S t a tion 3 41 Sub Station 2 42 WBSE 5 42 WESE 4 43 ............W E S E ......... ... 4 43 WESE 3 43 WESE 1 43 WESE 5 43 WESE 1 43 WESE 1 44 WESE 1 44 WESE 1 44 WESE 1 44 WESE 1 44 WBSE 1 44 WESE 44 WESE 44 WESE 44 WESE 45 REAR WESE 45 REAR W E S E 45 REAR WESE 45 REAR W E S E 45 REAR WESE 45 REAR WESE 46 REAR WESE 47 REAR WESE 47 REAR WESE 1 1 3 4 4 1 9 4 8 4 1 1 4 ASSET Induction Starter Allen Bradley Size B May 100HB 200 A M P Fuse Box 30 A M P Fuse Box 100 AMP Fuse Box Reset Switch Start/Stop Switch Westinghouse Control Station (size unknown) Jeffrey Electrical Control Panel Constant Weight Control Feeders GE Reset Switches A Bradley Automatic Starters Size O Start/Stop Switches Davis 833 KVA Transformers Cornell Dublier Capacitors RKVAR25 Style 1835 600 AMP Disconnect Switches Frank Adams Close Trip'ITE Circuit Breaker MOD KCG S/NG 9722 600 AMP Allen Bradley Control Panel for #5 Mill Primary 2300 Volts with Inductotherm Overload for 150HP Motor G E Controllers 7006-T~3E 2200 Volts 2300 Volt Disconnects GE Type ML 18934367 1300 x 24 Loader Tires Spares Tube Type Small Loader 20.5 x 25 Loader Spares Tube Type Large Loader B e a r i n g C a p s P a r t s S p a r e J a w c r u s h e r .......... ...................... Chain Drivers " "" " Chain Parts Spare Jaw Crusher Bearing Seal Rings Parts Spare Jaw Crusher Eccentric Arm Balance Wheel New Base Kennedy New Motor >r " " Gyrotory it "" "" Crushed it . 12 " " Parts it Used Motor " New Bearing " " " " " "" "" Crate Manganese Liners Kennedy Gyrotory Crushed 12 Parts DC Exciter Kennedy Gyrotory Crushed 12 Parts Oil Top " " n - it n Bushings " *" "" GE Meters " "" " Tail Section Pulley w/Bearings Parts 24" Conveyor Bead Section Pulley w/Bearings "' " " Sections Troughing Idlers "" " Return Rollers "" " Section of Troughing Idlers Return Rollers "" "" " " 50 Buffalo Scale GE 75BP Induction Motor Used 1271436 Banks Fuse Solders Page 3 TICKET LOCATION QUANTITY ASSET 48 WHSE UPPER 1 New Sgntron Elec. Controller S/ N C52719 MOD C 3 49 WSS E U P PER 6 Boxes Dust Collector Bags for Stydust Collector 50 WHSE UPPER 37 Boxes Spacers for Stydust Collector 51 W H S E U P P E R 45 C a s e s Various Size Cans Fiber Sides 52 WHSE UPPER 1 2 Wheel Hand Truck with Rack Extension 53 WHSE UPPER 3 Five Gallon Gas Cans 54 M A C H S H O P 1 Steel Work Bench 3 ' x 1 0 ' 54 MAC H S H O P 55 W H S E O F F 55 W H S E O F F 55 W H S E O F F 1 2 1 Mise. Steel Work Bench 3 ' x 12' Car Tires Plow Blade Chemicals 56 TOOL STORAGE 1 Johnson Bar 56 TOOL S T O R A G E 5 Bearings 56 TOOL S T O R A G E 1 57 MAIN MILL 1 Combination Starter Air Compressor Chicago Pneumatic CAP 300 CFM Diesel S/N 54005 . 58 ROLL S T OCK 1 1 9 5 8 I n t '1 T a n d e m D u m p C A P 15 Ton S / N F A 1 3 5 5 1 59 ROLL STOCK 1 1954 Ford Dumptruck S / N F 70 241 + 29043 Single Axle 5YD CAP - with Hydraulic Front Lift with Plow Plate 60 ROLL STOCK 1 1966 Clark Fork Lift 2 Ton - Propane S/N C1408-27-822-106 61 ROL L S T O C K 1 1963 Trojan 114A S/N 11927 1%YD Front End Loader 62 SPEC BLDG 1 Dust Collector Without Working Parts, Motor, Etc. .. 63....... S P E C B L D G .... ....1 .................... .....5 0 S c a l e Ho w e 5 7 63 S P E C B L D G 1 Fairbanks 63 SPEC B L D G 1 50 ft S c a l e M F G Unkn o w n 64 SPEC BL D G 3 3HP Motors on Elevators for Insecticide Bin 64 SPEC BL D G 65 SPEC BLDG 1 1 15HP Westinghouse Induction Motor to Run Blender Dry Blender 66 SPE C B L D G 2 Georgia Buggies mfd by General 67 SPEC BLDG 1 Mixer, ribbon with 10HP Motor S Speed Reducer 67 SPEC BLDG 1 Williams Pulverizer S/N 13408 68 SPEC B L D G 1 Toledo Packer 10 lb. with E l e c t r i c Eye Control 2HP Motor 69 SPEC BLDG 1 Electric Heater 70 S P E C B L D G 71 S P E C B L D G 71 S P E C B L D G 1 k1 Exact Weight Scale Type 213 311b. Max, 104393 Full Roll Boxcar Lin e r F u ll Boxcar Liner 72 S P E C B L D G l Stencile Machine - Hearsch 3/4" Letters 73 S P E C B L D G i Detecto Gram Scale S/N 46534 74 S P E C B L D G 3 F r a u g h e C an P a c k e r s (1 u n i t n o t w o r k i n g ) f o r sample cans 75 S P E C B L D G 1 Fry Bag Sealer CSG SN 58801 for Open Mouth Bags 76 S S P E C B L D G 1 Can L a b e l e r ft8001 Bur t M a c h i n e 3 k " x 7" 77 S P E C B L D G 1 3HP Air Compressor Twin Stage Ingersoll Rand Type 30 H244HD5 S/N 32736 78 SPE C B L D G 1 2 Valve Air Packer w/30T Holding Bin 78 SPE C B L D G 1 Dust Collector Page 4 TICKET LOCATION QUANTITY ASSET 78 79 80 80 80 80 80 81 82 83 84 84 84 85 85 86 87 87 88 89 89 .9 0 91 92 93 94 95 96 96 97 98 99 100 101 102 103 104 105 105 106 106 SPEC BLDG SPEC BLDG ORE DRYER ORE DRYER ORE DRYER ORE DRYER ORE DRYER ORE DRYER ENGR OFF ENGR OFF ENGR OFF ENGR OFF FORGE ROOM FORGE ROOM CAP ROOM CAP ROOM CAP ROOM CAP ROOM 3 14,500 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 CAP ROOM 1 CAP ROOM 1 C A P R O O M ........ .... 2 ..................... POWER ROOM POWER ROOM SC ROOM SC ROOM 1 1 1 1 SC ROOM 1 SC ROOM SC ROOM SC ROOM SC ROOM PPCR AREA PPCR AREA 1 2 1 1 1 1 PPCR AREA PPCR AREA PPCR AREA PPCR AREA PPCR AREA PPCR AREA PPCR AREA PPCR AREA 1 1 1 1 1 1 1 4 3EP Motor with Speed Reducer 50 # Bags 9 Ballets (Carbola Printing) 5' x 20' Ore Dry e r Oil F i r e d 10HP Motor 5H P Motor 3HP Motor with Speed Reducer 15HP Gear Motor 1000 Gal Oil Tank Fairbanks Morse Fluid Pump 6205 500 Gal Gas Tank (no pump) Blue Print Table Small Wooden Desk Wooden Chair Ingersoll Rand Drill Sharpener Type IR 34 S/N 10446 Electric Heater Electric Heater Dayton Electric Water Pump 3/4HP Motor 1HP Motor Hercules Water Pump Swedish Tool Grinder for Sharpening Bits A i r D r i v e n S / N 4 1 3 9 0 jf 4 2 0 0 Ingersol Rand Air Compressor for Mine S/N 8553 3-Type ESI Works Off Generator Motor Ingersoll Rand Air Compressor for Mine S/N 73915 Type ESI Low Volt Starter, 100HP Motor G E 12 7 K V A G e n e r a t o r S t a n d b y f o r E m e r g e n c y S e r v i c e .... with Control Bank Waukesha Mod 6WAK Aux. Power S/N 843003 180' x 1 8 " Conveyor with 3HP Motor & Speed Reducer 10HP Dust Collector Cedar Rapids Screen, Flat 4 ' x 10' Double Deck 25HP Motor 1750RPM Plate Feeder with Electric Drive Unit, 3HP with Speed Reducer Motor 1750RPM Cedar Rapids Double Impactor Crusher S/N 19080 30" x 42" Belt Driven Motors 50HP Fairbanks Morse Chain Hoist 3 Tons 200 AMP Lincoln Welder S/N A61661 200' x 2 4 " Conveyor with Link Belt Gear Motor 3HP Allis Chalmers Hoist, 75HP, G E Motor with Euclid Electric Manual Controller, Type MSP 18000 Small Electric Heater Allen Bradley Control Panel for 150HP Motor Bench Vise Apprentice 8183-B Submersible Water Pump Flygt 9HP Motor Westinghouse Main Feeder CAT F355 W e s t i n g h o u s e A u t o S t a r t e r M o d tt Typ e A Westinghouse Line Starter Spare All e n B r a d l e y O n / O f f Sw i t c h (3 service, 1 spare) Page 5 TICKET LOCATION QUANTITY 107 108 109 PPCR AREA PPCR AREA PPCR AREA 1 1 1 110 111 112 112 113 PPCR AREA PPCR AREA TURN ROOM TURN ROOM TURN ROOM 1 1 2 1 1 114 114 114 114 115 115 115 115 116 117 MAIN PLANT MAIN PLANT MAIN PLANT MAIN PLANT MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL 1 2 1 1 2 1 2 5 21 1 117 MAIN MILL 117 MAIN MILL 1 1 8 .... .... M A I N :M I L L 118 MAIN MILL 118 MAIN MILL 118 MAIN MILL 119 MAIN MILL 119 MAIN MILL 120 MAIN MILL 120 120 120 120 120 120 MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL 122 122 122 122 123 123 123 123 123 MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL 1 1 1 1 1 1 1 1 6 1 1 5 1 1 4 12 1 12 13 8 5 10 1 2 ASSET Lincoln Grease Pump Mod. 1277 5HP Motor General Electric 100HP 1836 Cedar Rapids Primary Draw Crusher, 3HP Drive Motor with Speed Reducer 2 8 ' x 24" Conveyor Kennedy Vibrating Screen 3' x 10' S/N 634, 10HP Motor 3HP Motors with Speed Reducers M a g n e t i c Pickup From C o n veyor Belt, Eriez Mfg. Co. 120' Conveyor 16" with 3HP Drive Motor with Speed Reducer Kennedy Vibrating Screen 3' x 10, 2 Deck S/N 659 3HP Motors with Speed Reducers 3HP Motor No Speed Reducer American Blower Type ELS, Size 250, S/N 250-7 3HP Motors with Speed Reducers 6 " Conveyor 40" with Motor 3HP Motors, 1 No Speed Reducer 14' Gayco Separators with 25HP Motors Fairbanks Morse 3HP Motors with Speed Reducers - All Part of Elevators Dust Collector HI S #4 Mill-Sly B a g Type 21,000 CFM, Barry Blower Size 633, Type R D S/N 67-1544 Wagner Electric Motor 75HP Model 37E 125 J 235 3HP Motor with Speed Reducer S l y D u s t ..C o l l e c t o r f o r .. f/2 a n d fl3 M i l l . Sly Blower B4-1914-D Pacemaker 60H P Motor Type C0G4B, Model 192540 M 26 3HP Motor with Speed Reducer Dust Collector for H5 Mill, Approx. 1/3 Capacity of Other Collectors . Sterling 10HP Motor Model HL 16686, Buffalo Blower, Size 35, Type M W HF617 3HP Motors Various Screw Drive Units with Speed Reducers Georgia Buggy Wheelbarrow Miscellaneous Shovels Hurricane Mill with 15BP Motor Rock Drill, hand in closet Reduced Voltage Starters for 30HP Motor for S e p a r a t o r s (G a y e s ) Fuse Boxes for Screw Worms 30 AMP F351 Fuse Box for Screw Worms 200 AMP F354 Reset Boxes Start/Stop Switches Fuse Boxes 30 AM P Reset Boxes Start/Stop Switches 100 AMP Fuse Box Combination Starters Allen Bradley Size O P a g e .6 TIC1 124 124 124 124 124 124 124 124 124 124 124 124 124 125 126 126 126 127 128 129 130 131 132 132 133 134 134 134 134 134 134 134 134 134 134 134 135 135 135 135 135 135 LOCATION QUANTITY MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN'MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL 1 1 2 4 4 7 3 17 6 8 11 13 2 1 MAIN MILL 5 MAIN MILL 9 MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL M A I N M I L L ..... MAIN MILL 2 1 2 1 2 2 1 MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL LOWER MILL LOWER MILL LOWER MILL LOWER MILL MAIN MILL MAIN MILL MAIN MILL MAIN MILL 1 1 15 1 1 5 1 15 2 15 1 3 3 1 4 3 1 2 2 4 1 ASSET 400 AMP Fuse Box 100 AMP Fuse Box F353 30 A M P Fuse Box Reset Boxes/Switches On/Off Switches 30 AMP Fuse Boxes Reset Switches Start/Stop Switches 30 A M P Fuse Boxes Reset Switches Start/Stop Switches 30 AM P Fuse Boxes 60 AMP Fuse Boxes Allen Bradley Bulletin 645 Reduced Voltage Starter 200HP 6 ' x 24' AlI H s C h a l m e r s T ube M i l l s 5 ' x 10' Blender, Ball Mill Capacitor KVAR 15 Style DB11, Type PF 405-R Cornell Dublier 200 AMP Fuse Boxes Jeffrey Scale Automatic-Insecticide Blending GE 150EP Induction Motor Kennedy Gyrotory Crusher H25 Secondary Loading Ramps - Steel Diamond Plate 50H E x a c t a .S c a l e ............. St. Regis Packer - Valve Bag/Band Fed Bags, Typ e 1 0 0 FI', S / N 4016 Allis Chalmers 15HP Motor 714E F u l l e r D u m p Val v e w i t h G e a r M o t o r if C - 4 0 A 5 2 - B 7 1 3HP Motors with Speed Reducers 75HP Induction Motor Georgia Buggy 200 AMP Fuse Box 600 AMP Fuse Box Combination Starters with Disconnects Size 0 Reset Switches Start/Stop Switches Combination Starters with Disconnects Size 1 Arrow Hart Enclosed Switches 575 AMP Reset Switches 60 AMP Fuse Box 30 A M P Fuse Box Start/Stop Switches 60 AMP Fuse Box 30 AM P Boxes Start/Stop Switches 30 A M P Fuse Box Portable Fan - Axidane Joy S/N MF655, Mod. ft L --2 1 , 4 7 0 C C F M ST-274 <-4/77) btate'cTf New York - Uepartment of I axation and Finance - Sa!es I ax Bureau N0TIFIC7 IN OF SALE, TRANSFER OR ASSIGNMEN' N BULK \ !o Pc filet/ in Iriphciilc) T h e f o l l o w i n g i n f o r m a t i o n s h o u l d be s u b m i t t e d by r e g i s t e r e d m a i l at l e a s t te n (1 0) d a y s b e f o r e t a k i n g p o s s e s s i o n o f or p a y in g for the property. Moil th is notice to the NEW YORK S T A T E SALES T A X B U R E A U , A U D IT AND R EVIEW U N IT , S TA TE CAMPUS, A L B A N Y , N .Y . 12227. S e c t i o n I - M a i l i n g A d d r e s s o f P u r c h a s e r , Se l l e r and E s c r o w A g e n t ( i f any)_ ____________ filarle Minerals, Inc. c/o Wittaker, Clark & -Daniela^-- Inc----------- Car.bula.CIiejnl.naL..Ilo.^. In c ESCRDW AGENT Bon d ,. .1000 CoolidgP- 1 Lincoln Center Sonth Plainfield. HJ Natural Bridge, NY Syrac use, NY 13202 S e c tio n II - V e n d o r Id e nt i f i c o i f on PURC HA SER ' S C E R T IF IC A T E OF A U T H O R I T Y I D E N T I F I C A T I O N NO. ' PURCHASER' S NAME Clark Minerals.Inc.. S C I I E R ' S C ER TIF IC A TE OF A UT H OR IT Y ID ENT! T ' CAT 1UN NO. SELLCR'S NAUT .1 G 0 9 9 5 9 1 0 . Carbola Chemical Co, B U S I N E S S QP TRADE N A r t f Inc ..,,Carbola Chexaical_..Qo.J^,,JLrLCLx. business uocatiohc / 0 Whittaker, Clark & Daniels, nu5liiEss location Inc.. 1000 C o o l i d g e , P l ainfield N J ______ Natural_ Bridge ,_NY S ection III - D e ta ils of Sale SCHEDULEO DATE OF SALE T O T A L S A L E S PRI CE OF B U S I N E S S OR PROPERTY S A LE S P R I C E OF F U R N I T U R E , F l M l l H E S , ETC. A M O U NT OF ESCROW FlJNO 1 ?./1.9 /ft0 $415,000-00 L OC A T I O N OF P ROPER TY WHEN T R A N S F E R R E D T YPE OF B U SI NE SS OR PR OPER TY M U D Xawn. of Diana,. County of Lewis NAM E OF BANK IN WHICH ESCROW FUND IS DEPOSITED Talc M i n i n ? arid Mill Operation ACCOUNT ID E N T IF IC A T IO N <Na M E AND N U MBCR) -Lincoln Eirs t...Bank , ..NA------- AOORESS ...1010087-12.. Lincoln Center. Syracuse. NY TERMS AND CONDITIONS OF SALE ^# Miscellaneous furniture, equipment and personal property is being transferred as par t of the conveyance of 350 acres of land, which includes mine,' mill and office space. Inventory not Included. Mining business has not operated for over one year. This is not a sale of the entire business assets. S ection 1141 (c) A r t ic le 28 of the New Y o ik State Sales and Use T a x L a w provides in part as fo llo w s : "W h e n e v e r a person re q u ire d to c o lle c t ta x sha ll make a sale, tra n s fe r, or a s sign m en t in b u lk of any part or the w hole of his business assets, otherw ise than in the ordinary course of business, the purchaser, transferee or assignee shall at least ten days before taking po ssession of the sub je ct of said sale, transfer or assignm ent, or paying therefor, no tify the tax com m ission by registered m ail of the proposed sale and of the price, terms and conditions thereof whether or n o t t h e s e l l e r , t r a n s f e r r e r or a s s i g n o r , h a s r e p r e s e n t e d t o , or i n f o r m e d th e p u r c h a s e r , t r a n s f e r e e or a s s i g n e e t h a t he owes any ta x pursuant to this a rtic le , and whether or not the purchaser, transferee, or assignee has knowledge that such . taxes are owing, and whether any such taxes are in fact o w in g ."  . .. . ----------------------- - ' r ^ e w Y o r k S ta te a n d io c a l 7 \ S a le s a n i l i T i i f t i f t n^ '! ew Y ork State Deportment o Taxation Page 1 and Finance 380 Under A rtic le s 28 and 29 of the T a x La w Use Labeled Form and Return Envelope for filin g your return. THIS R ETU R N MUST BE F IL E D WHETHER OR N O T T H E R E IS T A X TO BE R E M I T T E D If incorrect on label, enter correct information below. ID NUMBER ( Co. ^ 7 5 ) i o NAME CT IxCLaA.C..V NO. ANO ST R EET C. ZIP t Complete page 2 of th is form before making entries below. SUMMARY OF AGROSS S A LE S AND SERVICES BUSINESS (to nearest d o l l a r 1) ACTIVITY ^ TA X A B LE S A LES AND SERVICES B (to nearest dol lar) \ uK 4 T I C PURCHASES SUBJECT TO USE TAX (to nearest d o l l a r 1) TOTAL CREDITS CLAIMED ON PAGE 2 D OR ATTACHED SCHEDULES (dollars and cents) i 1 1 IF THE AMOUNT REPORTED IN BOXES B & C ABOVE TOTALS $300,000 OR MORE, YOU ARE REQUIRED TO FILE RETURNS MONTHLY. CONTACT THE SALES TAX PROCESSING UNIT OR YOUR LOCAL DISTRICT TAX OFFICE IMMEDIATELY FOR FURTHER INFORMATION. ENTER TYPE OF BUSINESS If t h i s return reports soles tax for i-- more than one location, check hero. 1-- ' 5 7 ?.... i S a l e s a n d U s e T a x e s ( to ta l column (e), page 2 ond amounts from Schedules A , B and N, If ony)............. ^ 5 2 (a ) C r e d i t s N o t C l a i m e d on P a g e 2 (attachments required) $ (b) P re p a y m e n ts (attach FormST-330) (c) T o ta l C re d its and Prepaym ents 3 S ales and U s e T a x e s D ue (line 1 less line 2(c)) $ > 1 > ~fr) $ 5 73 4 Add: L a te F ilin g Charge 5 A m o u n t D u e i n c l u d i n g L a t e F i l i n g C h a r g e (line 3 plus line 4) * A tt ac h remittance payable to " Hew York Stoic Sales T a x ' 1 and mail in the enclo sed envelope to the appli cable P.O. Box on or before March 20, 1980. SIGNATURE OF VENDOR X c J Pay this amount ^ $ .M l' For office use only M //P-3 . SIGNATURE OF PREPARER, IF OTHER THAN VENOOR PREPARER'S ADDRESS ST-100 (12/79) D id you complete the other side of this form'Tj t. t i ' STATE AND LOCAL SALES AND USE T A X % TAXING JURISDICTION iai ' NEW YORK S T A T E A ! bcny te <b> 4 7 TAXA8LE SALES a nd SERVICES {to n ea re s t doMari (ci 14 s m i A lie g a n y Broome Cattaraugus - except 7 7 7 Olean (city) Salamanca (city) Cay uga Chau tauqua 7 7 7 7 Chemung - except E Imi ra ( c i t y ) Chenango 7 7 6 Cl inton - except Plattsburgh (city) C o 1urn bi a Cortland Dutchess - except 7 7 6 7 5 Poughkeepsie (city) 7 Erie E s s ex I- r a n k 1i n 7 7 7 Fulton (county) Genesee 7 6 Greene 7 Ham i 1ton Jefferson Livingston Madison * except Oneida (city) 7 7 7 6 7 Monroe Montgomery - except Amsterdam (city) / 7 7 Nassau 7 Niagara Sherrill (city) Onondaga 7 5 7 Ontario - except Canandaigua (city) Geneva (city) Orleans Fulton (city) 7 7 7 7 7 NOTE: Vendors reporting amounts for c ities below marked oreo within the officici citv limits. report cnly amounfs -applica ble to the Show Net C red its (negative amounts) in parenthesis on appropriate lines below . Page 2 PURCHASES SUBJECT TO USE TAX ( to nearest dol larf (ti> SALES AND USE TAXES b < |C + d) (dollars and cents! (?) .......... it D (JO ` TAXING J J R I5 0 I CTION (a) CT. E lb} T A ` ABLE S A l ES AND SER VI C ES {to n e a r e s t dollar] ' id p u r c h a s e s o b jec t TO USE TAX {to n e a re s t dn1*5rl Itff 0002 Oswego (city) 0172 Otsego 021 2 jP u tn o m 7- 6 5 0312 0492 R en sselg er - except T roy { c i t y ) 6 7 0 4 2 St. L a w r e n c e * e x c e p t 7 0422 Ogdensburg (city) 7 0 5 0 2 M e c h a n i c vi 11e ( c i t y ; 6 0602 Saratoga Springs (c ity 1 6 0792 Schuy!er 7 0712 Steuben - excep* 7 0 8 0 2 Ho rne 11 ( c i t y ) 0092 Corn in g (city) 0912 Suffolk 1002 Sullivan 1102 ! ioga 7 7 7 7 1 1 1 1302 Tompkins - except 7 1332 Ithaca (city) 7 1412: U l s t e r 7 1502 Warren - ex cep t 7 1602 Glens F alls (city) 7 1702 Washington 1 8 0 2 Wayn e 7 7 1912 2002 2202 Westchester - except Mount Vernon (city) N ew Rochelle (city) 5 7 7 2402 White Plains (city) 2592 Yonkers (city) 7 g 2522 Yates 7 2 6 0 2 New York Ci ty 2792 8 SALES aNC USE TAXEE b ' 1c. + dj (dollars and cents.{cl C D n 3542 3602 3702 3872 3832 4092 4012 4112 4132 A` 4bv. 4622 4612 4712 4812 4902 5092 5012 5112 5292 5212 5302 54C2 5502 6522 SP' 5. 6572 5702 8002 2712 2842; REPORT BELOW SALES AND PURCHASES SUBJECT ONLY TO LOCAL TAX 29021 (See ST-150.1, Instructions I V C a nd D.; 30421 NEW Y O R K C I T Y 4 31021 J 8010 3272: 32321 32421 3472 3532 TOTALS . 1 ___ E N T E R ON P A G E 1, BOXB BOX C _________________________ i_____ i _____ 1_____ LINEI . December 19, 1980 Clark Minerals, Inc. Natural Bridge, NY Gentlemen: In connection with our closing today o n the purchase of 350- acres in the Town of Diana, New York, we agree to remove all personal property still owned by Carbola Chemical Co.. Inc. from the premises by January 31, 1981. If we do not remove all property by that date, Clark Minerals., Inc. may dispose of all remaining nronerty as it sees fit. Carbola Chemical Co., Inc. U //' William H. Kissel, Esq. P.O. Box 1980 Lake Placid, NY 12940 re: Carbola Chemical Co., Tnc. - sale to Clark Minerals. Inc. Dear Mr. Kissel: This letter will set forth our escrow agreement made December 19, 1980 between Carbola Chemical Co., Inc. ("Owner") and Clark Minerals, Inc., ("Buyer"). An^escrow fund (the "Fund") in the sum of $10,500 will be held by Buyer's attorneys, Bond, Schoeneck & King, as escrow agent ("Agent") to provide a source of payment of liens against the property for which satisfactions of judgment will not be available at the time of closing. The Fund represents 125% of the estimated amount required to pay the principal amount plus interest of the following judgments: James Huggins & Sons, Inc. - $996.05 ... .M. Berger.Company - $541.80..................................... FMC Corporation Agricultural Division - $866.93 Smith Transport (US) Ltd. - $983.18 Ogdensburg Electric - $614.66 International Paper - $3,654.43 This agreement is made in consideration of Buyer's agreement to close on the purchase of the Town of Diana property with the above judgments still of record against the Property. The Fund shall.be held by Agent without interest in its non-interest bearing account. Owner agrees to deposit additional amounts into the Fund in the event the deposit is not sufficient to cover the judgments listed above or in the event that the Fund is not sufficient to cover additional judgments which may become of record up to the time of closing. W i l l i a m H. Kissel, Esq. Page Two Agent shall'withdraw sums from the Fund to pay the judgments listed above or the actual amount of the above listed judgments with interest if the above amounts should be incorrect, and shall pay such sums to Owner's attorney. Agent shall only make such payments upon receipt of duly executed and acknowledged satisfactions of judgment from Owner's attorney. Such satisfactions of judgment shall be received within 4 5 days from the date of closing. Upon receipt of said satisfactions and payment to Owner's attorney Agent shall have no further responsibility under this agree ment and shall refund the sums remaining in the Fund, less recording charges, to Owner's attorney. In the event that, the satisfactions of judgment are not received during the 4 5 -day period, Agent shall deal directly with the judgment creditors to obtain satisfactions of judgment and shall make payment in full to the respective judgment creditors to satisfy the liens against the Property. In this event, Agent shall be entitled to receive from the Fund reasonable attorneys' fees and disbursements in connec tion with the satisfaction of the above judgments. In the event that any sums remain in the Fund after payment of all judgments and payment of Agent's attorneys' fees, as provided in the preceding.paragraph,.the balance.... shall be returned by Agent to Owner's attorney, William H. Kissel, P. 0. Box 1980, Lake Placid, New York 12946. Owner agrees to indemnify and hold harmless Buyer and Agent for any losses or damages they may sustain or any liability they may incur by reason of holding or making payments from the Fund and to defend Buyer and Agent in any legal action brought against either of them arising from such payments. Provided, however, that this indemnity shall not extend to any payments made by Agent other than to satisfy judgments against the Property or payment of Agent's attorneys' fees as indicated above. If your client accepts the terms of the above agree ment, please have the appropriate officer sign where indicated below. Accepted : CARBOLA CHEMICAL CO -/ INC. I nsurance binder # Ef? i S ^ W M ^ M & f l t f S l ^ ' N D ITtQ N S SH O W N ON T H E K E V E R S E .S t E O F T H IS FORM . .;'- d^ /.:.AijC'M;.tOS-iCKttw irthland Agency, Ltd. 31116 Arsenal Street Jatertown, Sew York 13601 !'.r.AAD "\Aik :A M$'.!Kc. COMPANY JCOMMERCIAL UNION ASSURANCE COMPANY ,m . ,;,10'00 a ;, December 19 ,80 t/u:!-, Li iCOi G Jo-! Feb. 19 .:.81 This binder 3 ts u e d to sstend :..; hi the -sbO'ir " .-ni"-c!| :! company perer.rynng` pohc/ ',, H't: -.: Dei-; /. Oiscdisio-iOpraib/Mcteg/Piipcri CLARK MINERALS, INC. .0. Box 398 Natural Bridge, New York 13665 Ore Milling Operation Buildings and Contents located Blanket Fire, Extended Route #3 and Old Karrisville Road Coverage, Vandalism & Town of Diana, Lewis County, Malicious Mischief Net-? York. Anil oS Insurance Oe<s. , $1,150,000.$100 80% C o verag e/T o rm Lim its of lia bility Each Occurrence ! A g g r e g a t e ! Scheduled Form i Comprehensive Form ' ............. gj Ptenmses.-'Operations........ .................................... 3J Produciri- Completed Operations - 31 Contractual i Q lO th er (specify fceiowi ! ! O Med. Pay. $ i^{ Personal injury v > $ Ar,i vuc-ri! j: Si A 3B Bodily Injury Fi opkf* sy Damsgfe * 1j $ Bodily Injury & Property Damage S I , 0 0 0 , 0 0 0 Combined 1 ' ;^ ,0 0 0 ,0 0 ( SC Personal Injury ' :1 ,0 0 0 J 0 0 i 0g Liability Q{ Non-owned ta Hired ' C o m p reh en s-'ve-D ed u citb le C o llis io n D e d u c t ib le . Medical Payments ; Uninsured Motorist . No Fault (specify). . Other (specify)' ? i $ $ r ........ ...................................U rn H s o f 'Usbiisty *.................................................... iNon-Owned and 'BodilyInjury (Each Person? $ Hired Car Bodily injury Each A ccident) $ Coverage only Property Damage ' Bodily Injury & Froperty Damage C o m b in e d 1 ,0 0 0 ,0 U WORKERS' COMPENSATION Statutory lim its (specify states neiow; SPECIAL CONDITIONS/OTHER COVERAGES u EMPLOYERS' LIABILITY -- Lim i! Including Ov?ner's & Contractor's Protective Liability @ $1,000,000. NAME AND AL'Dkcto <> S MQKrGAGtt U I -.S '' Vf f Carbola Chemical C o . , Inc. 1106 State Street Watertown, New York 13601 I ACORO 75 i l l -77) `InsuranceProfessionals - f NORTHLANDogancy.ltd. I- 1 1 1 6 A rs e n a l S tre e t -- W a te rto w n , N . Y .'1 3 6 0 1 \ Tel.: (3 1 5 ) 7 8 2 - 7 3 0 0 " . '' ` 10 M ain Street ` . P otsdam , N . Y. 1 3 6 7 6 T e /.:'f3 1 5 ) 2 6 5 -2 3 4 1 WILLIAM H. KISSEL, ESQ. P.O. Box 1980 Lake Placid, NY 12946 518-523-4211 December 19, 1980 Paula Seifter, Esq. Bond, Schoeneck & King 1 Lincoln Center Syracuse, NY 13202 re: Carbola Chemical Co., Inc. to Whittaker, Clark & Daniels Inc. Dear Paula: As we discussed at the closing of the above matter today, I will, as attorney for the seller, take whatever action is necessary to remove the lis pendens which was recorded on M a r c h 25, 1975 in the Lewis County Clerk's Office. As y o u know, Mr. Parker has also agreed to take w hatever action is necessary on this mat t e r but in the unexpected event that he fails to do so within a time frame satisfactory to you, you h ave m y commitment to take care of this matter. Sincerely, WHK:mas W i l l i a m H. Kissel STATEM ENT OF SALE D ated.......December..19.,...19.30 S e lle r ...Carbola. Chemical..Co,.,.. I.nc.Buyer.Whittaker,...Clark....Daniels...... VCiitllyagoer Tow No.......................................................................................................... Street Avenue n......P i a n a ...................................................County....ewi................State....New. York... Purchase Price................................................................................................................................. /.00G 00 Insurance Adjustment S.... Fuel ................................................................... City Taxes (Adjusted)...................................... 'T ee C ount> /fS es ( L if te d ) $.7.3.3...12...7...36.5. -.;2 -:v ii8 1 ..X ..1 3 ...= ....... Village " " .......................................................................................... School " ' S.9.43 . Q9...C .36.3..-... 2.. .5 9.7 5...x ...2,7C...-.... Fire " " .......................................................................................... Total Amount Due S e lle r..................................................................................................... S. $ ...... S..... s ..... $ ..... ..it $ ...... --a-r r-32? ..................................... S............. .6.6.4.9.6 ? ..................................... ____________ Credits to Purchaser: A m ount Paid D ow n .................................................... ....................... First Mortgage ....................................................................................... in te re st F ro m ..........................................T o ........................................... S econd M ortgage ................................................................................... In terest From ....................................... T o........................................ -- -S....... 5-/-00-Q-. (KL -S..255V00.0...QQ. 3 .................................. S.................................. $ ............................... ...... ................ . ... H'-.i.Ni (V-- Village Taxes iAssumed) ....... City Taxes 'Assumed) ............ County Taxes (Assumed)....... Local Assessment (Assumed) School Taxes Assumed! ....... Water ........................................ Rents: (Pro-rated) ................... Balance Due Se! Paid as follows: r D.-Ot.....A-C-V.i...Ac.- Expense of Purchaser: Recording Deed ..............................S .iA ic t;1.. Recording Mortgage Mortgage Tax ............... .................. s , y. 5...................... Escrows ...;...................... .................. 3...................... ...5...................... S .... ................ 5............ ......... jt-rdees cc D isbursernenrs......... ...S^ Tota! S.. -1 26--^00.CX_00. 3..,i-&&rr6e7.-2.-r.-49 Ci i-c D .y.i.,cCdiv/ C.'ivC.Tv wi Expenses of Seller:,... . Continuing Sc.irch .c'.cC-d ............ ___ AE ;i.oC. L t- -F c R w enue Starno-s. D e ed .................. t .Cxs.'sA q''^ Recordug Discharge of Mortgage 5.... ..... ;Vr\ j 9.... Rccoraing mortgage --.isdgn'neat $ . . . . ....1 0 .2..5... .3 ... Services Tota! L Piece:vrdnav-niencdi; SCHEDULE 1 CAREOLA CHEMICAL C O ., INC. - JUDGMENT CREDITORS AND OTHER LIEN HOLDERS vi ^ Gateway Equipment Corporation. ........................... . 571.14 " R/'-^'wens Illinois, Inc................. ......................... . 1,212.54 . ; ^t^.-'trathmore Products, Inc............ ................... ...... . 125.00 Athea Laboratories, Inc................. ................. ...... 821.70 'Berger Company............ .......... .................... . v - p ' ....... (^541.80 /' ^ --------- ' \ J ^ V--. Hungerford-Holbrook, C o ................... '..................... 148.73 Byrns Motor Express..................... 554.90. Giles, Maloney, Marsh, Swartz & Goodwin. 992.30 ^ Frank- Miller & Sons, Inc................ 295.40 1 IMo.'-H- ^ Niagara Mohawk Power Corporation...... ........................ S-rihM-rO0- / pi James Huggins & Son, Inc. 3/15/76 $1,992.10 ........... ........ I FMC Corporation 12/14/77 $866.93......... Smith Transport (US) Ltd. 3/23/79 $983.18 1 . 1\ Ogdensburg Electric Supply, Inc. 9/17/80 $614.66.. Pf'-tft-v U | U 7 * ~?G~'h 'Q \'<v t & i . H New York State Industrial Commissioner......................... 1,672.64 .. 1 - ~ a i. Internal Revenue Service...... ................................. Franchise Tax Warrants. 1974^ ??.*'. i^ \ H *-( t? 1:-7-3-?.Gv 8-5 EiBh^h4-se-=^&a35-'it-l:9 ^ r; ` ^em -efcasse^saiSS^iSLl. uo fi?. Sales Tax -- RgEtte............. . v^/YV. 'TVK ^ 'A7 ' ..................................... . . / ................................................. v C\7 S/.fe ......................................................... 3 ?c, . G' ! Real -Estate Taxes............... '............ ....... ........... -4,855.25 ^-''Small Business Administration........................... ;...... 45,087.29 Jefferson National Bank.... vv........................ ...... ...12/721,86 C M/- ^ c. -tiri? ,. . ' C) r v jc M `7 t/t?' 7-E : o.NvCt V c l \. b T W . l i -3 - Sample , \No. of Fibers No. of Fibers With R.I. Greater ?ifh R.I, Less Than 1590 Than 1574 Status With Regard to Pro posed FDA Method D r . John A. Refiner (U. of Conn.) for Avon Cont'd Montana-Pfizer Montana-Ferry Alabama Vermont 4 No. Carolina 0 13 26 41 14 5,844 9,281 15,125 165 11,852 , Fails chrysotile Passes tremolite Fails chrysotile Passes tremolite Fails chrysotile Passes tremolite Fails chrysotile Passes tremolite Fails chrysotile Passes tremolite Dr. Tryggve Baak of United Sierra Spiked Italian Montana-Pfizer Montana-Ferry A1 ab ama Vermont No. Carolina 3,000 1,000 0 0 0 0 500 . 2 , 0 0 0 0 0 0 0 0 0 Fails Passes Passes PctSSS3 . Passes Passes Passes Richard E. Stevens of Ernest F. Fullain, Inc. for Whit taker..C&D Italian Montana-Pfizer Montana-Ferry Alab ama Vermont No. Carolina 8,250 18,000 29,250 21,825 3,225 20,850 1,350 450 5,200 6,075- 675 6,000 Fails chrysotile & tremolite Fails chrysotile & tremolite Fails chrysotile & tremolite Fails chrysotile & tremolite Fails chrysotile & tremolite Fails chrysotile & tremolite Spiked sample was not run. AAAKBPXLG CF-BALL-9 -4 - . Sample No,. of-Fibers With R.l. Greater Than 1590 No. of Fibers With R.l.. Less Than 1574 Status With ' Regard to Proposed FDA Method M r s . Lucy McCrone of McCrone Associates for Kolmar Italian 53 0 Passes Montana-Pfizer 0 0 Passes Montana-Ferry 0 0 Passes Alab ama 0 0 Passes Vermont 0 0 Passes *No. Carolina 0 0 Passes Spiked Sample 483 16 Passes *Saiiiple noted to contain soma fiber b undies which, are rolled u p talc plus some non-fibrous tremolite The fo3-lowng participants examined their samples but were unable conscientouslyto count particles with'confidence , therefore, did not report numbers: ' Miss Marie Jones for Dr. G. Cohen - Bristol-Myers Products Research Labs. Mr. Salvatore DiBianca - The Mermen Company . ...Liberty Mutual Insurance Co., Research Center - for Kolmar Laboratories Mr. John Facq - The Colgate Palmolive Company, Research Center The table reveals strong inconsistency- between results obtained by the different scientists applying the method to the same group of coded talc samples. This inconsistency is the result of problems encountered in the methodology. . 1. The alpha refractive index of talc - one of the two indices exhibited by talc plates standing on edge - varies in value between 1.539 and 1.550^. This in combination with item 2 , below, may easily result in the mis-ciassification of such plates as "fibrous, less than 1.574" end therefore- chrysotile. Dr. Reffiner of the University of Connecticut, in his report to Avon, admits that this factor is paramount - "counts for chrysotile are high since (talc) edges will often he mistaken for fibrous particles". 2. The immersion method for the determination of relative refractive index becomes unreliable when applied to extremely small (ca. 1 pm)particles. This is due in part to the fact that particles . around 1 J1'11 in width approach the limit of resolution of the human eye when both size and contrast are considered, especially w hen'applying the Beeke line technique prescribed. This will -5- 2. cause eye fatigue'and resulting errors. Thus, a fine talc shard or plate on edge may be easily mistaken for an asbestos fiber. This applies to both the chrysotile and ampliibole portions of the test. 3. It is quite likely that chlorite - a mineral of varied compo >,,sition commonly found in pharmaceutical grade talc - would be incorrectly identified as tremolite. Refractive indices for chlorite vary in the. range 1.57-1.66^. 4. The examination of a sample of one milligram dispersed on a single microscope slide presents the investigator with a preparation which is too dense for a petrographic study. 5. The method is laborious and time consuming. Dr. Refiner quotes an analysis time of about five hours per sample and at JOHNSON & JOHNSON the investigator (D. H, Hamer) estimated at least two or three hours. 6 . Dr. Walter C. MeCrone in an earlier letter to the FDA suggested that there were relatively few scientists in the country who could u s e 'the method effectively.' Scientists at Bristol-Myers, The Mermen Company, Liberty Mutual and Colgate-Palmolive had great difficulty in following the method to conclusion. 7. .The proposed FDA method implies that all fibrous particles in talc having optical properties similar to those of asbestos . minerals are in fact asbestos. This is probably an unwarranted assumption. REFERENCES: 1. Deer, W.A., Howie, R.A., and Zus s m a n , J . , Rock-Forming, Minerals, Vol. 3, p. 121 (1962). ' -- - 2. Ibid, p. 131. We have concluded that the method publishel in the Federal Register does not provide a truly reliable means for the detection of asbestos in talc. It results in both false-positive and fa..se-negative findings. It is also tedious and may consume as much as one half day per sample. The subcommittee urges that the Food and D :ug Administration defer finalizing the proposed optical microscopic method and proceed into a Phase II program ..which ..would. -combine--FDA~and-Xn!usryc.jLn_a--strong-- -.. to develop a truly reliable method for measuring chrysotile content in talc. We are confident that the detection and estimation of fibrous tremolite can also be done, if necessary, as a fringe benefit, at the same time. -6 - We estimate that a satisfactory method v/ill take at least sir months to a year, to develop. We suggest a close liaison between FDA and industry in this all-out effort with updating reviews to take place as frequently as necessary. Review of Alternate Methods The CTFA Talc Subcommittee has reviewed several methods to detect chrysotile and tremolite in talc, including modifications of the optical microscopic method. These are listed with comments. 1. Optical Microscopic M ethod - may be used with some modification. Possibly better selection of R.I, liquids and reduction of sample size per slide. 2. X-ray Step Scanning - A good method for detecting tremolite if we could accept about 0.2% as the threahhold of detection. It does not distinguish fibrous from non-fibrous tremolite. The simultaneous detection of chlorite makes method impractical for chrysotile. 3. X-Ray Step Scanning + Optical Microscopy - Acceptable as in #2 above but the optical method continues to present the dilemma in reliable identification of chrysotile. however, this does not rule out a major revision of the optical method to do the chi-ysotile .... identification and counting. ............... ..... ...... ........... 4. X-Ray Scanning - The problem of chlorite interference in the detection of chrysotile is present in all x-ray procedures thus far available. It is reliable for the detection of 1% tremolite (both fibrous and non-fibrous). 5. Differential Thermal Analysis - This procedure is capable of detecting chrysotile at the 1 % level, however, it w: 1 1 not detect tremolite. 6 . Scanning Election Microscopy - This procedure is not capable of identi' fying asbestos. Even with energy dispersive analysis, completely satisfactory identification is not possible. 7. Transmission Electron Microscopy + Electron Diffraction - This appears to offer the best, most reliable method and is probabl3r capable of detecting chrysotile and tremolite (fibrous), both at a level of 0 .1 %. It is estimated that an installation would cost about $130M +, and is obviously prohibitse for the small manufacturer who uses talc. The amount of talc sample examined by this procedure, is miniscule. -7 - S unrmary - The CTFA Talc Subcomrp.ittee has completed its review of the Optical Microscopic Method for the Estimation of Chrysotile aDd Fibrous Tremoiite in Talc, which appeared in the Federal Register, vol. 38 (No. 188),(p. 27076, September 28, 1973). It recommends postponement of the finalization of the proposed regulation on talc. In addition, a collaborative effort between FDA & industry to resolve a satisfactory method of estimating chrysotile and tremoiite in talc, is recommended, with periodic liaison reviews to monitor the project status. A task force of industry experts has been designated to pursue alternate methods. We invite FDA to participate in collaboration with the task force. George W,. Sandland Chairman CTFA Talc Subcommittee GWS :dd MEMBERSHIP LIST - CTFA TALC SUBCOMMITTEE G, W. Sandland, Chairman Bristol-Myers Products (SAC) Dr. Murray Berdick Chesebrough-Ponds, Inc. (SAC) Dr. George Cohen Bristol-Myers Products Dr. Christopher Costello Colgate-Palmolive Company Mr. Salvatore DiBiarica The Mermen Company Mr. John Eacq . Co1gate-Palmoli1ve Comp any Mr. David Hamer Johnson & Johnson Research Center Mr. Alan M. Harvey R. T. Vanderbilt, Inc. M r . Ray R . Kraromes Whittaker, Clark and Daniels Mr. Adolph Maruszewski (SAC) Kolmar Laboratories, Inc. Mr. Louis D. Murino United Sierra Dr. DeWitt Petterson . Johnson & Johnson Research Center Dr. Robert Rolle Johnson & Johnson Research Center Mr. Fred Roesch Whittaker, Clark and Daniels Dr. Charles Rowland Avon Products, Inc. (SAC) Dr. Harold Schwartz The Mennen Company (SAC) Dr. Joseph Sirako Colgate-Palmolive Company Mr. Harold D. Stanley, Jr. Pfizer Mr.. Wallace Steinberg Johnson & Johnson (SAC) Dr. John Travers Avon Products, Inc. Dr. C. S. Thompson R. T. Vanderbilt, Inc. Mr. Ronald Yakupcin Kodmar Laboratories December 11, 1973 The Cosmetic, Toiletry and Fragrance Association, Inc. 1625 EYE S T R E E T, N.W., WASHINGTON. D. C. 20006 ...... - - 202/393^2070 Jam es H. Merritt President Norman F. Estrin, Ph.D. V ice P re sid e n t--S c ie n c e October 11, 1973 . -tv - . ' M I N U T E S CTFA SUBCOMMITTEE OF SAC ON ASBESTOS IN TALC The first meeting of the CTFA Subcommittee of the Scientific Advisory Committee, on Asbestos in Talc, was held on October 4, 1973 at the Colgate Palmolive Research Center, Piscataway, N.J. Those in attendance were: ' Mr. 'George Sandland, Bristol-Myers Products (Chairman) Dr. Murray Berdick, Chesebrough-Pcnds, Inc. Dr. George Cohen, Bristol-Myers Products - Dr. Christopher Costello, Colgate Palmolive Company Mr. Salvatore Di Bianca, The Mennen Company Mr. John Facq, Colgate-Palmolive Company Dr, David Hamer, Johnson & Johnson Mr. Ray R. Krammer, Whittaker, Clark and Daniels .Dr..BeWitt Pederson, Johnson &.Johnson.............. Dr. Robert Rolle, Johnson & Johnson Mr. Fred Roesch, Whittaker, Clark and Daniels Dr. Joseph P. Simko, Jr., Colgate-Palmolive Company Dr, John Travers, Avon Products, Inc. Mr. Ronald Yakupcin, Kolmar Laboratories, Inc. The meeting began with a discussion of the optical microscopic method for detecting asbestos in talc, which was published in the Federal Register . of September 28, 1973. The method, as written, is not completely reliable and discriminatory, since fibers other than chrysotile might fall within the critical range of refractive indices used. Cellulose fibers, for instance,would be counted according to the method guidelines. It is estimated by at least two academic sources, that the running of a single sample would take at least six hours for a count and a tenta ti.fve identification. The tedium effect pn the person counting is obvious. Several experts including Walter MeCrone agree that there are probably -- a-- txrtai-of^0-inrcrasrtrpffts"_ltrtfte~"TOi"E5'd""S"ta'fces"'wKo "wouIcTEe *sufficiently qualified to do the analysis. : -2CTFA SUBCOMMITTEE OE SAC ON ASBESTOS IN TALC It was generally agreed that with some modification the methodology could be strengthened to yield a more reliable identification and measure ment . A major consideration in the method is the extremely small sample, one milligram in size, which one must pore over for several hours, then based on the nature of this miniscule sample, make a judgment on a 20 ton lot. Bearing in mind the fact that most talc is produced by a con tinuous process, the reliability of a one milligram sample is poor, even if taken from a composite of several samples, since homogeneity of the sample is extremely difficult to achieve without changing fiber length. A discussion of the step scanning X-ray diffraction procedure fol lowed with a description by Joseph Simko of the method which was developed at Colgate. In contrast to optical microscopy, the X-ray method has a lower limit of detection of 0,5%. It is considerably more reliable for discriminating chrysotile and tremolite and uses a 500 milligram sample, thus providing much greater statistical assurance that the sample is representative. It takes about 3 hours to run including manual compu tation of results. It was agreed that we run a "round robin" test using six samples of talc from several sources in the United States and including Italian talc. Bob Rolle agreed to furnish a set of samp],es which will be "seeded" with tremolite and chrysotile using a special technique to assure homogen eity, These are intended to assist in optical recognition and to estimate reproducibility of procedure. The following eight volunteered to test (or have tested) samples by optical microscopy (Fed. Reg. 9/28/73) and those designated by asterisk will also test by the X-ray diffraction step scanning method used by Colgate, ' Dr. Murray Berdick, Chesebrough Ponds Dr. George Cohen, Bristol-Myers Products *Dr. Christopher Costello, Colgate-Palmolive Company Mr. Salvatore diBianca, The Mennen Company ' *Dr. DeWitt Petterson, Johnson & Johnson Mr. Fred Roesch, Whittaker, Clark and Daniels Dr. John Travers, Avon Products, Inc. Mr. Ronald Yakupcin, Kolmar Laboratories, Inc. ._ ' . ' . George Sandland will prepare, code and distribute the samples to the above list of persons. ' It was also agreed that George Cohen will contact Pfizer to encourage participation ia the work of the Committee. ______ _________ _ . .. . . ____ CTFA SUBCOMMITTEE OF SAC ON ASBESTOS IN TALC The Committee wishes to approach the evaluation of the FDA proposed optical -microscopic with an open mind and recommends withholding the critical commenting in these notes until a fair evaluation through the "round robin" is completed. Following the meeting, several members of the Committee visited the instrument facilities at Colgate to see the X-ray and optical units. We wish to thank Dr. Costello and Colgate for permitting us to use their facilities for this meeting. Dr. Costello also offered'to accomo date us for future meetings. Respectfully submitted to the Scientific Advisory Committee, George W-. Sandland, Chairman GWS:dd ' cc: P. ReisBerg - Carter Products S C IEN TIFIC CO N SU LTAN TS ER N EST F. F U L L A IV I, IN C , ELECTRON MICROSCOPY DIFFRACTION MICROPROBE ANALYSIS P. O. B O X 4 4 4 S C H E N E C T A D Y . N E W Y O R K 1 2 3 0 1 5 1 8 / 7 8 5 - 5 5 3 3 October l6, 1973 Mr. Ray R. K r a m m e s M a n a g er-Technical Services Whittaker, Clark and Daniels, Inc. 1000 Coolidge Street South Plainfield, N e w Jersey 07080 Dear Ray: Ref:Request for quotation, October 11, 1973 Regarding your telephone conversation with Ernie on October 11 and your subsequent correspondence, w e are definitely interested in analyzing talc samples for asbestos. O u r charge for this w o r k would be $50, 00 per sample, based on the official procedure described in the Federal Register (v. 38, no. 183, pg, 27080). T h e results would be described in t e r m s of two parameters: the n u m b e r of chrysolite fibers /mg. and the n u m b e r of arnphiboie type fibers/mg................................ A s you know, it is often difficult to prove the identity of fibrous material b y light microscopy, particularly if two or m o r e particles have nearly identical refractive indices or are not clearly resolved at a magnification of 430 times. Electron m i c r o s c o p y and diffraction of the suspect particles m a y be required to positively identify specific types of asbestos. T h e r e w o u l d be an additional charge of. $100 per sample for the electron optical characterization of particles in each s a m p l e (qualitative .information only). It w a s good to hear f r o m you again, and to find that you are stili involved with microscopy. D r o p m e a note if you have time. With best regards, E R N E S T F. F U L L A M , INC. R E S :,jbc Richard E. Stevens Scientist LA BO RATO RY AND O F F IC E : 900 ALBANY SH A K ER ROAD LATHAM, NEW YORK ,pj 1 A L C October 1i, 1973 Ernest F. FuHam Associates P. O. Sox 444 Schenectady, New York Attention: Dr. Fuiiam Gentlemen: As per phone conversation on October 11, i have enclosed 3 copy of a proposed method for the optical microscope determination of asbestos in talc. Please examine this method and let us know whether you would be interested in examining samples of Talc and what your charges would be per sample. Thank you for your cooperation in this matter. Very truly yours, W h i t t a k e r , C l a r k & Da n i e l s , i n c . .. . RRK/mw . . Enclosure Y iO ,, .. Ray R, Krammes Manager - Technical Services . COPY i \ 1' ""P. ; , "i h i SUMMARY AND COMMENTS ON /.NALYES FOR ASBESTOS IN COSMETIC TALC,PRODUCTS This summary contains the analytical results for asbestos in cosmetic tai.6 preparations, comments on these analyses, and other pertinent information on the work carried out by the following investigators: >y1. Seymour Z. Lewin, Ph.D., Professor of Chemistry, Hew York University. Dr. Levin was commissioned FDA in 1971 to analyze commercial cosmetic talc products. He purchased . and analyzed 195 samples by x-ray powder diffraction. Dr. Levin vas chosen because he is an internationally recognized expert on mineralogical chemistry. 2 . Arnold E. Schulze, Microanalytical Branch, Division of Microbiology (BF-216), FDA. Mr. Schulze investigated 32 of the 195 samples by means of polarizing microscopy. '3. Minerals, Pigments and Metals Division, Pfizer, Inc, Easton, Pa. This investigator employed the techniques of x-ray powder diffraction and reported on 7 of the 195 samples. This work vas complimentary. 4. Columbia Scientific Industries, Austin, Texas. This firm chucked samples for chrysotile by means of differential thermal analysis. This work was complimentary. There is poor correlation between Dr. Lewin's results and the findings ) of the other investigators. Dr. Lewin found definite indications of i chrysotile in 17 of the samples (many of these also had tremolite) and 'definite indications of tremolite but not chrysotile in 23 samples. The chrysotile content could not be confirmee with certainty by the other investigators, and tremolite vas detected by the others only in a few instances. The reason for these discrepancies may be found in Dr. Lewin's own.notes j] of July 10, 1973, in which he stated: "The chrysotile that I found in commercial talcs is generally different in significant resrsects from the chrysotile that occurs as massive, fibrous growth in veins in serpentine rocks. That is, the former h^s diffraction peaks that may differ from the latter by as much as 0.2 A- (at 7.3 A); it is more reactive toward dilute acids; it shows a different appearance under the microscope; and its DTA endotherms and exotherrrs are shifted relative to those of the latter {and apparently diminished)." lie further states that "the analy tical m e t h o d (x-ray diffraction" gives a reproduc;:' ~ty of + 2% to 37. average deviation in replicate determinations on the .-.amc sample, but 'different samples from the same bulk container are found t o vary as much; as 2 0 0 %." ' In the light of those discrepancies and because the inhalation of certain asbsstiform minerals is a potential health hazard, the FDA has encaged in an intensive research project to develop one or several methods of sufii.-cit-nt sensitivity and i d lability which wil ] permit he deto ir.) Ln 1 asbestos in tale-eonte.i.n ing product:; with the nocescary dr groe of .vu ano ac caneen tr ations at: which this con t a 3 nant. presen tx the hcal'ldi h.T-'ar-i Heinz J. Eiormann: 10--]-73 SLIIMARY TABLE OF RESULTS OF FOUR INVESTIGATORS ON ANALYSIS OF COMMERCIAL COSMETIC TALC PRODUCTS FOR ASHES! OS MINERALS PRODUCT NAME & MFG. CODE CHRYSOTILS S.3. Lewin X-Ray Diffr. (A) * A.E. Schulzs Opt. Micros. (B)* Pfizer Co Iu -t>. Sci. X-Ray Diffr, Diff. Therm.Ana. (C)* (D>* "IREMOLI TE A) * is) i; sslovs Perfumed Dtg. Pwdr, Prince Matchabelli, (Ca* s<ib rc ug:- Po nd s ) - n.d. ; - *>- Bmeruude Dig. P w d r ., (Coty) ' -, ' 2% ; _- e? Fmaraudo Stray Dtg. ?v:ar. ( (Coty) 1AEY n.d. ; -. ?i Jolie Madame Dtg. Pwdr, Balmain, (Revlon) - n.d. : - ->3O 76 Co Vr.ow Me Is To Love Me, Tinkerbell, (Ten Fields, Ltd. - - 77 Touch & Glow Face P wdr., Creamy Peach, (Revlon) ' - n.d. ; - JG ToOjOnrs Moi Bath Pwdr., (Corday) Constance Carroll, Bouque^, "3 Dcer-Xiss Talcum, (Xorkorf) 90 Flamingo Dtg. Pvdr., (Tussy) vi Dander Lilacs 3 Roses Talc, 31 Mavis Talcum, (Vivaudou) . 31 Mavis Body ? vdr., (Vivaudou) -'** lancee, {Lu f t*T &r.g ae ) 35 11T Baby Pwdr, - - - L1047 A \ \ - -, ) ,, ' ; ", - 30043 n.d. ; - 5% ; _ ^ ..n. d. -- 5% : n.d. 5% * + 5% ; 5% + 4% +. 3% ; ' n.d. _ -- -' - '- ' ._ - ' - - ... ,---- n.d. -. - -, '- ' n.d. ,, ' _ + +. _ 5-t 1 n.d. O3 2b m.a _ _ n.d 13 ' 3^ s .a 53 ra.a ;3 l.n 3% l.a 13 n.d. -. Zj 4 . 1-a - 51 . .,,, l.z T -5 2?. (c i, io; _n ARY TABLE OF RESULTS OF FOUR INVESTIGATORS ON ANALYSIS OF COMMERCIAL COSMETIC TALC PRODUCTS PRODUCT NAME g mfg, f-5 (a~J 111 101 us id; Blanchard's Dusting Pwdr.y {D$l Labs.) Born Wild Dtj. Pwdr-, (Del Labs.) Tsi Viir.ds Spray Talc, (Avon) Tosca Ttg. Pvdr. Revlon Intimate Perfumed Bath Pwdr. Juan lithe 1 Bath Pv:dr,, (Lanvir.-Charles of 111 1?.J 14 3 7/ 345 ;.;2 14; 154 Old Spies Body Talc# (Shulton) Vasaliia Intensive Care,(Chesebrough-Ponds) Johnson i Johnson Medicated Pwdr. (Johnson & Jchr.scn) ?ir-2ov Taler.a,(Perfection Beauty Products) Overton's "High-Brown" Face Pwdr. . Softae Face Pwdr. Lacy Fayr.e Face Pwdr. Solitaire Cake Makeup EisroLir.e Medicated Pwdr. CODE -` - i c h r y so t ile S.2. Lewin X-Ray Diffr. (A)*: A.E. Schulze Opt. Micros. (B)* Pfizer Columb. Sci. X-Ray Diffr. Diff. Therm Ana. (C)* (D)* 10% H n.d. jl ' 15% n.d. n.d. + (A) *; ! 1 1 G 121 - n.d. . - 7% 241 n-d. 2137 + n.d. - - - '--- - ' ,- 151 10% ' . 2 j i i MFO n.d. - - ,- IT - tr -- -' tr i <5)* <C)* ii; m, a . 0.?J= l.a. ' Ci.i.- l.a. - l.a. - -- - - -- -- - - -. n.d. 10% + 2% n.d. + n.d. - ~ ' - - .- ' - -' _- ' - -' - 1 tr ! - - 5% 1 - - Si. - - n.d.| s.s. - at - - 2% ' s .a . '0.5'. 1 r \ hka7 YofTrIJniversily `\ Department of Chemistry T4NeeWiwephsYhooinnrekg:,to(Nn21.Yi2')l.n5c19c0S.0'-R0334o2o7m 410 ATTACHMENT TO TAT LE I- Memorandum to; Dr. George Thompson . Food and. Drug Administration From: . S. Z. Lewin Chemistry Department, New York' University He: Determination of Asbestos Contents of Commercial Talcum Powders This will serve to summarize the main points of our discussion .on this date of July 10, 1973 with respect- to the factors involved .in the detection and estimation of asbestos in talc, and the status of the tabulation of results of the analyses of commercially-avail- . able consumer products containing talcum, powder. . , My research group has been engaged in studies of talc and ibs accessory minerals continuously since July 1971., and we are continuin .. to.work in this.f i e l d ... We have undertaken.to investigate.the -follow Ing problems:......................... , ' A. Tabulation of the x-ray diffraction data for talc and all 'solid phases (whether naturally occurring, or added in the course of processing) encountered with talc in mineral, industrial, cosmetic . and pharmaceutical products. . B. Elucidation of the x-ray diffraction spectrum (i.e,, precise , locations and relative intensities of peaks and variability thereof) of chrysotile. Assignment of the diffraction peaks to the crystal planes responsible for them, and interpretation in terms of crystallc 'phy of the effects of grinding, orientation, and sample preparation. ._ . 0 o Investigation of the chemical properties of chrysotile, antigorite, chlorite, tremolite, and talc; specifically, measurement o f .the rates of hydrolytic and ion replacement reactions. . , D. Microscopy, both optical and electron, of -chrysotile and of talcs containing various accessory minerals, Including chrysotile and tremolite. t-.v ksurem .i si t tion, of asbesto ant alcs. _ . _ .. enr ie hmant, due axr -lui. "I 4 U-U Arri* - P r-, ^ 4- - q UL/^u Jl x 0 , 0 W_ fclio civ1 from cor (OVER) Department of Chemistry 4 VtaUiinyion Place. Room 410 New York, N .Y . 10003 Telephone: (.212) 59S-3427 .1 ATTACHM EN T 10 l A e L E I ' ~~~ " " ~ .' Memorandum to: Dr. George Thompson . Food and Drug Administration '. . From: , S e Z. Lewin Chemistry Department, Nevi York' University Re: Determination of Asbestos Contents of Commercial Talcum Powders This will serve to summarise the main points of our discussion .on this date of July 10, 1973-with respect- to the factors involved in the. detection and estimation of asbestos in talc, and the status of the tabulation of results of the analyses of commercially avail able consumer products containing talcum powder. . My research group has been engaged in studies of talc and its accessory minerals continuously since July 1971., and we a r e continuin .to work in this field. We have undertaken to investigate the follow ing problems : .' A, Tabulation of the x-ray diffraction data for talc and all `solid phases (whether naturally occurring, or added in the course of processing) encountered with talc in mineral, industrial, cosmetic and pharmaceutical products. ' .' - B. Elucidation of the x-ray diffraction spectrum (i.e., precise locations and relative intensities of peaks and variability thereof) of chrysotile. Assignment of the diffraction peaks to the crystal planes responsible for them, and interpretation in terms of crystallc `phy of the effects of grinding, orientation, and sample preparation. .. . C t, Investigation of the chemical properties of chrysotile, antigorite, chlorite, tremolite, and talc; specifically, measurement of the rates of hydrolytic and ion replacement reactions. . ,____ D. M i croscop y , both optical and electron, of-chrysotile and of talcs containing various accessory minerals, including chrysotile an d trem o1i 12 c T4-74< Mi 1 I .'"o Fy f -if-/bisi or-\ rk. tion, ox asbestos' in the ligi U/tbi/ l a o i - ions of the dust from com:r-:uv,i' talcs. (OVER) Hew York'Univcrsiiy \ Department of Chemistry 4 K in g to n Pince.-Room 410 New York, N .Y . 10003 Telephone: ( 2 12) 59S-J427 ATTACHMENT TO TA-'LE I~ . , `` Memorandum to: Dr. George Thompson . Food and Drug Administration '. . From: , S. Z. Le win ^ Chemistry Department, New York" University Re: Determination of Asbestos Contents of Commercial Talcum Powders This will serve to summarise the main points of our discussion ,on this date of July 10, 1973 with respect- to the factors involved .in the detection and estimation of asbestos in talc, and the status of the tabulation of results of the analyses of commercially avail able consumer products containing talcum, powder. .- . My research group has been engaged in studies of talc and its accessory minerals continuously since July 1971* and we are continuin .to work in this field. We have undertaken to investigate the follow ing problems : . A, Tabulation of the x-ray diffraction data for talc and all 'solid phases (whether naturally occurring, or added in the course of processing) encountered with talc in mineral, industrial, cosmetic and pharmaceutical products. . B, Elucidation of the x-ray diffraction spectrum (i.e., precise locations and relative intensities of peaks and variability thereof) of chrysotile. Assignment of the diffraction peaks to the crystal planes responsible for them, and interpretation in terms of erystallc 'phy of the effects of grinding, orientation, and sample preparation. .. . C c Investigation of the chemical properties of chrysotile, antigorite, chlorite, tremolite, and talc; specifically, measurement of the rates of hydrolytic and ion replacement reactions. . D,, Microscopy, both optical and electron, of -chrysotile and of talcs containing various accessory minerals, including chrysotile an d treinolite E,, 1\V> ----. lJ tion, ox abe talcs. dus fc f r cm cor :e-:a-; (OVER) N e w YorrUnivcrsilv ' \' Department of Chemistry 4 Wdijngton Pince,'Room 410 Neu- Yo rk, Telephone: (N21.2Y). 5190S0-033427 . .' .` ATTACHMENT lO T A rfE I ' . - '. Memorandum to: Dr. George Thompson . Food and Drug Administration '. . From: . S. Z, Lewin Chemistry Department, New York' University Re: Determination of Asbestos Contents of Commercial Talcum Powders This will serve to summarize the main points of our discussion .on "this date of July 10, 1973 with respect- to the factors involved in the detection and estimation of asbestos in talc, and the status of the tabulation of results of the analyses of commercially -avail able consumer products containing talcum powder. . , My research group has been engaged in studies of talc and its accessory minerals continuously since July 1971* and we are continuin .to w o r k .in this.field... We.have undertaken t o .investigate the follow ing problems :......................... , '....................... A, Tabulation of the x-ray diffraction data for talc and all 'solid phases (whether naturally occurring, or added in the course of processing) encountered with talc in mineral, industrial, cosmetic and pharmaceutical products. ' .' B. Elucidation of the x-ray diffraction spectrum (i.e., precise locations and relative intensities of peaks and variability thereof) of ehrysotile. Assignment of the diffraction peaks to the crystal planes responsible for them, and interpretation in terms of crystallc 'phy of the effects of grinding, orientation, and sample preparation. .. . C,, Investigation of the chemical properties of ehrysotile, antigorite, chlorite, tremolite, and talej specifically, measurement of the rates of hydrolytic and ion replacement reactions. . D,, Microscopy, both optical and electron, of -ehrysotile and of talcs containing various accessory minerals, including chrysotilc and tremolite. _, .. Measurement of the degree of enrichment, du to air e l u i . tion, of asbestos in. the lightest fraction talcs. . f the dust from co am-.-mi (OVER) \ Department ofChemistry 4 Wshington Place,'Room 410 New Yoik. N.Y. 10003 Telephone: (213) 59S-3427 .* .' A l 1ACHMGNT 1 0 fA.-'Lb T ~ ~~ " . . ' Memorandum to: Dr. George Thompson . Food and Drug Administration '. . From: ^ S, Z. Le win Chemistry Department, New York' University Re: Determination of Asbestos Contents of Commercial Talcum Powders This will serve to summarize the main points of our discussion on this date of July 10, 1973-with respect- to the factors involved in the defection and estimation of asbestos in talc, and the status of the tabulation of results of the analyses of c o m m e r c i a l l y avail able consumer products containing talcum, powder. . . My research group has been engaged in studies oif talc and its accessory minerals continuously since. July 1971# and we are continuin .to work in this field. We have undertaken to investigate the follow ing problems : .' A, Tabulation of the x-ray diffraction data for talc and all 'solid phases (whether naturally occurring, or added in the course of processing) encountered with talc in mineral, industrial, cosmetic and pharmaceutical products.* ' ' .' B. Elucidation of the x-ray diffraction spectrum (i.e.,. precise locations and relative intensities of peaks and variability thereof) of chrysotile. Assignment of the diffraction peaks to the crystal planes responsible for them, and interpretation in terms of crystallc 'phy of the effects of grinding, orientation, and sample preparation. ... C. Investigation of the chemical properties of chrysotile, antigorite, chlorite, tremolite, and talej specifically, measurement of the rates of hydrolytic and ion replacement reactions. . . D. Microscopy, both optical and electron, of chrysotile and of talcs containing various accessory minerals, including chrysotile and tramolit'2. _. .. r q * Ojfn?'* 17 - CLlr> t o 0 1^ JA. i . tion, ox asbestos' In the lightest fractions of the dust frern com.'-: talcs. \ Dcparimcn! ofChemistry 4 Wshington Place.'Room 410 New Y o ik, N .Y , 10003 Telephone: (212) 59S-3427 . ,' ATTACHM ENT TO TA /.L E I * ', . '' Memorandum to: Dr. George Thompson . Food and Drug Administration '. . From: . S. Z. Lewin Chemistry Department, New York' University Re: Determination of Asbestos Contents of Commercial Talcum Powders This will serve to summarize the main points of our discussion on this date of July 1 0 , 1 9 7 3 - with respect- to the factors involved .in the detection and estimation of asbestos in talc, and the status of the tabulation of results of the analyses of commercially-avail able consumer products containing talcum, powder. - . My-research group has been engaged in studies of talc and its accessory minerals continuously since July 1 9 7 1 , and we are continuin to work i n .this.field....We.have undertaken to investigate.the follow- Ing problems : '. ' - A, Tabulation of the x-ray diffraction data for talc and all `solid phases (whether naturally occurring, or added in the course of processing) encountered with talc in mineral, industrial, cosmetic and pharmaceutical products. B. Elucidation of the x -ray diffraction spectrum (i.e., precise locations and relative intensities of peaks and variability thereof) of chrysotile. Assignment of the diffraction peaks to the crystal planes responsible for them, and interpretation in terms of crystallc 'phy of the effects of grinding, orientation, and sample preparation. ... C 0 Investigation of the chemical properties of chrysotile, antigorite, chlorite, tremolite, and talc; specifically, measurement of the rates of hydrolytic and ion replacement reactions. . D. Microscopy, both optical and electron, of -chrysotile and of talcs containing various accessory minerals, including chrysotile and tremolite. E* M e a s u r e m e n t of the deg r e of enrichment,`duc to air lut. tlon, of 0.S0^3 Cfc. in.- ChO talcs. . c w xxa.\J is.'Jii (OVER) P. Development of a method based on the combination of x-ray - diffraction, chemical reactivity, and microscopy for the estimation of the chrysbtile and tremolite contents of consumer products (these two being the only asbestiform minerals encountered in all the j:/ American products examined so far, with only one possible exception), and application of the*method to the analysis of about 200 standard store-purchased specimens. ' G,, Investigation of alternative analytical.methods, viz., diff erential thermal analysis and density gradient centrifugation, as alternative or supportive techniques. ' Our results to date support the following conclusions: 1*' The chrysotile that Is found in commercial talcs Is generally different in significant respects from the chrysotile that occurs as massive, fibrous growths in veins in serpentine rocks. That is, the j mer has diffraction peaks that may differ from the latter by as much .as 0.2 A (at 7 - 3 A);, it is more reactive toward dilute acids;. Iu . shews a different appearance under the microscope; and Its DTA endo- therms. and exotherm are shifted relative' to those of the latter (and apparently diminished). .' 2. The presence of chrysotile as a minor constituent in talc ma be established with reasonable certainty on the basis of (a) the presence of x-ray diffraction peaks In the vicinity of 7.23 to 7.^3 - and 3*59 to 3*65 A, (b) the pronounced weakening or complete disappes ance of these peaks upon treatment -upn-fc-reaijneixt- of the specimen wit h 1 M HCl at 80C for 1 hour, (c) the presence of fiber bundles o1 visible size under 250X or higher magnification in the optical micro scope which shew a refractive Index of about 1.5(1 (these fiber bundl: may be short and straight,_and may be coated with a bumpy encrustati' of MgC^O,,, or m a y be embedded In talc or other particles), and (d) t: .presence of fibers under the electron microscope which yield an elec diffraction pattern that corresponds in d-values to those f o u n d in t x-ray diffraction pattern (these-fibers typically do not have a ho'J central capillary running through them). - ' . . * 3. The concentration of chrysotile In a talc may be cstiir.rbe--' mea,. uring the area under the x-ray diffraction peak at about 7-3 A r e t live to* that of an internal standard. The best internal standai is calcium oxalate monohydrate (peak at 5 83 A),, 1 4 The quantitative results are conditioned by the fact that segregation effects i n 'talc powders are considerable; the analytical method gives a reproducibility of 2 to 3$ average deviation in replicate determinations on the same sample, but different samples from the' same bulk container are found to vary by as much as 200 5. The quantitative-results are further complicated by the factjef that antigorite____giy.es. an x-ray pattern that is indistinguishable from that of. chrysjjtile. The HCl treatment specified above does not affect ground antigor^te, but it is not yet known whether antigorite, if it occurs in talc, has the same chemical reactivity as the ground material from massive antigorite, or .whether (like chrysotile) its properties may be variable depending upon the rock matrix in whiej? it is found. . - . . 6. Subject to the qualifications inherent in the above, we have obtained quantitative estimates of the clrrysotile contents of about 200 commercial talcum powder specimens. -V/e have also determined the contents of the other minerals in these products, including tremolite, 'quartz, chloritej dolomite, and others. There is no ambiguity in the identification of. these latter species, but the quantitative results for these are also affected by the segregation problem, which is most serious for those constituents present in the smallest amounts 7. Most of the commercial talcs tested are free of any detectabl amount if. any of the ashestiform minerals, according to the criteria enumerated above. Thus, there appears to be an adequate supply of talc for which there is no ambiguity about the absence of chrysotile or tremolite. In about 10$ of the samples tested, there appear to be definitely detectable amounts of either chrysotile or tremolite preson  TABLE IV ' . KEY TO SAMPLE NUMBERS OF COSMETIC TALCUM-TYPE POWDERS' SAMPLE NO. , `. . - PRODUCT NAME FURTHER IDENTIFICATION .1 ' 2 Ammens Powder, Medicated Amolin Deodorant Powder . i Bristol-Myers (No. IF25) Norwich 3 Aquamarine Cooling Spray Bath Powder Revlon (143) 4 Bagatelle Amber Dusting Powder Corand (DCH) - 5 Bourjois Bath Powder ` 6 Caldesene Medicated Powder- Pennwalt (5274) '7 Cashmere Bouquet Body Powder Colgate-Palmolive 8 (Jianel No. 5 Bath Powder . 'S Countess Rocheau Cake Dusting Powder Jergens 1 0 Crepe De Chine Dusting Powder, Millot c ' House of Fragrance (L113 11 Crepe De Chine Poudre Mist, Millot . ? House of Fragrance 1 2 Cuticura Talcum Powder - . * . . Purex (07170) ' 13 Des.enex . - WTS-Pharmacraft 14 Desitin Baby Powder . Pfizer (11392) (3/29/72 15 Desitin Baby Powder - Pfizer (115) (5/10/72) 16 Diaparene Baby Powder ' Breon (E1030) 17 . Dorothy Gray "Secret Of The Sea" Dusting Powder 18 Emetaude Talcum Powder .* Coty (355-4010) .- 19 English Leather ' Mem . 2 0 Faberge "Music" Dusting P-owder , .(2891) 2 1 Friendship Garden Existing Powder . . ' Shulton (3/27/72) 2 2 Friendship Garden Dusting Powder ' ' Shulton (5/9/72) ' 23 Friendship Garden Dusting powder Shulton.(7/13/72) SAMPLE NO. 24 ' PRODUCT n a m e 't Heaven Sent Aerosol Bath Powder Mist FURTHER IDENTIFICATION Rubinstein 25 Heaven Sent Bath Powder Rubinstein 26 Helen Press] "Little Lady" 27 Importa, Spain Mens' Talc 28 Isis Floral Talcum Powder ^ 29 Johnson's Baby Powder (028Q) 30 Johnson and Johnson Medicated Powder 31 Koscot Beauty Dust-- Oil of Mink (3612) \ 32 Lanvin Arpege Dusting Powder (1288) 33 _Lanvin Arp.cee Powdered M ist .34 ' Lanvin Arpege Talc . 35 Lewis Baby Powder * 36 Loves Fresh Lemon Glossy Powder . 37 Macy's Scented Borated Talcum ?. /i'/.v.: '''";'Manley & James ? ;>v 'S' . V ^ ' 38 Macy's Talcum, Apple . . .. (2IC4) 39 Marcelle Dusting Powder, Hypo-Allergenic 40 Mary Chess Perfumed Dusting Powder . p$ 41 Mennen Baby Magic Po w d e r .. .. r"' . ) 42 Mennen Quinsana Foot Powder (B112) (H202) ' 43. Merck Talc, Product No. 6460, Lot - 'o . 6460) (8039301) 44 Mexsana 2387-D Medicated Powder ' Plough 45 Old Spice Body Talcum' - - - ------------------- "Shulton - - ....... 7;' :46 Persian Lilac^ DeluxeJDusting Powder 7,.:'.'r -(' April Showers (LFN) 47__ Persian Lilac Spray Bath PowdejL^,^..0.' April Showers 111200;;) 48 Pond's Perfumed Talc Body Deodorant Dream Flower (11513) 49 Prince Matciiabelli Beloved Spray Powder ' (OVER) S/JtPLE 1. yo. ' PRODUCT NAME , FURTHER IDENTIFICATION 50 Quest Deodorant Powder 1 _. 51 Replique Spray Bath Powder ' Parfms Raphael (004) 52 Riviana Foods - Italian Stearin Talc For Rice . 53 September Morn By Pond's- (19B) 54 . Seven Winds After*Bath.Talc ' ' DuBarry (021085) 55 U S P Talc . 56 Vaseline Intensive Care Baby Powder 57 Yves Saint Laurent Rive Gauche Spray Talc (I 209) V ...... .58 Z B T Baby Powder __ ^ ../-'.y ./-a A. / : . ..,,(F1021) . 59 .Zeasorb -Super Absorbent Medicated Powder_S*M- Stiefel 60 Ambush-Dana Dusting Powder ^{ , u 6X . April Showers ' (9884) . 62. 63" 64* 65 JT- 1 L \ 67 68 Avon Unforgettab.le-,.Pfi'r-fuied- Talc -I 'y?Beloved Perfumed Dusting Powder, Prince .;' Matchabelli Coty Face Powder JUchel '/rf 'ty -:r ''** Desert Flower Spray" Bath Powder ^,.t/ . Emeraude Du sting.,Bowde-r Emeraude Spray Dusting Powder// ' >' Shulton (F 1 BKI) Ul j?P'- r *-/bv - ',v V ' Coty . ' ' Coty (1 ANY) Faberge Flambeau Deodorant Spray Powder . (37 WBF) ' 69 Jean Nate Spray Bath Powder . . ( I N 247) ` 70 Jeris Talc, Flesh .' 4.. v l 72 73 Jolie Madame Dusting Powder, Balmain j^' Lady^Esther Face Powder, Rachel Max Factor Face Powder, Rachelle 74 Medicated Coiu'forc Powder . Parke-Bavis 75 OH.' de London Talc Yardley (493) SAMPLE ' NO. PRODUCT NAME To Know Me Is To Love Me - Tinkerbcll Touch And Glow Face Powder, Creamy Peach 5/: Toujours Moi Bath Powder . . .. Yardley April Violets Chantilly Dusting Powder . Cashmere Bouquet - Jean Nat/ Talc '. Mertnen Shav Talc . Shower To Shower Body Powder *Pure Baby Powder, Dart Drug Jt Pond's Dream Flower Perfumed Talc ' * Almay Hypo-Allergenic Face Powder . ' j?m'r' t Constance Carroll^ Bouquet Talc .fv*. - i ' Djer-Kiss Talc*um / * j : ' Flamingo Dusting Powder, .Tussy N . 91 i. 92 -'-f 93 ^ '9 4 # 95 hN-96 :- # 9 7 Lander Lilacs And Roses Talc - Mavis Talcum 7, :' Mavis Body Powd'er - Tangee ( r - ` r ZBT Baby Powder.-' i Blanchard's Dusting powder 'i 7 j ' Born Wild Dusting Powder 7'' 98 Lander Gar-denia And Sweet Pea Talc '99 100. .>7-101 Lander Lilacs And Roses Deodorant Body Talc Miss Dior Dusting Powder ,, . Tax Winds.. Spray Talc FURTHER IDENTIFICATTON Tom Fields, Ltd. Revlon Corday (4908) Houbigant (11F) (on 345) (B 81) Johnson & Johnson (5507BG) (K 11C) (0 13D) r. i1 . .. _ Kerkoff " " '' (L1047) Vivaudou 1 Vivadou Luft"Tangee (B0048) Del Labs (Avon (DCC 1272 2 -14-72 (OVER) f^-'102 103 104 105 106 107 .ifiio s ,-109 PRODUCT name; . V?Tosca Dusting Powder ' --.w Coty L'Aimant Talcum Powder ` Coty Emeraude Talcum Powder Coty L'Aimant Dusting Powder Coty Imprvu Dusting Powder Coty Muguet des Bois Dusting Powder Revlon Intimate Perfumed Bath Powder/' Jean Nat"Bath Powder ' - ' 110' Jean Natex Spray Bath Powder j W- 111 Old Spice Body talc : ~ / 112 Dr. Scholl's Foot Powder 113 Faberge Xanadu Luxury Bath Powder Spray ..114 Faberge Zisanie de Fragonard * ;ii5 Faberge Tigress Bath Powder '` 116 Faberge Woodhue for Men ' 117 Faberge Brut for Men Shower Buff All-Over Body Powder 118 Faberge Talc 119 120 121 . 122 Faberge Aphrod.es ia Bath Powder . Faberge Straw Hat Bath Powder ' Faberge Aphrodesia for Men Shower Buff Faberge Xanadu de Luxe Bath Powder - . 123 Faberge Uoodhue Bath Powder . 124 Faberge Music Dusting Powder " ' ' ' 125 Faberge Flambeau Bath Powder ' FURTHER IDENTIFICAT10N .(1JJ) (01A) . (1M) . ' .. /, .^ ' (IDE) (2E0) ' `* (241) . Lanvin - Charles of the Ri (2137) Lanvin - Charles of the Ri (2103) . Shulton, Inc. (MF0) (20517) (Yl) .. (2132) Ref, 61159-019.... Ref'. 2052-003 Ref. 5027 (0252) Ref. 5400 (raw material: from France Ref-. 2052 (2172) .Ref. 5027.. ' ... ..... ` Ref. 1244-028 (2342) Ref. 2052-002 . Ref. 0714-018 (3121) . Ref. 2052 (3471) v SAMPLE ' NO. PRODUCT NAME FURTHER IDENTIFICATION 126 Hennen Baby Magic ' ,,. '. 127 Walgreen's Crib Age . 528 Caldesene Medicated Powder 129 Des iten | 5jf'130 Vaseline Intensive Care ' 131 Johnson and Johnson Medicated Powder 132 Johnson Baby Powder v_ 133 Johnson's Baby Powder ' (108T) 134 J Johnson's Baby Powder - ,(109T) 135 Johnson and Johnson Medicated Powder . (0452K) 136 Johnson and Johnson Shower to Shower Body powder (C 512z) 137 Johnson and Johnson Shower to Shower Body Powder (0709X1) 138 Johnson and Johnson Shower to Shower Body Powder (0872K) 139 Avon Brocade Spray . (31602) 140 Avon Bird of Paradise Spray - (B1652) - 141 Avon Tai Winds Spray Talc ' (4065) . 142 Mennen Bath Talc - (A308) ' 143 . Fin-Zow Talque ^ ;w-?,is.; -' ' 2^144 . ' >345 Overton's "High-Brown" Face Powder Softee Face Powder 5-/' '[V: . fPerfection Beauty Product Inc Pearl River, N.Y. n.^ -i ; 146 Westport Face Powder '. t 147 . Hazel Bishop Pressed Pow.der 45148. - Lady Wayne Face Powder 4~149 Solitaire Cake Makeup *': , : ' l '\ . _' * 150 Dreatry.lo Pressed Powder '.. . . . ... (OVER) SAMPLE ; NO. PRODUCT NAPE 151 Early American Old Spice Talcum Powder 152 Corsage Dusting Powder 153 Admens Powder, Medicated # 154 Bismoline Medicated Powder 155 Rite Aid Pure Baby Powder s/ 156- Warner Pure Baby Powder_ Mavis Imported Talcum /* ^Avpn-'-Brocade Perfumed Talc Avon Blue Lotus Perfumed Talc Avon Beauty Dust Refill - Charisma Avon Elusive Beauty Dust Refill i ' #163 Avon Rdgence Perfumed Talc Pinaud Clubman Talc /G' / ;; -164 Grand Union Baby Powder.. 165 Cashmere Bouquet 166 Almay Face Powder, Soft Beige d.67 Tawny Tone Body Talc From Black, Heritage 168 169 # -1 7 0 Colgate Tooth Powder ii " Dr. Lyon's Tooth Powder '. i . "C" Bouauet Taic. 171 Tangee Dusting Powder V-1/2 '. Jeris Talc , at? 173 Corsage Dusti-n^ Powst . 174 Lander Gardenia & Sweet Pea Deodorant Body Tate FURTHER IDENTIPICAT1ON Lander (101672) ...... ..(4212DX) (Supplied by Mfgi (List No, 719, Lot 201, Supplied by Mfgr.) (Beauty Mustus, Inc, Greenwich, Conn.) (Winarick, Inc. Distr. by F. W, Woolwort.h) (2662 ) ' (GeorgeW. Luft Co. ) (2762 _ (Winarick) (2732) (Lander Co.) SAMPLE NO. ' PRODUCT NAME 175 Lander Baby Powder - 176 Lander Lilac 6 Roses Body Talc . , 177 .Beloved PerTurned Dusting Powder 178 Jean Nat/ Tale No. 60 179 Jean Nat/Sprey Bath Powder , 180 Tinkerbell Body Talc . 181 Yardley.Sigh Shadow Brush-On Eye Shadow 182 Max Factor Face Powder, Rachelle : .` X 183 Tweed Bath Powder, Lentheric / ' : f .184' Yardley Next to Nature Sheer Pressed Powder. '. 185 Yardley April Violets Dusting Powder . 186 Yardley Red Roses Dusting Powder . -187 -Yardley Springflowers Talc -- . .188 Yardley White Lavender Talc //u Ad-189 Yardley Red Roses Talc. ' - "190 April Showers Deodorant Talc 191 Chantilly H'-ubigant IXistingPowder 192 Tinkerbell Dusting Powder - 193 Tinkerbell Powder Mitt . 194 Tinkerbell Dusting Powder '. 195 Tinkerbell Body Tslc ' & FURTHER IDENTIFICATION Prince Matchabelli. (235A) (2264) (2101) / . ' (Tom Fields, Ltd., Div. of MEM) Ref. No. 721 \ (Supplied by Mfgr.) - (Yardley)(44) -" (A2) ' (162) : (165) (260) . ......... (27!) (214) Ref. No. 9882 (2JBB) .. (Tom Fields, Ltd.) - (Tom Fields, Ltd, ) (Tom Fields, Ltd.) (Tom Fields, Ltd.) .(OVER) TABLE 1 fcr FIN A L R EK )2T XoRAY CWDER DIFFRACTION ANALYSES OF COMMERCIAL COSMETIC POWDERS arrg>Xsas uTuswaAlmo C h lo r ite Aniego p X ta QuCaUnts Dmoliote- CaieIte Tjo?6lmite ,Cthirlyoso Stlahp-oerciJ.e^.f i 705 ` ' '35 75 nod nodo n<,d0 n.do Rod* s I005 Hqdp tud nod Itodo Hodo Hodo Rode 3 995 sudo 15 Hode SIed* Hodo Rdo Rodo 4 1005 iHoiio nodo nodo n0do Hoda nodo Rodo 56 955 8o5 25 25 7 8655 75 35 5OS5 Hode H0do nodo Redo ' Rodo nodo nodo n8d0 n<.do Rodo CaUadee 35 25 ned0 Red, ? 8 955 25 35 nodo n*do Hod, nado Rodo 190 895 . 935 . 75 35 25 25 nod0 fiodp Hod0 Rode 25 Hodo sudo Hodo nodo. H ' 905 25 12 100,5 Hodo 25 rudo 45 25. nodo Siedo HoU nodo' Hodo Hodo nido -Redo. 13 14 " 6o5 31,5 n 0do nde 505 .25 ned. Hodo o5 75 n edo Hod, Rodo ns.de Hodo Rodo ZnUnd&c 1156 1005 e*> nS3o^ido Hod* Hcwodo- nodo h.odo 'bxj* ned* ecs> nd?oodo ' KaQoil-irl-i:vJn-,s 17 6o5 305 45 nodo 65 Redo Hedo Rode 18 905 45 25 25 25 He?dij- Hddo Rodo 19 . 975 '15 2.5 Hodo nodo Hodo Rode Rodo 20 355- 6o5 15 45 n0do Rodo Redo Red 2Ara1rji> . 675.595; 255 355 23 4a5 505 24 25 . 945 955 1nc5( 25 15 25 5 35 35 . 35 H*o>dpfo 5 5sei p 35 HoS Pdo Hodo nodo Hodp h<>d0 R0d0 Hode Rodo HeOl0 Rodo Redo Rodo RdIo <3 % Rdo Hod0 Rodo- ? 26 . 955 15 45 nodon a a . hedp Rodo . ? 2wr,,v=*i?C,O>i . jo7L-?85j5'-irvss>'<rU> \+\rF> 3 nodo < l% 25 Hod'c* 25 d0 rieG Rod, nodo Redo' snodo 105 Rode Rodo T.Hft -' 3290 qu945 975 . St4-do 15 5 25 C*"v>AA 475 . 505 25 nodo. 25 CX0 OC< 85rJ/0 ru& b Hodo Rido 1>dQ >9-41Ce Redo Rode Rodo Hodo Rno0ddo i Fage 2 SE'I s 3 l- 5 PhX&go* .^?-e vhJ.gr:l?x> p it o 55# \ j4 o # 2# lio Q.p 78# 7# 4#' ' 3# 78# 5# 2# lo # 6 e s c8X# 4# n 0to iiod 7 3 ?# 50# 5# Hodo 8 87$ 5# 4# * 2# 9 ' 94# 3# lUO-o 3# 0 67# 25# 1 33# 8# nodo 2# 3# 2# 2 89# 6# n,odD n 0d 3 97# risdo n 9do 3# t esa 00 90 ^OXO^ KlltO 8# 5# nodo 7# 2# Ho do 5# 5# 3# n..oda a * Tnom- CaXftdts . o ld to to do iiodta , no do n&do riodo rio do n 0do liado nodo liado t i d<> n*do nodo nodo n 0do Hade nodo n 0do *. 2# ndo nd0 110 d 0 oc* Chryo<$= fc.Xcr . . U-Clo ti 0do Ho co n .d o n Bdo n edo l'l Ca(I & nodo nodo tido nodo ere? 5 6 6 $ ..4 8 $ 7 98# 8 ' 88# 9 ..lo o # 0 95# 1 . loo# 2 87# 3 90# 54 . ee.087# 80# 6 90# 7 80# 8 . 9 8 # 30# 4o# nodo 4# 5# lis do 8# 4# 3# 15# 7# 15# ri d<. nodo nodo 4 # nodo x\ d d 0 n 0do nodo 5# 7 # n do . n 0do nodo n Qdo n od 0 lio do 2# nodo nodo 2# 2# 4# n cdo Hada ' nodo ...n<,d<,.........nodo.......n d 0....... ..nado....... riodi* . rio do n 0do n ,,d 0 lu d o nodo Hode n 0do n 0d 0 to de Hg d nodo 2# 3# 2# 2# nodo 2# nodo n 0do itf de llda nodo nd 4# Tic do n<>do 5# ' 4# n Ddo n ad? ti 0d Uods n 0db . n 0do rio do XI0do 3# n 0do rio do 5# ru do xido tidc ndo nodo rtc d riodo 4# to do o do Hod . lo d co 0 \T> 9. e a 09 0# b c a o60# i 38# 2 ` 8 5# 3 87# OtoSO/*? rr 6 c a ,, 7884## V/N. co 7 S 9 9 7 # n&d<> 30# 40# . 2# ' 2# 5# i;5# 5# 15# i 5# X# Wo do Rodo rtd 0 3 # n 0 do rudo . 7 # 4# ' 18# nodo 3 # 2# 4# n 0do nodo 3# 2# nido a . d , **-, nf 3# - .VJ 3# h<K 3# 1. n.od<, d g. HoClo 1OOO i CO.C nodo 5# 5# 21c>Ci0 nodo 2# 1l1o#d 0 . nodo n 0do leo do 0de n<, do lio d or rudo lio do li de n edd 5# nodo n 0d o do ' r-^/ < c*r> Hado 1d n rodo tic Co n 0d 0 n 0tU lio do o do 0Cln rr Hoda , ti 0d 0 ti wd OJh&z* 81; n g .-;: M ica ZnO ,Knoli TaStf-nu c>,,,O.* ,, ,. paiS'6 3 CS|3.5?h!lOf>- CiU M o l i n n u 0hx^'a 0 Other* m 'TaV C h i o m ito nlfc*-? Oes rdui0* Bidt e CiXw.i'bo o l l b i VvfacS.V.':,sUr:J'JV Sy? nei- ) 28$ L 85$ > 06$ 5 ea.o80$ \ 90$ 5 75$ > 75$ r 91$ % j 85$ 81$ > cao 50$ 60$ 3,0$ '5$ 10$ n,,d0 5$ rio o odo 2$ 5$ 40$ Ttodo 5$ n &ti 0 . 2 $ ota1*! 4 $ rua,, 3$ nodo lodo nodo to CO 5$ 4$ 5$ 2$ 1$ 4$ 4$ n 0do rio co 6$ 7$ nodo n 0do 5% 5$ 15$ 10$ nodo 3$ . 2$ nodo H at& HqCla 2$ nodo 5$ 5$ nodo n cd. B . do O0/-*o/ nodo n 0do 3$ ned. TX&ci 0 n edo mdo 5$ 3$' 5$ nodo nodo rudo ru d o . nodo rio do Z n Ste n.o do n odo nodo . nodo Ho do nodo ? i Cito S0 $ i u 7 B$ \ Oa<>04$ t ea<>92$ 5 oac85$ 0" 3 . 85$ . r <iao30$ 3.' 61$ ? 68$ 7$ 12$ 6$ 4$ 5$ 4$ 50$ nodo ' 1$ 1 $ 6$ 4$ 2$ 4$ 3 $ 5$ nodo n<,do n 0do 4$ 0c i n 0d0 nodo 0$ 2$ ..... .......4 $ ...... ....... 4 $ n 0&< 4$ 12$ rio tU 3$ 5$ 25$ 8 $ , 10$ TXo-ci nodo ? i O$> npd(j ? nodo n Pdo ? nodo 'n 0do ? riodo n*do ? rto do nodo ? ' 3$ nodo ? rudo 4$ 5$ rudo 5$ ' 5$ 3 55$ 1 da*50$ 2 ' 64$ 3 . 55$ it c a o 4 6 $ 5 86$ 6 28$ l ' 31$ 8 e a 04o$ 9 cuo40$. nodo 1$ 3$ TeCo n o ^0 1$ 4$ nodo n 0do 4$ 3$ n.0do n Ddo 3$ 1$ 1$ ru ci e 3 $ nodo 3$ 0 a 8o Si 63$ 2 63$ 3 93$ it . 9 1 $ 108$$ 0(`{ 3$ O/* f/ ts.-"2> o do n-odo 7$ To o 6$ 6$ 6$ 5$ 6$ 5$ . rio .0 rio do nodo 7$ 3$ ' no2d$o 25$ 3$ 20$ 25$ 35$ 4$ 2$ 5$ 3$ nodo n,, do rudo . 5$ 5$ n 0do 4$ rudo 2$ 45$ 35$ 6$ n 0do hod ,, 2$ 8$ 12$ nodo 2$6$ . nodo 2$ rudo 4$ n 00.0 4$ . J-T>//r'-(7 ilo do nodo Xo Ci. 0 ' n cL 1aW5/*.-'$ry?^* Il 00-& nod* 5$ 5$ 5$ 4$ ? 3$ 10$ 15$ lo ilo . nodo nodo /*i 7(7 rio cu Hil Fila a Ka:>3L*. F |.7 Kac-12 ilio 2nd to . -- ^ _ p-2i?;o 4 * PhleK^ X-o%.ct= Trssn*- Chry bo^ Ct'.f;r 10^1 tn Oua^ts jrd.fetf Calcita =j S 4 2 _ yC.sv.vr-t;r.O l,..., 35 ' 92$ )6 9 1 $ 3$ 3$ 1$ 2$ 1$ . 3$ 2$ a0 0.0 2$ Rodo Red. Ho d 0 h 0d 0 Rodo 37 87/9 5$ 2$ Rodo 6$ Ha (o Rodo Ho d 0 38 8S,$ 10$ 19 74/9 15$ 1.0 99$ nd0 2$ 2$ 3$ 3$ 1$ * Rodo 3$ z Rodo Ho ci Ho (o ilaCq 2$ 2$ Rodo Rodo ? Ho Kaol.ln 1% 42$ 12 -ca<>60$ --- ----- 40$ nodo 2$ n 0do Rodo 4$ 15$ Rodo Ho Co 10$ 1$ Ho (io Hodo Il0d 0 SalloyJ kof'Bm 3 7 5 $ ^ 15$ ti*do 3$ 7$ Ho d.o Rodo iodo 14 - ""53$ 40$ Rodo 3$ '4 $ Rodo Rodo ilodo 15 5 3 $ 40$ nodo 3$ 4$ nodo n 9do Rodo L6 53$ 40$ tip(io 3 $ 4$ Rode Rodo Rodo 17 . 42$ 35$ Rodo 15$ 4$ 2$ Rodo ? 18 53$ f.9 49$ 4o$ 40$ Rodo ilo(io 3$ 6$ 4$ Rodo5$ Rodo n Bdo .do Rodo Ho d 0 20 .:..4 6 $ ... 40$ ilodO 8$ 4$ nodo Rodo ? co >*d->\ 21 22 56$ 23 51 $ 8$ 35$ 40$ 2$ ttecL n Pd t ilodo 5$ 3$ 3$ . 4$ 4$ Rodo Rode Rodo n<sdo Ho Co tipla Rodo ? ? 24 54$ 40$ Rodo 3$ 3$ Rodo Rodo ? 25 . 55$ 40$ riodo 2$ 3$ Rodo Rdo ? 26 75$ 27 . 85$ 28 . . 60$ 29 97$ 30 c.&c88$ 3 c-a ^92 3S 95$ T>*3 -O 94$ 34 93$ 35 . 93$ 10$ nodo n<>dQ Hotlp 7$ 3$ &<r7 ocX r 2$ . r\ H q Q-Cr H -d 0" Rodo Zioe *>/* 2$ 4$ 2$ 3$ 4$ 4$ Ho Cq Ho d 0 2$ Rodo Rodo Rodo Rode, Rodo 8$ Ho Co Ho do Rodo Ho d 710d.o 3$ - 3$ - 2$ Rodo H<>(i0 H c>(0 Rodo Ho Cie ilod 0 ' Rodo 2$ Rodo 2$ Rodo Ho (io Rodo Ha Co Ho d 0 trace-: trace: Rod Rido lQCi H b.do iloio ZI0CX0 Rodo Rodo trae. n cd, R od 0 H 0cl0 27,o0.0 Rodo Boriti l Oe.0ndc< 36 69$ 37 0* 4. y~r>< r-f-/ 39 NvrsirJ.,f,P,"C-r! 30 Cete85$ 4$ ];$ i/--r\i-,r* 10 e* nodo 3$ n^cU 'tv7';/^" H 0C0 X 0 cie 2$ 2$ Rodo Rdo 3$ 2$ Redo Redo 2$ 8$ t ed .-. n 0cl6 2$ . XIe*0.0 Rodo . Rodo Oc5 .fii rri Roda Ri,d0 Rod,Rodo ru d 0 Rodo Rod0 r' l-:r-.>....:>\ 2 ;r> -:  rjnpj Ta). o vhleir.iti5 F,,hl7o)g3i1v paga 5 Ocarte 1)04.0--= p Calcito _Troaml l-t--o _CfchlitloGsLo..-* Other 41 oO$> HgCio H(Xc* 20 42 79$ 43 55$ i'4 ca*70 $ 7$ 0 100 50 40 Rodo 30 Ho0 - 60 '4--5 ,, va*70$ --- ' 30 nod0 46 g&o850 ^Jtw d* rudo 4 7 . rio0 n0do 4G ca,450 400 n0do 49 GQ-oSO/J 100 . H-o0 50 oO$ 20 liodo 51 ' 30 250 n,,d0 52 eao7O0 20 Hqci nod 40 nodB Hoci* 100 50 20 n edo 53 0&08G$ 20 nodo nodo 10 Rodo 50 HoCo 250 nodo Rodo Rodo 30 n0d,, Redo H-oCi0 HoCo Rodo 50 100 50 7 Rodo 20 Rodo 50 Rodo. Rod Hodo 80 .no5d$o Rodo HoCo 20 Rodo 120 nodo 80 Rodo 50 Rodo Rodo 100 Rod Rodo n0do Hoci TipCo . HoCo Rodo nodo Rodo Ho0 Rodo 2'Syf'OoOhcv"\r K2naSol;loion.x KfZnnaOSotolianr, GnSfcaar Kaolin ZnStaar Kaolin Kaolin ....irtoaphy ZrA, Bi aoj: 54 08*70$ 55 a G4/i .56 79$ .57 630 58 . 780 59 ' eao740 .60 ' 600 .61 . 59$ 62 5>C$ 63 55$ .64 92$ 65 9$ 66 St.300 6dS?< 760 CO 69 70 .71 52$ 700 430 100 100 100 20 70 100 250 250 250 20 30 50 400 . 100 es> Het\Ac> 100 500 4^ riodo Rodo ToCo IdcL 20 riDcio nodo ru^o nodo 20 n tldo Rodo H(tClg nodo .od nodo 40 20 Rod 20 Rodo 40 20 Rodo HoCo ? 60 30 . ' bod 0 . 20 Rodo 30 180 Rodo 60 80 30 .20 100 nod Rodo fiodo 40 100 Roda ? Rodo 40 100 Rdd, trace 20 40 . 100 Rodo Hoo 3rdf'k//fo*jf ' 50 . 200 100 Rod* Rodo Rodo 100 100 n4d0 20 Hociu 16cig * 10 Ho(io 20 n0do Rod ? 20 80 Hati0 , Rodo ? . Rodo 120 L-Co .2 0 HoCig t3 d'j&'i *=> ea oO0 .CSV.? t=t 50 250 H0ci0 Rodo 80 50 - 150 n0do li 0(i0 .HoCi0 Rodo 50 nodo 20 Rodo HnO ,l ' mrolc 0)a'lct-nt, ChlarXtoQ i a . > i ,a.n,% T .TfT.-tn f.r '5 ca 86? 322 7'6 ca.7894,^f2 322 1022 r8 ca 5022 2022 '9 97/2 nod JO 8022 loCtp i J2 ecaa,,o74002222 n25o2d2o $3 ca076/2 1022 65 ca9530^/22 822222 36 . oa050/2 522 720 . 70/2.aa.o8522 522 1522 9 7222 1222 ? ca 8222 2J2 il 96/2 222 ?2 10022 Hod ?3 .ea93/2 222 ?4 ' ca9^/2 222 ?5 97/2 n 0do paga o P hloge '_ >o 2*= n c d 0 1022 ro-o u22$2 15/2 n odo 222 n od 0 ro 522 422 TCjO 322 Ho d li 6d 0 lodo 1222 n o d o n d o rio ci 1522 n 0d o nodo n 0d< n 0do 222 He do 222 n o d 0 ndo nodo ndo nd. nodo Uo do n o d 0 222 iio d 2?2 322 4?2 n d o 322 222 222 n 0d D 322 Ho do ...........i$ d o .... ........ 222 n 0do io Clp n o d o n o d o 222 22? nodo Hodo 3 # n d D n.od0 322 Trc-'OR Calcito ^ o ldfca nodo nodo nneddo ndo nado nod0 ndo nodo ndo xiodo 1022 Hriot dpCip nodo nodo 10/2 ndo 322 25/2 Hodp 2522 Hodo 522 222 5/2. 122 522 nod ndo nodo... ...ned nodo ndo n0do nado 352 n0d^ Tiadp ibdo hfei/l;l/o30''. OStrtae?cla ?' ? H?0d0 Kaolin n0d n edo nc-do Kaolin ? 2n0 7 ndo ldo 2n07 ZnO nd ? nodtl 7 rioop. n 0do 7 festaa 7 ilo do The Cosmetic, Toiletry and Fragrance Association, Inc. 1625 E Y E STR EET, N.W , WASHINGTON, D. C. 20006 202/393-2070 Mr. C.u. D r is c o ll President Whittaker, C la r k & Daniels, Inc. 1000 C o i n a g e Street South P l a i n f i e l d , New Jersey 07080 James H. Merritt President Norman F. Estrin, Ph.D. Wee P resid en t-- S c ie n c e The FDA, Mr. Driscoll -- -- has informed us that they are about to publish limits for as bestos in foods and will utilize an optical microscopy method for the determination. Their problem is that the Bureau of Foods has been considering an X-ray diffraction method for cosmetic analysis of asbestos that has a sensitivity of one to two percent, as opposed to the claimed sensitivity microscopic method of 0.001 to 0.1 percent. FDA does not feel it can publish two different methods of dif fering sensitivities and has asked our cooperation in testing their optical method. FDA proposes that cosmetic manufacturers test and submit coded data.for various cosmetic grade.t a l c s , so that they.can check... on the validity of the method and get a feel for the type of results which can be expected. I have attached a copy of the method for your review and a copy of a letter from Heinz J. Eiermann (FDA) requesting assistance from the Cosmetic Industry. If you would like to participate by testing talcs, please drop a note to me or to Mr. George Sandland (Bristol-Myers) who is chairing a subcommittee which will test this and other methods. Thank you for your cooperation. No r man F. Estrin, Ph.D. Vice President - Science N F E :jj September 13th, 1973 Attachments - 2 .cl ., D EPA RTM EN T O F H EA LTH . EDUCATION. AND W ELFA R E PUBLIC H EALTH S ER V IC E FO OD AND D R U G A D M IN ISTR A TIO N W A SH IN G TO N . D.C. 20204 September 5, 1973 Norman F. Estrin, Ph.D. Vice President, Science Cosmetic, Toiletry & Fragrance Assoc. 1625 Eye Street, N.W. Washington, D.C. 20006 Dear Norman: This will confirm the discussion Dr. Schaffner, Mr, Wenninger and I had with you last Friday, August 31, 1973, concerning methods of determination of asbestos in cosmetic talc products. There is considerable controversy among investigators with regard to the accurate determination of asbestos at concentrations of less than 2 percent. Apparently, conventional methods employing x~ray diffraction or differential thermal analysis are not sufficiently reliable to produce quantitative results of the desired precision. The Food and Drug Administration,-.therefore, has been.exploring...... refractory optical microscopy as a means of measuring asbestos in talc"! A copy of this method was handed to you on Friday, You were urged to contact the scientific experts in the cosmetic industry and have them analyze samples of cosmetic talcs by this method. The results of their findings and their comments on this analytical procedure should greatly assist FDA in the assessment of the asbestos problem. . The second request submitted to you concerned a statistical measure ment of the amount of airborne talc that might be inhaled by an infant per day under average conditions of use of a baby talc product. This information, should be helpful in estimating the potential exposure of a child to asbestos. The data provided by industry will supplement the efforts initiated by FDA in this matter and hopefully resolve the asbestos question in a scientifically sound manner. h e iu K J, Eiermaun, Acting D i r e c t o r Division of Cosmetics T e c h n o lo g y Office of Technology W. K. Abbott IC I Americas Inc. Wilmington, DE Gary Abend Quad Chemical Corp. Long Beach, CA Mark Abramson Felton International, Inc. Brooklyn, NY H. T. Afghani N u trilite Products, Inc. Buena Park, CA James Agard Estee Lauder, Inc. Hauppauge, NY Gary Agi sin J . B. W illiam s Cranford, NJ W illiam Ainsworth Pro p rietary Perfumes, Ltd. Maywood, NJ James Akerson Clairol Inc. Stamford, CT Larry Alania A lberto -Cu lver Company Melrose Park, IL Everett Alexander Private Label Cosmetics, Inc. F a ir Lawn, NJ Dr. Robert G. Allen Personal Products Mi 11 town, NJ Jean Allured Cosmetics & T o ile trie s Wheaton, IL Stanley E. Allured Cosmtics and T o ile t r ie s Wheaton, IL Richard J . Alonso B r is t o l Myers Products H ills id e , NJ George A!perin C la iro l, Inc. Stamford, CT Lee J. A lter Vivion Chemical Company Vernon, CA ANNUAL SCIENTIFIC MEETING THE WALDORF-ASTORIA NEW YORK, N. Y. NOVEMBER 30 - DECEMBER 1, 1978 ADVANCE REGISTRATION AS OF NOVEMBER 20, 1978 Ira Altman Alcolac, Inc. Baltim ore, MD James H. Baker ; Gar-Baker Laboratories, I New York, NY W. D. A lvin Vanda Beauty Counselor Orlando, FL Anthony P. Balchius Shaw Mudge & Co. Stamford, CT Edith L. Ambye The G ille t t e Company Boston, MA E li Balensuela Synfleur Monti cel lo , NY June M. Amlra Naarden In tern atio n al New York, NY . Fran Balensuela Synfleur M onticello, NY Dr. David Anderson Roure Bertrand Dupont, In c. Teaneck, NJ Manny Ball Protameen Chemicals, Inc. Totowa, NJ Robert A. Angulllo COTY, Div. o f P f iz e r , Inc. Parsippany, NJ William Ball COTY, D ivision of P fize r / Parsippany, NJ Leonard Appelle Chem-Pac, In c. Chicago, ILL Frederick A. Bamert D. H. L it t e r C o ., Inc. New York, NY Berdge Aprahamian Bush Boake Allen In c . Norwood, NJ Andrew P. Banham Croda, In c. New York, NY Mike Archer Mary Kay Cosmetics, Inc. D a lla s, TX Marie . Ardita The G ille t t e Co.-Personal Care Div. Boston, MA Joseph T. Bannan I . F. & F. New York, NY Martin J . Barabash Witco Chemical Corp. Oakland, NJ Eve G. Aron Combe In c. White P la in s , NY Allan S. Bardos Block Drug Co. Jersey C it y , NJ Richard C. Artale Avon Products, In c. S u ffern , NY Graham Barker Witco Chemical Corp. Oakland, NJ Donald L. Ayerlee, J r . Frank B. Ross C o ., Inc. Jersey C it y , NJ. Dr. Myra Barker Mary Kay Cosmetics, Inc. D a lla s, TX Y. Ayyadurai The Mennen Co. Morristown, NJ William B. B a rlic s Monsanto Flavor/Essence Montvale, NJ Lanny D, Babbitt The Quaker Oats Company Chicago, ILL Gabriel Barnett Helena Rubenstein, Inc. Greenvale, NY Howard Baker Bart Bartelsman Beecham Products, Western Hemisphere Research New England Nuclear Corp. Parsippany, NJ Westwood, MA -3- David B. Bunkin A lbert Verley & Co. South P la in f ie ld , NJ Fred Burmeister Estee Lauder, Inc. Hauppauge, NY Colin K. Burton S. C. Johnson & Son, Inc. Racine, WI Louis J. Burris /'Syntex Research Palo A lto , CA Frank Busch Chesebrough-Pond's, Inc. Trumbull, CT Betty M. Busse Creations Aromatiques, In c. Parsippany, NJ Claudia Butler Dragoco, Inc. Totowa, NJ . ^Robert B. Butler / Noxell Corporation / Baltim ore, MD ' Lyle E. Cady, Jr. The J. B, W illiams C o., Inc. Cranford, NJ Theresa Callahan Lehn & Fink Products Co. Montvale, NJ ' A. V. Calogero s Wickhen Products, Inc. / Huguenot, NY Lu is Calvo Germaine Monteil Cosmtiques Corp. Deer Park, NY Dr. David W. Cannell Redken Laboratores, Inc. Canoga Park, CA Anthony P. Cannone Lau tier aromatiques, Inc. A llen d ale, NJ Jo-Ann Cara A lbert Verley & Co. South P la in f ie ld , NJ Lois Carl sen Drom C o ., U.S.A. F a ir f ie ld , NJ Bernard C. Carlson R. T. Vanderbilt Co. Norwalk, CT F. Newton Carpenter Firmenich Incorporated Princeton, NJ . Hamilton Carson HAPPI Ramsay, NJ Robert Carola Norda, Inc. East Hanover, NJ Richard T. Carraher Lau tier aromatiques A llen d a le, NJ T. E. Carroll ^ Chesebrough-Pond's, Inc. S Trumbull, CT Dr. Steven Carson Toxicon A sso c., Inc. Brooklyn, NY P h y llis J. Carter ICI Americas, Inc. Wilmington, DE Thomas C arter Clairol Inc. Stamford, CT D. R. C asier Sterling-Winthrop Research In st. R ensselaer, NY Josephine Catapano I . F. & F. New York, NY Ursula Caterbone C la iro l Inc.. Stamford, CT Dennis C avaleri American Cyanamid Company C lifto n , NJ Dr. John A. C ella Elizabeth Arden, Inc. In d ian a p o lis, IN Hank Cenicola American Cyanamid Company C lift o n , NJ Dr. R. N. Chadha ' Carroll Products, Inc. Wood River Junction, RI Chun Keung Chan Chromex Chemical Corp. Brooklyn, NY Irv in g B. Chang A llie d Chemical Corp. Morristown, NJ Susie Chang Bush Boake A llen Inc. Norwood, NJ Joseph Chao Redken Lab o rato ries, Inc. Van Nuys, CA W illie R. Chapman Chattem, Inc. Chattanooga, TN James L. Chen , E. R. Squibb & Co. New Brunswick, NJ Eugene Chernows.ky Redken Lab o rato ries, Inc. / Canoga Park, CA V ija y Chheda Neutrogena Corp. Los Angeles, CA M. L. Chisholm Givaudan Corporation C lift o n , NJ Arvid Christiansen Mirano! Chemical Company Irving to n, NJ Ed H. Christensen The Quaker Oats Company Chicago, IL Dr. Michael S. Christensen Vick D ivisio n s R. & D. Mt. Vernon, NY Ho-Ming Chun LaMaur Inc. Minneapolis, MN Ken Chung Helena Rubenstein, Inc. Greenvale, NY Mario C ian ciab ella Cosmair, Inc. C la rk , NJ Frank V. C le ri Firmenich Incorporated Princeton, NJ Anthony J. Cimo Quad Chemical Corp. Long Beach, CA , Peter A. C iu llo R. T. Vanderbilt Co. Norwalk, CT Lois Anne Clapp Estee Lauder, Inc. New York, NY Dr. George S. Clark Haarmann & Reimer Corp. S p rin g fie ld , NJ Jack Close Malmstrom Chemical Linden, NJ Aaron Cohen ^Whittaker, Clark & D an iels, Inc South P la in f ie ld , NJ ^ Sam Cohen Lipo Chemicals, Inc. Paterson, NJ Mary E. C o llie r The G ille t t e Co. South Weymouth, MA Gerald M. Compeau Carter-Wallace Inc. Cranbury, NJ Frank Duneczky N.L. Ind u stries, Inc. Hightstown, NJ John Dworak Alberto-Cul ver Melrose Park, IL E rita Dzilna Lehn & Fink Products Co. Montvale, NJ Carl M, Eastman Mona In d u strie s, Inc. Paterson, NJ John Ebert A .T .I., Inc. Totowa, NJ Herb Edelstein House of Westmore (Syntex, In c .) Newburgh, NY Walter W. Edman Zotos In te rn a tio n a l, Inc. Darien, CT Robert Edmundson Kolmar Labo rato ries, Inc. Port J e r v is , NY John J. Egan PFW, Inc. Middletown, NY Anton C. Eggert The J. B. W illiam s Co., Inc. Cranford, NJ Lambertus H. Ekkart Lever Brothers Edgewater, NJ Robert E lia s E lia s Fragrances, Inc. Brooklyn, NY Barry Ellegant Summit Labs Chicago, IL Vincent E ll i s Felton International, Inc. Brooklyn, NY Stanley H. Elman Lonza, Inc. F a ir Lawn, NJ S te ele El mi Finetex Inc. Elmwood Park, NJ Dr. Wally Elv e rs Bristol-M yers Company New York, NY Thomas Eng Abbott Laboratories Chicago, IL Francis Erskine Zotos In te rn a tio n a l, In c. Darien, CT -5- Michael Eskalyo Takasago USA, In c. Long Islan d C ity , NY Anthony J . Esposito Drom C o ., U.S.A. F a ir f ie ld , NJ Fred Esser Protameen Chemicals, Inc. Totowa, NJ Evelyn Evans Clairol Inc. Stamford, CT Najib M. Fakhouri Palo A lto , CA Lawrence Frber Georgette Klinger, Inc. New York, NY Raymond Feinland Clairol Inc. Stamford, CT Howard Feinman Food & Drug Research L ab s., Inc. East Orange, NJ William Feinstein Whitehall International New York, NY Stu art I . Feldman L a u tie r aromatiques A llen d a le, NJ Dr. C arl B. Feig er G ille tte Research In stitu te R o ck v ille , MD Martina Fernandez Clairol Inc. Stamford, CT Sara Fernandez P fiz e r Consumer Products P a rsippany, NJ Kathleen M. Fernee Colgate-Palm olive Co. Piscataway, NY Joseph J . Ferro P ilo t Chemical Co. Avenel, NJ Terry Ferullo Van Dyk & C o ., Inc. B e l l e v i ll e , NJ Dr. August E. F ie b ig , J r . Alberto Culver Co. Melrose Park, IL J . George Fie d le r Strand Cosmetics Europe S.A. Lyons, FRANCE Tina Finkelstein Faberge, Inc. R id g efield , NJ Andrew W. Fin k stein The G ille t t e C o ., Personal Care Div. Boston, MA Alexander V. Finn Miranol Chemical Co., Inc. Irv in g to n , NJ Michael P. Finnen Lau tier aromatiques A llen d ale, NO George A. Fioto Noxell Corporation Baltim ore, MD Harvey Fishman Nestle Lemur Co, Bronx, NY Judy Fishman Product Marketing Magazine New York, NY Martin Flacks Lehn & Fink Products Co. Montvale, NJ Dr. Albert M. Fleisch ner Amerchol Corporation Edison, NJ Raymond J . F lin t de L a ir e , In c. New York, NY David T. Floyd NL In d u strie s, Inc. Hightstown, NJ Douglas M. Flynn Firmenich Incorporated Princeton, NO ' R. Foster Givaudan Corporation C lift o n , NJ Charles Fox Warner-Lambert Co. Morris P la in s , NJ Kishor Fozdar N.L. Industries Bayonne, NJ James R. France C. J. Patterson Company Kansas C ity , MO Samuel Franco J.B . Williams Co., Inc. Cranford, NJ Joy Frank Consumer Product Testing Co., Inc. F a ir f ie ld , NJ Carol G. F ra z ie r Johnson & Johnson Baby Products Company Piscataway, NJ Gertrude Freeze Fritzsch e Dodge & O lcott Inc. New York, NY - 7- Stuart P. Hanckel Compagnie Parente* Inc. S citu a te , HA Kenneth R. Hansen Colgate-Palm olive Co. Piscataway, NJ Lionel L. Hantman The G ille t t e C o ., Personal Care Div. Boston, HA Theodore A. Harden Norda, Inc. East Hanover, NJ John W. H arris Elias Fragrances, Inc. Brooklyn, NY Thomas C. H arris H arris Chemical Co. Inc. Paterson, NJ J . Roger Hart W.R. Grace & Co.-Organic Chemicals Div. Nashua, NH Peter Haugk American Cyanamid Company C lift o n , NJ Stephanie Haugk B ris to l Myers Products H ills id e , NJ Geoffrey R. Hawkins.......... Neutrogena Dermatologies Los Angeles, CA Robert J . Hecking Naarden Internatio nal USA, In c. New York, NY Herbert Heinrich Ridgewood, NJ Dr. Thomas Helcke Croda Food Ingredient Group Ltd. W itness, Cheshire, UK ' Michael W. H e lio ff Block Drug Co. Jersey C it y , NJ Mark A. H e llrie g e l Haarmann & Reimer Corp. S p rin g fie ld , NJ N icola Helwig Aromatics In ternatio nal, In c. M arietta, GA Gary H. Henderson Avon Products In c. Su ffern, NY Dr. Hyman Henkin Helene C u rtis In d u strie s, In c. Chicago, IL . M. Henry Bristol-M yers Products H ills id e , NJ Paul E. H e rrle tt C. J . Patterson Company Kansas C it y , MO Ju stin Herman Cosmetic Development A sso ciates, Inc. Norwalk, CT Stephen J . Herman P. Robertet, Inc. Oakland, NJ Dr. James Herrera The Mella Corporation Englewood, NJ Dr. Joel Hertz Whitehall Laboratories New York, NY P.A. Herzog A llie d Chemical Morristown, NJ Stan Heuer Florasynth Inc. New York, NY Bob Higgins Dragoco, In c. Totowa, NJ Dr. Gavin H ildick-Sm ith Johnson & Johnson New Brunswick, NJ Robert J . H ille rm e ie r... Chapstick Co. Lynchburg, VA Warren J . Hintz Carter-W allace, Inc. Cranbury, NJ Michael Hnatchenko Clairol Inc. Stamford, CT Stephen G. Hoch lingerer & Company New York, NY Barbara 0. Hodges Iodent Co. Elizabethton, TN Robert L . Hoen Henkel, Inc. Fort Lee, NJ Joseph Hoffman Clairol Inc. Stamford, CT Ed Holub Clairol Inc. Stamford, CT Paul Hores Chesebrough-Pond's, Inc. Trumbull, CT Zoltn Horvath Clairol Inc. Stamford, CT Melvin Hoyt Lonza, Inc. F a ir Lawn, NJ . Fred N. Hubner B risto l Myers Products H ills id e , NJ Martha L. Huff Bonat, Inc. West Paterson, NJ W illiam T. Humphries Johnson & Johnson New Brunswick, NJ Dr. Lee Hunter American Cyanamid Co. C lift o n , NJ Tony Hunting Malmstrom Chemical Linden, NJ V ic to ria Huseman Procter & Gamble C in c in n a ti, OH F. E. Hutchins R. T. Vanderbilt Company, Inc Norwalk, CT Gene A. Hyde 01 in Corporation New Haven, CT Dr. Bernard Idson .....Hoffmann-La Roche..Inc. ............. Nutley, NJ Mary C h ris In g lis American Cyanamid Co. C lift o n , NJ Sigmund Iscow itz Clairol Inc. Stamford, CT Harold R. Jackson Vidal Sassoon, Inc. Los Angeles, CA Dr. Paul T. Jacobs Arbrook, Inc. A rlin g to n , TX Joseph T. Jakiela Chesebrough-Pond's, Inc. Trumbull, CT Charles D. Janczewski Amerchol Corporation Edison, NJ Larry Janosky Drom C o ., U.S.A. F a ir f ie ld , NJ Dr. Joseph B. Jerome American Medical Assn. Chicago, IL Thomas Joannou Chanel, Inc. Piscataway, NJ Paul L. Kohnstamm H. Kohnstamm & Co., New York, NY Inc. Arpad Kolozsvary Chesebrough-Pond's, In c. Trumbull, CT ' R. P. Koos Emlin, Inc. Kenosha, WI Bert Kopf C la iro l, Inc. Stamford, CT George Korkis American Cyanamid Company C lif t o n , NJ' Agnes Korte Alpine Aromatics Internatio nal,- Inc. Metuchen, NJ - Joseph H. Kratochvil Creations Aromatiques, In c. Parsippany, NO David Krawitz Helena Rubenstein, Inc. Greenvale, NY Kevin J . Krivacsy Beecham Products Parsippany, NJ David A. Krdchock A1 berto- Culver.Company.............. ............... Melrose Park, IL Isadore Kuchinsky The N estle Lemur Co. New York, NY Thomas Kugeman B .F . Goodrich Chemical West Redding, CT P h ilip Kwong The Richardson Company Paterson, NJ Dennis Laba Block Drug Co. Jersey C it y , NJ Steve LaBruto Malmstrom Chemical Linden, NJ Dr. Karl Laden C arter Products Research Cranbury, NJ Robert Laggan Robinson Wagner Co. Inc. Mamaroneck, NY Sidney Lampson PFW, Inc. Schaumburg, IL . A. Lancz Colgate-Palm olive Co. P isca ta w a y ,.N J . -9- Dr. Leo M. Landoll Hercules, Inc. Wilmington, DE J u lia Lanigan American Cyanamid Co. C lift o n , NJ Monroe Lanzet Chanel, Inc. Greenbrook, NJ Corri e C. Laput PFW Tnr Middletown, NY Michael K. LaRue Mary Kay Cosmetics D a lla s, TX Joseph Laryea Malmstrom Chemical Linden, NJ Walter Lauer Lingerer & Company New York, NY Joseph G. LaVerdi Chapstick Co. Lynchburg, VA P a t r ic ia L . Lavman Chemical Week New York, NY -.J a c k Lawrence Malmstrom Chemical Linden, NJ Walter H. Leahy Shaki ee Corporation Dublin, CA Anthony Leardi PFW, Inc. Middletown, NY V a le rie A. Leavers Procter & Gamble C in c in n a ti, OH Dennis Lee Wickhen Products, Inc. Huguenot, NY Jae S. Lee P a c if ic Chemical of America, Inc. New York, NY Wilson Lee The Pantene Co. Div. of Hoffmann-LaRoche Inc. Nutley, NJ June LeLong Beddington Associates New York, NY Richard N. Lenham Noxell Corporation Baltim ore, Md. Edwin W. Leonard Leonard, Inc. A s h e v ille , NC Amos Lerner Chanel, Inc. . Piscataway, NJ Kenneth Lesenko Roure Bertrand Dupont, In c. Teaneck, NJ Dr. Irving Levenstein Leberco Laboratories Roselle Park, NJ Herbert M. Levetown Van Dyk & C o ., In c. B e lle v ille , NJ Samuel S. Levine Joseph H. Lowenstein & Sons, Inc. Brooklyn, NY Steven R. Levine Joseph H. Lowenstein & Sons, In c. Brooklyn, NY Adele F. Levy Avon Products, Inc. Su ffern, NY Dr. E. F. Levy Block Drug Co. Jersey C ity , NJ Sheldon Levy Estee Lauder, Inc. Hauppauge, NY H. Liebe....................................................... American Hoechst Corp. Som erville, NJ Dr. T. Joseph Lin Consultant P a c if ic P a lisa d es, CA Je rry Lindauer I . F. & F. New York, NY Dr. Martin K. 0. Lindemann Johnson & Johnson Baby Products Co. R aritan , NJ Garry Linstra Charles of the R itz Group Holmdel, NJ Chem J. L istn e r Charles H. Kline & C o ., Inc. F a ir f ie ld , NJ Dr. John E. Logun Brooklyn, NY Richard Loniewski Charles of the R itz Group Holmdel, NJ Nelson P. Loucks Firmenich Incorporated Princeton, NJ Stephen J. Lowenstein Lowenstein Dyes & Cosmetics, Inc. Brooklyn, NY Dr. E. C. Moore Hair Research Laboratories, Inc. Selma, AL Marius R. Moran Block Drug C o ., Ine. Jersey C ity , NJ Lee Mores Malmstrom Chemical Linden, NJ Charles A. M orris Naarden Intern a tio n a l USA, Ine. New York, NY Michael Mosquera Synfleur M onticello, NY Guy D. Moulton Alcolac, Ine. Baltim ore, MD Dino G. Muccia P fiz e r Consumer Products Parsippany, NJ Shaw Mudge, J r . Shaw Mudge 6 Co. Stamford, CT Shaw Mudge, S r. ... Shaw Mudge & Co................................... Stamford, CT W illiam H. M ueller S. C. Johnson & Son, Inc. Racine, WI Dr. Heinz P. Muenzing Drom C o., U.S.A. F a ir f ie ld , NJ V ik to ria Muha Amerchol Corporation Edison, NJ P a tr ic ia Mullen Naarden Intern a tio n a l USA, Inc. New York, NY Mari na Munteanu I . F. 8, F. New York, NY ' John Murphy Kolmar Lab o ra to ries, Inc. Port J e r v is , NY Lawrence F. Murphy C. J. Patterson Company Kansas C it y , MO E l l i o t H. Myers Penreco B u tle r, PA James R. McAfee Norda, Inc. East Hanover, NJ J. Jay McAndrews Mona In d u strie s, Inc. Paterson, NJ -n- Cornell McBride M & M Products Co. Forest Park, GA Ju stin McCarthy Malmstrom Chemical Linden, NJ N. 0. McCarthy Procter & Gamble Co. C in c in n a ti, OH Connie McComb Chesebrough-Pond's, Inc. Trumbull, CT Vincent McCluskey Charles of the R itz Group Holmdel, NJ John J . McCormack Johnson & Johnson Baby Products Co. New Brunswick, NJ Robert A. McEwan Firmenich Incorporated Princeton, NJ Lynn T. McGee Chattem, In c. Chattanooga, TN John T. McGlynn The Mennen Co. Morristown, NJ Dr. E l i McKenzie M & M Products Co. Forest Park, GA Edward C. McKeown Costec, Inc. Palatine, IL Joan McNichlas Estee Lauder, Inc. Hauppauge, NY Douglas W. Nabholz M allinckrodt Inc. S t. L o u is, MO Dr. Ju le s Nachtigal Conair Corporation Edison, NJ Dr. Jack B. Nagler Stamford, CT Mike Naima Sandoz, Inc. East Hanover, NJ Randolph Nakamura Advance Design Laboratories Los Angeles, CA Sayer Needelman Van Dyk & Co. B e l l e v i ll e , NJ Anne J . N eil son . Arthur D. L i t t l e , Inc. Cambridge, MA E l l i o t Nelson American Cyanamid Company C lif t o n , NJ V irg in ia Ner Chesebrough-Pond's, Inc. Trumbull, CT Ara Nersesian B ris to l Myers Products H ills id e , NJ W illiam Netzbandt Dumont, NJ Dr. John J . O 'N eill Avon Products, Inc. Su ffern , NY Kurt F. Neulinger Croda, Inc. New York, NY W illiam Neumann Posner Labs In c. South P la in f ie ld , NJ Terence E. New Norda, Inc. E ast Hanover, NJ Glenn Newman Croda Carson, Inc. New York, NY ............. .............. Joseph A. Newman Mennen Co. Morristown, NJ A. Edward Newsom Redken Labo rato ries, Inc. Van Nuys, CA Daniel N icolai S tie fe l Research In stitu te Oak H i l l , NY D. J . Nikles IC I Americas Inc. Wilmington, DE Richard C. Norgard Consumer Products, Div. of P fiz e r Parsippany, NJ Betty Oberstar B ristol-M yers Company I n t ' l . Div. Walton, CT Judy O'Bryant The Barcolene Company Holbrook, MA Ralph R. R. Oduor The G i11e tte Company Boston, MA Harold F. O'Keefe Arthur A. Checchi, Inc. Washington, DC Robert A. Olsen Creations Aromatiques, Inc. Parsippany, NJ Dr. Ganesan Ramani Johnson & Johnson Limited Montreal, CANADA Edwin C. Ramsey Shaw Mudge & Co. Stamford, CT V icto r A. Raul Miles Laboratories, Inc. E lk h a rt, IN Maurice R. Raviol PFW, Inc. Middletown, NY Robert L. Raymond Firmenich Incorporated Princeton, NJ Robert T. Reardon Takasago USA, Inc. Long Islan d C it y , NY Jh eri Redding Jhirmack En terp rises, Inc. Redding, CA Dr. George Red! Westwood Pharm aceuticals, Inc. B u ffalo , NY N. P h ilip Redmond Noxell Corporation Baltim ore, MD Ray Reed C arefree, AZ Dr. Henry E. Reich Ashland Chemical Company Columbus, OH Sharon Reich I . F . & F. New York, NY David T. Remes Naarden International USA, Inc. New York, NY Dr. Arthur G. Rich Avon Products, Inc. Suffern, NY Dr, Martin M. Rieger Warner-Lambert Co. Morris P la in s , NJ Ralph Rivero F ritz sch e Dodge & O lco tt Inc. New York, NY Dr. C. R. Robbins Colgate-Palm olive Co. Piscataway, NJ Richard Roberts Chesebrough-Pond's, Inc. Trumbull, CT Paul R. Robinson In d u strial Hydrocarbons, In c. San Dimas, CA - 13 - Frederick R. Roesch Whittaker, Clark & Daniels, Inc. South P la in f ie ld , NJ Jack M. Rogers Avon Products, Inc. Suffern, NY George G. R o lle r Sugar Beet Products Co. Saginaw, MI Susan R o se lii American Cyanamid Company C lift o n , NJ Dr. Ira E. Rosenberg C la iro l, Inc. Stamford, CT Mark Rosenberger American Cyanamid Company C lifto n , NJ Joseph Rosenstreich Estee lauder, Inc. Hauppauge, NY Maurice L. Rosenthal Robeco Chemicals, Inc. New York, NY Lloyd Ross Colgate-Palm olive Co. Piscataway, NJ Suva B. Roy Massachusetts College of Pharmacy Boston, MA Abraham Rubin Orentreich Medical Group New York, NY Arnold Rubinstein Zotos In te rn a tio n a l, Inc. Darien, CT Robert G. Rufe Hercules, Inc. Wilmington, DE Kenneth L. Rugg I . F. & F. New York, NY Marion I . Rum The G ille t t e Co. - Personal Care Div, Boston, MA Ju lio Russ Maybelline, Inc. Memphis, TN Evelyn Russell The G ille t t e Company Boston, MA Stanley F. Rutkowski Perry Bros. Woodsi de, NY Dr. Leopold S a frin East Orange, NJ P a t r ic ia Sagurton American Cyanamid Company C lift o n , NJ E rlin d a Sahagun Estee Lauder, Inc. Hauppauge, NY Barry A. Salka Lonza, Inc. Fai r Lawn, NJ Pola Salzman Paramount Cosmetic Sales Corp./ Hudson Cosmetic Mfg. Corp. Union C it y , NJ Richard A. Sambattaro P ilo t Laboratories, Inc. Avene!, NJ W illiam Samora Avon Products, In c. Su ffern, NY Dr. Paul A. Sanders In d u stria l Hydrocarbons, Inc. Wilmington, DE Donald R. Sanner Noxell Corporation Baltim ore, MD P h ilip E. Sapienza Reheis Chemical Co. Berkeley f i t s . , NJ............................ Reuven S a rra f Roure Bertrand Dupont, Inc. Teaneck, NJ Christine Sass Cyclo Chemicals Corp. Miami, FL Harry C. Saunders Shaw Mudge & Co. Stamford, CT Lawrence S. Savage Maybelline Inc. Memphis, TN James A. Savastano Lonza, Inc. F a ir Lawn, NJ Neil D. Scan carella Avon Products, In c. Su ffern, NY M. S c a r la t e lli American Hoechst Corp. So m erville, NJ Peter J. Schaeufele Lonza, Inc. F a ir Lawn, NJ Timothy Schaffern Henkel, Inc. Fort Lee, NJ Thomas Schamper American Cyamamid Company C lift o n , NJ David C. Steinberg Hank Steinberg H. Kohnstairm & Co.., Inc. New York, NY John J . Steinke Church & Dwight C o ., In c. Piscataway, NJ Irw in M. Sternberg Miranol Chemical Co., In c. Irvin g to n , NJ Seymour S te tze r Sun Chemical Corp. Woodmere, NY Robert Stonier The Wei la Corporation Englewood, NJ . Carl Steuernagel EMC Corporation P h ilad elp h ia , PA Lore ta A. Stover A lbert Verley & Co. South P la in f ie ld , NJ Jack Strausberg Carter Wallace, Inc. Cranbury, NJ ... Gerald S trick la n d L a u tie r aromatiques A llen d ale, NJ ........ Howard Stromberg Stepan Chemical Company Northbrook, IL Dean T. Su Colgate-Palm olive Co. Piscataway, NJ Joe Suchan Whittaker, Clark & D aniels, Inc. South P la in fie ld , NJ Drew Su je t Malmstrom Chemical Linden, NJ . Dr. P. K. Sundaram Walgreen Labo rato ries, In c. Chicago, IL Joseph J. Sunseri Bonne B e ll, In c. Lakewood, OH Dr. Warren Sunshine American Cyanamid Company C lift o n , NJ Marcel J. Suter Cosmetic World News London, ENGLAND Michael Sweeney Roure Bertrand Dupont, In c. Teaneck, NJ - 15 - Betty Tarnoff R. T. Vanderbilt Co., Inc. Norwalk, CT David J. Taylor Avon Products, Inc. Suffern, NY Norman Tehrani Clairol Inc. Stamford, CT Richard J. Thabit Avon Products, Inc. Su ffern, NY Paul Thau Cosmair, Inc. C la rk , NJ Linda S. Thiele Fritzsch e Dodge & O lcott Inc. New York, NY Janet W. Thompson Bonne B e ll, In c. Lakewood, OH ' Jim Thompson Sandoz Colors & Chemicals E. Hanover, NJ Allison Tindall Chesebrough-Pond1s , In c. Trumbull, CT James Tobin Vick Research & Development Mt. Vernon, NY Richard Tokosh Avon Products, Inc. Su ffern, NY Diana K. Tomaszewicz Timonium, MD B i l l Topken Dragoco, Inc. Totowa, NO Mary E. Torkel son Hercules Inc. Paramus, NJ Irene C. Tornell Creations Aromatiques, Inc. Parsippany, NJ John Tornell Alpine Aromatics In tern atio n al, Inc. Metuchen, NJ Audrey Tracy Avon Products, Inc. Suffern, NY Michael Trama Cosmair, Inc. C la rk , NJ Frank Tranner Chesebrough-Pond's Inc. Trumbull, CT Theodore L. T r e it le r Block Drug C o ., Inc. Jersey C it y , NJ Michael C. Tsoucalas Henkel, Inc. Hoboken, NJ Mary E. Turney Union Carbide Corp. Tarrytown, NY Phil ip Tusa Estee Lauder, Inc. Hauppauge, NY Lynn Uborka Carter-Wallace In c .; Lambert Kay D ivision Cranbury, NO E rica A. Ulbrecht Proprietary Perfumes Ltd. Maywood, NJ Bhupendra R. Vaidya Block Drug Co. Jersey C ity , NJ Andrew Valentine Estee Lauder, Inc. Hauppauge, NY Steve Vanata Monsanto Flavor/Essence, Inc. Montvale, N J.................................. Koert Vander Voort Norda, Inc. East Hanover, NJ Emory Van Dunk Avon Products, Inc. Su ffern, NY John L. Van Haften C. J . Patterson Company Kansas C ity , MO Joseph Vareo Clairol Inc. Stamford, CT ' Christopher Vaughan Private Label Cosmetics, Inc. F a ir Lawn, NJ V icto r G. Vely Scott Paper Company P h ilad elphia, PA Arturo Villam arin American Cyanamid Company C lift o n , NJ James G. Vincent Henkel, Inc. Hoboken, NJ Thomas E. Virtue Roure Bertrand Dupont, In c. Teaneck, NJ B. Vittone Colgate-Palmolive Co. Piscataway, NJ - 16 - John B. V iveri to Mallinckrodt, Inc. S t. Lo u is, MO K. Garretson Voorbees, J r . Lingerer & Company New York, NY Tuan Vu The G ille t t e Co. Boston, MA J u liu s Wagman Helene C u rtis In d u strie s, Ine. Chicago, IL Rosemarie W allisch Luzi er Overland Park, KS Peter Walters American Cyanamid Company C lift o n , NJ Ed Wang American Cyanamid Company C lift o n , NJ Dr. John B. Ward Arnold & Marie Schwartz College of Pharmacy & Health Sciences of Long Islan d U n iv e rsity Brooklyn, NY Tony Warren Beddington A ssociates New York, NY Dr. Sa tish K. Wason 0. M. Huber Corp. Havre de Grace, MD W illiam E. Waxter W.R. Grace & C o ., Davison Chemical Div. Baltim ore, MD Karl Weber Glyco Chemicals Greenwich, CT Dr. Herbert Weinberger Roure Bertrand Dupont, Inc. Teaneck, NJ Morris W einstein Onyx Chemical Company Jersey C it y , NJ Sh irley Weinstein Estee Lauder, Inc. Hauppauge, NY Dr. Sidney W einstein NeuroCommunication Research L ab s., In c. Danbury, CT L e ste r Weintraub J . B. W illiam s C o ., Ine. Cranford, NJ Mel Weiss Consumer Product Testing C o ., Ine. F a ir f ie ld , NJ Susan Wendling Beecham Products Parsippany, NJ Lynn Werner Charles of the R itz Group Holmdel, NJ Jack Westlund Glyco Chemicals, Inc. Greenwich, CT Mort Westman La Maur In c. Minneapolis, MN Dr. J u liu s Wetterhahn Flushing, NY R. Randall Wickett The Procter & Gamble Co. The Miami V a lley Laboratories C in c in n a ti, OH James M. Wilmott B risto l Myers Products H ills id e , NJ Jack Witeczek Clairol Ine. Stamford, CT Richard J . Witkowski Faberge, Inc. R id g efield , NJ B i l l Wohland COTY, D iv isio n o f P fiz e r Parsippany, NJ Nancy F, Wolejsza G ille tte Research In stitu te R o ck v ille , MD Dr. B. Wolf Revlon Research Center, Inc. Bronx, NY Stephen Wolff Roure Bertrand Dupont, Ine. Teaneck, NJ Thomas Wong E. R. Squibb & Co. New Brunswick, NJ James Wood Faberge, Inc. R id g e fie ld , NJ Bennett Woods Avon Products, Inc. Su ffern, NY Michael G. Worley Glyco Chem icals, Inc. Rosemont, IL Dr. Ronald J . Wulf Carter Products Research Cranbury, NJ Dr. Louis J . Yablon Life Laboratories, Inc. Sun V a lle y , CA Mitsuyuki Yamazaki Shiseido Co., Ltd. Darien, CT Dr. Samuel Yankell Univ. o f P a ., School o f Dental Medicine P h ilad elphia, PA Carl E. Yeager Avon Products, In c. Su ffern, NY Diana J . Yee The G ille t t e Co. Boston, MA David Yeung Vick D ivisio n s R. & D. Mt. Vernon, NY Ms. Natividad M. Ysla Beecham Products Parsippany, NJ Ed Yuhas Dragoco, Inc. Totowa, NJ Charles Yuster The Mearl Corp. New York,..NY............................ ............ ............... David Zajac Conair Corporation Edison, NJ J u liu s R. Zecchino Chesebrough-Pond's, Inc. Trumbull, CT John T. Zenno Sanofi Research Co., Inc. New York, NY Bernard Zimmerman lingerer & Company New York, NY Alex P. Znaiden Avon Products, Inc. Suffern, NY G ab rielle Zuckerman Lancome . New York, NY Dr. Samuel Zuckerman V alley Stream, NY Ronald Zukoski American Cyanatnid Co. C lift o n , NJ Robert Zu tic Haarmann & Reimer Corp. S p rin g fie ld , NJ Richard Schanno Glyco Chemicals Greenwich, CT Dr. David H. Scharer Shell Chemical Company Houston, TX Stanley Scharf Scharf Associates Dix H i l l s , NY Gerald Scheick Malmstrom Chemical Linden, NJ Dr. Alfred Schleppnik Monsanto Flavor/Essence, Inc. S t. Lou is, MO M itchell L. Schlossman Tevco, Inc. Carl sta d t, NO Brian F. Schmalz Naarden Internatio nal USA, Inc. New York, NY Eckhard Schmidt Haarmann & Rimer Corp. S p rin g fie ld , NJ Eileen Schmidt Colgate-Palmolive Co. P is c a t a w a y ,.. NJ Robert Schmit Summit Labs, Inc. Chicago, IL Ingeborg M. Schmi t t C-OTY, D iv isio n of P fiz e r P a rsippany, NJ Dr. Irvin g R. Schmolka BASF Wyandotte Corp. Wyandotte, MI Emil F. Schneider Avon Products, In c. Suffe rn , NY Richard W. Schnetzinger Revlon Research Center, Inc. Bronx, NY Harvey S. Schnur Monsanto Flavor/Essence, Inc. Montvale, NJ Linda Allen Schoen Neutrogena Corporation Los Angeles, CA Warren R. Schubert Colgate-Palmolive Co. Piscataway, NJ Dr. Harold Schwartz Food & Drug Research Labo rato ries, Inc. East Orange, NJ Irwin Schwartz Lowenstein Dyes & Cosmetics, Inc. Brooklyn, NY - 14 - John H. Simpson Dr. John J . S c ia rra Avon Products In c. Arnold & Marie Schwartz College Su ffern, NY of Pharmacy and Health Services Long Islan d U n iversity Alan S ivak o ff Brooklyn, NY Miranol Chemical Company Irvin g to n , NJ Nicholas Scodari Mem Company, Inc. Daniel W. Smith Northvale, NJ Chanel, Inc. Piscataway, NJ George V. Scott Colgate-Palm olive Co. Dean Smith Piscataway, NJ Alcolac, Inc. Baltim ore, MD P a trick A. Scott Firtnenich Incorporated Laurence R. Smith Princeton, NJ Onyx Chemical Company Jersey C ity , NJ Abraham Seldner Amerchol Corporation Maria Smith Edison, NJ J. B. W illiams C o ., Inc. Cranford, NJ John Selega Johnson Products Co., Inc. Terry Smith Chicago, IL Faberge, Inc. R id g efield , NJ Joseph F. Senackerib H. Kohnstamm & Co. Lau rie Smyla New York, NY Avon Products Inc. S u ffern , NY Paul Seplowitz Chesebrough-Pond's, Inc. William E. Snyder Trumbull, CT The Procter & Gamble Co. C in c in n a ti, OH Peter Sgaramella................................ American Cyanamid Co. Dr. G ian lu ig i So ld ati ....... C lift o n , NJ Carter Wallace Inc. Cranbury, NJ P ra fu lla H. Shah Block Drug Co. Alex N. Soltysyk Jersey C it y , NJ Albert Verley & Co. So. P la in f ie ld , NJ Charles G. Shalotsky The Mennen Co. Herbert Sommer Morris town, NJ Chesebrough-Pond's, Inc. Trumbull, CT Bertram Shapiro Syntex Research Marshall Sorkin Palo A lto , CA Carter-W allace, Inc. Cranbury, NJ V irg in ia W. Shen Personal Products Ralph Sorrentino Mi 11 town, NJ Onyx Chemical Company Jersey C it y , NJ Edward J . Shevlin Chattem Inc. Dr. Ronald J . Spanggord Chattanooga, TN SRI Internatio nal Menlo Park, CA Tsutomu Shimizu Noxzema Chemical Company of Canada, Ltd. Michael E. Spinapo lice, J r . Toronto, O ntario, CANADA Kolmar Labo rato ries, Inc. Milwaukee, WI Dr. Chung T. Shin B risto l Myers Products Frank J. Stanave H ills id e , NJ Personal Products Mi 11town, NJ Clyde Shoop Merck & C o ., Inc. Charles Steenbergen Rahway, NJ Penreco B u tle r, PA Steve Sichak Barr Company, Div. of Pittway Corp. Stanley P. Steinbach N iles, IL. . H. Kohnstamm & C o., Inc. New York, NY Edward Oltarzewski I . F. & F. New York, NY John Ong Hoiibigant, Inc. R id g e fie ld , NJ Robert Orth Naarden International USA, Inc. New York, NY Hovig Ounanian Chesebrough-Pond's, Inc. Trum bull, CT R. Dean Overley Mallinckrodt Inc. S t. Lo u is, MO Jon D urrell Packer Kolmar Laboratories, Inc. Port J e r v is , NY Harry Pact Henkel, Inc. Fort Lee, NJ Timothy J. Padden S . C. Johnson & Son, In c. Racine, WI Dr. Morton Pader Lever Brothers Co. Edgewater,..NJ ... ....................... A llen Pal anker Consumer Product Testing C o ., In c. F a ir f ie ld , NJ W illiam A. Palmer PFW, Inc. Middletown, NY V ictor Palinczar Carter-W allace, Inc. Cranbury, NJ Dr. K. C. Pande Carroll Products, Inc. Wood River Junction, RI Richard Panzarasa Roure Bertrand Dupont, In c. Teaneck, NJ George Panzer A lcolac, Inc. Baltim ore, MD P ie r re C. Parchois A lb ert Verley & Co. South P la in fie ld , NJ J. Paredes Givaudan Corporation C lift o n , NJ Anthony I . P arisse 'Carter Products Research, Div. of Carter-W allace Cranbury, NJ Stephanie Parker The G ille t t e Co. Boston, MA - 12 - Peter Passalacqua COTY, D ivision o f P f iz e r P a r s ippany, NJ Bhal Patel Whitehall Laboratories, Inc. Hammonton, NJ Dinesh C. Patel N.L. In d u stries, Inc. Hightstown, NJ G irish Patel Charles o f the R itz Group Holmdel, NJ . Dr. Jay Patel Armour-Dial Co. Sco ttsd a le , AZ Jayram D. Patel Keystone Lab o rato ries, Inc. Memphis, TN Ramesh Patel Carter-W allace, Inc. Cranbury, NJ Anthony P a tti Warner-Lambert Co. Morris P la in s , NJ Barry Pava Stepan Chemical Company Northbrook, IL Joseph Pavlichko Amerchol Corporation Edison, NJ Audrey Payne Naarden Internatio nal New York, NY Dr. A. John Penicnak Cosmair, Inc. New York, NY Martin Perl American Cyanamid Company C lift o n , NJ Leonard M. Perle Protameen Chemicals, Inc. Totowa, NJ Nicholas V. Perricone Bush Boake A llen Inc. Norwood, NJ Robert S. Pettus Cyclo Chemicals Corp. Miami, FL Dr. Gerald R. Pflug Carter-W allace, Inc. Cranbury, NJ Cari Phares Revlon Research Center, Inc. Bronx, NY Leon F. Pi erro F ritz sc h e Dodge & O lco tt Inc. New York, NY Ron P iz z a r e lli Shaw Mudge & Co. Stamford, CT ' Sophie L. Plechner Edison, NJ Stanley Pohl C lairo l Inc. Stamford, CT Edward A. P o le s e lli Vivion Chemical Co. Belmont, CA George Pollack Cosmair, Inc. C la rk , NJ Vincent C. Pompa Carter-Wallace Inc. Cranbury, NJ Johanna Poprzan Lehn & Fink Products Co. Montvale, NJ Gabriel Porres Noxell Corporation Baltim ore, MD Mary Lou Posten Avon Products, Inc. Su ffern, NY Paul V. Posten Amerchol Corporation Edison, NJ Fred Presant ATI, Inc. M ilford, CT Eugene G. Press Menley & James Laboratories P h ilad elp h ia, PA Eugene Puchalski Charles of the R itz Group Holmdel, NJ Dr. Peter T. Pugliese Milmark Research, In c. B e rn v ille , PA Dr. Franz J . Pum Redken Lab o rato ries, Inc. Canoga Park, CA Dr. Richard P. Quatrale G ille tte Research In stitu te R o ck v ille , MD John M. Quigg Compagnie Parento Ltd. Scarborough, O ntario, Canada Ed Rafferty Stepan Chemical Company Northbrook, IL Gary A. Ragone , Firmenich Incorporated Princeton, NJ Andrew M. Lubienski Mirano! Chemical Co. Irv in g to n , NJ Larry Lundmark Cosmedia Group of Henkel, Inc. M inneapolis, MN M.J. Lynch IC I Americas Inc. Wilmington, DE Renee Lyons Clairol Inc. Stamford, CT Antoni Macander Stepan Chemical Co. Northfied, IL Warren MacLean Lingerer & Company New York, NY William Maier Protameen Chemicals, Inc. Totowa, NO Richard A. Malmstrom Ru Ja c, Inc. Upper M ontclair, NJ Richard A. Malmstrom, J r . Ru Jac, In c. Upper M ontclair, NJ ....Dr. Milton Manowitz.............. ........ Givaudan Corp. C lift o n , NO Jose March Guerlain Somers, NY James W. Marchioni P. Robertet, Inc. Oakland, NJ Norman D. Marcus Peterson/Puritan, Inc. Teaneck, NJ John J. Margres Reheis Chemical Co. Berkeley Heights, NJ W illiam R. Markland Whately, MA Linda Marshall Elysee S c ie n t if ic Cosmetics Madison, WI T. P. Martin Givaudan Corporation C lift o n , NJ Paul Masengi Noxzema Chemical Co. of Canada, Toronto, O ntario, CANADA Henry F. Maso Amerchol Corporation Edison, NJ - 10 - Barbara Materna The Mennen Co. Morristown, NJ Don F. M ills Creations Aromatiques, Inc. Parsippany, NJ Heather Matesevac J. B. W illiam s C o ., Inc. Cranford, NJ B. H. Min Marubeni America Corp. New York, NY Dr. Jack J . Mausner Helena Rubenstein, Inc. Greenvale, NY Abraham Minton Gar-Baker Laboratories, Inc. New York, NY Gene Mavroudis Estee Lauder, Inc. Hauppauge, NY Maria B. M irabile COTY, D iv isio n of P fiz e r Parsippany, NJ Dr. Raymond L. Mayhew Mona In d u s trie s , Inc. Paterson, NJ S y lv ia Miranda Tim Meadows Terry Corporation Indian Harbour Beach, FL Thomas Miserendino Intarome, Inc. New York, NY Sebastian B. Mecca S c h u y lk ill Chemical Co. P h ilad e lp h ia , PA Regina Miskewitz American Cyanamid Co. C lift o n , NJ A1 Mel by Cosmedia Group o f Henkel, In c. M inneapolis, MN W illiam P. M itchell Waters Associates M ilford, MA John Menkart Clairol inc. Stamford, CT Dr. Arthur R. Mlodozeniec Hoffmann LaRoche Inc. Nutley, NJ C lara..Mercado.......................... Charles o f the R itz Group Holmdel, NJ .Chet MocuTeski.............................. Clintwood Chemical Company Chicago, IL L o lita Mercado J. B. W illiam s C o ., In c. Cranford, NJ D hiraj S. Mody Whitehall Laboratories, Inc. Hammonton, NY Anthony Mercurio American Cyanamid Company C lift o n , NJ Bha1 Moghe Block Drug Co. Jersey C it y , NJ James H. M erritt Dr. W illiam F. Moll Cosmetic, T o ile tr y & Fragrances A ssn .,In c . Georgia Kaolin Co. Washington, DC E liz a b e th , NJ W illiam Metzger American Cyanamid Co. C lift o n , NJ Dr. John Monick Colgate-Palm olive Co. Piscataway, NJ M errill Mezikofsky The G ille t t e Company - Personal C areD iv. Boston, MA Joseph Montani le F ritz sch e Dodge & O lcott Inc New York, NY Gerry Micheels PFW, In c. Middletown, NY Jose G. Montero The Mennen Co. Morristown, NJ Dr. Joseph F. M igliarese Research Testing Laboratories, Inc. L i t t l e Neck, NY . James J . Montgomery de Lai r e , in c. New York, NY Dr. Kenneth M igliorese Helene C u rtis In d u strie s, Inc. Chicago, IL Rhonda Montgomery American Cyanamid Company C lift o n , NJ Jeffrey Miles PFW, In c. Middletown, NY Russell A. Moody PFW, Inc, Middletown, NY Charles P. Johnson I . F. & F. New York, NY Judy Johnson American Cyanamid Company Cl i fto n , NJ Kathy J . Johnson Aromatics International, Inc. M arietta, GA Robert Johnson Clairol Inc. Stamford, CT Charles W. J o n a itis General M ills Chemicals, Inc. M inneapolis, MN J . D. Jones The Procter & Gamble Co. C in c in n a ti, OH Walter V. Jones P. Robertet, Inc. Oakland, NJ Ronald Joseph American Cyanamid Co. C lift o n , NJ Angelo L. Juliano The Quaker Oats Company Chicago, I L .................................... Tony J u li g Dragoco, Inc. Totowa, NJ Marie J u llia rd Estee Lauder, Inc. Hauppauge, NY Rene Jul lie n Aromatics In ternatio nal, Inc. New York, NY B. Kabacoff Revlon Research Center, Inc. Bronx, NY Carl E. Kaiser Revlon, Inc. Bronx, NY V isp i 0. Kanga Vick D iv isio n s R. & D. Mt. Vernon, NY Dr. Joseph L. Kanig R id g e fie ld , Conn. Dr. Yash M. Kapadia American Cyanamid Co. C lift o n , NJ Dr. J u liu s F. Kaplan Helen C u rtis Ind u s., Inc. Chicago, IL Sol Kaplan Sol Kaplan & Son, In c. Memphis, TN -8- Dr. E. J . Karolyi Mary Kay Cosmetics D a lla s, TX Richard D. K atstra Avon Products In c. Su ffern, NY Dr. Martin Katz Syntex Research Palo A lto , CA Peter Keane I-F . & F. New York, N.Y. David M. K e lln e r Revlon Research Center, In c. Bronx, NY Charles K elly Sandoz, Inc. East Hanover, NJ Lois Kelly Norda, In c. East Hanover, NJ E. T. Kendrick IC I Americas Inc. Wilmington, DE Divaker B. Kenkare Colgate-Palm olive Co. Piscataway, NJ.................... Howard Kennedy P fiz e r Consumer Products Parsippany, NJ S h e ila Kenyon Firmenich Incorporated Princeton, NJ Alan Kesten Belmay C o ., In c. New York, NY W. Roy Resting Amerchol Corporation Edison, NJ Ezzat N. K h a lil Johnson Products Co., Inc. Chicago, IL V irg in ia R. K ickertz Avon Products In c. S u ffern , NY Walter H. K iesel R . I.T .A . Corporation Crystal Lake, IL W illiam G. K iff e l S. C. Johnson & Son, Inc. Racine, WI Keith Kim Noxell Corporation Baltim ore, MD John F. King Robinson Wagner Co. Inc. Mamaroneck, NY Maurice King King Research, Inc. Brooklyn, NY ' W illiam J . King Colgate-Palm olive Co. Piscataway, NJ Lauren C. Kingman, J r . The Mearl Corp. O ssin ing , NY Diana Kiozpeoplou Colgate-Palm olive Co. Piscataway, NO James Kirk The G ille t t e Co. - Personal Care Div. Boston, MA Takeshi Kitazawa Shiseido C o., Ltd D arien, CT Kenneth Klausner Menley & James Laboratories P h ilad elp h ia , PA Debra Klein ' American Cyanamid Company C lift o n , NJ Kenneth Klein Henkel, Inc. ..:.... Hoboken, NJ................................ Robert W. Klein Dermik Laboratories, Inc. Fort Washington, PA William Klein Cosmair, Inc. C la rk , NJ . Ernest J . Klemm Zotos In te rn a tio n a l, Inc. D arien, CT P h ilip B. Klepak Johnson & Johnson East Windsor, NJ Mary Kliauga Good Housekeeping In stitu te New York, NY Ernest C. Kmitis I . F. & F. New York, NY John J . Koczwara The J . J . Koczwara Company C o o k eville, TN Harvey Koenig Charles of the R itz Group Holmdel, NJ Frederick F. Kohlhepp Carter Products, In c., Div. Carter-Wall ace Cranbury, NJ P ie te r G. Kohnstam H. Kohnstamm International New York, NY Dr. S tig Friberg University of M issouri-Rolla Roll a , MO P a tric k T. Gairns Naarden International USA, In c. New York, NY Gary M. Galante Avon Products, Inc. Su ffern , NY Anna Galiani Naarden Internatio nal USA, In c. New York, NY Dr. Mario L. Garcia C la iro l, Inc. Stamford, Cl John E. G arizio J.H . Walker & Co., Inc. Mount Vernon, NY David Garlen Cosmetech Laboratories, Inc. R o selle Park, NJ Bruce K. G arlick Aromatics Internatio nal, Inc. New York, NY David B. Garner Johnson & Johnson New Brunswick, NJ ..Frank Garone Estee Lauder, Inc. Hauppauge, NY R ita Gastom COTY, D ivision o f P fiz e r Parsippany, NJ Rita Gates Mary Kay Cosmetics, Inc. D a lla s , TX David C. Gaydos Robinette, Inc. Medina, OH Daniel Geary American Cyanamid Company C lif t o n , NJ Arthur Georgalas Charles of the R itz Group Holmdel, NJ Navin M. Geria B r is t o l Myers Products H ills id e , NJ Dr. Sol D. Gershon Teaneck, NJ Dr. Dipak Ghosh Chesebrough-Pond1s , Inc. Trumbull, CT . Frank Gianino The G il i e t e Company - Personal Care Div. Boston, MA -6- Frank Gichia The Hennen Co. Morristown, NJ Leonard G iglio Johnson Products C o ., In c. Chicago, IL F lo rica C. G ijirig u ia n Revlon Research Center, In c. Bronx, NY Mary C. Ginkiewicz Smith Kline & French Lab o ra to ries, Div. o f Smith Kline Corp. P h ilad elp hia, PA Gerry Goldberg V. Mane F i l s , Inc. F a ir f ie ld , NJ Dr. Melvin A. Goldberg Revlon Research Center In c. Bronx, NY Ronald Goldberg Alberto-Culver Company Melrose Park, IL Robert L. Goldemberg Rakuma Labo rato ries, In c . So. Hackensack, NJ Cleo J. Golding R. T. Vanderbilt Company, Inc. Norwalk, CT Tibor G. Goldner Revlon Research Center, In c. Bronx, NY Bernard R. Goldstein Tombarel Products Corp. Palisades Park, NJ Bernard Goldston GAF Corporation Melrose Park, IL Mabel Gomez American Cyanamid Company C lift o n , NJ Marion Gomolka Cosmair, Inc. C la rk , NJ Peter Goodacre Malmstrom Chemical Linden, NJ Brian J . Goode R .I.T .A . Corporation Crystal Lake, IL Stephen T. Goode R .I.T .A . Corporation Crystal Lake, IL P h ilip Gordon Chesebrough-Pond's, In c. Trumbull, CT ' Laura Gower Terry Corporation Indian Harbour Beach, FL Daniel Grabois B risto l Myers.Products H ills id e , NJ Je ff S. Graf Avon Products, In c. Su ffern, NY Dr. C la ire E. Graham Graham A ssociates Washington, DC Michael A. Granito D. H. L it t e r C o., In c. New York, NY Elizabeth Grazier Penreco B u tle r, PA Dennis Greaney Mary Kay Cosmetics D a lla s, TX B i ll Green Bio-Toxicology Laboratories, Inc. Moorestown, NJ Lois A. Green Bio-Toxicology Laboratories, Inc. Moorestown, NJ Dr. Stephen M. Greenberg Quad Chemical Co. Long Beach, CA James A...Greene............................................ Amway Corp. Ada, MI Lawrence J . Grenner Avon Products, Inc. S u ffern , NY Joseph Gubernick Estee Lauder, Inc. Hauppauge, NY Dr. W illiam Gump Givaudan Corporation C lift o n , NJ Michael R. Gutowski The Lanaetex Products, Inc. E liza b e th , NJ R. L. Hagopian Bush Boake A lle n , In c . Norwood, NO Rama Haidar Lehn & Fink Products Co. Montvale, NJ Thomas E. Hamernik Amway Corporation Ada, MI Joseph S. Hanak The G ille t t e C o ., Personal Care Div. Boston, MA Frances P. Hanckel Compagnie Parento, In c. S citu a te , MA George Concar Henkel, Inc. Chicago, IL Donald Conover Stepan Chemical Company Northbrook, IL Le ste r I . Conrad Amerchol Corp. Edison, NJ Wayne D. Constantin Mallinckrodt Inc. S t. Lo u is, MO Lloyd Copeland Avon Products, Inc. S u ffern , NY Dr. John Corbett C lairo l Inc. Stamford, CT Dr. Wal di mero C oscaren i American Cyanamid Co. C lift o n , NJ William Cotter J . B. W illiam s C o ., Inc. Cranford, NJ D. L. Courtney IC I Americas Inc. Wilmington, DE............ ........... Brant B. Cover Bristol-M yers International Stamford, CT Dale L. Craig Mary Kay Cosmetics, Inc. D a lla s, TX Dr. Richard J. Crawford Colgate-Palm olive Co. Piscataway, NJ Lantz Crawley American Cyanamid Company C lift o n , NJ Chris Cseko I . F. & F. New York, NY B oris M. Cumpelik Van Dyk & C o ., Inc. B e l l e v i ll e , NJ Andrew J. Cunningham Avon Products, In c. S u ffern , NY . Joanne Czajkowski American Cyanamid Co. C lift o n , NJ Mary G. Daguano HAPPI Ramsay, NJ Fred M. DaTey PFW, Inc. Middletown, NY John V. Daley Westwood Pharm aceuticals, In c. B u ffalo , NY Alan J . Dankwerth C. J . Patterson Company Kansas C it y , MO Thomas Dann American Cyanamid Company C lif t o n , NJ Donald A. Davis Drug & Cosmetic Industry New York, NY Lester W. Davis Abbott Laboratories Chicago, IL M. R. Davis ICI Americas Inc. Wilmington, DE Thomas R. Davis Polyesther Corp. Southampton, NY Joyce Debrowski Amerchol Corp. Edison, NJ Mark T. DeGeorge W.R. Grace S Co.-Organic Chemicals Div. Nashua, NH.............................. Robert Dekker Albert V erley & Co. South P la in f ie ld , NY Reno -Del Dotto TRI-K In d u stries, Inc. Westwood, NO Sharon A. deLegal Terry Corporation Indian Harbour Beach, FL C h arlie D ella Lana Colgate-Palm olive Co. Pi scataway, NJ Francine Del Vescovo Soap, Cosm etics, Chemicals S p e c ia ltie s New York, NY P. De Maio Block Drug C o ., Ine. Jersey C it y , NO Peter De Marffy Continental Perfumers, Inc. New York, NY Edward S. Demers Stepan Chemical Northfield, IL John Demo John Demo A ssociates Saddle R iv e r, NJ G. Frank DeMonico Amerchol Corporation Edison, NO Joseph Di Somma' Chanel, Inc. Piscataway, NJ Maison G. deNavarre Terry Corp. Orlando, FL S h irle y Ann DeRagon P la in f ie ld , NJ Dr. Frank De Santis Vick Research & Development Mt. Vernon, NY Al Di Sapio Dow Corning Co. Trumbul1, CT Richard Dixon S te rlin g Internatio nal Group New York, NY David D jerassi Pantane Co. - Div. o f Hoffmann- LaRoche, Inc. Nutley, NJ Howard D. Dolan Avon Products, Inc. S u ffern , NY Janet Donohue . Soap, Cosmetics, Chemical S p e c ia ltie s New York, NY P a trick J . Dorgan Frank B. Ross Co., Inc. Jersey C it y , NJ Robert J . Dougherty Westwood Chemical Co. Middletown, NY Robert C. D ressier Merle Norman Cosmetics Los Angeles, CA Clarence U. D risco ll W hittaker, Clark and D an iels, Inc. South P la in f ie ld , NJ Paul D risc o ll Whittaker, Clark & Daniels, Inc. South P la in fie ld , NJ John A. Duffy Avon Products, Inc. Su ffern, NY Dr. Gary E. Dugan The Gi 11 ette Company Boston, MA James A. Dugan Shaw Mudge & Co. Stamford, CT John Dugan COTY, D ivision of P fiz e r P a rsippany, NJ Jacques M. Dumont Chromex Chemical Corp. Brooklyn, NY William Bartuska Helene C u rtis In d u strie s, Inc. Chicago, ILL Richard L. Barzin Synfl eur Monti c e llo , NY P a tricia E. Bator Henkel, Inc. Hoboken, NJ E rik a Baumgartner H. Kohnstanm & Co. New York, NY John Beasley Mary Kay Cosmetics D a lla s, TX Deborah Bednar The G ille t t e Co.-Personal Care Div. Boston, MA Dan Beio Malmstrom Chemical Linden, NJ Robert E. Bellstrom Emery In d u strie s C in c in n a ti, OH Anthony J. Benfatto B r is t o l Myers Products H i ll s id e ,..NJ..... Frances C. Benkwitt S ta u ffe r Chemical Co. Dobbs Ferry, NY L is a A. Benton Firmenich Incorporated Princeton, NJ Ellen Berger Helena Rubenstein, Inc. Greenvale, NY Paula B ern itt Felton Internatio nal, Inc, Brooklyn, NY Gene R. Berube Chesebrough-Pond1s , Inc. Trumbull, CT William S. Bess B r is t o l Myers Products H ills id e , NJ Bruce D. Beyer Intarome, Inc. New York, NY Mukund I . Bhuta P h illip s Chemical Company B a r t le s v ille , OK 01 eh M. B ilyn skyj American Cyanamid Company C lif t o n , NJ Paul Bishop American Cyanamid Company C lif t o n , NJ - 2- Neil Blackmre The Mennen Co. Morristown,, NJ J. Blake-Haskins Colgate-Palm olive Co. Piscataway, NJ Dr. Baruch S. Bl umberg In s titu te fo r Cancer Research P h ilad elp h ia , PA S. M. Boccanfuso Colgate-Palm olive Co. Piscataway, NJ Andy Boccone Charles H. K lin e & C o., Inc. F a ir f ie ld , NJ Robert Bogart American Cyanamid Co. C lift o n , NJ Dr. James C. Bohrer Colgate-Palm olive Co. Piscataway, NJ Dr. Edward K. B o is its Johnson & Johnson Baby Products Co. New Brunswick, NJ Angelo T. Bonduris Noxell Corporation C o c k e y sv ille , MD Robert P. Bono S. Pasadena, CA Roland Bonorden Consumer Product Testing Co., Inc. F a ir f ie ld , NJ A. Bouchai Colgate-Palm olive Co. Piscataway,' NJ Toni Boutin Takasago USA, In c. Long Isla n d C ity , NY W illiam L. Bowers Merck & C o ., In c. Rahway, NJ Bruce Bowler PFW, In c . Middletown, NY . W illiam Boyer Alcolac, Inc. Baltim ore, MD Eileen Brady The G ille t t e C o., Personal Care Div. Boston, MA Robert P. Brandau Uni cure, Inc. Norcross, GA Steve Brem Noxzema Chemical Co. o f Canada, Ltd. Toronto, O ntario, Canada E. Robert Brenna P ro p rietary Perfumes, Ltd. Maywood, NJ Hernando Brieva Revlon Research Center, Inc. Bronx, NY Dennis L. Brigman Avon Products, Inc. S u ffern , NY M arcella A. Brodack Chesebrough-Pond's, Inc. Trumbull, CT Lee Brody Noxzema Chemical Co. of Canada, ltd Toronto, O ntario, CANADA John Brodzinski Charles o f the R itz Group Holmdel, NJ Dr. Richard C. Brogle Upper M ontclair, NJ Martin G. Brookins The Clorox Co. Pleasanton, CA Geoffrey J . Brooks Croda, In c. New..Y o rk , NY...... Bernard Brown I. F. & F. New York, NY Connie D. Brown Bonat, Inc. West Paterson, NJ Herman Brown Finetex, Inc. Elmwood Park, NJ Ivonne Brown Revlon Research Center, Inc. Bronx, NY G ail P. Bucher The G il l e t t e Co. Boston, MA Dr. Fran cis Buchwalter Max Factor & Co. Hollywood, CA John Wayne Buckley Cosmair - L'Oreal C la rk , NJ D. S. Buell Chesebrough-Pond's, Inc. Trumbull, CT Charles W. Buffa TRI-K In d u strie s, Inc. Westwood, NJ Hanno G. Buning Firmenich Incorporated Prin ceton , NJ _________ < i j Mj '} i -_______ Date -1to 't '. c e ssici__ X - \_ From __________-*vA ^T^jC.Vjs^---- 1133 15th S T R EET , N .W ., W A SH IN G T O N , D .C . 20005 P H O N E (202) 331-1770 Please; Attend to Note and return Note and forward to Files See (phone) me re attached I I Prepare reply for my '--' signature 1 I Send me information '-- required to answer Q For your information |~~| As per conversation As requested For your comments and suggestions Does attached meet with your approvali For signature, if you approve I I Make_____________ Photo Copies Other Remarks C V ~ > January 31, 1977 D r, M yron A . M eblman, Editor JNoautironnaalloIfnTstoixtuicteosloogfyH&eaEltnhv. iro n m en tal H ealth PR.o cOk.viBlloex, M18a2r9yland 20850 D ear D r. M ehlman; cology and EInnvtihreo nNmoevnetmalbHere, al1t9h7t6h, eirsesuweasoptuhbelisJhoeudrnaanl aorftTicolxe jentitled "Consumer Talcum s and Pow ders: M ineral and Chemical C haracterization" by A. N. Rohl et al, I have read the abovemm eennttiioonniendg aprutibclliecaatniodnisnwthheichinmtearye snt oothcaovrerebceteinn gbrtohue grhetctoordtheby Iatwteonutlido na popf rtehceiaatuethyoorusr, pIuabmlishenincglo. sing a L e tte r to the E d ito r w hich Sincerely yours, GHS:MMS Enc, be; M r, George Lee M r, M, Q. Tatlow Gavia Hildick-Sm ith,M . D. DC elipnaicrtaml AenstsoisftaPnetdPiartorifceas s o r College of M edicine and D entistry of New Jersey Rutgers M edical School Piscataw ay, New Jersey 08854 SAFETY OF CONSUMER COSMETIC TALC PRODUCTS wbddHtcsotihtthnhaaouifauuehelellssstassiccitcmStt1casshNabf1eenaremdhpIolteecn.mebuuirvon.eecocutessau,hsytmdttuaneeomCgtuabdfoabfrpcloaealaafsadtratsydosseCdumipeloapteeioehwsbcsuicrnttsseoseltitsoihmoucaauoctreniwemtcltucontecahnegiaiinetdbdnsakeriorai.nanntldetfsreeodlyiwuTniendwectbttaidghanhidtIfljhfetcinweeiteybsalcad"iedrinlJPmttcMuamochsdootrssiuihoumitnentsehtwnvcdr,reeepenaaoiuerrdoaeatcraaaracnsydelsolslltsibssiasmttin"hmioegioeaspmgoenfsxtricoosnandtbpiuposdaydavTonuisemtoCisteottresyseRfisoxhidoedmpttotuienaa.iiiochinmigesnlwocflnticesasoldaeicostRfteltuarighlaapotalesoyyslaftloctnchsraeCret-eemoaxailenhan.mfspn(tiamdl1bnltotiyra)pFoe9sini*a0xl.aEuurtseoc%ceaaltrbnrhtdoelcavllecsiodmdilorssmfrtueiniihoosadtssnsietcnanautnetdisnonaitdsterndtineatal/ruocso.laalniunecntnrltimndcaote1instr e Rwcs(2iooog)hnrnklditiinhfeTtgeiithcoeanaitnnaspl ..ltuclImnahmmaFdosnouoirnausbrentyeirrtnessi nasf wtlioabpfenrrerecoesndeisvlo,ieiisrmxcopiiannoanm.ssaesetndhontelctystioar etpreeftrdepai roloecrwrntiecdttdeohu s tttitooma lkpcnaoroocwvcrdenueumprs toteoanrmatt ssconobgyincnit taReeimwudnbopirlrbok.oyyineges ileetmaamt itppnearliorlonv.Tygerhemeveepssaesonnextdrt tharreomeiodnpppppolheerttyhdht eleaoldfttiowt eiitonnhtrhceakenrmi enciiagnnnscoeteirerrddemsnemvanpeilorcuxolelplinmeotmevsooeefnedlan(pr3ty.ut)fo.olmrc aionnKnt hcdalreeeuyriisrntmcfreaaieaglnndelct ei orft(noaelli.ldc5no)wbdt hyihuneosgRwt moecvhinoel ern ese xtvupadol usi eeaTdstheedatonbdiinoc oleoprsemgidcieecetinaiuclti o yagl oercagatdiri cvse iatlitynas lt cucodof dinecutsorsots mcl lo(een6tdd)i c.uacngt eirmda daeil n dt amulsicnt e de xue mps topsl uoh ryaese e b s e e n wnaTdnt omaouheettesoeukpstuderrnoaaIt(ndltfd6ruo)aoc.fdoatmaeneewat aTattaehhnlnshecydteakutsldyhddetohyovuawo,betisdaesxtsdeeehpnrotaoovconmbseeoubtsdwartteiadehtnihriiinenscfaldefhet.edvtwrhaecseeenholirnoneswcmciaeneoepoedfxtpntahpiirtncneootrhortsxeailtindmawat clnaoacinittutdmohielemdeilanysclacobelesexa1ss m7pt u0ooesce0dxstfatuepiridcedcoat isinismneeyagoddenrhgasipamedvia(nnee7ttahh)loe.s-at(fal6aola)igc,tlye d -2- wwfactt iaiohhmblgneiccenrrdohosuuPhtccpiaoatrCcevmohdeocespofdpansaiierhnssemtcuodeatowmaileuvcsnwmeneertipnmtlhowaoooinfryolddueal eecltidafrsracfselnoecmtbcnrreweteoirdralnsoselucpixolsneepbtegcoxus estpniinineroea.vvdnxseeedpoiddnnoi ncemseiepitidondowniednienneeatcechgpkmoewephircteoohmooeorlaxkftsoinmnigtepep(ievauc6tthelaeit,mcn8mlea )ltopy.wsgnlttorah7ouarye8ydder0eeie0es s mnt hoaeyt baneAohrlmthahzaaoazluradgrudhsoatoguResohhoetlofa el tchthoe.ssamil.teht,iscu gt hggereasdat ev tahtialaalt cb lceboys dmtaehttaei c ci nogndr asiudcmea teert a litcsh a t DPDRGCCieuaolesipvtlncngliaateneiritgctrsamesHatwrleiyaMonl ydAfte,oisdcMfosikNfcie-NeasdSwPeltiwmaecnJSidineJttciheerhasr,PotesaroreynMiol ycdf, se Ds s. o r 0885 , 4 REFERENCES 1* HAofsamsoTecar,ilnc Dt ia.onHnd., AJ Rosusorolnlcaei,a1t,ePd^.3R7.M.(,5i)na;en2rd9a6l sS-3;c0h4eA,l sm,MearJyi.cPan.1:97I nC6d.huasrtarcitaelr i zHaytgiioenn e 2* MRO ucobcriutnapola,ittiyoGn. aS lt uSMdciaeends s i ceoitfnt ie,T, a_Gl1c_.S,: M1PSi 6ni o-e1rl9sa t3ta,on ,dM aMGrc.i,hl ,l ea nr1ds9;7 R6Jo. omuarnno ,a l Co. :f ,3. KMA rloecrhitniavfleei tsl yd , o fAHmEo. nJng.v,i Tr oManlecms esMni ttiean,le r HsJ .e,aanldRt hoMo, yim1l 4laen: 6r, s6 0 3 .-i6n 6 7aNn,ewd 1Y29 6oar7kk.i., SMt a.Ht e.;: 4. KMoDfeli enpaieanrr stSf mey mlaednnpd,to s HMioufmi. lJ l. t h:eoenr sM.TIonartltceIa,nrlifi ootMyrram,y EaW8txi,poaesn1rh9iie7Cnn3gic.rteocnu,oBl afuDrrNe. a8euvC6.3Yo9,fo r kMP rioTncaeelsc,e d i n g s 5. KEo fxl epOienrcficeeunlpdca,etsi o11An-a,mloMnMge esTdsaii lct cei , n eWJ>o. r,lk_e6ar:ns3d:4 5AZ-3a4Ek9io,,Ml l o.MHvaU-yu, p1 M9 7So4t ur.tdayl;i t yJ o u r n a l 6. oHfi l Idnicdku-sSnt r;Li at lh , MGeadviicni nYe ,.: 3T3h, e 2B17i o-2l o2g9y, No fovTema lbce;r B19r7i t6i.s h 7J ou r n a 1 7 HWeBnaredimhgnsWhettreao,rtnssA,;oXnl ,VfErnIeCIgdIlhaanIrdnl ,et es ZrSnRewap.itttceikmoIennbr ,aehrla,G.l aCatr1oyi9no7gnM5r e(Ctsoosfa nhBonneaboypOnuc,TbcaluWilpcsiahltelPiidooaw)nm.adleCr H. ,beya l t h , 8. PHPOraixolrfdcot iierccdekld, e-iSsnEmgnsagintl hdaon,fdVGtahape1vo9iun74r6:tsh- ET( Itdaonil nct eb-b-ureRnr geaphctuiebon1ln9ti sa7hE5l e,pdSiPyd) .meermpgoaisomiluoomng iPoc nar l e sI snSht Lua ldtedide. s , ; I Labor Agency Cancels 'ts Safety Exemption 3n Industrial Talcs IVsVSetrauthcckrhbeyai pablooCyueLtsE2Vs2t0EruLpcrAkoNdiuDtsct!|?' THE WALL STREET JOURNAL, Thursday, Feb. 3, 1977 hubwrsdgficnuraaenlraoauglofcsdyiBWmTseduaneytihtupqigyrAnanoefaustglSrttseclacWohhdewbHhtfUtaaheteaifriIacretteisteylNocechftmlecoehdknGdxMSrh.satoreTetaaadIlfoJsbmiOrrlwrnnocrtygoeceNtpiibaeomoeDnnt-l--dntnegdFsfeoJdratTeoCchiaoffodnthereicmohuumdmettperehyreanrubedntbLwbasaemoaectdeltarinialhiion,xitbmcnnnhenSeJoM-gdIeitmaitrn1nrinoarnrl9odaitptril.7sr.Defveldut4etCirRge1srsoeaeatar9.treopnrtsrsu,tlpreeitai,inloahomadarirlhincltncstcmooegtteaaial1avrloslemj9lealteocn7ntexsrbh4seast,t formAt othfeastibmeest,oMs.r,. Corn said the old rul"ing wwaLotchitaohdehNbueeeolthdardhreteidratoDorelantmethtararpelae,asamirBcncwtitomuniiiltvnrdlheeitoenseattfutuhsf1tese3hacwoatiarfdaudpiflSetoihinnctnreaodgmgnnisndutofeogabonnfrsrtddehatehsqtsehdebure.seeetbsnBusBtatuodulsuylsytttr,ssetdoahaooeunesff of Standards' results. ..wdcts.a.uu.e.aifTssnlfptkhieoni,retmgieCnecgotirrotnsesminmn.pe,votxaihhleneieawtmyedme,,pdtctihaiotor.amktntTre,pe.tmml-iaVptasiolnakalneplectddsreeoeldbrtahbaeusesictclattytuCaaewsslaoecabr.,sestcsNohtsomotaonistrle,,l which has been linked to cancer. t"estohowxreoteAmaurrgpVde, htovaaineonnl'rnetddsg,eeltaribhkbluaeiatltt"tchtttehohitofehafnretie.cdsireaaaeplrlseeacssnriatn'imthddaaiendynngnyets''stptoelfbaredntdehaseneyctoihs1thi9tuor7aryn4tt GAM A T f, fiS0 A '-,vA N r ;V i O F ? , 0 tl,i -Oie J J j July Io, 19&? Dear Sir Cosmetic manufacturers are watching Washington with mounting concern these days. Regulatory agencies have been studying revised microbeological standards, as you know, and there is talk of new Govc.vmrfnu controls on cosmetic products, ;lo naturally, nsvcufactuners arc rors eager than ever to succeed in their continuing search for new ways no improve microbiological quality control procedures. That's vary I believe you.'11 be interested in STSRIL2X TALC--the bacteria,-free cosmetic talc that insures positive control on cosmetic talc and adds a. rev rrdcrotd.olcydcully clean dimension to all of your cosmetic products contain!ng talc A sealed package of STkFILFI TAX! is guaranteed to contain less than 10 bacteria per gram............................................. .................. :.. And less than 10 molds per gram. These guaranteed low levels of micro-organism population are produced by' cron.tin well-known core'crciai grades of talc-- and then packaging ATIRILFX TALC r.ob only in the customary talc package of a multi-layer paper hag, out also in or over wrapping of a sealed polyetnylene nag to prevent external cn-.gemination. Ir. addition, shipment is made in fiber drums or cartons for .added protection. For your review. I an enclosing data sheets containing complete prices and in formation about the typical physical and chemical properties you can expect from 3T71RILEX TALC. If you don't find here the grade of talc chat you wish, gust let me know. We can add it to our STEAIL3X TALC product line. In order to make your own evaluation, won't you. send us a purchase order for s. trial quantity? Vfe look forward to serving you.. Sincerely years Vice Pres 1eleni-- Karkotini The Bacteria Free Cosmetic Talc A Product of Gamma Process Company, Inc. 160 Broadway, New York, N.Y. 10038 * (212) 233-8570 GUARANTEE AND PRICE LIST STERILEX TALC is guaranteed in the sealed package to contain no more than 10 bacteria per gram and 10 molds per gram. PRICES listed below are based on truckload shipments packed in lots of 50 lbs. in multi-layer paper bags, over wrapped in sealed polyethylene bags for air tightness and shipped in fiber drums or cartons for protection during shipment, f.o.b. Chicago, Illinois. Terms, net 30 days. Prices are are subject to change without notice. GRADE Sierra Supreme USP Sierra Supreme 325 Sierra Supreme 200 Trinity Superfine Trinity Super Sierra Cloud Sierra Snow IS Silver Cosmetic Cascade 200 Cascade 325 Mistron Star QQ 1606 Italian QQ 4601 Metro #1 QQ Lo Micron QQ 123 USP QQ 568 Regal USP QQ 643 QQ 2450 PRICE P E R LB. $0,281 0.279 0.271 0.291 . 0.291 0.281 0.281 0.290 0.285 0.287 0.289 0.271 0.271 0.275 0.263 0.295 0.292 0.265 The Bacteria Free Cosmetic Talc A Product of Gamma Process Company, (nc. 160 Broadway, New York, N.Y. 10033 (212) 233-8570 TYPICAL CHEMICAL ANALYSES h OTHER PHYSICAL DATA PPuerrictyen(tI) (AMcaidxi'Smoulmub)le(s2) Sierra Supreme USP 96 - 97 .0. 50 Sierra Supreme 325 95 - 97......... 1.5 Sierra Supreme 200 95 - 97 1.5 Trinity Superfine 95 - 97 2. 0 Trinity Super 95 - 97 2.0 Sierra Cloud 92 - 96 6.0 1 Sierra Snow 92 - 93 6.0 IS Silver C osm etic '92 - 93 6. 0 LooseIBbu(3slk)./icnugP. ianfctk. ed (4) %F3i2nM5eirnMiueessssh 21 - 22 38 - 40 . 99.2 - 99.6 21 - 22 38 o 1 99.2 - 99.6 26 - 27 54 - 55 95.0 - 97. 0 23 - 24 45 - 46 99.2 - 99.6 25 - 26 50 - 51 95. 0 - 97. 0 27 - 28 50 - 51 99.2 - 99.6 28 - 29 51 - 53 99.2 - 99. 6 28 - 29 51 - 53 99.2 - 99.6 (1) Pneesricuemnt opxuidreityanedxpchreesmseicdalalsy ccoommbbiinneedd pweartceern.tages of Silicon dioxide, Mag {2} Method: Boil 1 gm talc with 50 ml n/10 HgSO.^ for one minute. Titrate while hmout lwtipitlhieNd /b1y0 0N,a2O81H euqsuinagls ppheerncoepnhtthaacliedinsoinludbilceatsourb. sta5n0cme icnaulscuNlaaOteHd atisteCr aO. (3) Scott Volumeter bulking of the "fluffed" m aterials as lb s ./ft. 3, (4) lTbosi.lept eGr ocoud.s fAt.ssoFcoiratgiornamSspepceifricmatiilolinmNetoe.r 1d0i,vidMeebthyod62N.4o3. . 12, repo.rted as The Bacteria Free Cosmetic Talc A Product of Gamma Process Company, Inc. 160 Broadway, New York, N.Y. 10038- (212) 233-8570 TALC _ QQ 4601 METRO #1 STERILEX TALC is guaranteed in the sealed package to contain no more than 10 bacteria per gram and 10 molds per gram. PRICE: $0,271 per lb, packed in lots of 50 lbs, in laminated paper bags , over wrapped in sealed polyethylene bags for air tightness and shipped in fiber drums or cartons for protection during shipment, f.o.b, Chicago, Illinois. Terms, net 30 days. DATA Color: White Physical Constants: (typical) Specific Gravity ..We igh t.per.solid.gallon... One pound bulks Loose Density Tapped Density Wet Screen Retention: . 325 Mesh 200 Mesh Dry Brightness: . Green Filter Oil Absorption: Rub-Out pH Value ' Hegman Fineness Chemical Composition: (typical) Silica Aluminum Oxide Ferric Oxide Calcium Oxide Magnesium Oxide SO2 AI2O3) _ Fe20 3) CaO MgO Loss on Ignition Alkalis and Acid Carbonates Solubility H ?0 N/2HCI 2.88 23.99.lbs. /gal.... ... 0.04168 g a l ./l b . 24.5 lbs./cu. ft. "t 1 54.5 l b s ./cu.ft. ' 1.5 - 2.0% 95 + 9.0 - .5 60.0 - 61.0% 0.25 - 0.4 ' .75 - 1 .5 20.75 - 32.0 4601 3.23% Neutral None T.G.A. Spec. No. 7.07d max to Litmus 0.03% 4.44 0 .2% max 6.0 mas The Bacteria Free Cosmetic Talc A Product of Gamma Process Company, Inc. 160 Broadway, New York, N.Y. 10038 (212) 233-8570 TALC QQ L0 MICRON STERILEX TALC is guaranteed in the sealed package to contain no more than 10 bacteria per gram and 10 molds per gram. PRICE; $0.275 per lb. packed in lots of 50 lbs. in laminated paper bags, over wrapped in sealed polyethylene bags for air tightness and shipped in fiber drums or cartons for protection during shipment, f.o.'b. Chicago, Illinois. Terms, net 30 days. DATA Color : Brightness : Description: White 91 - 93 #1 Talc Lo Micron, ground from the finest talc available, has excellent slip. Physical Constants: (typical) .Tapped.Bulk:..... :...... ... 20 grams - 500 times Apparent Density Loose Bulk: 20 grams Apparent Density Specific Gravity True Density Reflectance: Green Stim. Filter Oil Absorption: (Rub-Out) Sieve Fineness: Thru 325 mesh Hegman Fineness pH Slip 39 c .c. 32 l b s ./cu.ft. Il l .1 c .c . 11.2 lbs./cu.ft. 2.77 23.07 l b s ./gal. .0434 gal./lb. 91 - 93 47 100% 5 - 5.5 9.0 - 10.0 Excellent Chemical Composition: (typical) Silica Si02 Magnesium Oxide MgO Calcium Oxide CaO Aluminum Oxide A123 Ferric Oxide Fe203 Loss on Ignition 58.0 - 62. 31.5 -32. 1,0 - 6.7% 0 .1 - 0 .8% 0.6 - 1 .0% 2.0 - 8.0% The Bacteria Free Cosmetic Talc ' A Proauct of Gamma Process Company, Inc, 160 Broadway, New York, N Y. 10038' (212) 233-8570 TALC QQ 643 STERILEX TALC is guaranteed in the sealed package to contain no more than 10 bacteria per gram and 10 molds per gram PRICE: $0,292 per lb. packed in lots of 50 lbs. in laminated paper bags, over wrapped in sealed polyethylene bags for air tightness and shipped in fiber drums or cartons for protectio during shipment, f.o.b, Chicago, Illinois. Terms, net 30 days DATA Source : Coloi~ : Brightness : Description Uses : North Carolina White 86 . #643 Talc is one of the few true talcs produced in the world Cosmetics, rouge, pharmaceutics Physical Constants: (Typical) Tapped Bulk: 20 grams - 500 times Apparent Density Loose Bulk: 20 grams Apparent Density Specific Gravity True Density Reflectance: Green Stim Filter Oil Absorption (rub-out) Slieve Fineness: Thru 200 mesh Thru 325 mesh pH Slip Hegman Fineness . 20.5 c.c. 60.2 lbs./cu.ft. 48.8 c.c. 25.6 Ibs./cu.ft. 2.69 ' 22.41 lbs./gal. 86 43.2 99.287. , 93.56 9.17 Excelient 1 Chemical Composition: (1 ical) Silica Si02 Magnesium Oxide MgO Calcium Oxide CaO Aluminum Oxide A ^ O ^ Ferric Oxide ^e 2^3 Loss on Ignition . 48.0 - 54.0% 31.5 - 32.5 1.5 - 3.0 5.0 7.5 1.0 - 2.0 7.0 - 8.0 Acid Soluble Iron Soluble Calcium as CaO Pb (Lead) As (Arsenic) '-e 0.22 1.19 8 ppm 0 ppm 0 . 75 max. 1 . 5 max. 20 ppm max 2 ppm max The Bacteria Free Cosmetic Talc A Product of Gamma Process Company, [nc. 160 Broadway, New York, N.Y. 10038 * (212) 233-8570 TALC QQ 123 USP STERILEX T A L C is g u a r anteed in the sealed package to contain no more t han 10 ba c t e r i a per g r a m and 10 molds per gram. PRICE: $0,263 per lb. packed in lots of 50 lbs. in laminated paper bags, over wrapped in sealed polyethylene bags for air tightness and shipped in fiber drums or cartons for protection during shipment, f.o.b. Chicago, Illinois. Terms, net 30 days. DATA Source : Color; Alabama Whi te Physical Constants: (typical) Specific Gravity Weight per solid gallon One pound bulks Loose Density Density ..... ...... W e t screen retention: 325 mesh 200 mesh Dry Brightness: Green Filter Oil Absorption: Rub-Out pH Value Hegman 2. 79 23.6 lbs./gal. 0.0426 gal./lb. 28 t 2 lbs./cu.ft. 69 - 1 lb./cu.ft. 1.5% max. 90 - 92 32 t 1 8.0 t .5 Chemical Composition: (typical) Silica Magnesium Oxide Calcium Oxide Aluminum Oxide' Ferric Oxide Loss on Ignition S 1O2 NgO CaO AloOo Fe23 60 .0 - 63.0% 31 .0 -34.0 % 0 .03 - 0.06 % 0 .30 - 0.50 % 0 .50 - 0.60 % Le ss than 1 % U.S.P. Tests Loss on Ignition Acid-soluble subs tances Water-soluble sub stances Water-soluble iron < 1 .,00% 0 ..13% 0 .,02% None U.S.P. Limits 5.0 % 2.0 % 0.1 % None ^ ff& ftp -'s - - ': O U The Bacteria Free Cosmetic Talc A P roduct of G am m a Process Com pany, Inc. 160 Broadway, New York, N.Y. 10038 - (212) 233-8570 TALC QQ 568 REGAL USP STERILEX TALC is guaranteed in the sealed package to contain no more than 10 bacteria per gram and 10 molds per gram. PRICE: $0.295 per lb, packed in lots of 50 lbs, in laminated paper bags, over wrapped in sealed polyethylene bags for air tightness and shipped in fiber drums or cartons for protection during shipment, f.o.b, Chicago, Illinois. Terms, net 30 days. ' DATA Source : Color : Descript ion: North Carolina, processed Alpine, Alabama White #568 Regal Talc USP is a smooth, si.lky talc with excellent slip. Especially processed after mining to meet rigid USP specification controls. The con trolled pH identifies this talc and its treatment as unusual.in mineral...... pigments. Physical Constants: Color Reflectance : Photovolt Green Stim. Filter Loose Bulk (lbs./cu.ft.) Sieve Fineness: -200 mesh -325 mesh pH Slip Blue White 89 t 1 . 24.5 - 26.5 987 - 1 93% - 1 7.0 - 8.0 Excellent Chemical Constants : Silica Aluminum Oxide Ferric Oxide Calcium Oxide Magnesium Oxide Loss on Ignition Si02 AI2O3 ) Fe203 ) CaO MgO 58.0 - 61.0% . 3.0 - 5.0 0.1 - 1.0 30.0 - 35.0 1.0 - 1.25 USP Tests: Loss on Ignition Acid-soluble substances Reaction & Soluble substances 1.0 - 1.25 0.5 - 1.0 0.01 - 0.05 , U.S.P. Limits 5.07 max. The Bacteria Free Cosmetic Talc A Product of Gamma Process Company, Inc. 1 6 0 Broadway, Now York, N .Y. 10038 (212) 233 8o70 TALC QQ 2450 STERILEX TALC is guaranteed in the sealed package to contain no more than 10 bacteria per gram and 10 molds per gram, PRICE: $0,265 per lb. packed in lots of 50 lbs. in laminated paper bags, over wrapped in sealed polyethylene bags for air tightness and shipped in fiber drums or cartons for protection during shipment, f.o.b. Chicago, Illinois. Terms, net 30 days. DATA Typical Physical Properties: Dry brightness S.A. Cnm/Gm. Specific Gravity Tapped Density, Ibs./cu.ft. Apparent Density, lbs./cu,ft. Lbs./solid gallon One.pound bulks, gallons.... Oil Absorption Particle Shape Specific Resistance Hegman Fineness Thru 200 mesh, % Thru 325 mesh, % 89 min. 2.69 59.4 25 - 28 22.41 0.0446 21.6 99% min. Typical Chemical Analysis: Si02 CaO AloOo MgO N a 20 F e 20s so4 C02 Cu Mn Acid solubles as CaO Moisture Loss on ignition H20 Soluble pH Acid insoluble 48.0 - 54.0% 1.5 - 3.0 5.0 - 7.5 31.5 - 32.5 1.0 - 2.0 8 .0% max. v 8.0 - 8.5 The Bacteria Free Cosmetic Talc' A Product of Gamma Process Company, Inc, 160 Broadway, New York, N.'Y. 10038- (212) 233-8570 TALC QQ 1606 ITALIAN STERILEX TALC is guaranteed in the sealed package to contain no more than 10 bacteria per gram and 10 molds per gram. Price: $0,271 per lb. packed in lots of 50 lbs. in laminated paper bags, over wrapped in sealed polyethylene bags for air tightness and shipped in fiber drums or cartons for protection during shipment, f.o.b, Chicago, Illinois. Terms, net 30 days, DATA . Source : Color : Brightness : Description: Uses : Italy Whi te 90 #1606 Talc is ground from ore that mineralogically approaches a true talc. Face Powder, pharmaceutics, rouge. Physical Constants: (Typical) Tapped Bulk: 20 grams - 500 times Apparent Density Loose Bulk: 20 grams Apparent Density Specific Gravity True Density Reflectance: Green Stim. Filter Oil Absorption (Rub-Out) Sieve Fineness Thru 200 mesh Thru 325 mesh pH Slip 23 c.c. 54.4 Ibs./cu.ft. 48.0 c.c. 26.1 lbs./cu/fti 2.68 22.32 lbs./gal, .0448 gal./lb. 90 31 99.98% 95.19% 8.51 Excellent Chemical Composition: (Typical) - Silica Si02 Magnesium Oxide MgO Ferric Oxide Fe203 Aluminum Oxide AI2O 3 Calcium Oxide CaO Loss on Ignition 60.21% 31.17 1.12 1.49 0.52 5.68 The Bacteria Free Cosmetic Talc 160 A Product Broadway, NoefwGaYmormk,aNP.Yro. c1e0s0s3C8om(2p1a2n)y. 2I3n3c-. 8570 CO(STMypEicTaliCDatTa)ALCS 5/25/69 ASiI20O2 3 CA(PHNeArEcMLenYItCS'IASL CFea2OC>3 MgO KL.2O0 . I. _ CO2 1120 - % Acid Solubles (as CaO) %thru 200 (74 u) % thru 325 (44 u) PINARMTICICRLOENSSIZE %minus 30 u <%%%%mmmmiiiinnnnuuuussss ..21.500......uuu.... 3u .. ..... ................... %minus %%mmiinnuuss 2 01. 5 uu u %minus 0, 2 u (Spatula Rub-Out (lbs/100 lbs) OIL ABSORPTION < Gardner-Coleman (lbs/100 lbs) L (mI/20 gm) G. E. Brightness TRI STIMULUS COLOR . [Amber 000 mu S) Green 541 mu Blue 457 mu L% Y ello w n ess Specific Gravity Weight per solid gal - lbs ORneefraPcotuinvde bInudlkexs - gal Moisture % SURFACE AREA -{m2/gm BET - N2 Adsorption AVG. DIAMETER -{jat 50% finer) SDUIARMFAECTEERMEAN \/_"F(inishMericrSounbs-S-ieve) pH (1:5 Dilution) PARTICLE SHAPE-QP - platey / A - acicular B(AUpLpKaIrNenGt Density) ["Loose (Scott Vol.) <( Packed (Numinco) [_TGA (50 Taps) lb lb ss//fftt^3 T. G. A. JTPbO (20ppm max) soluble 1 A f<toOo { O r 62..303 .54 .21 32. 9 <. 004 62. 0 .3 3 .5 4 . 21 32, 9 C. 004 62. 0 .3 3 .5 4 .2 ] 32. 9 <. 004 .25 5. 00 .2 5 5 .0 0 .2 5 5. 00 0. 2 - 0. 5 99. 5/99. 7 96/97 0. 2 - 0. 5 100 99. 6/99. 8 0. 2 - 0 .5 300 99. 99 85 98 72 91 51 67 33 ......3 9 ................ 100 100 96 85 .... .........' 2114 7 3. 5 24 . 63 37 49 8 23 48 1 1 .5 1.3 2357 -~ 4227 27 - 30 42 - 49 38 - 44 68 - 75 8-9 9 -3 1 14 - 36 84 - 86 86 - 88 89 - 92 89 - 92 87 - 90 83 - 86 93 - 92 89 - 91 86 - 88 92-94 90 - 93 88 - 93 6-8 5.2 - 5 .8 2. 7 - 4. 5 2. 75 22. 91 0. 1 03-..5009.4336 2. 75 2, 75 22. 9] 22. 91 0. 04365 0. 04365 3 .5 9 1 .5 9 0. 3 - 0. 3 0.1 - 0 .3 10 - 12 9.5 3 3 - 13 7 .3 16 - 38 2. 0 3.98 1.58 .56 9 .0 - 9. 5 P 17 - 19 43 - 48 30 - 34 3ppm 9. 0 - 9. 5 P 7 -8 16 - 22 14-17 3ppm December 2, 1964 For All Salesmen & Agents INTER-OFFICE CORRESPONDENCE We now have a supply of the followin sheets found also in the new Reokitt's booklet Colours for Industry; Ultramarine Blue RS-1, 2, 3, 4, 5, 6, 8, 9, 10, Ultramarine Violet KS-11, RS-12 (Sliohtly redder than RS-11 and formerly called Ultra marine Rose), RS-13 (Water repellent Ultramarine Blue for lith ographic ink and similar in shade to RS-5), RS-18 (Highly water repellent and similar in shade to RS-5), AR2000 and 2001 (Acid resistant Ultramarine Blue particularly of interest for roofing granules ). All our data books for paint and rubber will contain the above sheets plus: Ultramarine in Paint, Ultramarine for Print ing Inks, Ultramarine for Plastics and Micronized Ultramarine., Also any of these data sheets may be requisitioned sep arately or collated, by the salesmen to be handed by them to the customer, or included with correspondence. Please notice that we do not stock all the grades listed but of course we are always willing to get them with required. Very truly yours, 11 22 33 44 55 66 77 88 99 TO 10 11 1) 12 12. 13 13 14 14 15 15 16 16 7 < 17 13 18 19 19 20 20 21 21 22 22 23 23 24 24 25 25 2 26 27 27 28 28 29 29 30 30 31 31 32 32 33 33 34 34 35 35 36 36 j7 37 H 33 39( 39 40 10 11 22 33 44 55 66 77 88 99 10 10 11 11 12 12 13 13 14 14 15 15 16 16 7 17 18 18 19 19 20 20 21 21 22 22 23 23 24 24 25 25 26 26 27 27 28 28 29 29 30 30 31 31 32 32 33 33 34 34 35 35 36 36 1 7 37 38 38 39 3? 40 40