Document j1E3BEZgYwXdeyQ2bN7y0vyy

DownloadRandom document
ARa.2.6 - / r i 7 7I T P' ''7 cCoD ro AMMONIUM PERFLUOROOCTANOATE (C-8) GROUNDWATER INVESTIGATION STEERING TEAM REPORT August 2003 Consent Order No. GW- 2001-019 ro CS* Cm-/oO 0-T--o37Irop3ni 33. CDPi o to o XCOT CONTAIN NO OBI 000005 Final C-8 GIST Report______________________________________________ page 2 Table of Contents: Executive Summary............................................................ 3 Introduction ...................................................................... 11 West Virginia Private Water Supply Sources............ ; . 13 Ohio Private Water Supply Sources ............................... 19 West Virginia Public Water Supply Sources ..................... 22 Ohio Public Water Supply S o urces................................. 25 Ohio River Sampling .......................................................... 28 Surface Water and Groundwater Monitoring..................... 30 Groundwater Modeling........................................................45 References ........................................................................ 48 Appendixes A: Site maps and Groundwater-Top maps B: Groundwater Data C: Consent Order No. GW-2001-019 Contact: Groundwater Program Division of Water and Waste Management 414 Summers Street Charleston, West Virginia 25301 304-558-2108 Members of the G roundwater Investigation Steering T eam : Don Criss, Geologist, Groundwater Program, West Virginia DEP Garth Conner, Environmental Engineer, Enforcement Division, Region III, United States EPA George R. Dasher, Geologist, Groundwater Program, West Virginia DEP Andrew Hartten, Principal Project Leader, DuPont Engineering Jack C. Hwang, Hydrogeologist, Region III, United States EPA Bill Toomey, Program Manager, Source Water Protection, Bureau for Public Health, West Virginia Health and Human Resources Roger Reinhart, Environmental Engineer, Water Division, Region III, United States EPA Dee Ann Staats, Ph.D., Science Advisor, West Virginia DEP Dave Watkins, Program Manager, Regulatory Programs Section, West Virginia DEP Non-Voting GIST team members: Sarah Wallace, Environmental Engineer, Division of Drinking and Ground Waters, Southeast District Office, Ohio EPA Steve Williams, Hydrogeologist, Division of Drinking and Ground Waters, Southeast District Office, Ohio EPA Division of Water and Waste Management 000006 Final C-8 GIST Report page 3 AMMONIUM PERFLUOROOCTANOATE (C-8) GROUNDWATER INVESTIGATION STEERING TEAM REPORT EXECUTIVE SUMMARY A multi-media Consent Order (GWR-2001-019) was entered into between the West Virginia Department of Environmental Protection (WVDEP), the West Virginia Department of Health and Human Resources-Bureau for Public Health (WVDHHRBPH) and DuPont on November 14th, 2001. The Consent Order identified a series of requirements to be performed by the Parties (WVDEP, WVDHHR-BPH, and DuPont) in order to determine whether there has been any impact on human health and the environment as a result of releases of ammonium perfluorooctanoate (C-8), CAS Number 3815-26-1, to the environment from DuPont operations at the Washington Works main plant and three associated landfills (Local, Dry Run, and Letart). C-8 is a material used by DuPont in its fluoroproducts manufacturing process at its Washington Works Facility's located in Washington, Wood County, West Virginia. C-8 has not been identified as a hazardous substance, hazardous waste, or otherwise specifically regulated under West Virginia or federal statute or regulation. In accordance with Attachment A of the Consent Order, three tasks were to be performed by DuPont and evaluated by the Groundwater Investigation Steering Team (GIST). The GIST used a phased approach towards meeting these requirements. Task A: Task A required Dupont to conduct a distance-phased public water supply service survey along the Ohio River on both the West Virginia and Ohio sides of the river. Subsequent to the Task A requirement, a one-mile (and possibly a two- and three-mile) radial distance of the Washington Works Facility and the Local, Letart, and Dry Run Landfills. The phased approach to the water and groundwater well use survey and sampling was intended to allow the GIST to focus efforts along potential C-8 impact transport pathways and eventually cease activities in directions where impacts were not present or where there were low concentrations. Division of Water and Waste Management 000007 Final C-8 GIST Report page 4 W est Virginia Private Water Supply Sources: Conclusions: Initial sampling within a one-mile radius of the Washington Works Facility and each of the three landfills resulted in varying levels of C-8 being found in private water sources. Private water sources within a one- to two-mile radius were sampled around the Washington Works Facility and the Local Landfill based on C-8 concentrations detected greater than 1.0 |jg/l in the one-mile radius. No further private water sources sampling beyond the two-mile radius is necessary based on the lower concentrations detected in the one- to two-mile radius sampling area. No private water sources in West Virginia were found to exceed the C-8 drinking water screening level of 150 pg/l. The highest concentration detected was 10.4 pg/l. Recommendations: Continued quarterly sampling of selected private water sources around the Washington Works Facility and Local and Dry Run Landfills for one year is recommended by the GIST. Annual sampling of the private water sources at the Letart Landfill is also recommended. Subsequently, the frequency of the sampling should then be re-evaluated. Ohio Private W ater Supply Sources: Conclusions: Initial sampling within a one-mile radius of the Washington Works Facility resulting in varying levels of C-8 being found in approximately 94% of the water sources sampled. Private water sources within a one- to two-mile radius from the Washington Works Facility were sampled based on the levels of C-8 detected at the outer limits of the one-mile radius. No private water sources in Ohio were found to exceed the C-8 drinking water screening level of 150 pg/l. The highest concentration detected was 23.6 pg/l. Recommendations: Continued quarterly sampling of selected water sources around the Washington Works Facility for one year is recommended by the Ohio EPA. Subsequently, the frequency of the sampling should then be re-evaluated. Division of Water and Waste Management oooooa Final C-8 GIST Report page 5 W est V irginia Public W ater Supply Systems: Conclusions: Ten public water supply systems along the Ohio River at various points up and downstream from the Washington Works Facility and Letart Landfill were sampled for C-8. No public water supply production wells in West Virginia were found to exceed the drinking water screening level of 150 pg/l. The highest concentration detected was 1.87 pg/l. The widespread distribution and low concentrations of C-8 indicate that the primary migration pathways to the public water supplies are air emissions from the Washington Works Facility and pumping-induced infiltration from the Ohio River, which receives C-8 from the National Pollutant Discharge Elimination System (NPDES) outfalls at the Washington Works Facility and the Letart Landfill. Recommendations: Continued quarterly sampling at the Lubeck Public Service District (PSD), DuPont Washington Works Facility, and General Electric public water systems for two years is recommended by the GIST. Also, annual sampling of the Blennerhassett Island, Mason County PSD, and the Racine Lock and Dam Public Water System for two years is advised. Subsequently, the frequency of the sampling should then be re-evaluated. Ohio Public Water Supply Systems: Conclusions: Six public water supply production wells along the Ohio River at various points up and downstream from the Washington Works Facility and the Letart Landfill were sampled for C-8. No public water supply production wells in Ohio were found to exceed the C-8 drinking water screening level of 150 jjg/l. The highest concentration detected was 8.58 pg/l. The widespread distribution and the low concentrations of C-8 indicate that the primary migration pathways to the public water supplies are air emissions from the Washington Works Facility and pumping-induced infiltration from the Ohio River, which receives C-8 from NPDES outfalls at the Washington Works Facility and Letart Landfill. Division of Water and Waste Management Final C-8 GIST Report page 6 Recommendations: Continued quarterly sampling of the Little Hocking Water Association Public Water System for two years is recommended by the GIST. Also, annual sampling of the Tuppers Plains-Chester Water District Public Water System for two years is advised. Subsequently, the frequency of the sampling should then be re-evaluated. Task B: Task B required the development and implementation of a monitoring plan that would determine the extent and presence of C-8 in drinking water, groundwater, and surface water in and around the Washington Works Facility and the three landfills, and to provide a compilation of all available groundwater/surface water monitoring and hydrogeologic characterization data for each facility. O hio River Surface W ater Sampling: Conclusions: Twelve sampling locations in the Ohio River at points up to 28.6 miles upstream of the Washington Works Facility and downstream to the Letart Landfill were sampled for C-8. No samples collected from the Ohio River were found to exceed the C-8 drinking water screening level of 150 pg/l. The highest concentration detected was 1.04 pg/l. Recommendations: No additional river sampling is recommended. Surface W ater and G roundwater Monitoring: This task included monitoring of the surface water and groundwater at the Washington Works Facility and the three landfills for four consecutive monthly events, followed by quarterly sampling thereafter. Dry Run Landfill: Conclusions: C-8 is believed to be migrating, via groundwater and surface water, from the C8-containing waste that has been disposed of within the landfill. Division of Water and Waste Management Final C-8 GIST Report page 7 Groundwater flow is toward the west and toward the Dry Run valley at this site. C-8 concentrations measured within the one-mile radius of the site show that some off-site migration of C-8 may have occurred. The Dry Run Landfill is located within eight miles of the Washington Works Facility. The transport of C-8 via air emissions from the plant could potentially be the source of the very low concentrations of C-8 detected within the one-mile radius sampling area. There are no known complete exposure pathways for human receptors that exceed the C-8 drinking water screening level of 150 pg/l. Recommendations: Surface water and groundwater monitoring should continue at this site. The groundwater sampling should continue to be quarterly, while the outfall sampling can be either monthly or quarterly, as required by the site's NPDES permit. The C-8 concentrations in wells DRMW-13A and DRMW-13A should be monitored, as these wells appear to be the most vulnerable (down-gradient portion of the C-8 plume). The C-8 concentrations at the Dry Run leachate discharge location should be monitored. Letart Landfill: Conclusions: C-8 is believed to be migrating via surface water transport from the C-8 containing waste that has been disposed of within the landfill. Groundwater flow in the A Zone, D-E Zones, C Zone, and F Zone at the Letart Landfill is towards the Ohio River, and is away from the private water supplies in this area. Groundwater flow in the F Zone (the deepest zone) is generally believed to be towards the Ohio River and away from the private water supplies in this area; however, there may be a groundwater flow divide on the upper and northwestern side of the landfill. The annual C-8 loading from groundwater to the Ohio River indicates a very low concentration in the river from the landfill, and this is supported by the very low concentrations of C-8 in the Ohio River downstream of the landfill. It is possible, however, that this loading is contributing to the presence of low C-8 concentrations in some of the down river community water systems. Air emissions are not a viable migration pathway from the landfill because there Division of Water and Waste Management OOOOll Final C-8 GIST Report are no air emissions at the Letart Landfill. ?ge 8 There are three complete exposure pathways for human receptors that exceed the CATT-established C-8 drinking water screening level of 150 pg/l. These are: contact with either surface water runoff (at the Cap Runoff location), leachate discharged to surface water at the toe of the Letart Landfill, and the resulting wet-weather stream that discharges into the Ohio River. However, these exposure routes are limited because of the remote location of the landfill, the very steep terrain, and the wet-weather nature of the stream. In addition, the fencing around the site limits trespasser access to the area, and the use of health and safety plans, standing operating procedures, and personal protective equipment also limits C-8 exposure for the on-site workers. Recommendations: Surface water and groundwater monitoring should continue at this site. The groundwater sampling should continue to be quarterly, while the outfall sampling can be either monthly or quarterly, as required by the site's NPDES permit. All three of the Zone A groundwater monitoring wells (LMW-1, LMW-7, and LMW-8) should be monitored for C-8 concentrations and groundwater flow direction. Zone F groundwater wells LMW-2A and LMW-12 should be monitored for C-8 concentrations and groundwater flow direction. Local Landfill: Conclusions: C-8 is believed to be migrating via surface water transport from the C-8 containing waste that has been disposed of within the landfill. Groundwater flow from the Local Landfill is toward the northwest at this site and toward the Ohio River valley. Flow is also towards the Washington Works Facility. C-8 detected within the one- and two-mile radius sampling areas near the Washington Works Facility and Local Landfill is likely to have been transported from the plant via air emissions. There are no known complete exposure pathways for human receptors that exceed the C-8 Assessment of Toxicity Team (CATT)-established C-8 drinking water screening level of 150 pg/l. Recommendations: Division of Water and Waste Management 000012 Final C-8 GIST Report Page 9 Surface water and groundwater monitoring should continue at this site. The groundwater sampling should continue to be semi-annually, while the outfall sampling can be either monthly or quarterly, as required by the site's NPDES permit. Three locations at the Local Landfill should be monitored: Outlet 101, Outlet LM1, and well LLMW-4. W ashington W orks Fac ility: Conclusions: The on-site Solid Waste Management Units (SWMUs) are believed to be the primary source of C-8 migration into the groundwater. Air deposition of C-8 onto the ground surface and its subsequent migration into the groundwater may also have occurred. No off-site migration of the groundwater is occurring, as long as DuPont's Western Well Field continues pumping. Some limited groundwater may migrate off-site in the northwest corner of the DuPont facility in response to the GE plant pumping their wells #3 and #4. Air emissions are believed to be the primary migration pathway of C-8 from the Washington Works Facility to adjacent areas in Ohio. Air emissions of C-8 from the Washington Works Facility are believed to be the source of C-8 detected in areas of West Virginia located adjacent to the facility and the Local Landfill. Air emissions of C-8 and the discharge of C-8 through the outfalls are believed to be the migration pathways of C-8 from the facility to the Ohio River, and-- most likely-- from the river to the public water supplies located downstream. Air emissions of C-8 from the plant are believed to be the source for C-8 along the Ohio River upstream of the plant. There are no known complete exposure pathways for human receptors that exceed the CATT-established C-8 drinking water screening level of 150 pg/l at the Washington Works Facility. Recommendations: Surface water and groundwater monitoring should continue at this site. The groundwater sampling should continue to be quarterly, while the outfall sampling can be either monthly or quarterly, as required by the site's NPDES permit. Division of Water and Waste Management 000013 Final C-8 GIST Report page 10 The following groundwater monitoring wells and outfalls require further monitoring at the Washington Works Facility: RO4-MW02, P04-MW-2, Q04MW02, VO5-PW01, NO4-MW-01, and Outfall 005. It is important that DuPont further investigates the high concentrations of C-8 in these wells, which are located at the Washington Works Facility adjacent to the Ohio River. DuPont has stated (in their February 2003 Summary Report) that C-8 is confined to a perched aquifer and that the deeper aquifer contains no C-8. Ta s k C: Task C required the determination of the vertical and horizontal extent of any and all C-8 impacted groundwater exceeding 1 pg/l. This task also included an assessment of C-8 impacted surface water and/or groundwater at the Letart Landfill and its impact on the Ohio River and nearby public water systems along the river. Groundwater Modeling: Groundwater modeling of the Washington Works Facility and surrounding area was conducted to evaluate the groundwater flow pathways and determine the potential of C-8 migration to off-site receptors. Conclusions: The Ohio River creates a groundwater divide in the Pleistocene alluvium under the river. As a result of production-well pumping at the Dupont Washington Works Facility and the neighboring GE facility, the C-8-impacted groundwater from the Washington Works Facility is not being drawn into either the Lubeck PSD municipal well field in West Virginia or the Little Hocking Water Association well field in Ohio. Some limited groundwater may migrate off-site in the northwest corner of the DuPont facility in response to GE pumping wells #3 and #4. Sources of C-8, for the Lubeck PSD and the Little Hocking Water Association, are coming from the Ohio River and dispersion by air. Recommendation: The URS Diamond model should be accepted as representing real-world conditions in determining groundwater flow and contaminant transport. Division of Water and Waste Management 000014 Final C-8 GIST Report page 11 INTRODUCTION C-8 has been used by DuPont since the early 1950's in its fluoropolymer related manufacturing processes. Residues containing C-8 from the fluoropolymer manufacturing processes at the Washington Works Facility are or have been released to the air, discharged to the Ohio River, disposed of at the facility, and otherwise shipped off-site for destruction and/or disposal. DuPont also captures for recycling a portion of used C-8. No permits issued to Dupont authorizing release of pollutants to the environment contain specific limitations on the amount of C-8 that may be released. Since as early as 1990, DuPont has performed regular, voluntary water sampling to detect the presence and level of C-8 in and around its facilities in West Virginia, and has reported the results of these samplings to WVDEP. As a result of DuPont's sampling, C-8 has been detected in varying concentrations in private and public water supplies. DuPont, by and through its use of C-8 in the fluoropolymer manufacturing process, was considered the likely source. The federal Environmental Protection Agency (EPA), WVDEP, and WVDHHRBPH determined that it was desirable to ascertain the source of C-8 in drinking water for persons potentially exposed to groundwater or surface waters in the area of these facilities. The EPA, WVDEP, and WVDHHR-BPH requested that DuPont submit all information and documents relating to the detection and presence of C-8 in and around these facilities. The agencies concluded that it would be of great importance to have sufficient data upon which to determine the potential exposure risk of the presence of C-8 in the environment. Therefore, a C-8 Groundwater Investigation Steering Team (GIST) was established in the Consent Order to oversee investigations and activities that would be conducted to assess the presence and extent of C-8 in drinking water, groundwater, and surface water at and around the main plant, and the Local, Dry Run, and Letart Landfills. The GIST was made up of a team of scientists assembled from the WVDEP, WVDHHR-BPH, EPA Region III, and DuPont. In May 2002 a Memorandum of Understanding (MOU) was signed by WVDEP, WVDHHR-PBH, and DuPont with the Ohio EPA. The MOU established guidelines for Ohio EPA's participation in the GIST due to the discovery of C-8 in Ohio public drinking water supplies. DuPont, through an agreed-upon third party and under the supervision of the GIST, conducted the groundwater use and well survey identification and sampling of groundwater wells and other water sources (/.e., springs and cisterns) within the onemile radius of the Washington Works Facility and the three landfills. Identification and sampling of private wells was contingent upon landowner permission. Based upon concentrations of C-8 found in water sources, the GIST through the Consent Order was empowered to possibly expand the radial survey distance to include wells within a two- Division of Water and Waste Management 000015 Final C-8 GIST Report__________________________________________ page 12 or three-mile radius of the Washington Works Facility and the three landfills. Historical data and hydrogeologic information was evaluated in order to prioritize the initial scope of work for continuing groundwater monitoring and any additional investigation activities (e.g. monitoring well installations) required under Task C Plume Identification. Upon conclusion of the Tasks set forth in the Consent Order, the GIST was charged with preparing a final report with findings and conclusions regarding groundwater quality, and the extent of groundwater impacts. The final GIST report provides conclusions and makes recommendations regarding the need to conduct further work, or to take actions necessary to assure protection of groundwater quality and human health. The following report summarizes those findings, conclusions, and recommendations of the GIST in fulfillment of the Consent Order. Division of Water and Waste Management 000016 Final C-8 GIST Report Pa9e 1 3 WEST VIRGINIA PRIVATE WATER SUPPLY SOURCES Pursuant to Attachment A of the Consent Order, the Groundwater Use and Well Survey involved evaluating C-8 in groundwater initially within a one-mile radius from the Washington Works Facility and the three landfills (Local, Letart, and Dry Run) by sampling water from wells, cisterns, and springs. The area was expanded to a two-mile radius at the Washington Works Facility and the Local Landfill based on the initial results obtained from the one-mile radius survey and sampling. Between March 2002 and October 2002, DuPont's third-party contractor, Potesta Associates, Inc., performed a door-to-door well survey and collected samples following protocols established by the multi-media consent order. Representatives from the WVDEP and the Wood County Health Department accompanied Potesta Associates, Inc. personnel during the initial door-to-door survey. W ashington W orks Facility and Local La n d fill: In April 2002, DuPont submitted a report to the GIST documenting the well survey and C-8 sample results within a one-mile radial distance around the DuPont Washington Works Facility and the Local Landfill. Because of the proximity of the Local Landfill to the DuPont Washington Works Facility, groundwater wells located within the combined one-mile radius (of both sites) in West Virginia were sampled. A total of 44 samples were collected from drinking water wells, non-drinking water wells, unused wells, springs, and cisterns. The C-8 concentration from drinking water wells ranged from 0.328 pg/l to 2.8 pg/l. The highest concentration of C-8 from the category of non-drinking water wells and unused wells was 14.3 pg/l. C-8 was detected in all wells, springs, and cisterns sampled within the one-mile radius. A total of two samples collected in the one-mile radius had concentrations of C-8 abovelO pg/l. Because of the levels found in the onemile radius of the Washington Works Facility and the Local Landfill, the private water supply sources survey was extended by the GIST to a two-mile radius. In addition, private and industrial water supplies used for drinking water were sampled on a monthly basis until the CATT drinking water screening concentration of 150 pg/l was developed. The private water supply sources survey and C-8 sampling results within the one- to two-mile radius of the DuPont Washington Works Facility and the local landfill were submitted on August 2002 to the GIST. A total of 65 samples were collected and analyzed for C-8 including drinking water wells. The C-8 concentrations measured in drinking water wells ranged from non-detect (<0.010 pg/l) to 0.889 pg/l- The highest concentration of C-8 from non-drinking water wells or unused wells was 1.57 pg/l. A spring sample, used for drinking water, had a concentration of 1.8 pg/l. Due to measured concentrations of C-8 in the two-mile radius indicating a decreasing trend in distance from the Washington Works Facility, the GIST determined that additional samples beyond the two-mile radius were not necessary. Division of Water and Waste Management 000017 Final C-8 GIST Report Page 14 In summary, C-8 was detected in 100% and 79% of the private water supply sources sampled in the one- and two-mile areas, respectively. The concentrations of C-8 were lower in the two-mile radius area as compared to the one-mile radius. No private water supply sources in the one- or two-mile radius area exceeded the CATT-established C-8 drinking water screening level of 150 pg/l. The widespread distribution of C-8 in private water supply sources, combined with the lack of groundwater flow to this area from the Washington Works Facility and the Local Landfill facilities, indicates that air emissions may be the primary migration pathway of C-8 from the facility to adjacent areas in West Virginia. Recommend ations: Under the Consent Order, a significant number of private water supply samples have been collected that document the extent and current concentrations of C-8 in groundwater within the one- and two-mile radial areas. Most locations have been sampled at least once. It is unknown whether the concentrations detected in groundwater are the result of historic air deposition or result of air deposition in the last couple of years. Therefore, the GIST recommends that DuPont collect additional samples from the following selective locations to evaluate the current trend of C-8 concentrations in private water sources. Additional samples should be collected from the following sample locations, with the owner's permission: Drinking water wells with detected levels of C-8, Drinking water springs with detected levels of C-8, Non-drinking water wells with detected levels of C-8, Springs and cisterns with detected levels of C-8, and Wells or springs used for cattle above 5 pg/l (total 1). The GIST recommends selecting ten of these locations, with at least one or more from each category, for quarterly sampling for one year. Subsequently, the frequency of the sampling should then be re-evaluated. Letart Landfill: In April 2002, DuPont submitted a report to the GIST documenting the well survey and C-8 sampling results within the one-mile radial area around Letart Landfill. A total of 30 samples were collected from drinking water wells, non-drinking water wells, unused wells, springs, and cisterns. The C-8 concentration from drinking water wells ranged from non-detect (<0.01 pg/l) to 0.139 pg/l. The highest concentration of C-8 from the category of non-drinking water wells was 0.636 pg/l, from Brinker Run, which was named for sampling purposes" Route 33 Unnamed Stream." This concentration may be the result of surface water infiltration from the Letart Landfill into Brinker Run. Due to the low C-8 concentrations found at the Letart Landfill, and in the private water supply sources the survey was not extended by the GIST to a two-mile radial area. Division of Water and Waste Management 000018 Final C-8 GIST Report page 15 In summary, C-8 was detected in 6% of the private water supply sources sampled in the one-mile radial area. No private water supply sources samples exceeded the CATT-established C-8 drinking water screening level of 150 pg/l. Recommend ations: Under the Consent Order, a significant number of private water supply samples were collected that document the extent and current concentrations of C-8 in private water supplies within a one-mile radius of the Letart Landfill. Each location was sampled at least once. The C-8 concentrations measured in all Letart Landfill one-mile radius samples were non detect or not quantifiable, except for one sample collected from a well used for drinking water that had a concentration of 0.139 pg/l and one sample collected from an unused well that had a concentration of 0.639 pg/l. The GIST required that the drinking water well with the C-8 concentration of 0.139 pg/l be resampled. The resident refused to have the well resampled. Each location has thus been sampled a single time, and there is no clear trend as to whether the concentrations of C-8 detected in groundwater are increasing or decreasing. Therefore, the GIST is recommending that DuPont collect yearly samples from the GERLACHIBA and the BRINKERA private water supply sources, contingent upon permission of the well-owners, to evaluate the trend of C-8 concentrations in the private drinking water supplies. This sampling frequency should then be re-evaluated. Dry R un La nd fill: In April 2002, DuPont submitted a report to the GIST documenting the well survey and C-8 sampling results within the one-mile radius area around Dry Run Landfill. A total of 53 samples were collected from drinking water wells, non-drinking water wells, unused wells, springs, and cisterns. The C-8 concentrations from drinking water wells ranged from non-detect (<0.01 pg/l) to 0.422 pg/l. The highest concentration of C-8 from the category of non-drinking water wells and unused wells was 0.839 pg/l. Due to the low levels of C-8 found at the Dry Run Landfill, the private water supply survey was not extended by the GIST to a two-mile radial area. In summary, C-8 was detected in 60% of the private water supply samples collected in the one-mile area. No private water samples in the one-mile radius exceeded the CATT-established C-8 drinking water screening level of 150 pg/l. The widespread distribution of C-8 in private water supply supplies within the one-mile radial area of Dry Run Landfill indicates that air emissions may be the primary migration pathway for C-8 from the Washington Works Facility. This assumption was made due to the lack of groundwater flow into these areas. Recommend ations: Under the Consent Order, a significant number of private water supply samples Division of Water and Waste Management Final C-8 GIST Report Page 16 have been collected that document the extent and current concentrations of C-8 in groundwater within a one-mile radius of the Dry Run Landfill. It is unknown whether the concentrations detected in the groundwater are the result of historic or recent air emission sampled at each locations only once. Therefore, the GIST recommends that DuPont collect additional samples from selective locations to evaluate the trend of C-8 concentrations. The criteria to select repeat sample locations, with the owners' permission, may include: Drinking water wells with detectable levels of C-8, Drinking water springs with detectable levels of C-8, and Springs and cisterns with detectable levels of C-8. The VWDHHR-BPH and WVDEP recommend selecting ten, with at least one or more from each category, of these locations for quarterly sampling for one year. The sample frequency for sampling private water supplies should then be re-evaluated. Summary o f C-8 R esults in Private W ater Supply Systems at the Concentration of C-8 (|jg/l) Drinking W ater Wells -1 0 Non-drinking / Unused Wells 28 Springs and Cisterns -1 0 Division of Water and Waste Management Final C-8 GIST Report page 17 Summary of C-8 Results in Private Water Supply Systems at the Washington Works Facility and Local Landfill (2 Mile Radius) Summary of C-8 Results in Private Water Supply Systems at the Letart Landfill (1 Mile Radius) Concentration of C-8 (tjg/l) Drinking W ater Wells - 11 Non-drinking / Unused W ells - 19 Division of Water and Waste Management 000021 Final C-8 GIST Report Page18 Summary o f C-8 Results in Private Water Supply Systems at the Dry Run Landfill (1 Mile Radius) Division of Water and Waste Management 000022 Final C-8 GIST Report page 19 OHIO PRIVATE WATER SUPPLY SOURCES As a result of C-8 being detected in the Little Hocking Public Water Supply in December 2001, Ohio EPA and DuPont, in addition to the work being performed under the West Virginia Consent Order, agreed to expand the private water supply sources water use survey and C-8 sampling into Ohio within a one-mile radial distance from the Washington Works Facility. Between March and June of 2002, Potesta Associates, Inc. personnel performed a door-to-door well survey and collected samples from private water supply wells, springs, and cisterns. The samples were collected following the protocols established by the multi-media Consent Order between DuPont, the WVDEP, and the WVDHHR-BPH. Representatives from the Washington County Health Department, Ohio Department of Health, or the Ohio EPA accompanied Potesta Associates, Inc.'s personnel during the initial door-to-door well survey. In August 2002, DuPont submitted a report to the GIST and Ohio EPA documenting the well survey and C-8 sample results within the one-mile radial area. A total of 69 samples were collected from drinking water wells, non-drinking water wells, unused wells, springs, and cisterns. The C-8 concentrations measured for drinking water wells ranged from non detect (<0.01 pg/l) to 8.59 pg/l, while a single spring used for drinking water was 1.29 pg/l. The highest concentration of C-8 from the category of non-drinking water wells and unused wells was 16.9 pg/l. C-8 was detected in all the springs and cisterns sampled within the one-mile radius, including a concentration of 23.6 |jg/l in a spring used for livestock. Overall, a total of nine samples collected in the one-mile radius had concentrations of C-8 above 10 pg/l. Because some of these higher concentrations of C-8 were detected at the outer limit of the one-mile radius, DuPont agreed to expand the sampling effort in Ohio to two miles from the Washington Works Facility. The private water supply survey and C-8 sampling within the one- to two-mile radius of the facility were completed in September of 2002. The results were documented in a report submitted by DuPont to the GIST and Ohio EPA in December 2002. A total of 63 samples were collected and analyzed for C-8, including 50 drinking water wells. The C-8 concentrations measured in drinking water wells ranged from non detect (<0.01 pg/l) to 6.5 pg/l. No cisterns and springs sampled in the two-mile radius were used for drinking water. The highest concentration of C-8 from non-drinking water wells or unused wells was 8.68 pg/l. One spring sampled for C-8 had a concentration of 3.02 pg/l. Overall, no concentrations of C-8 were detected above 10 pg/l within the one- to two-mile radius. In summary, C-8 was detected in approximately 94% and 77% of the private water supply samples collected in the one- and two-mile areas, respectively. In general, the concentrations of C-8 are lower in the two-mile radius area as compared to the one-mile radius. Because measured concentrations in the two-mile radius indicated a decreasing trend in distance from the Washington Works Facility, the Ohio EPA and DuPont determined that additional sampling beyond the two-mile radius was not necessary. No private water supply samples in the one- or two-mile radius exceeded Division of Water and Waste Management 000023 Final C-8 GIST Report agglQ the CATT-established C-8 drinking water screening level of 150 pg/l. The wide spread distribution of C-8 in private water sources, along with the lack of a groundwater pathway, indicates that air emissions are the primary migration pathway of C-8 from the Washington Works Facility to adjacent areas in Ohio. Recommenda tions: At the request of the Ohio EPA, DuPont has collected a significant number of private water supply samples in Ohio that document the extent and current concentration of C-8 in groundwater, springs, and cisterns, within two miles of their Washington Works Facility. Each location has been sampled once, and it is currently unclear as to whether the concentrations detected in private water sources are reflective of historic air emissions or air emissions in the last couple of years. Therefore, to evaluate the trend of C-8 concentrations, the Ohio EPA recommends that DuPont collect additional samples with the owners' permission from the following categories of private water sources: Drinking water wells with detectable levels of C-8, Drinking water spring with detectable levels of C-8, Non-drinking water wells with detectable levels of C-8, and Springs and cisterns with detectable levels of C-8. The Ohio EPA recommends selecting at least ten locations with one of more samples from each category for quarterly sampling for one year. Subsequently, the frequency of sampling will be re-evaluated by the Ohio EPA and DuPont. Ohio 1 Mile Radius 25 20 15 10 Drinking W ater Wells -18 Non-drinking / Unused Wells- 30 Springs and Cisterns - 21 Concentration of C8 (pg/l) Division of Water and Waste Management U00024 Concentrations of C8 (pg/l) Final C-8 GIST Report 25 20 15 10 Drinking Water Wells - 50 Ohio 2 Mile Radius gg.g.,2 1 iL Non-drinking / Unused Weils - 9 Springs and Cisterns - 4 Division of Water and Waste Management 000025 Final C-8 GIST Report________________ _________________________ Page 22 WEST VIRGINIA PUBLIC WATER SUPPLY SOURCES Public Water Supply Sources (PWSSs) in West Virginia along the Ohio River were sampled at various points upstream and downstream of the DuPont Washington Works Facility pursuant to the Consent Order. Initial sampling of PWSSs within a one-mile upstream and ten miles downstream of the facility began in December 2001. Based on the C-8 concentrations measured, the sample area was expanded to include PWSs located as far as seven miles upstream of the facility and 54 miles downstream. Sampling efforts between January 2002 to March 2003 resulted in the following findings: Public Water System River Miles from Washington Works Parkersburg Water Department -7 Blennerhassett Island State Park -1 DuPont Washington Works Facility 0 General Electric 1.5 Lubeck PSD Bellville Hydro Electric Recreation Ravenswood Municipal Water Works Mason County PSD-- Letart 4.5 14 31 45 Sampling Dates Well Field Results (C-8 pg/l) Mar and Apr 2002 Jan 2002 Well #1: 0.0686 to 0.0746 Well #2: ND Well #3: ND Well #4: ND Well #5: ND Well #1: 0.165 Jan 2002 Mar 2003 Jan, Feb, and Apr 2002 Jan 2002 to Feb 2003 Jan 2002 AM07-PW01: NQ to 0.335 AO08-PW01: 0.308 to 0.499 AX13-PW01: 0.721 to 1.42 Well #3: 1.75 to 1.87 Well A: 0.683 to 0.938 Well B: 0.443 to 0.61 Well C: 0.398 to 0.592 Well D: 0.397 to 0.758 Well E: 0.332 to 1.21 Well F: 0.283 to 1.04 Not tested Mar 2002 Jan, Mar, and Apr 2002 Well #1: ND Well #2: ND Well #3: ND Well #4: ND Well #5: ND Well #1: NQ Well #2: 0.0618 to 0.0838 Well #3: 0.063 to 0.102 Distribution System Results (C-8 pgA) NQ Not tested Not tested Not tested 0.6 to 0.69 ND NQ Not tested Division of Water and Waste Management 000026 Final C-8 GIST Report page 23 Racine Locks and Dam New Haven Water Department 48 54 Jan 2002 Apr 2002 Not tested Well #1; NQ 0.518 ND A negative stream mile value refers to a location upstream from the Washington Works Facility. A positive number refers to a location downstream from that facility. ** ND refers to a "Non Detect" concentration that is at or below the laboratory's minimum detection limit. The listed concentration can vary by instrument and time; however, the Non Detect concentration for C-8 for this period of time is 0.01 pg/l. *** NQ refers to "Not Quantifiable." It is a concentration that is below the laboratory's minimum detection limit and is therefore below the level of quantification. The Not Quantifiable concentration for C-8 for this period of time is 0.05 pg/l. Upon completion of the C-8 Assessment of Toxicity Team (CATT) study establishing a drinking water screening level of 150 pg/l for C-8, sampling efforts were discontinued for General Electric, Parkersburg Water Department, Blennerhassett Island State Park, Bellville Hydro Electric Recreation Plant, Ravenswood Municipal, Mason County PSD-- Letart, Racine Locks and Dam, and New Haven Water Department based on the measured low concentrations. Sampling was continued at the DuPont Washington Works Facility and Lubeck PSD on a quarterly basis to continue to evaluate trends in C-8 concentrations. Conclusions: The completion of the groundwater studies and sampling efforts performed as a part of the C-8 GIST study have resulted in the following conclusions regarding the source of C-8 in the West Virginia PWSSs: Parkersburg Water Department and Blennerhassett Island State Park: It is believed that the C-8 levels are transported from the DuPont Washington Works Facility via air emissions. Please note that C-8 transported in air emissions and deposited on surfaces is likely to be mobilized by precipitation and migrate via water transport to surface and/or groundwater. DuPont Washington PSD: It is believed that the C-8 levels are transported via air emissions, and from groundwater migration from C-8-containing materials in the on-site Solid Waste Management Units at the Washington Works Facility. General Electric: It is believed that the C-8 levels are transported from the DuPont Washington Works Facility via air emissions associated with the infiltration of precipitation or from production-well-induced recharge from the Ohio River impacted with wastewater discharges from the DuPont Washington Works Facility. Lubeck PSD: It is believed that the C-8 levels are associated with pumping-induced recharge of surface water from the DuPont Washington Works Facility's wastewater discharges to the Ohio River and possibly via air deposition. Division of Water and Waste Management 000027 Final C-8 GIST Report P ^ e 24 Mason County PSD-- Letart: It is believed that the C-8 levels are derived from pumping-induced recharge of surface water from DuPont Washington Works Facility's wastewater discharges to the Ohio River. Racine Locks and Dam: It is believed that the C-8 levels are derived by pumpinginduced recharge of surface water from the DuPont Washington Works Facility and/or the Letart Landfill leachate discharges to the Ohio River. Recommend ations: Considering this data, it is the GIST'S recommendation that DuPont continue the following for the PWSSs: Lubeck PSD, DuPont Washington Works Facility, and General Electric: Quarterly sampling of wells for two years to ensure that C-8 levels are being maintained or reduced. Conduct a limited field investigation to determine the extent and concentration of C-8 in soil at the Lubeck PSD in the vicinity of their production wells. When the soil sample results are available and the data is evaluated, the GIST will determine what additional sampling activities are necessary to complete the investigation. DuPont will submit a report documenting the sampling investigation and the C-8 results to the GIST when the results are finalized. After two years, the sampling program will be re-evaluated. Blennerhassett Island State Park and Mason County PSD-- Letart: Annual sampling for a two-year period to ensure C-8 levels are being maintained or reduced. After two years, the sampling program will be re-evaluated. Racine Lock and Dam: Annual sampling for a two-year period to evaluate levels of C-8 due to the upstream proximity of the Letart Landfill, and to ensure that C-8 levels are being maintained or reduced. After two years, the sampling program will be re evaluated. Parkersburg Water Department, Bellville Hydro Electric Recreation Plant, Ravenswood Municipal Water Works, and New Haven Water Department: No further action is deemed necessary at this time. Division of Water and Waste Management 000028 Final C-8 GIST Report page 25 OHIO PUBLIC WATER SUPPLY SOURCES Task A of the GIST Team Objectives and Efforts required DuPont to perform sampling of the public water supply sources along the Ohio River. As a result, the well field for the Little Hocking Water Association Public Water System was sampled for C-8 in December, 2001. The sampling results within the well field and subsequent monitoring allowed the GIST to expand the area of monitoring to include public water systems five miles up and 57 miles down the river from the Washington Works Facility. Sampling efforts between December 2001 to February 2003 have resulted in the following findings: Public Water System Little Hocking Water Association River Miles from Washington Works -0.5 Sampling Dates Dec 2001 Jan, Feb, Mar, Apr, Aug, and Oct 2002 Feb 2003 City of Belpre -4.6 Feb, Mar, and Apr 2002 Tuppers Plains/ Chester Water District Village of Racine Village of Syracuse Village of Pomeroy 14.15 51.15 56.9 56.9 Feb, Mar, Apr, Jul, and Oct 2002 Feb 2003 Mar 2002 Mar and Apr 2002 Mar and Apr 2002 Well Field Results (C-8 pg/l) Well #1: 1.82 to 3.65 Well #2: 2.07 to 4.26 Well #3: 0.42 to 0.952 Well #5: 5.69 to 8.58 Well #1: 0.0995 to 0.13 Well #2: NQ Well #3: 0.12 to 0.141 Well #4: 0.101 to 0.133 Well #5: 0.103 to 0.111 Well #1: 0.486 to 0.726 Well #2: 0.235 to 0.417 Well #3: ND to NQ Well #4: ND to 0.076 Well #5: 0.201 to 0.297 Well #6: 0.433 to 0.649 Well #1: ND Well #2: ND Well #3: ND North Well: 0.208 - 0.491 South Well: ND Well #1: ND Well #2: ND to 0.06 Well #4: 0.071 to 0.085 Distribution System Results (C-8 fjg/l) 1.82 to 4.29 0.081 to 0.12 0.24 to 0.363 ND ND 0.063 to 0.066 * A negative stream mile value refers to a location upstream from the Washington Works Facility. A positive number refers to a location downstream from that facility. ** ND refers to a "Non Detect" concentration that is at or below the laboratory's minimum detection limit. The listed concentration can vary by instrument and time; however, the Non Detect concentration for C-8 for this period of time is 0.01 pg/l. *** NQ refers to "Not Quantifiable." It is a concentration that is below the laboratory's minimum detection limit and is therefore below the level of quantification. The Not Quantifiable concentration for C-8 for this period of time is 0.05 pg/l. Division of Water and Waste Management 000029 Final C-8 GIST Report Page 26 Upon completion of the CATT study in which a drinking water screening level of 150 pg/l for C-8 was established, sampling efforts were discontinued for the City of Belpre and the Villages of Racine, Syracuse, and Pomeroy. However, quarterly sampling was continued for the Little Hocking Water Association and the Tuppers Plains Water Systems in order to further evaluate C-8 concentration trends. Conclusions: The completion of the groundwater modeling and sampling efforts performed as part of the GIST study have resulted in the following conclusions being drawn concerning the source of C-8 contamination in Ohio public water systems: Little Hocking: Mainly air deposition from Washington Works Facility's stack discharges; however, pumping-induced recharge of surface water contamination from Washington Works Facility wastewater discharges to the Ohio River may have also contributed. Belpre: Air deposition from Washington Works Facility's stack discharges. Tuppers Plains: Pumping-induced recharge of surface water contamination from Washington Works Facility wastewater discharges to the Ohio River. Village of Racine: No discernible contamination. Syracuse and Pomeroy: Pumping-induced recharge of surface water contamination from the Washington Works Facility and/or the Letart Landfill leachate discharges to the Ohio River. Considering the public water system data, and the elevated levels of C-8 noted in the Test Well 4 Investigation (see below), the GIST recommends that DuPont continue quarterly sampling of both the production wells and entry point for the Little Hocking Water Association public water system for two years. Also, annual sampling for the Tuppers Plains Water System (production wells and entry point) to ensure continued reduction of C-8 is advised. At this time, no further action is deemed necessary for the Villages of Belpre, Racine, Syracuse, or Pomeroy. After two years, the sampling frequency will be re-evaluated. Little Hocking W ater Association W ell Field Investigation: In addition to sampling Little Hocking Water Association's production wells, DuPont has periodically sampled ten test wells (/.e., monitoring wells) within the Little Hocking Water Association well field. The concentration of C-8 is less than 2 pg/l in most of these test wells; however, a few wells exceeded 4 pg/l. In one test well, TW-4, the concentration of C-8 was measured at 37.1 pg/l in January of 2002. Subsequent sampling of TW-4 indicates generally decreasing concentrations of C-8 at 33.3 pg/l Division of Water and Waste Management 000030 Final C-8 GIST Report page 27 (March 2002), 28.7 pg/l (April 2002), 12.3 pg/l (August 2002), and 14.5 pg/l (October 2002). However, in February 2003, the concentration in well TW-4 rose to 22.5 pg/l, indicating possible seasonal effects on this well. At the request of the Ohio EPA, DuPont conducted a field investigation in the Little Hocking Water Association Well Field between August 19th and August 30th, 2002. The purpose of this investigation was to determine the extent and concentration of C-8 in soil and groundwater in the vicinity of test well TW-4. Groundwater sample results collected during this investigation ranged from non detect (<0.01 pg/l) to 78.0 pg/l of C-8. The highest C-8 concentration detected in soil from the well field is 170 pg/kg. A report documenting the results of the investigation was submitted by DuPont to the Ohio EPA and GIST in April of 2003. Once an evaluation of this report is complete, the Ohio EPA and DuPont will determine what additional activities are necessary to compete the investigation. Division of Water and Waste Management 000031 Final C-8 GIST Report page 28 OHIO RIVER SAMPLING Ohio River sampling activities were conducted to determine the concentrations and extent of C-8 in the Ohio River. Samples were collected from 12 river transects and 19 locations, and multiple depths were sampled at many of the locations. The most distant river sampling locations were approximately 28 miles upstream and 46 miles downstream from the DuPont Washington Works Facility to determine background levels of C-8. Samples were collected adjacent to and below the DuPont Plant to determine the concentrations of C-8 in the river. The final part of the river sampling was adjacent to the Letart Landfill to determine if concentrations of C-8 were present there. At the end of the Ohio River sampling, 49 water samples were taken, with the following results: Transect River Number Mile 1 161.7 2 179.2 3 185.8 4 189.9 190.3 5 190.4 6 191.0 7 192.7 8 194.0 9 201.2 10 209.3 11 236.3 236.3 12 236.5 Number of across-river samples 1 1 1 3 3 3 2 1 1 1 1 1 Depths Number of Samples collected dip and mid-column 2 dip and mid-column 2 dip, mid-column, and bottom 3 dip, mid-column, and bottom 9 Washington Works Plant outfalls dip, mid-column, and bottom 10* dip, mid-column, and bottom 9 dip, mid-column, and bottom 7* dip and mid-column 2 dip and mid-column 2 dip and mid-column 2 dip and mid-column 2 Letart Landfill dip and mid-column 3* Average C-8 Concentration (ugA) <0.01 <0.01 <0.01 <0.01 <0.01 <0.01 0.1167 1.0445 0.295 0.2375 0.105 0.10755 * includes a duplicate sample. Division of Water and Waste Management 000032 Final C-8 GIST Report page 29 Conclusions: No river sample exceeded the CATT-established C-8 drinking water screening level of 150 pg/l for any of the Ohio River samples. No additional river sampling is thus required as a part of the Consent Order; however, sampling should continue as part of the Washington Works Facility and Letart Landfill NPDES outfall monitoring. Division of Water and Waste Management UU0033 Final C-8 GIST Report page 30 SURFACE WATER AND GROUNDWATER MONITORING It should be noted that site location maps, top-of-groundwater maps, and site geological maps are located in Appendix A, and that a complete set of groundwater data (in both table and graph form) is located in Appendix B. These data included with this final GIST report ends with the March 2003 sampling. The hydrological information is from the February 2003 Summary Report. It should also be noted that the data displayed here (both historical and recent) have been generated using several different analytical methods. Prior to 1991, DuPont performed the C-8 analysis at the DuPont Experimental Station in Wilmington, Delaware. In 1991, when the Resource Conservation and Recovery Act (RCRA) Verification Investigation was conducted at the Washington Works plant, the analysis was contracted to the CH2MHill Laboratory in Montgomery, Alabama. Both of these laboratories used a Gas Chromatography-Electron Capture Detected-based analytical methods with detection limits for C-8 that ranged from 0.1 to 1.0 pg/l. CH2MHill conducted the C-8 analysis into the fall of 1998 when the laboratory ceased operation. At that time, the analytical work was transferred to Lancaster Laboratories, in Lancaster, Pennsylvania. DuPont continued to use this facility until October 2001, when development and testing was completed on a new analytical method utilized by Exygen Research, Inc., located in State College, Pennsylvania. This method uses a Liquid Chromatography-Tandem Mass Spectrometry. DuPont adopted the regular use of this method in November of 2001. Historical Work: Before any assessment could be made of the groundwater and surface water at the four DuPont locations, a summary of the historical data was compiled. This was submitted by DuPont in January of 2002 in the document, Compilation of Historical C-8 Data, DuPont Washington Works Facility, Main Plant, and Landfills. This report included a brief historical, geological, and hydrogeological overview of the four sites (Washington Works Facility, Local Landfill, Dry Run Landfill, and Letart Landfill), and identified three data gaps: the need for additional groundwater monitoring wells, continued refinement of the groundwater model at the main plant, and the need to evaluate the Ohio River surface water. This report also included location maps for the four sites, multiple geological cross-sections, four top-of-groundwater maps for each facility, and construction details for the groundwater monitoring wells. Many of the locations were sampled only once; however, samples had been collected from other locations on as many as 17 occasions. The information submitted on the four sites' historical sampling locations was as follows: Division of Water and Waste Management 000034 Final C-8 GIST Report Pa9e 31 Facility Washington Works Local Landfill Dry Run Landfill Letart Landfill Outfalls Sampled 2 6 1 2 Other Surface Water Locations Sampled 2 2 5 6 Groundwater Monitoring Wells Sampled 62 4 9 Zone A: 3 Zone B: 0 ZoneC: 1 Zone D-E: 3 Zone: F: 4 On-Site Drinking Water Locations Sampled 4 0 0 0 To satisfy Task B of the GIST requirements, regular surface water and groundwater monitoring for C-8 then began in December of 2001. At first the groundwater sampling was monthly; however, this interval was modified to quarterly once the initial four sampling events were conducted. The surface water was (and still is) sampled each month. To date, including the historical data, the four DuPont sites have been sampled for C-8 for the following number of locations and occasions: Facility Water Type Washington Works Local Landfill Dry Run Landfill Letart Landfill Surface Groundwater Surface Groundwater Zone A Groundwater Zone B Groundwater Zone C Groundwater Zone D Surface Groundwater Zone A Groundwater Zone B Groundwater Zone C Surface Groundwater Zone A Groundwater Zone B Groundwater Zone C Maximum Number of Sample points 6 20 6 4 1 3 1 8 3 12 1 6 3 0 1 Maximum Number of occasions 26 19 23 13 2 2 2 22 18 18 2 25 21 0 10 Division of Water and Waste Management 000035 Final C-8 GIST Report Groundwater Zone D-E Groundwater Zone F 5 8 page 32 13 25 To satisfy Task C of the GIST requirements, it was also recognized that all of the four DuPont locations required additional groundwater monitoring wells. The following wells were added in August of 2002: Number Type Maximum depth Washington Works Facility Three Bedrock about 100 feet Local Landfill Four Overburden Four Bedrock about 65 feet Letart Landfill Two Zone A about 40 feet Four Zone F about 155 feet Dry Run Landfill Six Overburden Six Bedrock about 175 feet Drilling rig Rotosonic Hollow-stem auger Air rotary Air rotary Air rotary Hollow-stem auger Air rotary Diameter 2-inch 2-inch 2-inch 2-inch 2-inch 2-inch 2-inch Screen length 20-foot 5 to 10 feet 20-foot 20-foot 20-foot 5 to 10 feet 2-foot These new wells, first sampled in October 2002, fill in missing gaps in the groundwater well fields. They provide a complete encirclement of the four DuPont locations, and should identify any C-8 groundwater plumes migrating from any of the four sites. Results and Conclusions: Dry Run Land fill: The Dry Run Landfill is located west of the town of Lbeck, on the headwaters of Dry Run in southwestern Wood County. The site is about eight miles southwest of the Washington Works Facility and the Local Landfill, at 39 1T 07" North Latitude and 81 4T 18" West Longitude. Dry Run begins at the toe of the landfill and flows to the northwest. It is a tributary of the North Fork of Lee's Creek, which flows into the Ohio River. The landfill is situated on the dissected Appalachian Plateau, and is underlain by the sandstones and shales of the Dunkard Group, which are of late Pennsylvanian or Permian age. The Dry Run Landfill began operation in 1986, and the central portion is Division of Water and Waste Management 000036 Final C-8 GIST Report page 33 still active and operates under WV-NPDES Permit No. WV0076244. The upper (southeastern) portion of the landfill is closed and covered with a soil and vegetative cover. The lower (northwestern) portion also closed and is covered by an engineeredlandfill cap. The Dry Run Landfill is about 17 acres in size, and is approximately 690 feet wide and 1500 feet long, with an elevation rise of about 250 feet. It is oriented in a southeast and northwest direction, and is constructed in an old, v-shaped valley above Dry Run. Physically, the site is a long grassy slope of fill material surrounded (and situated on) the small valley's native rock and soil. The site borders no highways, residential, or industrial areas. In the late 1980s, waste sludge materials from an anaerobic digestion pond (from the main plant) was placed in the upper, southeastern side of the landfill. Geologically, the bedrock beneath the landfill is comprised of individual layers of shale, silty clay, and sandstone and siltstone. Within this sequence the three dominant aquifers are nearly continuous sandstone and siltstone. These have been labeled by DuPont-- beginning with the October 2002 groundwater monitoring report-- as Zone A, Zone B, and Zone C, with Zone C being the deepest. Zone B is considered the main groundwater zone, and has eleven wells screened through it-- five of these wells are newly constructed and have only been sampled on one occasion. Zone A has three wells screened within it, and Zone C has only one well. The Zone A groundwater flows to the west-northwest, and has a gradient of 0.055 vertical feet per horizontal foot. The zone varies in depth between zero (to the northwest) and 200 feet deep (to the southeast). It is between 25 and 35 feet thick. The C-8 plume, based on three wells, appears to be moving to the west-northwest and down the axis of Dry Run. Of the three Zone A groundwater monitoring wells, one-- located northeast of the Dry Run Valley-- has consistently contained concentrations below 1 pg/l. A second well, located to the southwest of the valley, contains concentrations of between 0.2 and 5 pg/l. The third well, DRMW-13, has contained the highest concentrations of C-8, ranging from 3.6 to 20.9 pg/l. This well is located in the middle of Zone A and the Dry Run valley. The Zone B groundwater flow appears to be moving in an arc that varies between a northwestern direction in the upper southeastern portion of the site, and in a western direction in the lower western part of the site. The zone is about ten feet thick with a gradient between 0.006 and 0.023 vertical feet per horizontal foot. Zone B varies in depth from between 220 feet deep under the southeastern portion of the site to just a few feet below the surface at the toe of the landfill. It may be breached by the Dry Run surface stream northwest of the landfill. All of the wells surrounding Zone B were sampled in October 2002. Only six wells in the down-gradient western part of the landfill contained detectable concentrations of C-8. The well which consistently contains the highest concentrations of C-8 is well DRMW-13A, located directly in the Dry Run Valley and is adjacent to well DRMW-13. The C-8 concentration in well Division of Water and Waste Management 000037 Final C-8 GIST Report Page 34 DRMW-13A is less than in well DRMW-13; however, it does seem to indicate that Zone B's plume is also moving directly down the Dry Run valley. As stated previously, Zone C is the deepest of the three groundwater zones. This zone is only penetrated by one groundwater monitoring well, DRMW-21B. Zone C is located approximately 120 feet below the Dry Run valley, and it has not been determined if it extends to the southeast and under the landfill. Zone C is at least 45 feet thick, and may be confined, as the groundwater surface in the well extended above the well's screen and the top of the sandstone-siltstone layer in the October 2002 sampling. Without additional wells penetrating Zone C, it is impossible at this time to determine the zone's extent or the groundwater flow direction and gradient. Well DRMW-21B contained no detectable concentrations of C-8 on the two occasions it was sampled, so it is presumed at this time that there is no C-8 in Zone C. It is difficult to make any kind of conclusions regarding the surface water at the Dry Run Landfill because many of the sampling locations have been consistently dry during much of 2002. It is also difficult to make statements regarding the concentrations of C-8 found to date because these concentrations vary so much from sample location to sample location. The highest concentration of C-8 found at the surface sampling points is the Dry Run leachate location, where the concentrations of C-8 has ranged between 109 and 704 pg/l since December of 2001. The leachate is collected and hauled to the Washington Works Facility's treatment system, and does not discharge into Dry Run. A further breakdown of the Dry Run Landfill sampling data is as follows: Dry Run Landfill Surface Water: (units are fjg/l) Sample Point Outlet Outlet Outlet Property 001 003 004 Boundary Number of samples 15 3 2 12 Minimum C-8 17 6.77 0.7 0.88 Maximum C-8 88.5 25.3 158 39 Average C-8 58.57 17.39 79.35 11.3 Stream #1 11 0.54 1.63 1.07 Stream #2 11 4.6 87 40.29 Dry Run Leachate 12 27.4 704 205.59 Pond Under Drain 8 29.3 99.7 50.98 Dry Run Landfill Groundwater Zone A: (units are pg/l) Sample Point DRMW-12 DRMW-13 DRMW-15 Number o f samples 13 12 10 Minimum C-8 <0.1 3.6 0.25 Maximum C-8 0.134 20.9 5.0 Average C-8 0.08 12.16 3.74 Division of Water and Waste Management Final C-8 GIST Report_____________________________________________ page 35 Note: For the purposes of averaging these values, a No Detect concentration of "<0.1" was calculated as zero Dry Run Landfill Groundwater Zone B: (units are pgA) Sample Point DRMW-6 DRMW-6A DRMW-12A DRMW-12B DRMW-13A Number o f samples 6 13 13 11 13 Minimum C-8 <0.1 0.19 <0.1 <0.1 0.07 Maximum C-8 1.0 1.24 0.181 5.4 15 Average C-8 0.57 0.66 0.09 0.55 6.18 DRMW-14 13 <0.1 2.5 0.20 Note: For the purposes of averaging these values, a No Detect concentration of "<0.1" was calculated as zero Dry Run Landfill Groundwater Zone B: (units are pgA) Sample Point DRMW-16B DRMW-17B DRMW-18B Number of samples 2 1 1 Minimum C-8 <0.1 0.155 <0.1 Maximum C-8 <0.1 0.155 <0.1 Average C-8 <0.1 DRMW-19B 2 <0.1 <0.1 <0.1 DRMW-20B 2 <0.1 <0.1 <0.1 DRMW-21A 2 0.138 0.27 0.204 Dry Run Landfill Groundwater Zone C: (units are pgA) Sample Point DRMW-21B Number of samples 2 Minimum C-8 <0.1 Maximum C-8 <0.1 Average C-8 <0.1 Letart La nd fill: The Letart Landfill is located about 0.6 miles north of the small community of Letart in northern Mason County. It is 46 miles down the Ohio River from DuPont's Washington Works Facility, and is located at 38* 54' 15" North Latitude and 81 55' 43" West Longitude. The site-- like the Dry Run Landfill-- is situated on the dissected Appalachian Plateau. Bedrock consists of the sandstones and shales of the Dunkard Group. It is sited in a valley that is directly west of the Ohio River, which is here flowing north. West of the landfill (and across the hill behind the landfill) is the north-flowing Brinker Run. The Letart Landfill was operated and closed under WV-NPDES Permit No. WV0076066, and was permanently closed by installing an engineered multi-layer Division of Water and Waste Management 000039 Final C-8 GIST Report page 36 geosynthetic and soil cap in 2001. The permit requires quarterly groundwater monitoring, surface water monitoring, and cap maintenance. Physically, the Letart Landfill is tear-shaped. It is approximately 1,400 feet long, and tapers in width from a maximum of 850 feet along its northern edge to a narrow point at the Ohio River. The elevation difference between the wider, higher northern boundary and the lowest elevation point near the Ohio River, is about 140 feet. The landfill itself is covered with grass. There are no highways, residents, or businesses adjacent to the landfill; however, U.S. Route 33 parallels Brinker Run, which is located about 700 feet to the west. This is a rural part of West Virginia, and there are no residents and businesses along this section of the highway. Geologically, the bedrock beneath the landfill is comprised of individual layers of shale, silty clay, and sandstone and siltstone. There are, depending on how and where they are counted, between four and six aquifers at this site, which have been labeled by DuPont as Zone A, Zone B, Zone C, Zone D, Zone E, and Zone F. Zone A is the shallowest of these aquifers, and is monitored by three groundwater monitoring wells. Zone B contains no wells, and Zone C contains only one well. Zone D-E contains five groundwater monitoring wells, and Zone F, the deepest and dominant aquifer at this site, has nine wells screened through it. Groundwater Zone A is exposed near the surface, and varies between 25 and 60 feet thick. It is continuous in nature, but apparently contains interbedded discontinuous shale, sandstone, and siltstone lens. There are only three wells screened in Zone A. These wells are all located relatively close together and more-or-less in a straight line along the northwestern edge of the landfill. Given these limitations, the October 2002 groundwater sampling gave the appearance of a north groundwater flow and a plume that centered on well LMW-1, the central-most of the three wells. Of the three Zone A wells, LMW-1 has the highest concentrations. These concentrations have varied since April 1996 between 1,700 and 30,500 pg/l. Well LMW-8 has the next-highest concentrations, and these concentrations have varied between 280 and 4,020 pg/l. Well LMW-7 has displayed the least concentrations of C8 in these wells since October 1999 between 158 and 567 pg/l. There are no wells screened through Zone B. However, judging from the crosssection produced when the deeper wells were drilled, this zone reaches its maximum thickness of more than 70 feet at the northern-most tip of the landfill, where it is combined with Zone C. Zone B pinches out (disappears) completely as one moves down the landfill toward the river. Zone C appears to be continuous across the site. It is approximately 15 to 25 feet thick under the main and southern portions of the landfill, and combines with Zone B in the northern part of the site. Only one well is screened through Zone C, so no assessment of a plume or groundwater flow and direction can be made. This well, Division of Water and Waste Management 000040 Final C-8 GIST Report page 37 LMW-3, is located near the very toe of the landfill and in close proximity to the Ohio River. This well had a concentration of 2,270 pg/l C-8 in May 2002. Zone D-E is the most complex of the Letart water-bearing zones. These zones appear to be combined in the southern, central, and northern portions of the site. They are separated by a shale layer in the western and possibly the central portion of the landfill. It is also possible that Zone D may be completely missing in the northern and northeastern portions of the site. The thickness of this zone can range between 10 and 40 feet. Zone D-E, as mapped by DuPont in October 2002, has a gradient of 0.026 vertical feet per horizontal foot with a groundwater flow direction to the south-southwest. There are five groundwater monitoring wells screened through Zone D-E. Most of these wells are located near the southern toe of the landfill. Of these five wells, two were only recently installed, and long-term data exists for three of the wells. LMW-4 has consistently contained the highest concentrations of C-8. These concentrations have ranged from 172 to 2,840 pg/l. All five of the Zone D-E groundwater monitoring wells sampled in October of 2002 indicate high C-8 concentrations under the main part of the landfill, with a plume flowing due south and through LMW-4. Two wells, located just east of LMW-4 contained much lower concentrations of C-8. As previously stated, groundwater Zone F is believed to be the dominate aquifer at the Letart Landfill. This zone is the deepest of the six aquifers. It is continuous across the site ranging from 30 to 70 feet thick. The groundwater within the zone flows to the south-southeast. This zone has a gradient of between 0.030 to 0.057 vertical feet per horizontal foot. There are nine groundwater monitoring wells screened through Zone F positioned all around the landfill. Six of these were sampled prior to October 2002, and seven were sampled in October of 2002. These wells project a possible C-8 plume moving south down the center of the landfill. The lowest concentrations are to the west of the landfill, where there is one concentration of 105 pg/l in well LMW-14B. The highest C-8 concentration is at the very toe of the landfill at well LMW-5B, which has consistently contained high concentrations since it was installed more than a decade ago. Since July of 1999, these concentrations have ranged between 592 and 2,280 MQ/I- Zone F well LMW-2A contains high concentrations of C-8 that have varied between 242 and 913 pg/l since September of 1994. In addition, this well is located on the extreme northern edge of the landfill, away from the anticipated plume direction. Well LMW-12, drilled just to the west of LMW-2A, was dry during the October 2002 sampling event. These two wells should be monitored closely to determine groundwater flow direction and if there is a plume moving off the site to the north. It should also be noted that there is a private water source (GERLACHIBA) north of the Letart Landfill where a small concentration of C-8 was found. Division of Water and Waste Management 000041 Final C-8 GIST Report page 38 It should be noted that, due to the installation of the synthetic cap, stormwater contribution to the groundwater flow has been lessened under the landfill. It is probable that the contribution of C-8 to this flow has remained stable. Less groundwater volume combined with a steady contribution of C-8 will equal a higher concentration of C-8 in the groundwater. This scenario appears to have occurred at the Letart Landfill. The site should be monitored closely to ascertain trends in C-8 concentrations. The surface water at the Letart Landfill has been sampled for C-8 at six locations. The data for some of these points is very intermittent. While most of these concentrations are very low, C-8 has been found at the two Brinker Run sampling locations. The two highest concentrations were found at the southern toe of the landfill, at Outlet 002 (the Leachate Basin) and the Cap Runoff location, both of which indicate increasing concentrations of C-8. Outlet 002 and the Cap Runoff have had concentrations as high as 3,240 and 415.6 pg/l, respectively. A detailed breakdown of the surface and groundwater data is as follows: Letart Landfill Surface Water: (units are pg/l) Sample Point Outlet 002 Outlet Stormwater Route 33 003 Run Off Stream Number o f samples 18 6 1 13 Minimum C-8 4.52 0.06 50.9 0.57 Maximum C-8 3240 0.239 50.9 3.92 Average C-8 899.22 0.21 1.96 Brinker Run 2 0.06 0.247 0.154 Cap Runoff 6 65.1 415 225.18 Letart Landfill Zone A Groundwater: (units are pg/l) Sample Point LMW-1 LMW-7 LMW-8 Number of samples 21 20 20 Minimum C-8 60 0.1 280 Maximum C-8 30,500 567 4020 Average C-8 14,896.57 233.57 2499 Letart Landfill C Zone Groundwater: (units are pg/l) Sample Point DRMW-3 Number of samples 8 Minimum C-8 <0.1 Maximum C-8 2270 Division of Water and Waste Management 000042 Final C-8 GIST Report page 39 Average C-8 1320 Note: For the purposes of averaging these values, a No Detect concentration of "<0.1" was calculated as zero. Letart Landfill D-E Zones Groundwater: (units are pg/i) Sample Point LMW-3A LMW-4 LMW-5A Number o f samples 10 12 8 Minimum C-8 60.3 172 0.8 Maximum C-8 380 3060 112 Average C-8 170.39 1577.83 71.43 LMW-13A 2 144 510 327 LMW-14A 2 498 974 736 Letart Landfill Zone F Groundwater: (units are pgA) Sample Point LMW- MW- LMW-6 LMW-9 2A 5B Number of samples 23 22 12 9 Minimum C-8 50 340 9.4 0.2 Maximum C-8 990 2280 30 0.91 Average C-8 496.8 1161.9 17.49 0.65 LMW10 5 0.126 0.298 0.165 LMW11 8 0.058 0.159 0.110 LMW12 0 LMW13B 2 0.09 0.149 0.1223 LMW14B 2 70.4 105 87.7 Local Land fill: The Local Landfill is located immediately south of the Washington Works Facility in northwestern central Wood County. It consists of three separate closed cells, and is located at 39 15' 54" North Latitude and 81 39' 16" West Longitude. It is situated on the dissected Appalachian Plateau, consisting of Dunkard Group sandstones and shales. The three landfill cells were operated from 1964 into the 1980s, and were closed under WV-NPDES Permit No. WV0076538. They are now covered with approximately two feet of low permeability soil and vegetative cover. The site is in a somewhat rural area; however, there are a number of residential homes south of the landfill. State Highway 892 is just north of the landfill and located between the landfill and DuPont's Washington Works Facility. Physically, the three Local Landfill cells are 60 by 140, 70 by 110, 40 by 60 feet in size; however, the landfill cells are irregular in shape and the cells are actually smaller than these dimensions indicate. These cells are sited along the tops and sides of three hills, which are located just south of the flat Ohio River flood plain. Geologically, the bedrock beneath the landfill is comprised of individual layers of Division of Water and Waste Management 000043 Final C-8 GIST Report page 40 shale, silty clay, and sandstone and siltstone. There are four principal aquifers, all of which are continuous under the overall site, and are comprised of sandstone and siltstone. DuPont has named these (in their October 2002 groundwater monitoring report), from shallowest to deepest, Zone A, Zone B, Zone C, and Zone D. Zone A is believed to be the dominant aquifer. Zone A is usually between 10 to 20 feet thick, and varying in depth between 60 to 110 feet. This zone is continuous across the site, and has been eroded by an unnamed stream that flows out of the landfill area to the west, and then flows to the northwest. Groundwater flow in Zone A is to the north-northwest with a gradient of 0.008 vertical feet per horizontal foot. There are four groundwater monitoring wells screened in Zone A. Two of these have consistently contained C-8 concentrations that are below 1 pg/l. A third well, LLMW-6, has contained C-8 concentrations below 10 pg/l. The fourth well, LLMW-4, contains C-8 concentrations up to 79 pg/l. This supports the theory that the Zone A C-8 plume is moving north toward LLMW-4. Zone B is generally 5 to 10 feet thick, and between 90 to 130 feet deep. It is incised by the unnamed surface stream, and grades out to the east. There is only one well screened in this zone, and has only been sampled twice. It contained a C-8 concentration of 0.0658 pg/l in October 2002 and a No Detect concentration in March of 2003. With only one well, no plume information or groundwater flow and gradient data can be generated on this groundwater zone. Zone C is 10 to 20 feet thick, and 90 to 130 feet deep. It is continuous across the entire site. Due to Zone C's greater depth, it has not been incised by the surface stream. Groundwater flow is to the northwest, and the gradient is 0.0153 vertical feet per horizontal foot. Three wells are screened in this zone. Each well has been sampled twice, and the C-8 concentrations ranged from 0.317 to 6.61 pg/l. Zone D is more than 12 feet thick, and is 135 to 170 feet deep. Only one well has been screened in this zone, and has only been sampled twice, with No Detect concentrations on both occasions. With only one well, no plume information or groundwater flow and gradient data can be generated for Zone D. Six sampling locations are used to monitor the surface water at the Local Landfill. All of these locations have displayed concentrations of C-8 with the highest concentrations occurring at Outlet 101 and Outlet LM1. These concentrations ranged from 38 pg/l in June 2002 to 72 pg/l in January 2003, and dropped to 45.4 pg/l in March 2003. Outlet LMTs concentrations are higher: They were 120 and 81.7 jjg/l on the two occasions this location was sampled. The Local Landfill data can be further broken down as follows: Division of Water and Waste Management 000044 Final C-8 GIST Report page 41 Local Landfill Surface Water: (units are fjg/l) Sample Point Outfall 004 New 004 Outfall 005 Number o f samples 15 6 15 Minimum C-8 1.51 9.29 6.8 Maximum C-8 13 14.6 51.4 Average C-8 10.1 12.69 35.19 New 005 3 9.51 34.3 19.94 Outlet 101 19 12 115 57.1 Outlet LM1 2 81.7 120 100.85 Local Landfill Zone A Groundwater: (units are pgA) Sample Point LLMW-4 LLMW-6 LLMW-9 Number o f samples 13 13 13 Minimum C-8 1.4 1.32 <0.1 Maximum C-8 79.6 19.9 0.14 Average C-8 42.63 11.06 0.02 LLMW-10 10 0.15 1.12 0.41 Local Landfill Zone B Groundwater: (units are ptgA) Sample Point LLMW-12B Number of samples 2 Minimum C-8 <0.1 Maximum C-8 0.0658 Average C-8 0.0329 Note: For the purposes of averaging these values, a No Detect concentration of "<0.1" was calculated as zero. Local Landfill Zone C Groundwater: (units are /jg/1) Sample Point LLMW-11A LLMW-13B LLMW-14B Number of samples 2 2 2 Minimum C-8 2.05 6.38 0.317 Maximum C-8 2.22 6.61 0.488 Average C-8 2.135 6.495 0.4025 Division of Water and Waste Management 000045 Final C-8 GIST Report Local Landfill Zone D Groundwater: (units are fjg/l) Sample Point LLMW-11B Number of samples 2 Minimum C-8 <0.1 Maximum C-8 <0.1 Average C-8 <0.1 Page 42 W ashington W orks Facility: The DuPont Washington Works Facility is located just north of the small community of Washington and about seven miles west and downstream of Parkersburg. The facility is located at 39' 16' 13" North Latitude and 81* 40' 34" West Longitude, and is sited on the Ohio River flood plain. The flood plain here is comprised of Pleistocene glacial outwash and Holocene river sediments (alluvium) overlying the bedrock of the Dunkard Group. These sediments are comprised of sand and gravel, silt and clay, colluvium, and fill. The site is in a somewhat rural area. State Route 892 is located just south of the plant property. The Ohio River is located immediately to the north of the property. There are more than 100 groundwater monitoring and production wells at the Washington Works Facility. Of these wells, the following 19 wells were chosen by the GIST to be sampled under the Consent Order: AE11-MW01 AM07-PW01 A008-PW01 AX13-PW01 D08-MW01 E13-MW01 K16-PW01 L04-PW01 N04-MW01 N13-MW01 P04-MW2 P08-MW01 Q04-MW02 R04-MW02 V05-PW01 Y14-MW01 AJ06-MW02 N04-MW03 Y14-MW02 Of these wells, five have consistently been less than 1 pg/l, and another seven have been less than 20 pg/l. Three of the remaining wells have had C-8 concentrations between 20 and 60 pg/l; however, one of these wells (P08-MW01)-- when last sampled-- contained 120 pg/l. A fourth well, N04-MW01, has only been sampled once, but this concentration was 689 pg/l. The remaining three wells all contain high concentrations of C-8. These are wells P04-MW-2, Q04-MW-02, and R04-MW02, with reported concentrations as high has 46,600, 7,720, and 322,000 pg/l of C-8, respectively. At present, six outlets are used to monitor the discharges at the Washington Division of Water and Waste Management 000046 Final C-8 GIST Report page 43 Works Facility. With a few exceptions (one of which was Outfall 005 in November 2001 with a concentration of 915 pg/l), all of these outlets have had consistently discharged relatively low concentrations of C-8, ranging from ND to 54.9 pg/l. A further breakdown of the Washington Works Facility discharge water and groundwater data is as follows: Washington Works Facility Surface Water: (units are /jg/l) Sample Point Outlet 001 Outfall 002 Outlet 003 Number of samples 16 25 16 Minimum C-8 2.15 0.118 0.175 Maximum C-8 51.4 8.54 7.13 Average C-8 14.39 3.21 1.544 Outfall 005 26 1.43 915 81.15 Outlet 007 16 <0.1 8.56 1.42 Outlet 105 16 3.69 54.9 14.43 Note: For the purposes of averaging these values, a No Detect concentration of "<0.1" was calculated as zero. Washington Works Facility Groundwater: (units are pg/l) Sample Point AE11MW01 AM07PW01 AC08PW01 AX13PW01 Number of samples 10 16 14 7 Minimum C-8 0.41 <0.1 0.167 0.721 Maximum C-8 2.82 1.9 1.0 1.42 Average C-8 1.41 0.374 0.46 1.03 D08WM01 8 0.117 3.72 0.882 E13MW01 11 0.59 3.43 2.127 Note: For the purposes of averaging these values, a No Detect concentration of "<0.1" was calculated as zero. Washington Works Facility Groundwater: (units are pg/l) Sample Point K16PW01 L04PW01 N04- N13- MW01 MW01 Number o f samples 11 13 1 3 Minimum C-8 0.46 0.20 689 <0.1 Maximum C-8 17.2 40.9 689 57.8 Average C-8 11.3 15.01 29.13 P04MW2 11 8300 46600 28545 P08MW01 4 20.7 120 55.02 Q04MW02 10 32.2 7720 1780 Note: For the purposes of averaging these values, a No Detect concentration of "<0.1" was calculated as zero. Division of Water and Waste Management 000047 Final C-8 GIST Report page 44 Washington Works Facility Groundwater: (units are pg/l) Sample Point R04MW02 V05PW01 Y14- AJ06MW01 MW02 Number o f samples 11 13 10 2 Minimum C-8 1300 0.66 4.95 0.099 Maximum C-8 322000 51.2 18.4 0.133 Average C-8 69729 26.2 13.76 0.116 N04MW03 2 21.2 244 132.6 Y14MW02 2 <0.1 <0.1 <0.1 Recommenda tions: The first priority at each of the four sites is to continue the surface and groundwater monitoring programs. Sampling of the groundwater should continue to be quarterly, while the outfall sampling can be either monthly, quarterly, or semi-annually, as required by each site's individual NPDES permit. The continuing source of C-8 at the Washington Works Facility is believed to be originating from a previously reclaimed digestion pond and from the old River Bank Landfill. Currently, the facility is under a RCRA Facility Investigation, which is addressing these C-8 sources. It is the recommendation of the GIST that any action relative to the investigation or remediation of the C-8 sources be deferred to the WSEPA-WVDEP RCRA Corrective Action Program (CAP). Division of Water and Waste Management 000048 Final C-8 GIST Report___________________________________ GROUNDWATER MODELING page 45 Groundwater modeling of the Washington Works Facility's main location was completed independently by DuPont's URS Diamond contractor and by the United States Geological Survey (USGS). URS Diamond's modeling was completed using Groundwater Vistas software. The USGS model was completed using Visual Modflow software. Both models were based on similar calibration data and boundary conditions. The USGS groundwater model did not address groundwater seepage from the adjacent bedrock aquifers, whereas the URS Diamond groundwater model did address this seepage. Preliminary analysis of both models show close agreement in groundwater flow directions, calibrated heads, and rate and volume of groundwater flow. The model data that follows is primarily from the URS Diamond groundwater model. The USGS groundwater model will be published as part of a larger modeling effort in corporation with the WVDHHR-BPH, Office of Environmental Health Services (OEHS). The URS Diamond model boundary was the alluvium, and into bedrock. The URS Diamond model domain was 5.0 to 7.9 miles, consisting of 153 rows, 235 columns, and 3 cells deep. Fifty-one discharge wells were included in the simulation. In the beginning stages of building the models, a major gap in the data occurred due to lack of data concerning river bottom geometry. The data gap was eliminated by a great abundance of new data obtained from recent surveys compiled by the Army Corps of Engineers for construction projects at the eastern end of the model domain. Geology: The alluvium was found to be between 60 to 80 feet deep on terraces and 10 to 15 feet deep in the center of the river valley. Alluvial aquifers in the model domains were mostly unconfined, with some locally confined by Holocene overbank deposits. These alluvial aquifers consist of coarse sands and gravel underlain by predominately horizontally bedded sandstones of the Pennsylvanian Dunkard Group. The Ohio River creates a groundwater divide in the Pleistocene alluvium under the river. This groundwater divide does not appear to exist in the bedrock aquifer. Typically, the permeability of the alluvium was 100 to 300 feet per day. Bedrock aquifers were primarily confined, and consisted of Dunkard sandstones with some minor limestone. Permeability of the bedrock aquifers ranged from 0.5 to 5 feet per day. Hydraulic conductivity used in the models were 330 feet per day for coarse alluvium, 30 feet per day for reworked alluvium, and one foot per day for fine alluvium. Hydraulic conductivity for bedrock aquifers was 0.1 feet per day. Alluvial aquifers on Blennerhassett Island had a hydraulic conductivity of 200 feet per day. The normal pool level of 582 feet above sea level was used for the hydraulic head of the Ohio River. Division of Water and Waste Management 000049 Final C-8 GIST Report page 46 Model Calibration: A total of 50 industrial and public water supply wells are located in the model domain, 44 of which were actively pumping at the time when synoptic groundwater elevations were being measured for model calibration. The well locations to the model domain are: DuPont Washington Works Facility (WV): 13 wells Blennerhassett Island State Park (WV): 12 wells GE Facility (WV): 14 wells Lubeck (WV) PSD: 6 wells City of Belpre (OH): 1 well (Note: Belpre has five pumping wells; their total flow was assigned to one well for the model.) Little Hocking (OH) Water Well Field 4 wells (wells PW-1, PW-2, and PW-3 were included in the model. Although well PW-5 was included, no pumping was simulated) The mass balance of the groundwater flow model had a total error of less than one percent, indicating very little error in simulating real world conditions. Recharge was estimated to be an average of approximately 8 to 10 inches per year, according to the USGS model. URS Diamond's model was calibrated at eight inches per year and, as the modeler for the USGS agreed, seemed to satisfy conductivity calibrations better. Differences in the two figures arose from different interpretations of possible areas of incised valley bottom fills under the Ohio River. These areas may have slightly different hydraulic conductive properties from the adjacent sediments. Sensitivity analysis was run on three parameters: hydraulic conductivity, recharge, and river boundary conductance. This sensitivity analysis indicated that most of the uncertainty associated with the model was in the value assigned to the re-worked Pleistocene alluvium under the Ohio River. C o n c lu s io n s : The calibration of both models was tested and highly refined over the course of the modeling effort. Both models were only slightly different. All parties placed high confidence in the somewhat more sophisticated URS Diamond model. The USGS further refined their model by incorporating some of the data presented in the URS Diamond model. The Ohio River creates a groundwater divide in the Pleistocene alluvium under the river. The principal conclusion, supported by both models, was that the groundwater Division of Water and Waste Management 000050 Final C-8 GIST Report_____________________________________________ page 47 divide under the river, along with the pumping rates from the DuPont and neighboring GE Facility wells that draw down a cone of depression, precludes C-8 impacted groundwater from the Washington Works Facility from being drawn into either Lubeck PSD municipal well field in West Virginia, or the Little Hocking Water Association well field in Ohio. Some limited groundwater may migrate off-site in the northwest corner of the DuPont facility in response to GE pumping wells #3 and #4. Sources of C-8 in the Lubeck PSD and the Little Hocking Water Association wells, are most likely coming from the Ohio River and dispersion by air. Recommendation: It is the recommendation of this report that the URS Diamond model be accepted as representing real-world conditions in determining groundwater flow and contaminant transport. Division of Water and Waste Management 000051 Final C-8 GIST Report REFERENCES Page 48 Cardwell, Dudley H., Robert B. Erwin, and Herbert P. Woodward, 1968 Geological Map of West Virginia, West Virginia Geological and Economic Survey, 1968. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Letart Landfill Groundwater Protection Plan, SW-NP Permit WV-76066, DuPont Washington Works, Parkersburg, West Virginia, January 7, 2000. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Compilation of Historical Data for Washington Works, DuPont Washington Works Site, Washington, West Virginia, January 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, December 2001 Groundwater Monitoring Report for Washington Works Facility and Local, Letart, and Letart Dry Run Landfills, Washington, West Virginia, January 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Groundwater Investigation Quality Assurance Project Plan for Washington Works Plant, Washington, West Virginia, January 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Ohio River Water Sampling Proposal for the Washington Works Facility and the Letart Landfill, January 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Proposed Groundwater Monitoring Plan for Washington Works Facility, January 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Ohio River Water Sampling Proposal for the Washington Works Facility and the Letart Landfill, February 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, January 2002 Surface Water and Groundwater Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Landfills, Washington, West Virginia, March 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, February 2002 Surface Water and Groundwater Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Landfills, April 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, One-Mile Radius Survey and C-8 Sampling Report and Ohio River Public Water Supply Sampling, DuPont Washington Works (December 2001-February 2002), April 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Proposed Sampling Investigation Plan for Little Hocking Water Association Well Field, Little Hocking, Ohio, April 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, C-8 Identification and Groundwater Assessment Work Plan, DuPont Washington Works Facility and Local, Letart, and Dry Run Landfills, May 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, March 2002 Surface Water and Groundwater Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Landfills, May 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, April 2002 Surface Water and Groundwater Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Division of Water and Waste Management 000052 Final C-8 GIST Report______________________ page 49 Landfills, Washington Works, West Virginia, June 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Revised Proposed Sampling Investigation Plan for Little Hocking Water Association Well Field, Washington County, Ohio, June 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, May 2002 Surface Water and Groundwater Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Landfills, July 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Two-Mile Radius Survey and C-8 Sampling Report, DuPont Washington Works Facility, and Local Landfill, West Virginia (March to May 2002), August 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, June 2002, Surface Water Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Landfills, Washington, West Virginia, August 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, One-Mile Radius Survey and C-8 Sampling Report, Washington County, Ohio (March to June 2002), August 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, July 2002, Surface Water Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Landfills, Washington, West Virginia, September 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Third Quarter 2002 Surface Water and Groundwater Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Landfills, Washington, West Virginia, October 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Fourth Quarter 2002 C-8 Surface Water and Groundwater Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Landfills, Washington, West Virginia, December 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Two-Mile Radius Survey and C-8 Sampling Report, Washington County, Ohio (June to September 2002), December 2002. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Revised Groundwater Flow Model, DuPont Washington Works, Washington, WV, January 2003. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, November 2002 Surface Water Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Landfills, Washington, West Virginia, January 2003. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, C-8 Data Summary Report,, Consent Order GWR-2001-019, DuPont Washington Works Facility and Local, Letart, and Dry Run Landfills, February 2003. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, December 2002, Surface Water Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Landfills, Washington, West Virginia, February 2003. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, January 2003, Surface Water Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Landfills, Washington, West Virginia, March 2003. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Sampling Investigation Division of Water and Waste Management 000053 Final C-8 GIST Report page 50 Results, Little Hocking Water Association Well Field, Washington County Ohio, April 2003. Corporate Remediation Group, an Alliance between DuPont and URS Diamond, February 2003, Surface Water Monitoring Report for Washington Works Facility and Local, Letart, and Dry Run Landfills, Washington, West Virginia, April 2003. DuPont Corporate Remediation Group, Letart Landfill Hydrogeological Evaluation, DuPont Washington Works, Letart, West Virginia, July 1993. DuPont Engineering, Public Water Supply Results, West Virginia and Ohio, DuPont Washington Works, Washington, West Virginia, July 31,2002. DuPont Engineering, 3Q02 and 4Qo2 Public Water Supply Results, West Virginia and Ohio, DuPont Washington Works, Washington, WV, November 20, 2002. O'Neill, Colleen M., "C-8 Health Level Established," InDEPth, June 2002, page 4. Tetra Tech Richardson, Inc., Monitoring Well Installation Program, October 1989. Tetra Tech Richardson, Inc., Monitoring Well Installation Program at Letart Landfill, Summary Report, August 1990. West Virginia Department of Environmental Protection, Final Ammonium Perfluorooctanoate (C8) Assessment o f Toxicity Team (CATT) Report, August 2002. West Virginia Department of Environmental Protection and the West Virginia Division of Health and Human Resources, Consent Order Issued Pursuant to Articles 5 and 12, Chapter 22 and Article 1, Chapter 16, o f the l/l/esf Virginia Code, November 14, 2001. An air rotary drilling rig installing a new groundwater monitoring well at the Letart Landfill. Division of Water and Waste Management Final C-8 GIST Report APPENDIX A: Site Maps Topographic Maps Plan Views Groundwater-Top Maps Site Cross-Sections Division of Water and Waste Management 000055 LETART LANDFILL C T \csu^ L crowe Mew's WASHINGTON WORKS FACBJTY/ LOCAL LANDFILL DRY RUN LANDFILL Figure 1.0: Index map for the four Dupont sites. Figure 2.0: Location map for the Dry Run Landfill, 000056 Figure 2.1: Dry Run Landifll with sampling points 00057 Figure 2.2: The Dry Run Landfill Geological Cross-Section Lines. Figure 2.3: Dry Run Geological Cross-Section A-A' 000058 Figure 2.4: Dry Run Geological Cross-Section B-B' 000059 N o rth w e st A 60 ti CSoutheast . 60 /.: : IX - ' MONE MAirS.A. tt.y/l'.Aj LJ.AL.U t\`A hOH 0! i Figure 2.5: Dry Run Geological Cross-Section A-C. N orth D a Coivate R South B' w- ORMAWd /- t WL.L H SCHflNEO f| iNIERVA- - , SAMiS TONf 1 AND ` SlUSTONt. Mn MA U'HIA:. S C A ,, i W AitR i V u T { :? ?ot;?) j SHA 1 A /ONL AUl/M ;H ONt 300 a .30 NO'L. Su TOC se * i t e no i sne *.n un a parole geologie u VLHUCAi. iX A G U H A UON 0 f (tX Figure 2.6: Dry Run Geological Cross-Section D-B' 000060 000061 ;i LFiogcuarteio3n.1M: LapetCarltosLea-Undp.fill 000062 ^, LW^-12 LEGEND: LMW-8 A ZONE MONITO WELL L M W -J C ZONE MONflQfi WELL Corporato Remedtoiio* Croup LMW-4 /E ZONE MONITOR VWLU .4AtetMndPURSMNNtowMinnM r *A K ZONE MONITOR WELL SURFACE WATER SAMPLE LOCAllON Baria; U ll Pia io , Bu4m<i 27 Figure 3.2: Letart Landfill and SamplingWSmJnjton, Qstavarc P'98QoSints. MONITORING WELL AND SURFACE WATER LOCATION SAM PLE MAP Letart Londifll Site Letart, West Virginio ~oa *5 ' B --------- MHS-------- TBST- 000063 000064 000065 NORTH SOUTH l FGENQ SANDS'! ONL AND SILTSTONC [ _ ; SMALL CHOUNLMAIfcH ;LVA!IUN (O ctm er. 2C02) *GROunDWATCH'LO* wreoon SCALE IOC 2 0 0 f I V C o rp o ra l* H a m a a * M on G ro u p A*. W a w aiaaaMi i>-rtnu aaa u n it guaoaaiU C R 0 S S -S E C 1 I0 ! t.e lo rt La nd fill L e ta r t , WV Figure 3.5: Letart Landfill Geological Cross-Section B-B\NOft: Surface : anown as a separte geologic < liw i*,' I lU floro, U~)otrq tV s ------------ ( s s n -------- U e e r - North D MO 7M 740 730- I 9*0-j AJONC MONE . c... catone South D' MO 710 7M - 740 730 700 \ u MO \LMW- j* A \ LM * 5 f too 1- SKCVJNUWAtlK LLr.VA HON (o c t o h h . 200?; alu'l 2om: ' ?00' NOIL. jui fuce >oua u, tiU C Ai t.AACGiHA T/Ofv O i bx Figure 3.6: Letart Landfill Geological Cross-Section D-D'. 4 c 000066 Figure 3.7: Letart Landfill Geological Cross-Section C-C\ 000067 000068 000069 Sttirft: USQS litw * Wochr|. O ft* - m r . tfiaiir.w C b<idrtf Figure 4.0: Local Landfill Location Map. .ocal icm iifiilil 'flumhtngton. Wesd Vidimo- "jpMa------juriBB-- %/tr/^' I"""11* ^m i* [ W j Ml l M tiirn i 000070 - 'O'JS - o v toa ui tx moni rawve nu - ac jM x x non roHiNt m u. - SUWACt iAAlPit Figure 4.1: Local Landfill with Sampling Points. Figure 4.2: Local Landfill Geological Cross-Section Lines. 000071 <( *;Rf i \ j^uuiriu-J/| t!| / P^GJEC' --,-61111v r /f iI :: .-i'1 i / ! ! rrid/ -- ------ a t j x n u H 1 -- ^L \ j 1 ! ; ^_y 1 j i 1 j j 1 ! : lL C 'j ck O rr < V n:3 z<: rLrJ ft. j -J ^ 5 11 1 1 c5 j "a ! < jo J^ j ?l 13 Cg | \ <<zzo <<z -L< C..' c/: (/) 5a; L.J O flJ tinri' N <v i.\{ (U.iNOClNVHv) , - . y o Z t/1 O >-- ianis> Z< zo 1-0 < ( im n ; n o ii v a ; ' j) Figure 4.3: Local Landfill Geological Cross-Section A-A\ 000072 Figure 4.4: Local Landfill Geological Cross-Section B-B\ 000073 Figure 4.5: Local Landfill Geological Cross-Section C-C\ 000074 400 ^ ^ -o r-C ro ^ ' Ql./ve _ v MVi; . ...?$$ F,gi" ^ v il* . '' * nt.:T< L ,,C11; U tid n ii 7 ,, oo- n e C T,,p.of.Groundwatw Map. 0007< B WASMMGTON WORKS FACILITY 1 v>. '*'1 " *LW*''P~f' * , '%N,, y ' i I f ; v1 * c 1 .. ***?<f*r y .fi* ,, \ jfr'il. V rS, Jtfi- 1 2 li -Z~~ v j V . J .0 **<'. v&t *& > . "VJK..=f v. N- ,t ,,T*Cw' '* 1T- %f T/'- U~~v S S **. UtAF AKfcN i l C N IH U J ftiC * . V u s e s QUADRANC il A ik*HvU1M*d AF 9Mqntnciy'n^Mtol*n.*KDkt:<t5.M^or* *199606 S l it LOCATION MAP O u P o n t ah m g to r> Wortes f a c ilit y (-U-IM-W-M---ma-stIInihinuirgkW--tl--oU--Mn"-r--m]]7Wm1e--Iinsctiif-"-V- iintrmg1uien0mwiaiw--n--- Figure 5.0: Washington Works Plant Location Map. 000076 Figure 5.1: Washington Works Facility Sampling Points 000077 Figure 5.2: Washington Works Facility Geological Cross-Section Lines. 000078 Figure 5.3: Washington Works Facility Geological Cross-Section A-A\ 000079 Figure 5.4: Washington Works Facility Geological Cross-Section B-B\ ooooso Figure 5.5: Washington Works Facility Geological Cross-Section C-C\ OOOS1 Figure 5.6: Washington Works Facility Geological Cross-Section D-D'. 0 0 0 0 S2 Figure 5.7: Washington Works Facility Geological Cross-Section E-E\ 000083 Figure 5.8: Washington Works Facility Geological Cross-Section F-F\ 000084 Va Q4- imi P4--MWOJ * "inrj ->* MVfT1 lG1[ i UNi;: < /// 'b U h IA r Nt -.>Vt A SK \,n . ANU Ci a y l't i M ' U \il M At iA: r U A H x y.A M ) A r. i .' 1. JiOK./ON Al *>LA i ( sa a **.: a i m : a i * ` 4U` j j CBrprst n inn ateti Qreup ilr j > , 0 * '3*ar l S I c ; K ; N <; G A 'n t r t u s l '.'. ' - jU j- : , W n a l 0* * ........... '. M e i " " iw s * ........... u n * * * s. ^ ., M ! StMIDb- jX ~ ; Figure 5.9: Washington Works Facility Geological Cross-Section G-G'. 000085 iI tre p"r5 ut Oh-i Se>8r wPfot- p o?tz>r *ftn H o T* O o C Pa 3Si o cc QO O JEGEND = MONITORING WELL - PRODUCTION WELL . = appro xim ate groundwater flow direction = groundwater elevation contour 1I scale 7oc mo TBCr JflJL_____ <4B ^ pSTd C o n ta n t* R w n a d itio r O ra te wupqwc 1 AH Bcrlfty klii Piceo. Buiktoq 27 0<o#or I81DS 700' REVISED - FEBRUARY 2 0 0 2 GROUNDWATER ELEVATION MAP DuPont W ashington W ort Main Ptont W osnington, West Virginia Final C-8 GIST Report APPENDIX B: Groundwater data (both graphs and tables) Division of Water and Waste Management 000087 DRY RUN LANDFILL SURFACE WATER {i/Bri) 83 C or Cutlet 001 (Juliet 003 Outlet Q04 Boundary ..Stream #1 Stream #: ...Leachate . ' Limit ; oooo* 1GG0 G oc Q 1.0 DRY RUN LANDFILL ZONE A GROUNDWATER DPMVV-12 r\ ,, 2R vA , e> ,x> X <;f A 1' O ' O ' ' O ' O # < :# R# eO Or" ,# lo D ate -VO ' O '' DRMVV-13 ;' Limit 'tOLL.0 DRY RUN LANDFILL GROUNDWATER ZONE B ; DRiviVVm -"# DRMVV-6A ' DRMVV-17R DRMW-18B DEMW-12.A DRMVVA9B Date DRMW-12B DRMWAOB DRMW-13A DRMWUm DRMW-14 Limit DRMW-16B Du Pont de Nemours and Company Dry Run Landfill W ood County C8 w ater data Units are (jg/l A zero equals a Non Detect concentration A yellow-colored concentration is above the W V-DEP limit Groundwater m onitoring well MW -21B is actually a "Zone C" well G roundwater Zone A -- D a te D R M W -1 2 D R M W -1 3 D R M W -1 5 Lim it May-91 Apr-93 Jul-94 Jun-95 Apr-96 0 Jul-97 0 7 May-98 0 9.2 Jun-98 Jul-99 0.134 3.6 0.263 Jul-00 0.16 9.8 0.763 Dec-01 0.086 9.86 4.94 Jan-02 0.116 16.5 4.35 Feb-02 0.11 11.5 3.65 Mar-02 0.0929 12.6 4.91 May-02 0.0817 16.9 5 Sep-02 0.0626 13.1 3.99 Oct-02 0.109 20.9 4.92 Mar-03 0.101 15 4.64 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 G roundwater Zone B - ate D R M W -6 D R M W -6A D R M W -12A D R M W -12B D R M W -13A D R M W -14 D R M W -16B May-91 0 Apr-93 0.4 Jul-94 0.5 Jun-95 0.6 Apr-96 0.97 0.19 0 11 0 Jul-97 1 0.36 0 15 0 May-98 0.27 0 8.7 Jun-98 00 Jul-99 0.096 0.081 5.4 0.07 2.5 Jul-00 0.212 0.128 0 9.9 0.115 Dec-01 1.04 0.158 0.215 6.4 0 Jan-02 0.824 0.168 0.085 5.97 0 Feb-02 0.822 0.125 0 3.73 0 Mar-02 0.843 0.0785 0 40 May-02 1.24 0.0832 0 2.31 0 Sep-02 Oct-02 Mar-03 0.785 1.13 0.727 0.088 0.181 0.059 0 0.258 0.052 5.14 6.66 1.5 0 0 0 0 0 ite D R M W -17B May-91 Apr-93 Jul-94 Jun-95 DR M W -18B DR M W -19B DR M W -20B D R M W -2 1 A Lim it 150 150 150 150 OOOOS1 Apr-96 150 Jul-97 150 May-98 150 Jun-98 150 Jul-99 150 Jul-00 150 Dec-01 150 Jan-02 150 Feb-02 150 Mar-02 150 May-02 150 Sep-02 150 Oct-02 0.155 0 0 0 0.27 150 Mar-03 0 0 0.138 150 G roundw ater Zone C-- D a te D R M W -2 1 B Lim it May-91 Apr-93 Jul-94 Jun-95 Apr-96 Jul-97 May-98 Jun-98 Jul-99 Jul-00 Dec-01 Jan-02 Feb-02 Mar-02 May-02 Sep-02 Oct-02 0 Mar-03 0 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 Surface W ater-- Property Dry Run Pond D a te Outlet 001 Outlet 003 Outlet 004 Boundary Stream #1 Stream #2 L each ate Underdrain Limit Apr-96 86 9.9 Jul-97 62 May-98 17 1 4.6 56 Jul-98 0.88 Dec-99 66 39 0.54 87 34 Oct-OO 31.5 10.3 0.758 27.6 27.4 Dec-01 3.99 1.19 20.5 109 35.4 Jan-02 41.6 11.1 0.893 42.4 398 29.3 Feb-02 43.9 3.81 0.85 24.3 256 37.1 Mar-02 71.6 6.77 158 22.8 1.06 66.6 334 66.7 Apr-02 41 20.1 6.69 0.932 28.9 237 33.4 May-02 30.9 9.41 1.63 51 150 67.4 Jun-02 Jul-02 25.3 0.7 Aug-02 Sep-02 Oct-02 81.7 3.8 1.63 29.2 704 38.8 Nov-02 64.6 Dec-02 56.9 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 000092 Jan-03 88.4 Feb-03 69 Mar-03 88.5 D a te Outlet 001 Outlet 003 Outlet 004 11.3 1.24 61.1 99.7 99.7 Boundary Stream #1 Stream #2 Leachate U nderdrain Lim it 150 150 150 000033 Le TART LANDFILL GROUNDWATER ZONE D-E LMWU LMW- e*x;'LL Date ..LMVV- -IA -- Limit (/rf) 8 3 LeTART LANDFILL SURFACE WATER 1. 0.1 a Outlet 002 " ' . Date US 33 Stream m... Brinkei Run Cap Runoff ...4...Limit S iG O O O O Du Pont de Nemours and Company LeTart Landfill Mason County C8 water data Units are pg/l A zero equals a Non Detect concentration A yellow-colored concentration is a concentration above the WV-DEP's level Groundwater data-- F-Zone wells-- D ate LM W -2A M W -5B LW M -6 LM W -9 L W M -10 LW M -11 L M W -12 Mar-91 50 340 25 Nov-91 Oct-92 63 380 24 0.2 Mar-94 Mar-94 260 1200 530 Sep-94 270 480 Apr-96 460 Jul-97 May-98 Jul-99 460 445 990 350 1750 30 Oct-99 Jan-00 Apr-00 Jul-00 370 1030 453 1020 306 1100 275 900 9.4 Oct-OO Jan-01 Jul-01 Dec-01 Jan-02 Feb-02 Mar-02 May-02 Sep-02 Oct-02 Mar-03 248 1190 423 615 242 592 830 1880 740 1890 714 1460 717 1810 922 1720 676 1480 931 2280 676 1470 15.8 0.845 0.134 0.128 18.1 0.875 0.133 0.159 14.9 0.617 0.126 0.112 14.8 0.631 0.136 0.119 20.7 0.715 0.298 0.069 10.5 0.479 0.058 15.1 0.907 0.121 11.6 0.625 0.12 L M W -1 3 B L M W -1 4 B Lim it 0.0956 0.149 105 70.4 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 D-E Zone wells-- D ate LM W -3A L M W -4 L M W -5 A L M W -1 3 A L M W -1 4 A Lim it Mar-91 Nov-91 Jul-99 380 350 60.3 690 830 1.6 0.8 Jan-00 Apr-00 172 272 Dec-01 100 1580 94.4 Jan-02 98.6 3060 99.3 Feb-02 101 2250 82.2 Mar-02 132 2620 93.6 May-02 134 1690 87.6 Sep-02 1410 Oct-02 204 2840 112 510 974 Mar-03 144 1520 144 498 150 150 150 150 150 150 150 150 150 150 150 150 150 C-Zone wells-- D ate L M W -3 Lim it Mar-91 390 Nov-91 1000 Dec-01 1520 150 150 150 000099 Jan-02 Feb-02 Mar-02 May-02 Sep-02 Oct-02 Mar-03 1700 1920 1760 2270 0 150 150 150 150 150 150 150 A-Zone wells- D ate LM W -1 LM W -7 LM W -8 Lim it Mar-91 60 Nov-91 68 0.1 280 Apr-96 1700 15 2200 Jul-97 5100 53 2000 May-98 24000 260 2700 Jul-99 6020 78.3 1790 Oct-99 12600 339 3260 Jan-00 17400 219 2100 Apr-00 13600 211 2180 Jul-00 8990 158 2160 Oct-OO 10600 231 2300 Jan-01 9190 249 2650 Jul-01 6100 242 1120 Dec-01 24600 334 3240 Jan-02 29400 496 3930 Feb-02 18400 180 2230 Mar-02 20600 324 3520 May-02 30500 567 4020 Sep-02 23000 197 3100 Oct-02 25900 300 3480 Mar-03 25000 218 1720 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 Surface water- S torm w aterR oute 33 B rinker Cap D ate 002 003 R u n o ff S tre a m Run R unoff Lim it Apr-96 1.8 Jul-97 2 Jul-99 2.23 Oct-99 3240 Jan-00 920 Apr-00 Jul-00 Jul-01 Nov-01 1900 1350 159 53.2 0.573 2.01 Dec-01 Jan-02 36.1 0.39 50.1 0.148 1.9 119 Feb-02 Mar-02 355 131 0.198 3.92 1.26 Apr-02 May-02 443 0.0653 1630 0.282 0.845 1.57 279 371 Jun-02 Jul-02 1410 Aug-02 2050 Sep-02 4.52 0.17 2.24 Oct-02 645 50.9 2.83 0.0612 102 Nov-02 639 65.1 Dec-02 1170 415 Jan-03 Feb-03 Mar-03 2.27 0.247 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 000100 Date 002 003 SW Runoff33 Stream Banker RurCap RunoffUmit 000101 LOCAL L -------- -- - -- *v -- 4 --------- Outtaii 004 --lie New 00^ uate Gutfaii GO5 N ee/005 - - ^ - O u t l e t '0 1 Outlet eM 1 .......Lew LOCAL LANDFILL GROUNDWATER ZONE A Date O O O lU J LOCAL LANDFILL GROUNDWATER ZONE B i'OTOOO Date LLMW-12B LU:!! LOCAL LANDFILL GROUNDWATER ZONE C :GO O CO - cm cm mO O' (L OO Late LlKmVV-11a LLMW-3B ....... Ll M W -!4B Limit LOCAL LANDFILL GROUNDWATER ZONE D Date .MW-11B Limit Du Pont de Nemours and Company Local Landfill Wood County C8 water data Units are (jg/l A zero equals a Non Detect concentration A yellow-colored concentration is a concentration above the WV-DEP limit Groundwater Zone A-- Date L L M W -4 L L M W -6 L L W M -9 L L M W -1 0 L im it Apr-96 39 15 0 May-98 26 9 0 0.22 May-99 16.2 1.32 0 0.15 May-00 10 1.42 0.039 May-01 1.4 3 0 Dec-01 54.6 11.9 0.046 0.133 Jan-02 58.4 12.2 0 0.146 Feb-02 50.2 10.1 0.14 1.12 Mar-02 47.2 11.5 0 0.698 May-02 55.7 18.6 0 0.56 Sep-02 63.5 13.7 0 0.357 Oct-02 79.6 19.9 0.0569 0.395 Mar-03 52.4 16.1 0 0.318 150 150 150 150 150 150 150 150 150 150 150 150 150 Groundwater Zone B - Date L L M W -1 2 B Lim it Apr-96 May-98 May-99 May-00 May-01 Dec-01 Jan-02 Feb-02 Mar-02 May-02 Sep-02 Oct-02 0.0658 Mar-03 0 150 150 150 150 150 150 150 150 150 150 150 150 150 Groundwater Zone C-- Date L L M W -1 1 A L L M W -1 3 B L L M W -1 4 B L im it Apr-96 May-98 May-99 May-00 May-01 Dec-01 Jan-02 Feb-02 Mar-02 May-02 Sep-02 Oct-02 2.22 6.61 0.488 Mar-03 2.05 6.38 0.317 150 150 150 150 150 150 150 150 150 150 150 150 150 Groundwater Zone D 000107 D ate LLM W -11B Lim it Apr-96 May-98 May-99 May-00 May-01 Dec-01 Jan-02 Feb-02 Mar-02 May-02 Sep-02 Oct-02 0 Mar-03 0 150 150 150 150 150 150 150 150 150 150 150 150 150 Surface W ater- D a te O utfall 004 N e w 004 O utfall 005 N ew 005 O utlet 101 O utlet LM1 Lim it Feb-94 11 35 Apr-96 13 39 May-97 13 41 Jun-98 12 39 54 Jun-99 3.06 6.8 15 Dec-99 7.1 34 Sep-00 4.73 13.3 12 Dec-01 82.4 Jan-02 11.4 51.4 81.4 Feb-02 10.9 46 63.1 Mar-02 1.51 14.6 39 16 36.4 Apr-02 15 14.5 40.9 34.3 48.2 May-02 40 Jun-02 10 9.29 27.3 38 Jul-02 11.6 11.2 32.1 63 Aug-02 70.3 Sep-02 115 Oct-02 78.6 Nov-02 76.7 120 Dec-02 12.5 10.7 38.1 9.51 49.5 81.7 Jan-03 72.3 Feb-03 43.6 Mar-03 14.7 15.9 44.9 45.4 D a te O utfall 004 N ew 004 O utfall 005 N ew 005 O utlet 101 O utlet LM 1 Lim it 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 000108 KOOCK 0 100000,0 0CCG 0 1CG0 G 100 0 GG WASHINGTON WORKS GROUNDWATER ..AE1 1-MWG1 ... K16-PW0' QCA-MW2 N04-MW03 . . AM07-FWC1 -- -- L04-PW01 RG4-MW02 Y14-MWC2 AC08-PWG 1 N0KMWCR VOS-PWOi Ljme Date AX13-PWCN13-MWCR Y14-IWAR i1 ! r ~j 1_ 1j wK W .-A K 0" W# K c.oOw"' ~ cf D'-KGG" DO8-MVV0; PQ4-MW-2 West Wei; Field El 3-MWG1 P08-MW-' ' OTOf WASHINGTON WORKS SURFACE WATER :,u OT TOO O ' <5" CO xo , 0 o # \ Ox O N CO 0) O w# A O" O ' w-A-: o0- O : ao O<^AOO' A# O'<WOO'O..O' 0'OO 'oo..Wo'OOa' fO.OOyW>cOcGx>0TOO' ' T 0" .O O <:f ' #'* ,,O # .:A Dae -Outlet OIA Ofaii 002 Outlet 003 Outfal 005 -- Outlet Ou7 Outiet 105 ......um Du Pont de Nemours and Company W ashington W orks W ood County C8 w a te r data Units are (jg/l A zero equals a Non Detect concentration A yellow-colored concentration is a concentration above the W V-D EP limit G roundw ater- Date AE11-MW01 AM07-PW01 AO08-PW01 AX13-PW01 DO8-MW01 E13-MW01 K16-PW01 L04-PW01 N04-MW01 Apr-96 0.48 0.52 Jun-97 0.79 0.55 Jun-98 Nov-98 0.41 0.4 1.9 1 2 0.46 7.9 Feb-99 0.69 0.082 0.59 16.2 5.89 May-99 0.578 0.307 0.882 Aug-00 0.071 0.167 Nov-00 0.24 0.4 7.5 13.8 Jan-01 Apr-01 3.99 Jul-01 0.202 Jan-02 1.2 0.131 0.355 0.582 2.11 10.5 30.9 689 Feb-02 1.45 0.129 0.439 1.03 1.27 2.32 12 23.5 Mar-02 2.82 0.171 0.568 1.22 0.262 1.62 17.2 40.9 Apr-02 1.22 0.159 0.497 1.42 0.424 2.44 13.2 16.1 May-02 1.25 0.247 0.499 0.911 0.551 2.47 12.4 15.1 Sep-02 1.92 0.335 0.42 0.834 0.117 2.39 9.71 3.06 Oct-02 1.74 0.269 0.415 0.721 0.126 3.43 16.2 14.03 Mar-03 1.37 0 0.308 1.07 3.72 3.15 8.93 19.8 Date N13-MW01 P04-MW-2 P08-MW-01 Q04-MW02 R04-MW02 V05-PW01 Y14-MW01 West Well Field Apr-96 Jun-97 Jun-98 Nov-98 0 8300 36 660 1300 0.66 12 Feb-99 29.6 13600 994 9420 12.4 4.95 May-99 Aug-00 Nov-00 13.7 Jan-01 12600 13800 Apr-01 5.48 1.58 Jul-01 11.4 2.31 Jan-02 23600 43.4 1480 47500 29 12.7 2.31 Feb-02 57.8 26800 20.7 1590 43600 25.1 10.9 1.58 Mar-02 32300 2070 54400 40.9 15.5 7.72 Apr-02 36500 1210 56300 37.6 13.9 6.69 May-02 42400 1480 68100 35.8 15.3 7.09 Sep-02 34400 32.2 66500 34.8 18.4 6.41 Oct-02 46600 120 7720 84100 51.2 18.2 10.3 Mar-03 36900 566 322000 42.5 15.7 7.2 Date AJ06-MW-02 N04-MW03 Apr-96 Jun-97 Jun-98 Nov-98 Feb-99 May-99 Aug-00 Nov-00 Y14-MW-02 Limit 150 150 150 150 150 150 150 150 O O O lll Jan-01 Apr-01 Jul-01 Jan-02 Feb-02 Mar-02 Apr-02 May-02 Sep-02 Oct-02 Mar-03 0.133 0.099 21.2 244 150 150 150 150 150 150 150 150 150 0 150 0 150 Surface water-' Date Outlet 001 Outfall 002 Outlet 003 Outfall 005 Outlet 007 Outlet 105 Limit Feb-01 1.74 153 Mar-01 8.54 199 Apr-01 1.5 4.31 May-01 0.436 1.43 Jun-01 0.594 7.4 Jul-01 0.558 120 Aug-01 2.16 Sep-01 0.118 2.86 Oct-01 2.8 65.7 Nov-01 4.84 915 Dec-01 3.72 1.98 7.13 35.2 1.99 9.78 Jan-02 10.9 4.23 3.99 137 0.871 7.53 Feb-02 9.43 4.66 1.33 141 0.339 14.6 Mar-02 21.4 5.85 2.91 9.26 0.483 13.2 Apr-02 19.7 2.45 2.76 3.8 0.567 15.9 May-02 22.4 4.13 0.503 98.6 0.49 6.27 Jun-02 17.9 3.86 0.175 17.9 0.284 3.86 Jul-02 8.63 2.29 0.291 19.2 0.597 34.7 Aug-02 2.94 2.56 0.268 12.4 0.207 6.73 Sep-02 2.15 2.14 0.317 5.02 0 3.69 Oct-02 10.5 3.49 0.87 12.1 0.251 54.9 Nov-02 17 5.28 1.24 18.1 8.56 10.5 Dec-02 9.75 2.37 0.68 6.62 0.263 6.07 Jan-03 3.58 5.46 0.75 33.4 5.77 16.9 Feb-03 18.9 4.15 1.06 46.4 1.1 17 Mar-03 51.4 4.11 0.43 43.1 0.897 9.25 Date Outlet 001 Outfall 002 Outlet 003 Outfall 005 Outlet 007 Outlet 105 Limit 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 150 000112 Final C-8 GIST Report APPENDIX C: Consent Order No. GW-2001-019 Division of Water and Waste Management 000113 ARTICLESC5OanNdSOE1F2N,TTCHHOEARWPDTEEERSRTISV2S2IURAEGNDIDNPIAUARRCTSOIUCDALENE.T1,TCOHAPTER 16 TO: E. I. DU PONT DE NEMOURS AND COMPANY DATE: November 14, 2001 WWeesstt VViirrggiinniiaa DDeeppaarrttmmeenntt ooff HEneavilrthonamndenHtaulmParnotRecetsioonurces Order No. GWR-2001-019 PaHnreodatleDtchitriaTeonchndti,osHarCnoudOmf ttNhahneeSRDECeNiovsTmoisuimOorcniResssoDi,foEpAnuReirrrsiuoQsafuinstahstlueittoeyBd,tuhWbreyeeaatusuhttefhVoDorirriiPgrteyuincbsitlaoeitcrDfoHoefrpettaahhlrettihmnD, emiWnvoitesroseiotfdnVEeonitravfgiilWirnboiaenatlmeoDrweeRn.pteaasrlotmurecnetsof I. INTRODUCTION OF PARTIES. ERCneovsmoirpuoarncnTmeyhsei[-snDtCBaulPouPnoresrnaoetun]te[tcfcOootirlorldPenecurt[biWvilsiecVleyHnDtreeEearfPelet]drh,reit[nhdWteotVoWbDyaesHsattnHhVdeRib"r-gePBtiawnPriHteaiee]Dn,s"eta]hp.nI.eadrWtEm.eesIn.ttdVouifrPgHoiennaitaldthDe eaNpneadmrtHmouuemrnsat anonfd II. PURPOSE OF CONSENT ORDER. drpuDCilOfDemarern8ouwrlotudedpmePciaPeelrsseoesrmroeDsnmentnWsasitouTnTntefaptPooenderhhturesioftiidtwitfrtssnhatoausesVmhtuiCrCnrhnetWaoitemhooersitnpnfghrennatoietefriessehsoinrnterendhaaeoriinn.tgitacuhrniatttermoihsoegDegOOnirtrethasheusoprrsft.ddiPnheCeshiteeraodnoaCoWfrrCzneslna8sahcurtosobnearoaonaeidtlreysnsrssgnkoeostepbtrsarnuftoneroaeoOsfmcoetteavrautscrtsnnOaecahdteuyrtniteernoelebtaodirdeirostiameciynsgtidratranoeoeop,lrlnarmgeotaitnucin[eghccaptCeysosoueattel,e8ttyloodoevahid]ctmnfdt,waahboiitlzoCehpyninaaiatrdnultsAshrDeg.ikptmWdtmiSoasyrutoaoounPeauNtondtcdonsoesefuhthnfbbewtamiaeothedenniaaretiibgbphlnnsaeetttofegohdneriairusnntmfnfs3a,onod,odn8irdorfirWsdnc2lmttosubhheg5itotooeyeehs-htor2dnrheeootad6rihtbcposfewh-eCtyr1nfafiCoiaot,onvsatedconheutinrpoturnsenmyosrcasttupoPnytnlsehsinecma,ndeaocedrmtWbetiefceeifiOndaonretliehittcnisnvrtasnaiduyacitksiglrseflnleVoousaCryannncsoittorirtmhorrboeuginedatygneirsssetniueunsrnpiinltltagoaattto.rtfote.fd 1 000114 wBPilHl ntoot icsosnuetesitt. the validity of this Consent Order or the jurisdiction of WVDEP and WVDHHR- III. DEFINITIONS. attachmWenhtehneerveteor,ththeeteformlloswidinegntdifeiefidnibteiolonws sahraelluaspepdlyin: the Consent Order or in any exhibit or BDuivreisaiuon1fso. roPfuAbi"lriTcQhHueaeAlailgttyehnaacnnidedsWt"hasehteDarlelRpmeasretoamunrectnheteso.DfeEpnavritrmoennmteonftaHleParlothteacntidonH,uimncalnudRinegsotuhreces, 2. "C8" shall mean the chemical compound ammonium perfluorooctanoate. wnslapuibetmohcriibnfaeiteros3dpro.yemfcaliaanftbidreoidxt"rh.DaletiIeomtptrieriisectasstbcitoaoaiscnfveapadLlirleinoamcebnieilsteqdi"outimnoanneacatanoitncdnaosdtaimutochcncpetu,litlrpahoarnewcecycaeeinsu-stmanioladyonnesnareailstnryo.odtriuicantaicgnlcelpuerrlvoaaebgclyoratrhumaantotdtroceyarhncnaoobvnreemdraieatislloiuaonfbpsflieycfroiaeartcniaoht nievoefda 4. "Effective Date" shall mean the date set forth in Section XVII of this Consent Order. 5. "EPA" shall mean the United States Environmental Protection Agency. jwcscuhooidanmtihltclrpoionlauylolti6ottnl.rifbgimbDewuirutnaeiPtatqhio"luosnFtinhrtoo,eewrrdacwohcetttiooshcMrehcokraofcjptneoGhlcuauioernrlddded. ,"epnatsaoochrtttaiaiholenlansyvm, oeolearrbabinesnotearrcnicodktoneieovmdsneioatriorncoofdlnamsgsb)o,eoovwrrbecdryhniiirsdcmcphuueuempntedrtsaesitllvai(egnapngecrotneevnscoeicrbdiedaeeynsed,lod,aonhysrdohDawatdhluelmePvinroeinercna,iltsusDtfodrrunaeoPt,amibovlneetor tdtppeherureotrmepvgroirm"dosmeeiun7snoa.idnnosigtumthopteahrprideln"tyehgGpaobhrwnyfyoepsutdhilonclio"gtdaasgwlibe,inlnaccelgtihlesu,wertdebmaMdeotiesrcoaripa.nnbligoi,et,vozbedorio,irmnilblogeluigtntWeigcrdsa,eolldea,ls"nroidvnsrhioronaatbgldils,niejmocerllvteoutaaigdntnieicgoaaw,nnloeywprlrlecsoolatlpwshsee,ehrdrwtoimesehxesieccptohahrfvoiamgadrtresiaooriufnynonsrpodttaurwhlrolaepeptodepesrun.feroipnirTsoghstieoentoof icnocllluecdteio8dn.risnyksitne"gmGwrthoaatuetnrsdwuwpeapltllesi.ersWAwsealult"eserodfroi"rnWptuhebilsll"iCcs,ohpnarslilevnmatteeO,anridnaednru,ystthdriirasilll,teeodrrmoargaperixpccluiaelvtsuarotaenldlyugstreooauwnneddlwlsshaatellr 2 000115 located in West Virginia. wicWAGnootrsVtAoratkusDcttnhaoaEdmtcftP9whrD.e,imabnectuteeoetnCrsaAttIb,snnC"laivenRnnetdtecoSsoiuttcmtiraahgoranbieastsyutdtssi,rCoobsPantoaythhbntSer.WlsDiretebep.VnuCeatitrDnoariOtnbsEitgtrclhPsedie"Tpetiarnoesn,nheaawctgamsnolohlynot(oimnGnaceatoeIticrSahnoetTnetinros)aCcen.acorn8tvwsodtiArisnitgmrhsaesttiepttnahrsliieesntbmmhpeuaduetetannbbapttltlaoieocttshifi(omteoTinonedoneoixatrfiinaenctschihgtticisoysooudnTnCretleoorsyaacnfmbcrstitahe,bosneearitsssd)Otdiotnreodsecthrr,iebtehde located 1in0.Wash"iWngatsohni,ngWtoonodWCoorkusn"tys,hWallesmteVainrgtihneiam, aansudfeapcitcutreidngonfaEcixlihtyiboitw1nteodtbhyisDCuoPnosnent tand Order. ddeeppiicctteedd11oo.nn EExx"hhTiihbbeiittF31a.,ctihleitiLees"tasrthaLlalnmdefialnl, tdheepWictaesdhoinngEtoxnhWibiotr2k,saannddththeeDLroycRaluLnaLnadnfidllf,ill, peienfxefcrpelhoucastdpsuisnrd1egau2ntr.soienonagrsdciae"toirRlmviofeepefftsoemiuurmebanenpgd.con.epiCtuDuhldoareotsineoo"inrcsogR,rretf"haDRatestfrDia)sr"oelifskshapeaeldlyclaitmifoliycebaaeelnxlywpaonditsehuevosreetuiltmolepaavnetedeal p(tfowporribetethchipeuarnbhocluteeemrcrtitaasinivkneptoyoffopsdrpueallloanetntniegoirn-nitgo,eurms wlifaetteirm, eo1ri3ns.otihle, th"huSamtcriasenelnipkionepglyuLltaoetviboeenl".wsihthalolumt aenanapthpereccoinabcleentrriasktioonf idnelaetsepreiocuifsicemffeecdtisadsuurcihngasaair, IV. WAIVER OF RIGHTS. riasessqsuiugeinrteshm.DTisehuCniPstoosCnnosotefnwntshtaeiiOnsvtrCedOsoeranrd.nseyernaatnpOdprladielelsrr,tiogahnadtnsdsihtiasmllbainynodhtiancvhgeautlolpeonangpeptheteahlePojaurrrtciihesdsa,lilcaetnniodgnethotehfierthvseualcAicdgeietsysnocoriressatnod V. FINDINGS OF FACT. 1. C8 is a chemical substance which has no established state or federal effluent or emission standards. 2. C8 is a perfluorinated surfactant manufactured by the 3M Company and others. 3 000116 pSrioncceestshees eaatriltys W19a5s0h'sinCg8tohnaWs boerekns ufasceidlitbyy, DloucPatoendtiinnWitsooflduoCroopuontlyy,mWere-rsetlVatierdgimniaan. ufacturing WactapathstuehriFensa3gc.tfoiolnritirWeescRo,yraecknslseiddaauoreesthisgoecnrrowihfnaiitcsvaeaeinnsbtihnepigeponprCteri8doelnfoerafoofsm-fesuditsfelteuodfootCrhroe8dp.eaoislryt,rmudciestricomhnaarangnueddfa/octortudtrhiisenpgOosphariloo.cReDsisuvePesro,andttisaplsoosed of cHa1so0onpwmtaaeriictvnirec4osru.np,lseaC)ct,8eifoimrcreNalaleotistamepsareie,tvsraPomtaMilroaiettnisioslaeid(sopsdonuarregretthsdaisecnetuioadclmaDmctoeououmPmrneopatnogtottueefnanrCudewt8.rhaittolhhlryaiaztininmnagWaeyrrVeobldDeeyaErnsePealsmeDaoisicfvepdidsoiiatloolmunttehoatenefrtAesnleitvrosisQrtohtuhneaamlenientyonvrtip.reeoqrnmumaitlesntot thsEoaaPmsdAerp.etlepecso5tr.attnehdde prtherepeSsoirenrentcssceueClats8sanoecdafornltlehycvieseanslstaro1amf9tiC9po0l8ni,nsiDgninutaoPwnodvanataterrirhooaauussnsdprgeeocqrvefuoreitrrraemnidmnebdeoynfrteiptgaesgurFmelaanircct,siivleiiostsi.lseuusCneitudnarrbrWyeynweWtslayttV,eVrDDirsuEgaPPminopiananltidananglsdo pinubalnidc wa6r.aotuenrdsucApeprstlaiaeinrse.osuflittsoFfaDcuilPitoienst'isnsWamepstliVngir,gCin8iah,aisnbceluednindgetpercitveadteindvrianrkyiinngg wcoantecrenwtrealltsioannsd Service7.DistricAtn(a"lLyPseSsDo"f)wdraitnekrisnagmwpaletesrhsauvpeplrye.ported levels of C8 in the Lubeck Public is the lik8.ely souDrcuePoonftC, 8bypraensdenthcreoiungahnidtsauroseunodf Cce8rtianinthoeffiltusoFraocpioliltyiemseirnmWaneustfaVcitrugriinniga.process, panardtitchiep9ae.tnevdirionnAmmlueolnntitgp. lwe istthudenievsireoxnammeinntianlgstahmepplointegnftioarlCef8f,eDctusPoofnCt8haesxppoesruforermonedhuanmdan health diannogdseetssht,ieoi.1nee0,n.,.vicniorhonanslSamidttuieeodnrniitne.1asgnpbdeodrtfheorrmammaeloducobnntytaaDncudt.PdoSunrttuatdaiinoedns 3ohMafveexhpaavolsesoudrfeeo,tueirnsmdtoitnhxeiacdt Cttoh8aatinsCimp8eairlnssissttuhefrnfoituciginehnhtumans ttchhoeelleeencxttveeid1nr1otb.naymnDdenucAtPo,lnotthhcnoeetnuiAntgrdghaietcDinoacuntiePsessootnbhfteaChlti8aeCsvi8necoittshlhlepaertceetansedveddniraitotiilnonamnrtgaheelneitansmaufotrofrouamrncanetteoiaaofnrnddtawhgteairloFlouaanncsditslhwiisetitaepttsehr.reesmaAetnvtichnaeeildaoLebfleliCtenae8rdataitantianngd 4 000117 Dry Run Landfills and at or near the Washington Works facility. sinouthrceeaor1ef2a.dorifntkhWiengVFawDcaEiltiPetrieafsno.dr pWerVsoDnHsHpoRt-eBnPtiHallyhaevxepdoesetedrmtoinCe8d itnhagtroituinsddweasitrearboler stourafascceerwtaaintetrhse hadnueotmetchateniro,h1neh3a.aalnvtdhe prseEtruqePdsuAeieens,sctWeebdeVo,infaDngCEd8pPDei,rnufaoPnarndomdnWetadhrVoarDuselnHsadutHebtdhmRet-ioBtFteCPadcH8,il,ieintixinfeposocrsomaunnarsdetui.doltonactaiuonmndeadnnotdscuwcmoiotehpnertserasrpteieolacnttiwntogitththoeotnhee WeeavxdVapvleoDursasuEteriP1oeh,4nep.aaaonlttfdhhwwWBehafaVeyfsetDhtecodetHsrhuHtfuphrmRooemn-agBnriCsnPof8uHaonn,reddmxthpawaenothidsAoeuntsgrhueese.rnufrcabpicmeeesriswtbtoeeandltiseebrivsynenDatonhuwdaPtaocarondontdutainatniidnodintrnhaeeglvFidCeaa8wtcaiheldwaitvioteeousalddaacrteaoesmasbtipysrltieEsitknPeAothf,eir pexerpfoosrumr1ee5ds.toanndtThahredehrefuomhraaCvn8ehabepeapeltnlhicnaeobfflieencdttosepotehfneCdge8ennetexgrpaoolvspeuurrnbemlifcoe.nr ttahleoprunropno-siendoufsetsritaalblsitsuhdiniegs an tdpoaertaetsirccmiepriant1at6iein.ngatnwhdehTaeehstxshetieesArnt tgCinea8nnthpdciiresleessevehfenfalotvsroet.facnCoy8npccolousndsciebedlnettrhdaaattinofgnuelsrl itsnoittethheaenepdnuvhbielriaocln.thmDaesunsPteoasnsnmtdhetaonstsaasgasrrieesetndethctoeemssainry eeamcihsscioomn1s7p.faonrye'Tisthhceeormftlhmueoirtymoepaeonrlty1md9a9et9ers.oDirnutdhPueostynretyachroa2ms0m0co0imtbteymd i5tt0oteptdheitrsocegEnoPtaAlwiinttoh2irn0e0dt0uh.creeetototaflivaectyueaal rCs 8of WmaajsohrinCg188t-o.cnonWtaDoinrukiPnsogfnawtciailnsitstyetawtlhlaeatdet,risisntdrMeemaamor.cnhst2ra0t0in1g, arefmiltoevraalnedffciacriebnocnytroefa9tm0-e9n5t%syostfetmheaCt 8itsin its VI. AUTHORITY TO ISSUE CONSENT ORDER. 1. The WVDEP is the state agency vested with the authority to protect the environment in West Virginia. Act, gra2n.ts to thAertWiclVeD1E2,PCthhaepatuerth2o2riotyf ttohepWroteescttVthiergSintaiateC'sodgero,uthnedwGartoeurnfdrowmatearnyPrcootnetcatmioinnant 5 000118 raenqdu,iwrihnegrethcaot ngtraomunindawteadtegrrboeunredmweadteiartiesd.found, to institute a civil action or issue an order cgirvainltsactot3i.otnheoWr iAVssrDutieEcloPerdt5he,erCsahtuoatphetonerfriot2yr2cteootfphtrehoestetaWcttuettshet.eVSitragtien'isaaCirofdreo,mthpeoAlluirtaPnotlsluatniodntoCionnsttritoulteAact, protect 4d.rinkingThweatWerVsDupHpHlieRs-BinPWHeissttVheirsgtiantiea.agency vested with the authority to regulate and tithhneeveaasuutittghh5aoo.trriiiottyyn ttnooeApcinrertsositcstiealteucrytte1tt,hoaCecahtpisaouspnubtsrleiecrain1tdsd6ripionsukfsruitinhteygeoawWrndadeetrsesstraVtfsoeuitrprygep,islnatyoniarodefCfttuohhrdeetehps,eturgartrgieatrynaatnnostdfstosttaootihdptehewerWfaWotVremVrDsDHaulHpHl pHRlyR-.B-BPHPH VII. REQUIREMENTS OF CONSENT ORDER. warhoiucnhdtoTthhdeeeFtAearcgmielniitncieeiests.hehTashvceeorepcfeoonarcenl,dutdhpeeodtAetnhgtaeiatnlcitrieiissskroeofqfgutrhiereaetptihrmeespfeoonrlcltoaenwocifenCgto:8 hinavtehesuefnfvicirieonntmdeantat iunpaonnd A. Establishment of Groundwater Investigation Steering Team. mTtroGeefhaIeqStemmuhTiWebraeesGrVmhre1sIa.DeSslonelTEfttbPstwfehosriefereAlutltphtnebrf"daoeieGnmesrttedrfhoonucbutioloaynlnvntidieDSsnvwrieeussActaePiwttetnioetoiagnralnclntIoshnbifemnAvexWeeaptsthncVhetetcidrgDooAitateruEitdaogioPamouhfn,nstcCW,lhSee.piastVwhedTCeaeDihrstrohieH.enndgSHswTeaehTRonpceret-tpkiBaOoromopPbnraejHd"ecVrefch,(rIoGt.EIitrIvoImPHSeoAfesTfoudtw)alRhfnwsieieldhsvgliaiteiCsnhlorplgo,noebnttcvheIhsiIeeefeIeri,ncspsmtaitrgtaniOaambhdjsroltkdaiDrsfsreirhyutrooye.Pmpdfooutnwfhtrhtpeti.heothese AtbtGeha.IrecSmkAFTigannrscayohi2tluaigi.ontlrilndoeisusod.nsfaudDttUeawhu,piiasPgnotrtoeCneornoructimnomnrsndoeecwsnonelirutatroftsvOeiirenorirsnadnmlgethorropeefnalpkairnotinedogryrthdssimtnhesvgatioele,llteltraosibenntpeqodgeunidpnfeeolscspurtoutmimrhnrpseoftouhidirnaedaindftettieinancdtstagoiktfasisiAsoconsataftetaiomtfocaffhniconttmhraotaeshernnpdpditlneeacAsrnAomcsrnstiithcutbaalpemculdohlsonmisidonureinerfnAsvintciertavAtewategi,caoathtlhrnhmdeoefiefnontgrhte Facilities' permits. B. National Pollutant Discharge Elimination System Requirements. 6 000119 Ps0a0om4llupatlnaindn1gt.0Df0o5irs.cCh8EaxragcteetphEtelaiLmsooicncaacltaiLosainonnSdefydisltlbeamyt nc(oe"-rWftaloVinwNocuPotDnfadEliltSsio"id)nesP,netDrimfuieiPtdoNninot.sWh0a0els7lt6pV5e3rirf8gomramsiaOm/Nuotafntaitlohlsnlya1l01, sPaemrmpliitnN2g.of.oWr CV8E0xa0ct0et1ph2te7aW9s aoasschcOianusgitoftaonlnelsdW0b0oy1rnk, os0-0ffa2loc,wi0li0tcy3o,an0td0ci5tei,rot0na0isn,7D,oauuntPfdaoln1lst05sid.heanlltipfieerdfoirnmWmVonNthPlDyES WsamVp0l0i7n36g.2f4o4r.C8ExacteDprtyaRs oucncLasainodnfeidll bayt anlol-ofluotwfa'llcsoinddeintitoifnise,dDinuPitosnWt sVhaNllPpDerEfSormPermmointtNhloy. WsamVp0l0i7n46g.0f6o6r.CE8xacteLpettaarstoLcacnadsifoilnleadt ablyl onuot-ffalollws icdoenndtiiftiieodnsi,nDitusPWonVt sNhPalDl EpeSrfPoerrmmmit oNnot.hly rsseahsmaullpltlrsiensc5gho.arsdlhlaablneldWbdereeiltppihveorerrfertoesardpmleltcoeatdttttheopemuthrWpsetusVraetnDoqtEustiaoPrmeewmpsitletaehnbiutlnsinstdohhefeirdrptnayEoraPd-gfaAlryoaswgpuohicfsdorVeenlcdiIneIi.tieBivsoi,.nnlwsgt.hhsreuorceuhgahrpepVsluiIclIta.sBb. .l4eD,,uaaPlnlodnt oOtdIamsshfhanboheimacdtwliaeloDolpoinsnnlbensRciutteenaereip6gvencress.aeittxtawvrimrrmtaoeeeiitnarlnnpislmodmleLbtengWeh,ieisdmmeflaerpiasottaeiebohtumrnaroiepapfttnvasoswrpeeter9riearemnoe0fxctnoihpahtettdeumeryidaiasnnaDulryddolotirsyeivenffn.iteaonsetgwrchafcaemetmattenihtoneWipyoelnrlerrseEasiiaaLdnvsfml,dhfitelmaeuoitrpnkhcvwilmtgeeteiinsatvdiasolslerweentpwegrsDiuemWtfadbahaotmoelietuoinenrwcnrtkootidsnwhnsrfstwiiattatrnfwrhttakieeytiaceoharsnirmilsfiCyrnivoutiyvosreopw.eenrppfghrsmlutmieyhmIcbnfiehwlelitcielnWceoisOittnsnhwdrastcuidaoosanekpehwtnereesit,txnhntsrrrDgtesaesaetttuarrunuoieemopPdpnapnetso,moWsltdnirae,eobtsoosaaefaarrmdgakCpstdlrsahp8oeiomrrtnfereioaasgopebpcnltortieroahliivdialvetetyeer. iprneeqcroumripirteosmr7ba.eytnemdtsiiunnpTotoorhnetmhraeoeddnFdiefaiwitccioiaalnlittiaoioelnfsm.t'hWoeDnpueitesPortormVinnititgrsrg.eriseneqirauv/iNeresamtthieoenntrasilgchPotontltolauirtneaeqndut eDinstistahchimsaorsgudebifsEieclcaitmtiiooinnnasothifoatnlhleSbsyeestem C. Toxicological and Human Health Assessment. Order by1.establishing aDnuePscornotwagarceceosutnot fautnadbtahnekvaagriroeuesd ttaoskbsystehtefPoartrhtiebse,loowr bayssaopmaertoothfethris Consent 7 000120 mToexaincsitaygTreeeadmtoLbeyadtehreaPnadrtDieusP. oDnitsrbeuprrseesmenetnattsivferojominstalyidaessdcreoswcrisbheadllbbeeloawu.thorized by the C8 member2s. of theAteCam8 AcossnessissmtinegntooffreTporxeisceintytatTiveeasmof(:"CAT Team") shall be established with WENWADPITuVVCAPSDDSoDRnEHRtePHgiRo-nBIPIIH 3. The WVDEP representative shall be the Team Leader. set forth4.in fullTinheAitntadcivhimduenalt tCeaomf tmhiesmCboenrss,enthteOtradsekrs. of the team, and the team objectives are ihsesauletharf5iis.nkasl arsespUoocpritoasnteedcttoiwnngcitlhfuosCrito8hnafotinftdhaielnlFgtsahceoilftiatfsiaekcsst. saentdfcoortnhcilnusAiotntascahsmtoenwt hCa,tthexetCenAtTthTereeammasyhablel D. Emission Modeling Assessment. t(h"iDsAsuQb"s1)e. cwtiiothni:n 30 dayTshoefftohleloEwfifnegctiivnefoDrmataetieoxnceshpatlwl bheerseubamdiiftfteedrentot tdheeadDliinveisiisonproofvAidierdQiunality bsdPtairrsosupefceidtlruesoriIneonsntphluooetcf"PaCatrae8ro.edgaerwmaomiiftshbsAi(iunEoinlPctdhsoAi.emn-g4WSp5liwgea4tnsa/ehRkifiea-in9cngea3dftn-ofa0tenc3cicmt8Wsu"prRoaaaretcskevtsdilfsieofseafrtdicnoeiFlaefiecdtbybhui.ntish8ltdtra,huitn1ech9gtEau9dvPr5eie)Am.oaeUnsnistsgheinoeri'nfssiipcGteaaunrsaithdmiaemlelttpobearetcshtdefoeoBtnreuartmihllledininegd eaaelmcmlciisostotrsiudinorigncnegCrsat8oltoeDisctausabtPnes.otddancwctkosinthIhA.faDiilnrl.cmotlahiemnsedtdpWaalclceolattruersreaheallisennpCvdgoa8tannocedtncmisnuWtiagrsacsoptkieroekprnlsmiasrrftiaaattomcenifsleuiDttmieynur.bsPpeEootro.unanctbF'hdseosecurpmusereeairrdscesyhniinetosanptaraeipcfrroomkdriiniistdtthtpeeesendhrytsaiaeiflloiallenrobdw2em0aalob0ibsdo0lteevefldeoinrags. shall be suppliecd.: For each emission point (stack) emitting C8, the following information 8 000121 1. Phase of C8 (solid, vapor or aqueous solution) at stack conditions. ppaarrttiiccllee dsieznesditiyst(rgib/cumtio3i)ni.. (microns), the mass fractionTohef Cpa8rtiincleeacchhapraarcttiecrleizsaitzioencatotegboeruys,eadndfotrhme odeling incl bp(EIDoadmsaSEoacdsrefueCsrafPtdcdthPaeevirAiisscrecoeGstliuts-lnanioieu4rqsavpgtnei5uepsit.cdsmnih4irlhadzDageo/eFaneBivnaalomcdcl-ntedteloee9hldiofe,woo5s(aifftFwciff-virfnr0tCiiicieoihegfbc0noo8nzuitu3jgneher'curtbsmnfneeiisaioettsdSiasprs1nimiceitfei1rwgias.inpeaeocevhotcnteinati.ettidtfa,htpnifit1lIniwoooigitSn9ttghrFniayiC9tsnetsohtou5higieirnEopn)GfiivnpncnpPt(wetuhoa"ohnAsDtiererIroeedtSiftd'AvtipafsCebciatenianhvQuceIynrcgneeiGlste'eua,idnds)eunoutsDutaeselstiffsye,ssdedouettutsDarrhPitm,ocifneneaCoAohtfrciolrinsmt8eQatahsStswr"'n'ieeesmo)osddsee.qunnshetsteutcirsocauDoandcea,lirbsgeelssuvmrsumtip.ePeicoCrsaoqanaioenDslsosuvgmnimusimzeAeaitietneeisoennopmQtgdneangdlnttr.ieadcisenDrxniymcoeecsgS,guasceosomhevVPifcunwdsforeooabsiieveunioceidnmretldligfnshietdsefneiii.rinotnrlDgtcDe,eahtngisstAwtbeeAet.ic3neaorQirQotsrvtnDiMhseegeraiAdfdoehs(nonfghitfiQdusdtca3rhtDaep/ior0UespelsodA-hnprdnGirSmenatrQiaEgqoultgmyilh'huvnPissdeCa)tieArtapo,thef8nopofet'corrstoehvee lCtwferdrmfSDihueeomeqh8ieuacsrnctuomedoiPhciaEsiuresntdon.sviiDlf.sionddofeoaiDeAntndsnncDcreAQdotsolterAhiensQfavifetaenQsttrdeieniorcrsorsvriDdzlohdtgnueeerapiahUsdensnlolttglaieetStnfppthat,awEogDrrpepsiedPinrirpAictrzioenfAhirnieovgqiQopfgvorSehuvuit.m'to,rtieCessamrDciattead8nooittadoiueig'rmotosadncPidnonsFfiersosiosetnacosonite1rssaoaormrts.oubv4pntgnssrteeup.aahehounlrtsmauepafohcFgelespltveloideoaehnoenliehuidpeglnrmftsaoewtifIvtcowrcoteShicoeohiftmrCieeehfeenCtnwnfihcogjpsGcft8uoeepaisirac'sutneigeosrotisinfdeimpiednigsfeondsaioclshepeciste,naetftsteaon,evctsCdtsiwftrewecinioiao8.naatsigtriinvtlgcuttoehiDhheaoitrnmiinyienvunnfniggenmiPbtiswsnhniscoasnDeoegeoirsntvgdvoiiheAepttneeendiefcangmnlnQfsoiriegontcdeca'tdvin,shgifoyaeaeefDayselytnwinseth,scfsuutttfeiiw,DstoiPblesecltpnoumfAioorinbhteuctnaQsiherynhltitnedet,'st(psqdsasihwbfmcruhrdsomotaei/eaoueertsvllsehbcei-lgirtpnamiditmeainsirasseqngosimuisodumges3apruns)oe.s0eeaeeieusmrofsaedtDotosanntiaeaurieA.dynnssbsgQtooiotsfhf dsotehifmaaCglplr8eab'rsmeactrurfeiorpterircseC.asl8edpnw.rtoaitpthievrreteisoepsfeescxhthatlaolupbsertegpsasrsouTvrceoiodantehndddeitaietolexonmtnsegpnbetwertafhiottahurtermetha.eneaTdpshuhaerfaetstedeersmrcaeponxengirtseratost,uloareefqspoauhnliiapddsm,peleritenqrsatu.sniudsErietasintoridamnnvagateepssor phase (T-P) 9 000122 meccossouoqopeblnuneaumiccrstlaeeiiuitbonntirtrnntteeirrsgduaadmttacpiitsooooKbnnnatessdvhft,ieuaewott.linreDuoecmreentAenisplfo.QaeowntrreFIawaondCuttufier8latrptirhcheedHiaiusenidn,rsswodms6aofon0iColcabdlrdi8seabbpa,etieyHaritnovhspasdneeorridryossifecnvowpptuihlhrdausheeqasebessiduEnieoel.enfintoft(teyeTTaurscetsht-aitegxvenisdva-edoyirenlid)oKunfDiftodnriaatarioghatmfhneegfte.sthara,ratePadimaonovnnsgiodnpreleitaasnmpctoorietelfehbiasGtCissyeseu8CnprortveiaifanenmrtCdagaveg8qdantrhurauitineseprooihovuanuqasfgsspuhCaoesa8coorlt-lluulubisatqeilounids, Tachteuaclooepffeircaiteinotnf.ss.hall beHdeenfriyn'esdlaawt vcaoreioffuiscietenmt fpoerraCt8uraensdcoavdeirsicnugssthioenraonfgitesodbespeernvdeedndcueroinngpH. g. Any carbon adsorption data in the form of isotherms for C8 adsorption. assumpDtioAnQs pwriiollrptorofviindaeliDziunPgothnteamnoodpeplionrgturneistuylttos. comment on modeling methodology and requeste2d. abovAe nshyaellxbpeencsoevseirnecdubrryedDuasPoanrte.sult of accurately supplying the information prersoecrevdeus3r.tehsearriegUhdtepetoomndesidusabinpmapiprsopsvriooenparnoiayftetdh.aetainiffotrhmeaatnioanlyrteicqaulirmedethboydtohliosgSyuobrseqcutaiolintyVcIoI.nDtr,oDl AQ VIII. REIMBURSEMENT OF COSTS. ntdCahnoeoistsnieicgssCetenionamontt1fesa.OdesteunrrdctoeehOpfrr.dRrDedesePueseirriPmng.iootnbanrEauttittxroviaspoeagtnehbrnoeelsdfeehiestatChxulteleoorecsbWesutesstVftistraoheoDbnnamlEttiosPWttfhohtaiVhatsnhniDsdeaecECposcePcoforrnDusoesnowxuetnpPnsseaothccinOadcttsloerl(dnut"boetndeirtfie,inmtseWocidagufVdnrpueauDuntrudneEsdpduRPoearernenhitptajmhorstieobispnsueSrCtronesaovtacpnaibtpdtsilioreeevonndevCtsXDaoO"lV)usr.btPdIsyeWoourna.fnrtdtidhtwuetielrisynth atpeuSecsenanccrierfdotxoohupweronmesutcn2aesrfd.cadouecnwndouddunaasdndmcoitecWnolrmolutauithuhtnrnhessittsitna(rsb$Cemhe1m1oao00lnsaul,ubsi0nbnepu0teinps0notior)gnefr,OetpifoesrnildrdsfettenayhdbrsieaystsyhahheasgoesanrudcolelsrifewtaobedtnwhiemtdtehoriaedzEcabteocdufydlfordlenatuiachtrencitsedoictvon(date$auote5lnDstD0hitfgai,ueu0ntnneP0gcad,o0,otsDen)nid.ntwcu.cl3PrEhuleuoesapdinncroihetennvssgeeehoxnraifnptltatlvhehtndoeievdeibcewpiaetsouol.sasrrieankAtncfitndernoyoritmbseheceleethiespesstcstrh.oawn 3. DuPont's obligation to pay Reimbursable Costs under this Consent Order shall 10 000123 nwitoshtiocebhxlciageraeetdiaotdnwdsoreuhsnsudeneddrrsCeedopnaasrnaedtnetfliyOftiryndtethhroissuhssaaelnlcdtbioednot,hlleaalrlssool(teSh2erer5s0cp,o0os0nts0si)ib.niclEiutxyrrceaednpdtbayosbDtloiugPRaoteinoimtnibnoufcrDasarurbPylieonngCt.oosutts IX. QUALITY ASSURANCE/QUALITY CONTROL. pgsaruomidcpealdninucAgere.lrsle.sgaaTmrhdpeilnilgnabgqouarnaaldtiotayrynaapslesyursfreoasrnmpceeirn/fqgourtamhleietydancpaoulnyrstsrueoasln,stdhtaaotlalthbvieaslaiCdpoaptnriosoevnne,tdaOnbdyrdctehhreasiPhnaaolrltficecosunspftrooirdomyr ttoo EPA X. C8 REDUCTION PROGRAM. oyTisvehsaeuerraarbnelalcp1seCo.isro8tiafnenamgdSNirsscehosrqiaetuowlelinnrisfetiuhnmtrsgottehaLtnehnteredvcpiaeonrilngordtvtaceoiiudrnirneevroedetondmhttefohporreeelerliWomnthwisVatihtnnDeagdlaElctePbhtmueemaimplsorscooniaodctlhnieefldniyleudedervaemretsolyissse,qesaDuitroaoun2ruPt0seto0rrine0lnyptlAoareergvttptresaeolcesrrehstosgmtnaouerpadnloiitcmnnaCgiltt.ehCne8d.ar collect2iv.ely byD5u0P%onftroamgreaecstutoalre1d9u9c9eleevmeilsssbioynDs etocetmhebearir3a1n,d2d0i0s3c.harges to the water of C8 seyffsitceimen3ac.tyiitns WitDsaumsPhaoijnnogtrtsoChn8a-lWlcooonprtkearsianftiaencgailniwdtyamswtaeiitwnhtaatthiener tgshtoreaelafimoltf.eracahnidevcianrgbo9n0-b9e5d%treCa8tmreemntoval dates: 4. DuPont shall conduct the following construction projects and abide by the specified Twop6heIiZrcahCteiovonenrspihesarlemlaa.britleiRegri1.n3nD-8ou1Pl5aoDten.rt tsChhaoannllsttihrneusctdatailoltenanosfhimastlalprrbtoeuvgpeindafnstcoerrulatbhtbeeerArthfpairlnitleFrsehtoburtrudeaoprwlyanc2,e8o,rre2cJ0ou0vn2ee.r2yI8nd,iet2iva0ilc0e2, bRbueismepeugnlsiaieosinfszstt,ieenoodrSopnetethlropraeiaoetpteiAsirnrno2ptbgtv0hr.e,iialldp(enGesevhrFoaemuteofitfDbidodetrntoucuEewtPadiinsvorngyeen,1imtn72doe0s8iirshse,Jsfprau2eiielone0lnrngt0semsi2aPo2ob.fnr8droao,Iivocnfm2etyfii0tcpgit0seaahrc2larera,tduoisswecbptA.uabehlcrepiTaakcrptthheiTlfeoeioce6vnrsamIetFbesarihmlCcseiakssilistsloeodhsanbiaiSarosellmltngiaaebieccprnet.ckoeoneirHAnro,mdtetvliiiTatnetgtitlg6emheoIdrtctZesoits)ttCho.y4waE,5enChamsConetohinndosetssdhdftidelroaeouatvnowtciteftchpireSoeooatnifTtanest6tsethsIaZhartalClll 11 000124 T6IZCE. tuscpchtooneuamrmidtmtsypspihaCltsea5nh2ftl.yoealDlrcsnlThRoobCan1ells2la3icts-iooem2tnrm3opt6ppfhl5eelaaemArnDmtse.ettuuihnbtPIdetmyRoyiendpt1onhtel3defen-sms6hteoci1anfefril4dnuNelAtbdcoaob,otfviiemnCoMerdnm2poauErpborcocHeeftvhrrtCaeah22mt2esi00coe0io0rnmn2un2t.b.fpspobrefProeorrrvdmroeeotvivmphtiitidceRismeen1ddtiCs3eztv-2haf1ioDtec9iroeW5rtne3hasC,enauda2nllntadssodtitrnameeCrrcpei1ldoeaFeevrrnSmveciCirmicoyt2eupRisrmroa1owngp3viir-pelno6lrmgv1ob,ee4petmnAohtsees.endftTophrreogram XI. COMPLIANCE WITH SCREENING LEVELS. C have1b. een foTlhloewfeodll:owing requirements shall apply only if the procedures set out in Attachment ovLrSeracevlrviiiendeeeflwosndriedanmmengardoitLvniaoeespnvtdpraea.drfltosoeevvlswlaeotlilhwtobhaNpiyitnenogDdthalutapehrPtueeeAorarspngsutroteho'annsancacnoetibpdet6loesue0rrttatedhhitsmaaiisoytsenseCisst(aotdohhfnteueaesstver"ieingRrnetnreceeAOmesdtruietpdtaldotteceiroahrdelomfdirnPneuoolnacCtttniehf8"Ceiscreu,oaxicDrtnhpi"ofuootnePhsrxuoemfprnrPeoaotsltsmsaiuoahnrnbta"ehlos)lte.vhtseAoauttgblhieemsevnriecSetliccsaeersbpeneetlthalnoanainwntfdgdotarhtea WcParaeonplvaVdmpnirsDps,oehltvEdehaatPleteblonlWsseehapsdaVResldc,elDbri,mefe.EuyisetpPshtdohetisnhearhelracaWePpoldlalpneiasnftrsonhiooucnivtlsinisteehfayn3fatoiocl0oDrlrinedbdussaeuiPwsyicoaddishtpneehoptendfrmttiioihnsrfeaveeiwdpeceWdperatiirhptiVovnietvniDootagPhHllfl.aetahtHtDnhinao.eRotuntPt-RIihBfcooeeetPnfmh.RtHteheseDdiWhmasiuanaCeVPldlldooDPbrinnaelaEastlss'enPusePnbdlsfdtmauaiuOnisbilpatrumhodprtanheiepstrert.taebooRcdevcseeebuunmsyrbatdemhDcdieysiiua,taRPplqaoepnPunmralotal,eivntdteyhiad,aesland ElCRaepPoevpgAneeulsaelSflanotttt2arohn.OreCdy8rRadEreiedPngr",Au)aIDlcntaSchuttotoahPartrenodywdnaeEatnov'rsPcuedelnAo.dtbwDSEbliiettgPuahaPAantapodipoponapnrlrtidlsctrihecauiesnabneblWdprelveertoeVrossctDtheDaaeiEtlsuudlPptiSroniodegrgnycehsttvt'iassseonelniadoptcpasmrtrhseiavaagatilyuentlildheabasantefovdiodrneryeaatttplorehiaezrercqmetoFsuifmianarrcoeemrimdmeleiftewnetinhetriestitusshnipcn(Cro"eedontfhedn,epeosroeeesRbnnnejed/ctesgeecOcuntrtrtloetadoeotet,nofhroir.etnyhrgis XII. COMPLETION OF CONSENT ORDER. DSeucPreotnatr1'ys. oobfltihgeEatWxiocVenpsDthEaesPretoournDhduiesrPdosehnsati'lglsntoeebremliaginnadtaitofernousmpuontnhdeeisrCsuSoaemnctcmieoinsosfXioaIn,cetohrmiospfCltehoteinosWnenVltetDOteHrrd(Hse)rRfa-rBnodmPHthteo 12 000125 DAtPhaugerPetoinoebcnslitie.agsgaIrtsniehoeaanltslthimiaastnsedtulhyewemtohAraegkncentonhemcaritpefhosle'alltvooioebwnlniignoleagtttbtireoeernce(enst)iopcttooismosDfupuealPewttohernidistttiloenenrtatserchercaqosluhlredaislasltsnubfcreeeoadmwelieeDthmttuetePrhdoitsonatCDntoohunnePs-oredennissttpcdOreeecrtttdaiioevilrnei.naTrgyhe duty. PaOsarrdpterieors.v.i2Sd.uedchinobSDleiugcPatitooinontn'XssIhooablfllitgtheairtsimoCninotanotseeanocthniOleyvradesearpnrsdohvamlildaesinudtraivniinvSeceotchmteioptnleiarXmnIcienoarwtuiiopthnontohfaegthSriecsermeCeoennnitsnegonfLttehveels XIII. ADDITIONAL ACTIONS. mtPNaclrSaoiesocoaaoaqtnpbflriytuelesorihuliotsdniDirittnttetiesryeuorgamtTcinetninietihnroetnksmCheintmniutatnosiAgshanpmngsiyegoestoaarWcetfhrtonCiinhaDspflacaoifvhrteAuaitneeeeedcPsvaacrspteoldt,eihAt,unondnheirotnnctitrstittaedOaiun,hoinoinangetvrfdnhdnd.rio/atedetohsnlrruttreWoraaoaitetctAnlhhuetlltheeyiisgtaoneaeteneonssgVnynfer,aeciviwbcndpifrieroegerpaotsyolirhlylmnaioneficlisrcnmcaaooaCtdbCimenGnvllntoyeesehrtnttaol.eiactynstoulkue,tNanaWinttipnehdsmotugskiwatsOrhstaossaeimruusrntrmdeecagacAetrhnoatrtiPftcduneaostrtisrc,hrofote,ttiahttihchotelooihalsercniftenotWisCfaiiob.oretconhldentsiNniisegtoossaAtraorneatVCttucnlwehatotitC,iorgaDnnOgtrialshgyvueiirenenaPedindinsrnoeaWtutrnoAttOcDhytesfoiihrstusrasmdotatPnAaelCVmuodlrtcu,onnibotartnidt,egonsusetfirtchenonrlyhaotneerioawantcrakfesi.OAenettsydryrsiuae,dranereradyyrl XIV. ENFORCEMENT. ArDceogusnuePdnlotictniiitnoeEnssenhsnifanooflolrtfchrntceehoemitCmsebiCenrenctoutlnoiiaastfbcetCtlnhieootisufnOorCbtrrdoeoveniifnrosWgeblanyttotaioDokOdneurnsPdC,eoooirnfnumttcnhlitauisysyd,aiCWbnveogienohsaslataerdtVneiotqbinruyOgeoitrsnhdftieetafrho.feidrlVuiWcneiigvoetilosolatftpaiVaneonynicraig"ovlFitifniloetishraacceaCetsitooeMsdrnemeatbjsaefyonuaardrntnehdm"ybaoyyfltahwe. condition. XV. CONTENTS OF CONSENT ORDER/MODIFICATION. iCOnoradnnesyrensathTttaOhaleclrhdbemeenrtemiinrneatcstdlyueoodroifenntxlghyhiasibbnyCiytosamgnrrseoeefdeenimrfteiOcenancrttediodeonrfhcteohorfenetisPinimsa. trestMfireoaosfmdtihniefesiwctoaerritrtimidonensga,oadnelfidxtnhceceesoptnetedsrttmihataibsotlniamsnshodsededcitofiifnncodarttithhtiiiosohnnCessroteooninfsaetnahnynitsd 13 000126 rmeqemuibreemrseonft tsheet oGuItSiTn othrethaettaCcAhTmeTnetasmto, athsisapCporonpserinatteO. rder may be made upon consensus of the XVI. ADDRESSES FOR ALL CORRESPONDENCE rcoeorcrteroeipssptuAorcelnhlqdduaeodencsdctureeem,ds,tseoenhsbtasneD,dsiunudPcbeolmlunivdtiteiotnrerygdW,ruoeVnvpdeoDrernEtrsiPt,ghhaimpst pamCyroaodivnleasoslesirng,tbnnyOaottcreidofieiuncrraiwstehirroainstlilesnr,bgved.icisseeanptotpbrtohyvecafelosrlt,liofainweddinomgthaaeidlr,drreetsusrens Documents to be submitted to WVDEP should be sent to: WC13hV5a6rDleHesatponansrf,tomWredensStttorVefeiErtgnivniiraon2m53e0n1tal Protection AAPhttttoeennnettiiooNnno::.:AD(3rem0e4aA)n5nd5no8S-B2tea5na0tis8n,cPahsa.D, E. sq. Documents to be submitted to WVDHHR-BPH should be sent to: BWC81uhV5raerQDaleuuesatpforoarnrri,tePmrWueSbentlsrtietcoeVHtf,iHerSageuliatnihtlietah42a15n83d0H1 uman Resources APhttoennetiNono:.:W(3il0li4a)m55T8o-2o9m8e1y, Manager of Source Water Assessment Program Documents to be submitted to DuPont should be sent to: PEWPa..TOark.s. hedBriunsobgPxutoor1ngn2t,1WdW7eoeNrsktesmViorugrisniaand26C1o0m2 pany PAhttoennetioNno:.:P(a3u0l4B)o8s6s3e-r4t 305 and 14 000127 ELW1.0eig0Il.7amdlMiuDngaPetrpookannert,ttmdDSeeternNleatee,wtmSauoreiuter1s9Da8-n97d81Company APhttoennetioNno:.:B(e3r0n2a)rd77J.4-R5e4i4ll5y, Esq. XVII. AUTHORIZED SIGNATORIES/NON-ADMISSION. raOaWoaenndfrvddVmdaieelDtdilwhrsetEseahfirteTNPTnToeehndnhhhfieaPssoeeiihnebsatrChsaduueyrCtvennotiWeDhreeoddnnsaenteustVththerresPbessnmeerDeoiintggtltnaHaeohtnOntuyrwiHOeemstorhbdddrRfC(seode"rda-roeroeaEBnoirnptvfafyyPsrhmnfateeHhefidetslnaaociraesycttehibibntnbavOCblitovyeenaeaorertdndcinDisnovyeohsitargfehenaaotsndneaffnetirinteh"yrseordym)Oetep.parrleilrptrynetemdsoohgpeactcraaarhenetottl,ucatedutenntltdhniirwoivaite.ttnhrbeyeyigetirehpltyhpxioiataanefhyrrvuavcta.tyellsuovll.oDtlteakivhwonunhiendnPoafagwdootsuhnhrtltfheetahturhildoelrlelegdxrobiiaeprtfepnyroscaedehortfsfotaufsifialtleenelsyicssrnctterteooioelevrrpnsrmetepoisinrtusonivdvptrtaeoouotounstlntetvdnhhaiisaelintclsiynoggsrCnntiaogdmaohitntuetiss,roeennst. WEST VIRGINIA DEPARTMENT OF ENVIRONMENTAL PROTECTION BY: 'C1w3he5as6rtleHvsatorngnsif,noWiradeusSettprVeaeinrtmgienniat oi environmental 25301 rroiection 15 000128 PWUEBSLTICVIHREGAINLTIAHDIVISION OF HEALTH AND HUMAN RESOURCES - BUREAU FOR BY: BDWD3C5uhiR0eara.s:mer'tCHaloeVua'snEpitfdroifotglnorBRi,lnPu'WiSu'ia'lTtbdreDlAeisineectYgtypVH,aLciRrerOqtagmoRlSiotneh,tminaCct72Oo05fM23H0M1eaIlSthSIaOnNd IHuman Resources Entered this ay of. Y ml _, 2001, by: E. I. DU PONT DE NEMOURS AND COMPANY 16 000129 Attachment A C8 GROUNDWATER INVESTIGATION STEERING TEAM dWIBaDansnrPiivodspnHebrrktskou,hitsnvriEegsgifAPedaDamwAteciutidoeaelPRanitnitoemnyetrnSsg,,SttoifaegorernfeerocndorspmticiuIrntoEienhgetns,dehneTwiaVtnLsinestaIoadaaIttcsmItceiDacrovslouh(e,faGuaP,ntLhnldIoAleSetntbnsaTstaued.hr)ttrrat,afaeDslasalhcwcsunhabeePdleSemldow.DiabnnHaCurltcteytaeoslhdrurnhRotdatstarueoeeltilnnznaas.eftnscLudsdOinaeejndornasddsirttneiofhstirtuheltllsn(yes"Gd.fpbtrhIrotySTehemTshetCheeDeWvnoGicnuWaVesProaeVDoannunnDEtndtePdOEsWew,cPrxrdWaaoteGetswerVhnI"ritSD)an.TocgHcftlooHCenua8Rnd-teinr, Athescehneddoulfethsiusmdmocaurmizeinngt.key GIST tasks, submittals, start and end dates is provided at GIST Member Organizations/Representatives/General Functions WVDEP disburseDDGmaeeevoenirAdgt enoWnvDeaSartskstaihiganehtsrst-,;-aGPpdhrvroo.iDsjueon.cr-dtaawdmnvdaaitnsteoearcrgPhernmoicteeanclttriaeonvndi-ecwGoIoSrTdinteaatmionleader; escrow funds EPA Region ID JGRaoacrgktehCrC.RHohnewninaonhr-gasrc-t-ieEHnnycvdeirraoodgnvemioseloonrgtaisltEngineer DuPont pAfurnondjderscetwdimsHbauanrratsgteeemnm-ePennrtitnoacvniepdrascligoPhortro.djeincattLioenadoefr/fHieylddriongveeostlioggaitsito-ntecahctniivciatilerse;veisecwro, w WVDHHR-BPH Public HWeiallltihamadTvoisoomr ey-Manager, Source Water Assessment Program- Bureau for A-l 000130 GIST Team Objectives and Efforts tpaOmenearadrdmnfeonsrreumdrar.TnefeacdhdcieseUibnipoynwrntlihDeamistusmesaPrAraoyokmtnttiohatnobecgonrhjrewimtctioiottessriwneivnrteae.gdrpodirTarfeenhstmcdheetneeeGtiedanGtItivSiInbevSTgyseTtswit.gtihhisaleelttiouoGrtneeiIlqfSiafuzTiceic,rtiieaevmtnihptteehileynaststrsaeeasdvskiinsaeppwropaeunrsaotcnlariedincfbhefdeidicdarineebidcnnettleogtmhwraoenpudlosCnhydotawinrlmlasapeetbneildyert rgctoeorconaoutsmansmudmrwiTeneahnaptetderioraoGttneioqIcSiuntniTasolnraiwtenyogdilaflirgandirrisoonsuuagunnnedtddhwaetahanfrteioeenuerFadnqladucfrioaellritpithtioayeenrstya.(Fnsf)dauTcrhwithluhiietmetihreGaswnf,IiSonhTradekniandfloigtnrhsatahilcnaettnrioeodpentxhocsteroetthnnfuascthtltuuanorsleelfioe. fndgusrrtootrhuebengredawmtradakaitnekegner pbiTdeeheronfnosteeirfcmitecaTesashsdtkaiesobryntysa,hsDtaokalunsl PdabssoeesrnteuatcrfgeoaernprettdtehhodetrbhueeigpdloooGeawnnIltsSbifaTyi[ncfdptauhutleilironsGngut]rIhaoSneouTtfnC.tdotohwntehsaeetGenCrItSoOaTnsrssdeaeensnrsdtmaOtreherndettehCrae. onmnAdsidenCdni8imttiOuoimmnrdapletaartcastkas, rksepstloummmebatyee. Key Tasks of GIST Task A: Groundwater Use and Well Survey/Groundwater Monitoring OaocmTraStaaosamgheelhlnlfurhfbll1lileeaoooonetmeqj-aashguuwaewimWuegsemrGmsnlcuaordietdatateWIllaruaidhhecSiwseivflrntn.eehtidTyyea(iecadgiv-ass:GGlotnwstwdhn:eiTotDnagStIIhdrCiaiihmSSctncaeetlutowoeehlTopTegmsPpnnnCrinoetdplriooptttdldisnwedW8oohrlnnnlsuitasiategetdipcncmftoibsWleiroiooatgaelorprmlxecrsngnkyedanootecsurcscisywsihrtedne2saetn,,.kraeiefiepinetoesasaaeltdsspDtlhqtfcnwnvraagftruiiwbdas1aaoonolnnhritieltorcadirwitep3uapttayoeecunpgsh-aehL,.nrh-m/neti1r1epeaeneordf-tsitrihlfo.hmcnTowwloutegotaehraehnhl.rimwis)atl,iteletmghe,mefstehlraie,eddLaanp1ietetprrunacaed-adeshwaagtkubmnrltitdaact.raaaaslwdhsg,ioteoilbretuseleerteSsuiaefld,rstodairnanhhsws1iunartrodsdaoahaha-nednttinwmfmpuedeahldddldndtlpinweaeiphdwsuoDblrcttgueeleCssoteeeeaicr.1pplnarrptlrt8oo7geemoehcagwrunscrerhirdrReuvimncwienesiwndfureimdueleeispeveilnnecwsnrrilaaela,tloeatlatpLrlcyyahstncntnaeottuhueatdetibdidirretsodinnorenfrpoewwefdiianGewtonnlantnhfaslxahsshmiIsteusetlatleeSieelpllorfserylscTrtvy1ooeefGni.o-ueitm1urffCmdnwuttoIsyshffeSgerec8epoiiiesdslTllnuarasyerlehsftdsetubnouhadhaeomirrdyulrnanaewdvlafvnragdtdtebsbeeeaaddhniayoceyryuatienmmhstvnisswienwtrG,deopairoainnilnlIlnuatatile.SchondngceTigdkhn 1 The water use survey should be in substantially the same format as Attachment B. 000131 wadpathdiuhfrijrrseeupeNctsAqohttoiuseetotetedreansn:ctaocoohsyTnnmedllhtxyyeoeep.ntaebatlnD.ernemdvdrdeiintnelnhotkoeeetidfrnawmg1tsheiuanwellgeba/Gds1teueInbiSrrscvyTwheutmytehiinlleatlioszrfGkuetarhdIftS2ahoiTt-nerm.mrdtaiheenlietacseserruCamordoeifinnutasihsnbe,egonavttra3eiOss-kkmr1sdjaieLalntregnd/f1droatsohrdhbimiasujleosllce,nbtvoiietevroleriresmni-nssaageaytsmpbfpeoeclretihfdiciant Tcsuoimrnvdieunycgta:ecTdthiwveiititinheisitniwa6li0lwldbealelycssouonrvfdetuhycetweCdiothoninsneanats1cO-hmreddileuerl'resatdEoifufbesecotdifevtteheerDmFaiatnec.eidliAtbideysdtiwhtieoilnlGabIlSewT.ell Task B: Assessment of Existing Groundwater and Surface Water Monitoring Data aWcOcdmpcFSTagsiOnnohconrarauiborofhoadamtmnacmdojanvsreuliteeryalpehiiidimncaimntncrdxtiituondti'lnuigtteaicasaelredwevgi:eraittsrnnaenyieitWlai.hooolgftfzsg:tlyfoannnea:oTieghndrwtrtcfhDhoriifWdrtmostooeoCheifitennlrufvgooo8oalvaGneeserrl3ncdeilikeodiaIn0ildicanScsllaowtsaataoiohTvdapttdltfcagyareaaartitfdfilw.aiyiinceclaohlvnanasirgaciryiltktidlbitiamindloeilitaolnieyfriafbenatonmoosgycnetdans.grhghdp)nmwwiteeratlIadfoorhoedtaiasacelulmyrtdtLkilcooqeiisndieinoomgubretldrd,aignicniieootwcprnagytwgenaisltlra,niedai,enuaonicttaoltdbeLmuoiifhusloprmoinerona/nonardrastdgndeivamtnunetweiyoferetirrcltdeatresffae,aotdtatxipotcTitdairnecohpgtlintdarfeepunonaea,odsidrmgttdtwkraitGiiDiomooaoinpeatnAIrnendlrtsaSdiiadey.a,TutdteTinsrlimtzeaRteouhemiTenbtwvnrnmuehrtflhamovtineiaaiGhalfetntectuihireALcsIienmGyaditStaanietoeiw-nIatiTongrtiloSty6ieoidfa.ahtnTnw0rinttfaheameigi.loioaldwlrllslivnfDalascsnihinyenelcroueiaaledsxospsrncPavttipeoethohdnsotiilehtefyrevdanoipiwendtntiotcfrehtargaifopswdreeoealhowrvshsgleotaCutilioeoasdrl(sntoloekberethtdknon.llhegoifasrcesto.fgieheC,hocrniearc8tal Task C: Plume Identification/Groundwater Assessment iwOggrwSldmoerreuaabcwootpmtteejuueeeeaprnnmrrrccmtddottsstaeiiwhworuvnrdsrupyeaea,erp:g:ttscweealTDrheinrroieoh.etupeshlaetdxnlepauGcedrpltmmemowhrIenoSaeipadnngpsTthieernacti1rshgatsohhaueitnsaeetg1trl/rLolis1uvivcn.bgefeeoi/tur1rrtaTptsh.tiriethocotnairrsoLgseleafavttasanaowinersdddoewokifarrrihkelsshlwoch.witraaiseiAtnlthzhdlodeocrartbntiilheictystvseaaogiltltiphrmiiedooneexaustpceGttlnaesauncdIhndtStawioteanTouoaldn,altfdtenwrotarehbnahsfieesylisuocslOpuehawtsrsnshimesdoitomdoorafawieyRatlTilnsaziadtCrveasedoedk8tdrefotrAiraofCmimfnn8-tapkdisodnaiintpdecegurtaeebdslsic A-3 000132 pmbTpboarrcyetiiehimtgoidtpeUvrhTriieraiinechrptttatifgiieoGezceoo:ndetsntrIiimUSv.mpncgTioeleprtiuoie,dmonemdutngsbhpeneylweroddeeifwDtiGvdailtolnieahuIennSdtbePwetTeoiroaifngnoofifwiclrtnftioeaiinoalwaetalvlnildloecspanaasctonhot.vhmsidaagecbsipdahcyleltuaeoeitbodlontheelufnteealpeaemaGsilnncuteiIatfmniSsibonvatTlreaiinimttbsitiitahleodaitlessrtei,cdaehnoanvDetnbrisdarfuyplyaiubPcontayohaordtttuenitioomthotGnnetnsohIh/oaGSdieaneTflsIgvllScd.soephTaFsatret.toluaoidsgrvuattoaoihsldtfeseideeotrthesnotitsehnebaefrvGceumeGtItsidSuivtIneriTSiegetteTiaseparthmsnwlouadraiilmyntlnheded AMGshnIoaSyldTlea.ulnisndegaGllromuonddewliantgerpMerofodremliendg pSuyrsstueamn,totor stohmiseatotathcehrmmeondt ealndasthaeppCroovnesednbtyOtrhdeer A -4 000133 TABLE A-l COMPILATION OF HISTORICAL DATA AND MONITORING PLAN J a. aihtDdnhvioefsaacotptiourleimramnnibccdaeialetlnuilintotdeydtnedaus,ot:piaafnoncsneaurmtrtheamepinoarrty b. mFaAdaodcgnrirlieoitstouisern,isdnawgtwaahptimlecarhninsifmhooruutmhlde: AmwAITstceystCgDTATcslItwwiCamdmDmiohhfaiehannnhfeoioram8ahhonelu8mveveenDaelasfetoootonulptteenoniesoPilletereainncnuarcn-tllpesurtsstbelgcitnrr/eroessohooiyeteitatleeamliaPaersththod(naimnaefnnm.sbaosolmtacasnnob-ldterntuasifaicttltatrhayrgyuoioCganetprsooeeaIdtnapeiinhmebaettiresptenfnntdltrn8pnnhhopf,cagolitedaltamqsgD"ogpihnoseiuetmehnlsmtuurfiougrsNyrw"sshlgaacnseao.uwapnlohiptsnWraahmaslea.etnthDstwsPeoredwr.orphreoisophnnieohgrloootvguoowawaeasp.u"Tfilyeenobognenvts/tbnncgnslllerthrhah"is,efurroiud.lhhihiledbtrntifaahytditeyleclehrlrmireoeenwyToghdmlaobnessaoesierorsstwsanheitonyeoussegdanhatoauttnsmt"ihiedntblehfftueftehmmtmdssieedtopoote1faeuedro'enodeaetuhefrisneugur-hpaegayrnelpabanbelasmaaldteGbrprl/eligonebtlsehWtnm."oebnfqyaaylwssi.armctmilItedsasatosiltioeufeaaSrihefiatfoosbotlotvoa'TeurtssmteiohbsTehttrnserior.cprhegnntesonhrhoekratotaheearswohdretchdoabsensduaaedAhattgao.GayuneeywusheionatatlibsoapiucoodeolnddufelnoIctTrdotbduahhlndfonSayratffhshdasthrnohfabsdy,oredTrfeneba,qehbtphesnnie'erassw'laDlhrrt.tveouosesol"osuiales.tbotetifeaaemduaa<mfuywmuwrhemtknaoewvrtnpaleTP-dx,lFetneofsetrdoodptkadsiioeoiaw"aohtohranoonninrlelgehrstlrs,gcnobu-eitwswni;aeiseagnerenphrcmittsnutueaeeo)slceslonoiognaeelf,taaibtsllfhsfuaosunoirtnlhedlwrtchmtdaoidllingssDtiofmorcehesqhrenhnoaehentisdrtmedsiehcaulutglaodsnlpaEaltwl.aqslnesatdeeoaiPnlu.nageibfgetupctltbsudraetafnhonfdahdileettsniryletmbotevemeherndloeen,eaewtcpfesectteriytwchgrttboothta.a;tsdunuihheetierhrrearptiavmbiealldeoeoarnfsfasyltaelmnaorseisnlei.oittlcrrnceef,a.t l A-5 000134 RWeVpoDrEt PofGRreosuunltdsw. aRteerpPorrtoignrgamshoautltdhebefoqlluoawrtienrglyaadnddretsos.the WRGC12ehrV0:oa1urDlneGEdsPrDtwoeueDnanPt,iebvoWrrinPisteei/rosrCotnSg8VtroramiefmregoWtinniaittaoerri2nR5g3e.s1o1urces Each report should include the following: (a) A site location map. well loc(abt)ioAnss.ite map showing the groundwater monitoring (c) A top-of-groundwater map. (d) A C8 concentration map. (e) Groundwater elevation and well screen data. wuanshededr"etpopa(dvmf)ea"siliAsaghbntolaaeubtelildneNfnoooorfmtDablaeletttiehuocsentehcdaoil.slnotocwerisnc,taralabtCbio8rnevssaiaamntipdolnitnhsgeshudonautiatls.d"Nnpopottbeb":e (g) Laboratory analysis sheets. (h) Chain of custody records. A -6 000135 Attachment B Name: Address: GROUNDWATER WELL USE SURVEY Phone: ____________________________ _ Best Time to Contact Owner:_________________ 1. DIfonoy,osutohpavneowoneanodrrmetourrenwsuartveeryw.ellY(se)son__th_i_s_propeNrtyo?_(_It_n_e_ed not be in use currently.) County Water Well Permit No. _______________________ 2. Is the well(s) currently (circle one) used unused or filled in? 3. Is the well(s) used for drinking water? Yes _____ No _____ 4. Is this well(s) used for other purposes? If yes, please specify uses below: 5. What is the approximate frequency of use? Circle One: Daily Weekly Monthly Summer 6. Date last used? ___________________________ 7. Is there a pump in the well? Yes _____ No _____ s8y. stem?Is thereYaecson_d_i_ti_o_ner, sNoofte_n_e_r,__chlorinator, filter, or other form of treatment for the If so, what is the form of treatment? _____________________ B-l 000136 9. Is thereYaneys f_a_u_c_e_t wheNreow_a_te_r__does not first pass through the treatment system? If yes, is it (circle one) inside or outside? 10. What year was the well constructed? ___________ 11. Please provide the following information regarding the well(s) if known: (circle one) A. Total Depth (feet below ground surface): 30-60 60-90 90-120 120 or more B. Casing Type: PVC steel stone none other _______________ C. Well Construction: dug drilled open or uncased bedrock D. Screened Interval (length in feet): 0-10 10-20 20-30 30-60 60 ormore E. Well Diameter (inches): 0-6 6-12 12-24 24 or more B-2 000137 Attachment C C8 ASSESSMENT OF TOXICITY TEAM h(TiNnCeeida8xaul)motshnrt)re,yalsAaen.hsadatTsaletelhahrsimeeenfpcrCeroolneAumfvsdTseiercDnoTitsenuacentmPiaitevomiensennttstitao'slsastfsshsoaWsafcolrstelohcisvmibatailettVlieaeaidicsnsra.scgwdeliTumenitdmhihbaeeil'eaestCx,hdcp8egitotooWAiszvuaeseVrssnresenDses.mtssEosmePantemhtEn,emntntvooooinfxnro-iTicupnoimrmtxoyifepciantienttroyadfrllTgruAiaeosndakrimovztoooacc(tChitaoautAennm,soT,Paantaaenmd c(TpMaiocrnNionoerasg.nrdnkIyrDfCaittlosrEanoa.Sakrcsrinmac)z,tsvcn,taTePieoidwtsfsrhdhimosooeJhi.mrbnDtonmihWtsmyae,h.unnasTeTeVnttTnoan.DEisDhcftxoeRafoWaeriEn.llcvtA-lNiPoHoiapDoc,lrIrnraeoerhCkous..asgiftSdlaBdyiidtTltseheieessEh,zoshcsifeicPxrgckaongrcrnhlNerigalieb.mrbDnsIlsefeClesieuude.zhdrnSbnnvaahtTdcchtilsscieolseeh,ohernrfetenfasfeaatroil,riTomsnlinarntkm,Ehcs.iRsluarteR,iiPinabawssANandorckkniioiaztedanschAnteshtitottdcosMaehrmoresnalnioleflcaammdiwscptrlvssusoprewImheoannnuracilavsitebtflcacbthinllwidacoilttUcettetuuiih(sttonfmnThseeotnaeiErevntrrffhpeevRouetohertrirnnAdiocesndC-teevi)opgNetssihyxrsdwcdeIo'iireCnstcmhbifodbiioSyCtttieopyscbesdDsexarycnoholiubiptcafJveePSeoaloniCrlltodmilotun8ofbniewdofet,getii,res.cotyeJhxsRBsfaahepnuneaewrcdlralktoliesrrek, CAT Team Member Organizations/ Representatives1/ General Functions WVDEP Dee AndtnoisxSbitcauoarlstose,gmPyeh/rn.iDtsko. v-aesSrssceiisgeshnmtc;eepnArtodajvencidstocmroma-ntmeaagumenmicleeaantidtoeanrn;;desccoroorwdinfuantidosn; Pam Nixon - Environmental Advocate - advisor; NICS Jan Taylor, Ph.D. -contractor administrative oversight; James Becker, M.D. (Marshall University) - consultant in risk communication; TERA (apsosienstsmofecnot;ntact: Joan Dollarhide, Ph.D.)- consultant in toxicology/risk ' The parties may, in their discretion, elect to substitute their representatives with persons of similar qualifications. C-l 000138 DuPont Gerald K-ernenveiedwy,erDtiorxecictoorloogfyA; epspclrieodwTfuonxdicsodloisgbyuarsnedmHeenatlothv,eHrsaigshkte;ll Laboratory John Whysner, M.D. - toxicology/risk assessment and communications; Paul Bossert - Washington Works Plant Manager - communications; The following members of the CAT Team shall act as reviewers or advisors. WV Department of Health and Human Resources - Bureau for Public Health (WVDHHR-BPH) WBLoaicrlblaialarmraepTTraeoysoelmonrtea-ytiD-veiMre-acantdoavrg,iesOor,rf;Sfiocuerocef EWnavtierornAmsseenstsaml HenetalPthroSgerarvmic-esad-vaidsovri;sor; Environmental Protection Agency (EPA) HRCeeingacdioiqnnunSRGaIaIratoIatimegrP-treuhhsJreio-CllRahaJoRdenseniesonnCneltnhpseoiisahncrfmriemb-tareea-ra-Snngdtree,;evecPvid,sihoeD-.wrDVrhee.Myrv-diaerr-nwoedvgreeiearevodwailveoneiwgdsryoeaa;rrndaSdvnaiadsfdeoavrDditsvoroiixnsriokctrioonlxtogoigcxWoyicl;oaotgleoyrg/Ayr;icstk; AgencyAPfhtoliralanTdtaeolax-psiJhscoeiaShssnu-mbLWesonthratae;neWcleeser,ranPnehrd.D-D.cio-soerreadvsieineaRwtoeegrriafsontrrdyAa(TdAvSTiDsSoRrD;iRn)toxicology/ risk Non-CAT Team Efforts TotehaemOr tehtfoeforurettifslf.iozerTt.shTeahsreee icCnuAcrlrTuednTet:leyamunwdeirllwcaoyowrdhinicahtemaanydpcroomdumcueniincfaotremcalotisoenlyfowritthhethCeAseT 1. Dupont's air modeling of C8 emissions from the Washington Works plant; 2. WVDEP's air modeling of C8 emissions from the Washington Works plant; C-2 000139 r3e.gUarSdEinPgACD8r,atfot tHhaezeaxrdtenAtscsoesmsmpleentetdwphriicohr tsoumthme aarsiszeesssmtheenatvcaoinlatbemleptloaxteicdithyeirnefino;rmation 4wc.oitmAhpTCleS8tDeidnRpd'srriiHonrkeitanolgththweCaoatesnsrseufsrlsotammtieotnnhtetchLoanuttbeeemsctikpmlPaatuteebdslihtcheeSreeririnsv.kicteoDthisetrcioctm, mtoutnhietyexatsesnotciated 5. Existing C8 concentrations in Lubeck Public Service District data. U6la.snedGfSriolulursvnaednywd(asttheeeer WeCx8aamsAhpninlaeglytsosuinrsvW(esyeoerinkGsAIPSttlTaancahtc.mtivenittieBs)daetstchreibreedsiidnenActetascihnmthenetaAre)a aonfdthWe 3ell Tasks of CAT Team iWn omrokrfeoTdrhebetoattiahlsbkDesrl.otowBb.eecTkpheererfsaoenrdtmasfeokdrsbTayEretRhdAeisCcausAswTseeTdlle.baemlowarewditehsicnritbheedcbornietefxlyt ionfTaaSbcleop1e, oanfd tshpsccpPfhithoourulnuoeaannmbddsslncdllieieatineeu,cncnnsgtcoata;mtsetThnsnri.ddaknededaPetasgesuiivtlhntkohcntioeahsnnteetlns;sghocoseeL.epueetfuosIgvcitsInTsbheahIeSagnlheeciurscceenoyPcCarkrcneirrtateAliodeeoPlunnsnvTudrgptupiiiibensusrlfTetsieilkgbsoxciepcltniaLiahoatscasamSroetfsleisevmstnekheRressfgsevehlosetesimaaiarcf,Ctnssleiealefnf:k8rnoonebDgsrdrrgntee.mintvrcsihhoeonetiaorceeruvtilgDewincodtoashtdlois.nnvtnrwsahieigerzTrneeaeysegEtalfdleaavtiaRcrortnaniisoAndavidtpmlnteafrpoSasiebpultchlptlolaybhrsaearesllreriiialetesecsconneopoxdfaminrlpnoineosctehgrpdhgieaotaaeiLytrscfnriieeWenasdeasvlkgxna.hea.hpdalsroePossehIleahssndpifpluenaootiPsthrsgrdrheshe;ttepmeoamoaIrnssenonieiendntoWcettcIlhocIolso,eutnghiirTddoriakceEnlslasRlobAfe TpeTfrEEfooRRvriAAtdb.esyNdhoDatolulcDopbmoer.nmpBteuserhmncakiciletlatrebtiadeonnwsdebinTtehtEtowiRnueAttertnihbpeyDlipcuWaaptrVoetincDttoiEprDaePtpr;i.roteShnsuteoasnaf,ttaDastlirlfv.oieSrnsftfaooaarnrtmwds.aaNtrAidIoCilnnlSgic,notDfonortDr.rmirBb.auetBtcieoekdncekrtw,oeriotlrhlaenbde Phase I TASK A-l: First Public Meeting spLaehfcaufatrboitlvilereitcotsskiceitTcnsoPu;wuttrahhbonieelnidpcpGuPiuSbnrhbolevailurcisivtcneim;idncIrwgeeefeoatlDhtatrieteintisrhngtpCregsui8cpbahtruliAieswrctpnoaatoanrotslietyceirpcassasiilpsruoitapnifactpnfeiionldpdyrta;rmWftooiedanretbuflitolycohrinUimncsogsopieonnrtphgoSpeejutrerheracCvevttAi.eincoyTgiTu.tishwTzIeenceintoaFhosmnirrcsdosaeaetfmnnrtPtdhtpruoealobtipeintloihnrgcenespsruaManiionnredefgevsCtofiuoln8rvrgveitendhye C-3 000140 FtoixrsitcoPluobgliiccalMineefotirnmg,atCioAnTcoTnecaemrnminegmCb8e.rs shall familiarize themselves with the available ptmscouor:eermerp(ot1maiu)nrenegcnAd.oatinnsnFCdgwaiAungricaTleetllnslabTiydde,aeseiatrntfhmeeotecirvaomFltirhsideariesteertedpttiaoPunbsbugt;yhlb(iseWlc2hi)ctamhVdlMrleiDesbeeecEteeiulPntahsig.nsne;dgltdh(f4wieil)mlistlcolmoaxbnoeiecdrddihittiayhentleeaodltWfyeaCnpaa8dnrsihdopairnunpdbgrtoeltoiopcttanhhrqeeeWurfefipoorssertrtkirottsphinnuePseblpnaaliuntncbdtd,mlaiacteane;dt(i3n)g TABLE 1. TASKS OF CAT TEAM TarmOTaPCOOTicPTbrSPTOPOPneenaercaraArgrraaaebsbbgcbbdreiriiiisusresssecjemjjmmTejjmmnokkkkekteletpieeseitonuccctaccatnpasaaTnAiBCoDotnEttttrroregrraiioieiiirgd::nyv::y:rvyyvysnvvsaffmewkgeePDe.eemDEoRRnRRRsD(:::::uaaraLfuceieeemeoetteybcrtntFtovrveeoosoastosssivrldleoivreepbtppifpponeyitcdlturdleewonohdooogpoyaoeeltRoMnfneennlpis,rnvipreavoclereiefssmisnslcRsmiefrmarseelqziipiiihCodmlblbebbebweeceueoouaern8pitnioiiDnidiplsrmliltlllCrtto,toitniahteiaiihewatttttPriav8ptigoeayoydyyteyctasfinaraensf::l::uaf:PoihpdlrilsdhnPlrRo(lSaSvraTThoTaavbtTodrctasFcwieotasEbvEEieeosaavnirEsoiviulensyioRvrRleaRniaieconicRl,sboetieladbocAAaAnussimywltniwAlioinen_ienassnt_si__obeneRads)id_l_nifi_z__ensenotxac_u_gerRete_,ea__taolroh_cp_ircnmnnm__le_aLnnt,ue_Ro_osa_efn__Rgdteo_iaar_ellerd_de_s_osltuvynt_neer_fses_i__eecfsdesf_tarou_ac__he_iniltuorts_rent_sssihe_sr_s_ceelnfd_k_ewotne_ef_dB_tgsp.e_na_oiocs__e_alxaaf_nc_rto.etl_s__ooDsdspeht_l_sfC_._eis_lDeoNe_ec_lodtDd___to8sfhs_i_oseeow__upr_;wsoee_os_rvot_mr_a_miasseen_i_eemnat___ents_el.e_fbeait_Ps__ogdnoen__trot__:_prodn)ehrt__vou_.__e(te__Csdewts__i_te_tcn_Neee_8f_o_thcr__irva__e_Morstem__fdseis_ue__ttook__tleehneri___orns_nvv_peei___tp.nt_aee_tuhr__ho_itlyg__bahn_oi_es_f;_o_tluug_p_c_Hii_n_aamfc_r_n_#_fn_inSu__h_oitma1_d_mcec__a_inf)__irrne_l__(eaiet_a_itiehah___nnneent__te_ei__tnrtif_o_HaeMni__o_ispm_n_lnng__tr_eto_u_egth__a_aeta_ped_tel_nc_Lnrot_tui_n_doiihe_de_n_sbtp_ls_vki_o_lgtea_i_ehh-__gcrlb#_lae_f_i_sac2_ov_;__sa)_re___eml____d PShcraeseenIiIngTLasekvselBs,, aCn,dDR, iasnkdAEssDesesvmeleonptment of Provisional Reference Doses and ATreEfgtRaerrAdhinasIhvngaiPniltlghscaproserenvosipIueIo,wlstTeewEddiRtathhApeptorstooxhaxiaccliolcholcoflooogngridsittuchsacisolt ntiphnrtefohojeteromcCxtai.ActioTFolonoTlglreoieacwgmaali,rnadganisndscgurociCohskr8dcapionsrnasosetvuesildsdtmaebtdieyonbnDty,raT.WcSEtiVtvRaiDaAtiteEss,P. , C-4 000141 ptsarDrliucgwwsiCsseehadienhnocohutvlrsineoesehiuavodrsamkmsilildnenlesdcotiuldltlrzleiatmthpsaielnebiuihduednvuispnracfndrlsaeasesieielrtrtedetcwnterrteb.eivedsa)ew,siaagsap.eTzsatsolttsrpsisluataeuaaithocomnuoheeToartfsnrreuneodrpeerfrvnihedofsitrtttbeCacnhieti(feaeofPostoyesiciisetr8nalerefudfss;xeilroiixaonhs'dparineintctvwsacphtahpvfpaxoevfakifiloeteroasledapsnntotlayotysirxitaodcrluUlab,oeugfvuiapspesndoresrntrrtsSbituonorhhkeedinifeaaolersiEltmaseesglnCirencutsafstzsa)PecRador,8W.pmechttcffelAcnhi.doeoduaitago.tneTcieaftacom'dvronhTnaeesfstuEoreeornaslhnrwtsphDsdouRetitbdaesehigoamntnnrrnArehhsionaeyaadgcnfieaectrspsrfoewtoeiTnlyuoaetoT;sonlectlsDEanmnHhnfp(Eoshaiitcf4RneodseoeanlaeoRoWu)orcervrsdznAtrfsrfglAenoeietatruuhoodesrisftersdcs'artrexieafednshdekamhafloessppnlto;laislaer:trApotseiertrtrlai(ahmcP(serlsdifp2srdn1Cos.euuivlcsc)ocakdi)aaaprs8eihasrtaAenienlsrsiectltpdttiedwtdcfsrohidusac,ueaoedomeu,.stonsbcdhtarnnelashpnaetoanlaustetvTiiebancihSotmtdfumcsafeaErioetecfgitict;mttncwaavlRirhSghehaoaceaasnteaxceteeeeArburkentivarsalpinhoslnlsdlroLetteelauodseensiii,enourno;oAchsaasbinliubohngfnunltarnyoeiTtieerlftslsfnhhoeflLahteosacSgrs,nantsfireqpkreeoDdcloeismouavecLcanoearCPRrtSeaioefmcaennsirffuAptlloctlovt'outcislahmubistircnneeT.eroroayeedlmt,lcHanoinlrelhsiiTctbTbsirtadnneegefr;teflEnoeeegeadSiaorryocnd(.nalofRtlerr3iowitftgmdeaunerohood)ATmwvnesongnLgreEteitdaatrd;esreecisesakentRmc;wrnhevervemdiaeaacArepaaren,lrnhlsloaitlladsnedsottl(taeorhepofin(diofe5ldrr) Phase III Second Public Meeting oafarlsfosstomeh.sesTrmeehsfTeefihndoWeter.tnspVAtuioDairrflpEtmowhPseoeewldGloesiIllfaSlitnnThagddeadrpSnerueesdbuscClsolitncsAadnwoTyPfeTutflhulebseraltitmhechefesfMroisanrecctcersteltiuiooendnnfgiisWnnitggshVtaCloDet8vmEpecrPlaeosysnaaecnbnnededtnDtnttorheaucettpheigoosesenncanstrietwyiirn.zaiellglnrrbirosyeuktndhdieswcruaestsesureldts C-5 000142 SJACOMPEES OBFECWKOERRK, MFO.DR. Mwbaneialltolircswbihpe.aaDlatlesrUsd.isnBptiuievnbcegklrisectihrtmeyiseWSaectVmhinoDegodEsli.PcoaTfilnMhdehoeiscdsptioecsprciniesfecpicieCactleatiyansltkiaeszrrieanfasogsroiigfRnnrueiesrndkavlticoaroonDmndmrmE. eBunnnvetiiaccrlkoaehntiremoaanelrtenhattdaatelthsHetchreteiwableothd. He Phase I Task A-l: First Public Meeting mbpaesevmereeaeaepprnictlhaiahsnrabuesgolDmiefrspormtdrorooBonaxtvcheritiuiccehdzmkoeiefnelideoerrgnsgpiwttnieicdpixratleeuplhltmbeeradilrsieiDtaoscivtsilraasomea,tlgfwieitinnwceHhatrpiiiilalncsrlzshegkbatpuwreacaddrorireialmeAeltqdsimbs.ouesesinueNrcpsnerfsordiiomcobt.reaveettdiShtindhopetbeanedepftcilr.troitehfsowHpitecha:petrisoumewuxbdbiilblctiblacoyysflmkaWoUmsgeSViericEeltDiaiqPanluErgAdiiP,zr.aee,atdanwNhdiaiionmtlahrlPtesitptaeheeadlnarfryasdtwteihuctihIaurteehsltaotrhe includinSgubbutatsnko1t l-imFiatmediltioa:rization with toxicological data provided by WVDEP bac(dn....oA8DJteoCrcuaooGrfnmntIlayHHplaaaacTzrstahtmidrrcdeialsselcAlhssopsaolsondefrdstLisioonmimntfheoieonrtrmftVitdanhaotfilisocuoureinmnm(fpaTeortnLorimotvVnifa)drt.poeiormdonvtUocidoSUenEdScPeEbArPyn;AsWCuV8nD)d;eErPT. SCA by 3M Corp Subtask 2 - Attend a meeting prior to the first public meeting to: a. bc.. mdlcdoioiecssncamculdubsursesecsrsttsiah.daneedsntiottpeixraeivlcpiaosarlireoteagosayf;ntahanegde3rnildsakan;sdfaislslsocainadtetdhewWithasCh8inwgittohntWheoortkhsePr lCaAntT, aTnedam Subtask 3 - Attend First Public Meeting Phase III Task A-2 Second Public Meeting mreqeeutiirnegdD:prroBveicdkinergwexilplearstsisiset iinnrpisrekpcaoramtimonunfiocratthioens.ecTohnedfpoullbolwicinmgeseutibntga,skasndwialtltebned the preparedSubbytaTsEkR1A-; Familiarization with the toxicological and risk assessment report C-6 000143 Subtaska.2 b. -CddAAiisstTtcceuunTssdsseataahmnmedmetpoeerxtemiinpcbgaoerlpeorsrgai;yonraatngodetnrhdiesak.ssecaosnsodcpiautbeldicwmiteheCtin8gwtiot:h the other Subtask 3 - Attend Second Public Meeting NrSecosoutepltetshooaftfWtdhaoetraskec.coollnedctpiounblmicamy eweatirnragnitsaadsdsiutimonedaltopubbelitchemfeientailngpsubalnicd maneeetxinpgan; shioown eovfetrh,e C-7 000144 SCOPE OF WORK FOR TERA tgpdaWhsrreaoosvateuvsesahnilsdopdimnippnTbglieginetEneogtsstRwnerfsAreioWosverkui(noctTnhferedaokesncxstvi3toinoPcixrlrolatosiaolcnnonxaodmtgnil.fcoydieolgTnlEslsitohcc,xagarelcLel,yeseuidlpnanblaeenidetncndacugicksfrteitoiccrPsryfktuito,htabreaeaslrsRkniirscasdiie;ssSsakgkasseonmsaArvdivsgeessincncsreneotees.smsndDsmdTmetiuoenEsecnttTRrnttiigtEnAcp)rgtRoriowsusAoccpanaiesetaes.nenrsroegtTitnessdoEnu-tespepRfsrirpwcnAoalrdlfiyilibwrltcaiesbooindlkemrdlgbbmatehenloeoiznwa.tion SPchraeseenIiIngTaLsekvselBs,, aCn,dDG, aennderEa:l ADsesveesslompemnetnotfoRfisPkrovisional Reference Doses and pTforoolxlvoiicwdoielndSoggut:iboctabalsykdaW1ta-VtTDoEEbReP.AprNostvoaifdlfietwedriatloltufTraeEmsRielAiaarrcsihhzeaoltlrhidenomcclsuuemdleveebnsut wtreiitstrhinetovhtaellitmwoxiiltilecdboeltoorgetiqhcueailrdedat.a a. bc.. U3J8DoMSucuoPErCmnoPanoApltra.pacrDt(tnidrcaoilsftetecssHoaonanzlfdyairoandtfhsoAmerrsmasilnealsftpiosoomrnmrteipanorttnioofvoonirfdsetCuhd8bis;mtoiintUtfeoSdrEmtPoaAtWiounVndDcoeErnPcTeSbrynCsACb8y); Subtask 2 - TERA staff will: a. b. c. d. pdRtdstrcDfiohoeiuooeedneruexcbvvsne.faiotisteeenvrlclSamiililretobnszfotoeinaikmflleeppnnoeyaeicid)etm2Rgnnseaanii-rgg.enlesaodlmDftg;tuReaSshpsoettrcooeeiaeesirodsfssennteesnioscencroisslbeenogcoufnloioogDbeenacrfrytxgtedoractpethirssfLDhnosiokeetpeasesrio2ucCotvsdTeaar-neeAdenealEldsv;sdTtRibaeofnfnySolAxoTgodrcirDepctrtf2oaaeihoran-m.ieelcrbegon,Sia,olgittwcisnoaratihaaycngxaailadttidc,iseLclnr;ircoRiesn,toClvtiheouanceifangdanslelsduiliacrseeltisbtsstinnstooaunwcssniaduaeleis,ytitdbiDthac,aainooodbsOCdnoeselAehedrnddistTefooiiofrna,nimrTnateodtesdaeaalpdfimidon(rbeirfsyent lsaunpdpfliyllsbSaausnbedtdaWsokna3schu-irnrTegEntoRtnrAiWskshotarokllhscuPomlnaadnnut,chtaenoadnltehth.geeTnLheuirsbaelrcirskiksPkausabsselsisecssmsSmeernevntitcsehfoaDrllitshinterciltcuhtdrweee:ater a) gidroenutnidfiwcaattieornuosefsr;easonably anticipated land use, surface water and C-8 000145 bcde)))) iciLidddoeeeemvnnnetpttliiiasfffi;iircccisaaaotttiiinooonnnofoooefffxreepexxcoppesoopusstruuoerrreesc;opcnoactnhecwnetnaraytrtsai;otinosnsto; appropriate Screening TERA shall utilize the following data in the risk assessment process: abcd)))) ef)) wawagdaeiinfrrarerfioynletmmulecksanrto;oivsdnuddawgsfeeirelllaoawiitnndbmeaggalrteteeadddArxaaafpdtttTraaaoaoStsmfffaDurrrooorfRtermmmhoetHmoDtWWheCueLaVePl8uGtlDohlbirnnEeUoCtcP;upsok;enundbPsSwluuuicblartvlatsieetcuiryopS;WnpelretyvhlliadctAreiannDskasilieysnstsgrsiieswcstoapwftoeCertl.e8lns;ftioarl residential health souffefcicoileonSgtuicibnatfaloshrkema4alt-thioTnEtRoAsusphpaollrtrethveiedwevtheleoepcmoelongtiocafladaCt8a SancdredeentienrgmLineevewl hfoerthperrottheecrtieoins csuommmpraerhSyeunobsftiatvsheker5feop-loloTrwtE(iRdnrAga:fsthaanldl cfoinmalpivleerasinodnsd)i,scwuhsiscthhealrseosureltfserosfttoheanadbopvroevtiadsekssainbtroieaf bacd)))) e) UDgALWexroSuToVpcPEuSoaDonPDlsdnuEARRwrtP'ee'ssaHs'tstiaDoedeiaraerrCilanrdmt8fthamtsot,iHCadonaedoafnplreznidoulansimbrugnLdllgiutdtcaAhbadtesetiasauocstG;apnke;psrPtoslhymuuabndteldrnaiicwtsnsokaSetifesensrCrgve8Csiwc;8peaoAtDetenrins,attilriyfiacsaltiv;shaeaialnaldtbhlWee.feflelcUtssferoSmurvey of cfCoa8rr.cfiuAntoulsgAroeed,nrdTiecisEtieitoRaynrAcoahlfslyChg,a8lelTlaiEnnpeRrrodaAvtsdidsuthoerianhilnlguimttnhhcaeilnsursepd.preooicrntesothsfetahraseutpmowrmot uaalnrdyyfdiunirsstcihguehsrtsseiolounrciordefacttohemethrmeeleetnovdxaaintcciioetyntshoef C-9 000146 000141 Rural Jinr k / - ; - - '3 / V ( v ; r r . 'i- r . '- \ v \\\ .-. I I- U-tij-. Fr. I;. \* i:5 SOURCE HEW HAVER. V V -0 ffiD QUMFAND .' .1 l^|T . - A- -i .1 rr *'2. \ A 'Ois ,-f. -T * S '*{ Norii* 2000 SCALE 0 2000' Corporal* Romodlatlon Ckoup i n AJUmula M u a m JX cA m f M id i J1U i r -- c jDUu m m A Cnvup EXHIBIT 2 SITE LOCATION MAP L e ta rt Landfill Site P a rk e rb u rg , WV 4UL A* ahnwr. OATC 17/71/0 TEL tassa M ru M DEL T2MA003 m ss 1 000148 fill II GfrTOOO 1200 SCALE 0 1