Document gbO0QVjzb72ZOJ2yEbpwj1JYG

AR226-1374 oe ATTACHE TIME LINEFORC-8 CONTROL PROGRAM ARARG 1374 March 20, 1981 o pIrnefloirnmeidnabryy 3anMinoaflessbturdyioetsoxwiictheffCe-8c.ts observed fn March 27, 1981 o3fM vtaesatviressiutletds.by Du Pout personnel to verify valldity March 27-31, 1981 o pDreocciesdiuornemsaddeevetloompoevdefoarllhafnedmlaliensg ftreommpoTrEaFryLOmNoveasrea and (AttachmeInIt - typed April 9, 1981). March 31, 1981 o S(tAatntdabcyhmMeendtiTaV)S.tatement and Questions and Answers received April 1, 1981 @ Employees informed and all females temporarily removed from exposure area (Attachment III). Begin blood asmpling of femsles involved. Completed April 10, 1981. aBesgsiunrevenrobaflemacloenstaocftscvhiitlhdbceoanrtirnagctcoarpsabiaslinteyediendextpoosure area. April 6, 1981 o Conplete Company communications package issued (Attachment IV). Aprils, 1981 a WoeobxrtpaokisbnueergdeisJnuisnneoont3,hdeirs19p8ea1rr.seiasoFnoimfnoadltehlreiePnslgualntttso.dceotmIepnrliaetttineaedl adiatraborne August 7, 1981 (Attachment XIV). April12, 1981 e Wciatpahbmieldiitcyalslalpopvreodvatol',reftemuarlnestoofTEnFoLnO-Nc.hildbearing April 16, 1981 o fSeecmoanldescaofmtmeartctahteioinnittioanlePvlearatquaenasctuinocnesnernatised by (Attachment V). Supplemental Nadia Standby Questicns and Answers 4ssued (Attachment VI). April 1s, 1981 Communication of procedure for permanent reassigments g to all wage roll (Attachment VII). g ~ EID079423 = | 000028 To April 26, 1981 Yay 4, 1981 Nay 6, 1981 June 9, 1981 August 4, 1981 ATTACHMENT I (cont.) o Begin permancat reassigmments. DBliovoidstsoanmjpolbisn.g begins on male employees catering TEFLON Additional toxicity testing starts at Haskell Laboratory. PtloaduitsMceudsiscaCl-8Suspietruianttieonnde(nAtttcaaclhlnesntarVeaIDo)b.stetricians Initial blood sample results received and communicated to individuals (example -- Attachment IX). Letters of communication famed to vaste disposal vendor (Attachment X). Notification letters fasued to sir pollution and water resources authorities (Attachments XI, XII). Baployee commmnication on blood sampling and status of program (Attachment XIII). IFD:mah 12/14/81 3 2 Bs EIDOT9424 000029 Lo C . PERSONALAND CONFIDENTIAL Apr 9,i 19l 81 ET -- (Ref. C-8 Communication 4-1-81) TenporaryMoves 1. ProtectpayofZoneVIonloan - 2employees. 2. Allmovesout OfTEFLON willbeonshiftannouncementmade. 3. All movesaretemporary. 4. AdiLvLiTsEiFoLnoOvWefretmianleersolsotaenreidmtmoedoitahteerldy.ivisionswillbeputon new 5. `fToErFLaOnNOfTemaaslsiegsrlmoeannte.daretobeby-passed andnotcharged untilqualified 6. Smiexdpioaotleelmyp.loyees loaned to TEFLONwillbepotonTEFLONovertimeroster 7. Alrolstmearl.e groupemployeesloaned to TEFLONwillremainontheirhome C 8. Temlp oanosfr romaTEr FLOy N: 1. Allempsl tayo ony cure rene tshs ift 2. Movesmade onneed, work experienceandseniority. 9. Maleemployeesmoved to TEFLONwere all from2/23/81hiring - least seman lei emplo oyer es. `PermenentMoves - 1. Females thatwantandhave approvalwillreturn to TEFLONon4/12/81. 2. Females that desire to stay in TEFLON must talk withDr. Power by 4/10/81. 3. Divisionwillposton4/13 -postingdown 4/16. 4. Gatepostingon 4/~2do0 wn 4/23 - announce successful bidders 4/24/81. 5. All rovesannounced on 4/24 will be madeimmediately. 6. ALLTEFLON femalesthat bidon gateposting. donot return to TEFLONwillbe required to C S1- . . Ce Z g EID079425 000030 ---.-- . C " _i- PermanentMoves (Cont'd) 7. Arenqe uirq edtu obi idnwuv mibtehraoTEfl FjLuOnNe ioarn smaalt cehso(imcien.us sevenpool employweiellsb)e 8. Femaleemployees that bidout ofTEFLONon gate postingwilltake their 'TEFLONgroupservicewiththemtonewdivision. However, willnotbe `usedtodisadvantageofemployeeinnewdivisionwithmore plant service. 9. ZmeVIfemalesthat bid outof TEFLONwillhave payprotectedinnew divisionuntil (1)they have senioritytobe asuccessfulbidder on a ZoneVI job; (2) theyvoluntarilybidoutofnew division; or (3) they aprayeriantveolwvieldlibnerdeodwuncgtriaodneodfpfeorrGcreeteno Buotoikliptryocpeodoulr.e.In eachcaseemployee 10. oVtahceartidonsielevctwiiiolnlpsbreeivhioconuosrlneydm.adebyTEFICfemalesrequired tobid to BYB/WBB: jsh C 1 Z 2 8 . EID079426 000031 $e . cc: J. H. Todd WG.. TA.. BRoowseernlund 0D.. DL.. DDaarlbtyon W. H. T. D. Darnell Ramsey, Jr. AR.. NR.. TSatyollotrenberg E. P. Waltzer March 31, 1981 trTO: ee to SUPERVISION THROUGH DIVISION SUPERINTENDENTS C-8_commuNICATION ing schedulAet.tached information will be communicated on the follow- All Division Superintendents T9u:e0s0daay.,m., 3/31/81 ATlhlrouFglhuorFooproelmeynmer--SCuopmeprlveitseidonBy: T4u:e0s0dapy.,m., 3/31/81 SALuLperOvtihseorrsSu-p-erSvtiasritonAtT:hrough T1u:e0s0dapy.,m., 3/31/81 All Supervision Through Foremen W9e:d0n0esad.amy.,, 4/1/81 All Fluoropolymers Employees W1e2d:n0e0sdNaoyo,n, 4/1/81 All other Employees W2e:d0n0espd.amy.,, 4/1/81 i RIB/djp ' i . FDOT | ; 000032 EMPLOYEE COMMUNICATION preliminaryWerheasuvletsbeoefn ainnfeowrmaendimbayltshetud3yM Cionmvpoalnvyingabothuet tfhleuorctususurerefdacaittnanWetax,scheisCns-8g,otfonwhtWiwocerhnktsyi.syeaan3rMseisssienonutfirlaulporrimonapctoielpryaimlaelrsrutephspailtnisehramsafnbourefeancthis chemical. dkenfoewcntsas inFWCe-t1h4ew3erueonrboaradnmvmiwoshenedinuomnfepdMearbfrylcuhosrt2o0o,omcatc1ah9n8o1ta,utbeet,htaotcauCf-se8em,dalebalisrrotaths siniganedlatboordaettoerrymienxpeerdiomseangte. liTmhiitss pwarsiora ptroealimfiunlalr-sycaslteudystdued-y on'C-8's potential to cause birth defects in rats. Of the preAlitmtihniasrytiamnei,malweexdpoerniomteknntoawsthiet msaiygnirfeilcaatnecet,o eimf-any, Tpelporyoedeucextpiovseureef.fectFsu.rther studies are planned to define possible decided,thaAts uantpirlecafuutritohnerbaisnefdoromnatitohen insewobsttauidnyedw,e ahlalvefemale TefhmoeprsleoeyxepfeoessmuarlweeilletompbelC-o8yreeeamsnodvweidllolafnrecodomnsaiurmelmatesdwiiwaththeerleyourttoheProleatnhteisrMdepidoviticesaniltoinasl. Dtihveisoipotni,onantod rtheotsuernoftonotnhe-chFilulodrboepaorliynmgercsapaarbeial.ityWowmielnl obfe cghiivledn- abfetaerringa will be pmcaaeiprnamtbaainileninettdypawlinaldnltvbpaeocsattaiilnolgnowehsdaesletocbeteibnoindsmafdpoerr.eovtihoPeurrselsypelnmatandtpeayjwoirblsaltes be honored for those females reassigned. Wboerekns,exptohseerDdeurhitanosgC-bt8heeenlpeveneroliskondotwhtnahtaetvpioC-ds8eencahedavsetbrhesaeetnohueurasletdehmpaletfofWyeaecsethssi.nhgatvoeAn p(r0e.l56impianratrsy apcecrepbitlalbiloen)exwpaossureestalbilmiistheodf 0.01 mg/m3 which we believe has aeanndyceeqduiamtbpyealiyromuerpnrtoetmopeflcotyetedheeso,muarlteehmeprrleeopyrieosedsun.cotievAveitdefenuxcnpecotsiutoorne.sulgegveeslts etxhpeereri-is Ocfoulidtsreemspull3to4yeifenisresaltnednvoatttiehfadtioerdtghaeunssiecienlfel1vu9ao7t8reiddtehaltelveeevlxeslpsoscuoirunledthteopebCr-ls8oiosdt pflooryeeexst,enedmebdarpkeerdiodosn aonf etximtee.nsiAvte ptrhoatgratmimet,o rweeduncoetiefxipeodsuermebleeveenlsk,eptanaddbveisgeadn obnlonodewmodneivetloorpimnegntasnalaynsdeso.f blEomopdloyteeesst rheasvuelts. participatiWoenasikn yaouprrocgoroapmerfaotrioanddiwtiitohnajlobblroeoadssisganmmpleinntgs. and 5 tained. We will inform you promptly as new information is ob- 28 | RIB/a3p - EIDO79428 000033 LE QUESATNDIAONSNWESRS - To Be Used As Needed To Answer Questions - Itfo Ptlhaernet Maarneagaenmyenqtu.estions not answered below, they should be referred 1. Qt How2many femle erploysesat yourPazkersiuryplantmay havebee3 n exposedto A: About sixtyvorked in areas wherethereispotentialforexpose. 2. Q: vHaatveedyoorugsaanmipclfeldutohriedbelloeovdeolfst?heseemployeestodetermineiftheyhaveele A: SFarmogerbaunts.notallfemaleenployeeshavebeensampledas.partofourexisting 3. Q: Dothey havelevelsof C- abovenomal? A: Yes,somedo. 4. Q: Areanyofthesixtyfemaleemployees pregnant? A: Yes,tothat velaowof. S. Q:Aarnedtwhheoraeraennyofwopmreegrneamnptl?oyeesyouknowOf Whomayhavebeenexposed to C-8 A: Yes,onethatweknowof. 6. Q: Whathaveyouadvisedthesepregnant womentodo? A: aWtiloophnhayovsfeitcahidvaeinps.oetdTehtnehtieeasxlearecimtslsokiysgenaienfsditwcoainlccloehnosafuvltetththeheaemnpiclmoaanlnsttulpethsaytlsrsiecosiuwalinttfshottrhoaetnirheepxheprulsamonnna faourtfdhefdr esixidpsoaptystuearritaeurtionehakntoonbwrtgneaas.iunlelHtdo.swienvehri,cwoedlbeevlieelvsegiretaptreurdtehatantboaceklgirmoiunnadtuenatnyi.l 7. Q: H3avCeoympoaunayt'tseamnpitmeadltsotldocyawtheifcohrimnedrifceamtaedletehmaptlCoy-e8emsatyobaedtveirsaettohgeenmiocf?the A: Wateea,rfeoirmnetrhee pmrocpesslowifolrelvbyieewreiotneigfoiuserd.employmentrecordsand whereappropri- 8 0: bDeoeynoeuxphoasveedantoyCku-o8uwlheodsgeecohfiDldurFeonnstufefnpelroeydebeisrotrhdfeorfmeecrtesm?ployeeswohave A: Mhoo. hTahveerbeeeinsemxopeovsieddetnoceCo-f8bciomrptohudnedfseacttsDaamFoonngtc.hildrenborn ofmothers 5 ~ EIDO79429 3 ' . 000034 -2- 9. Q: eDmoplyooyueehsavwehoanyhavkenowbleeedngeexopfose3dM fered birth defects? CtoompC-a8nywheomspeloyceheisldrorenfsourfmee.r A: aNon.y 3W4eemaprleoyneoetskonrowlfeodrgmeearbelmeploofyetehse wphroegwnearnecyeoxupotsceodmetoofC-g. 10. Q: WOhfatchiilsdbtehaeripnogssaigbeiliwtiythtehlatevaetmepdlooyregeasniocr may give birth to children with defects. fflouromreirdeemprleovyeeless A: Wfeurtdhoernotexpkonsouwr,e.but we are taking appropriate steps to avoid 1l. Q: eImspltohyeereesaenxypoisneddictaotiCo-n8 tmhaayt tive function? mhaalvee esumfpfleoryeedesloosrs foofrmerrepmraoldeuc-- A: POWfreodthuhaecvteimvaneloesilnyadsbitoceramattoiroornyittashnaitfmuanCl-c8stioehnxa.psosaeTndheetfrofeepCc-rt8ooatnwcetrteihveecmlaoolsreeglanyrseeatxtarmiibnuetdabalned wteoreC-8noremxaplo,surwei.th no evidence of abnormalitiss 12. Q: Are there any tests that can assure the fetus is all right? : A: rTiihnge'hrstoe.mearceTahsenerose.taersetIsftwtehshetisscehwhctiaecnshtsacsasanruereddeottnheeacttantfdheetaalrfeeatnubosnromriasmla,laillttiheesre is a good likelihood that the fetus is all right. 13. Q: Wwhhaothaavdevicbeeendoexwpeosheadv,e afborouwtombeencoomifngchpirledgbneaanrti?ng capability A: Tcihains. is a personal subject between the voman and her physi- 14. Q: Wiinlltiemel?evated organic fluoride levels in the blood decrease A: Yes. 15. Q: Hoevwellso?ng does it take for these levels to fall to background A: It is not known at this time. Blood samplins is continuing. 5 8 3s EID079430 i 00003s J -3- i. tr BClaonoedpslaofyeeleys?andformer employeeswithelevated organicfluoridelevelsdonate h: BOllfeovCoe-dl8hdooanrsawnthoiontghbiaeesvnewdaeadtreekrefmdiiennerdarsroheapoatbusilolodfnre.poottPdeeonrnstaaintaselbwelxhopooohdsauuvrneetetiloletCvh-aet8aehdlnobdoltdoholedeblvleeolvoeodlfs C-8 returns tobackgrloeuvanlsd. 17. 0: Whatisthebackgrloeuvenld? A: Ifnoroporteexnpteiraileenxcpeosiunrbel,ooordgtaensitcsflcoumotruicdteebdlaomoodnlgeevmepllsoyraenegsewdiutphli0tt0.l4epcphmance 18. Q: Haveyouresampledemployees' bloodrecently? A: Yes, and vearetakingadditionalsamplesinan ongoingprogram. 19. Q: Werethelevels lowerinthe recentbloodsamples? A: So farthereism obvioustrend withthedataavailable. 20. Q: Istheredanger tothefamiliesofemployeeswho workinthe area? A: Bntyoifvhoealezlqaouriwdpitmneognttthhaeeneedmspftloaolbylleoiews'ihsnegdfpgaromaoicldtypi.ecressoanmailhpyrgoiceednusrpersa,cutsieceso,fptehresroensahlopurlodtbeec: 2. 0: iat1o9p7e82rating procedures were institutedby Du Bont after thefirst Mreport A: cEianxtstiteoinntssuitvaeendedhnlignoiconrdeeearmsionengdiutporsroeigonrgafampnsedvresaorineradsleapvmrepolltoiepnecgdtpiwrvhoeigecrqahumiisnpacmlseunwdtee.dlleIqanusaimpdmrdeientsttimrooiwdnnie,gfein-t bousekeepingstandards. 22. Q: Whatadditionalchangesinoperatingproceduresdoyouplanrow? A: Thishasnotbeendetermined. Vearerevitehewsitiuantiogn. 23. Q: Areyoulockingfor asubstiftoruCt-8e7 A: Yes, vehavebeen forsame time. 26. Q: Whatarethepossiblesubstitutes? A: Wehave notidenfonieaftpireseendt. . EID079431 ,= ; : 000036 S4- 25. Q: Why did the 3M Company test C-8 for teratogenicity? A: Wpboeeuntudensrdaetmroasgdteeannibdcy.th3a4tanC-d8thisatchienmiecaarllileyrsitmeisltainrgtoweroethefroucndomeso 26. Q: When aid Du Pont learn of the latest study results? A: March 20, 1981. 27. Q: fHiaesazthe appropriate Federal regulatory agencies been notiA: Yietss. res3uM,ltso.ur supplier, has notified EPA of the study and 28. Q: What were the hirth defects noted by 3M in the unborn fetus? A: qEuyieredde.fects are reported but complete testing will be re- 29. 0: What additional animal testing is planned? A: pEtolosacubroorenaftilerevmeCl-38Mfpotrreerlafietmmoaillnoeagsry.yerveasluulattsionasndoftoliadbeonrtaitfoyrysarfeesuletnsc 30. Q: Wthoaxtinsi?s Du Pont's policy on emplo: ying women around embryoA: Wpaoromesaeusrneoofflecpvohetilelnditbsieaaklrnoiwennxgpcaonasdpuarbetiheltoietxytpeoarsrauetroegaselnlscoawnwehdebrteeomwaaoinrstkaafieinneedxbnkoentloowwnaloltrohweweshdeertleoevetwlhoser.kpoitnWeonmatreienaalsofwexhcpehoriseludrbseaesfaerairnlegovacebalospvaebairlesiaftnoeyt.laerveels. Waroemaesn owfhopoatreentnioatlofexpcohsiulrdebeatrointgeractaopgaebnisl.ity can work in 31. Q: sHatseriDluizPeodn?t ever required or suggested that an employee be Ar No. 32. Q: Atrheattahreereeamnbyryoottohxeircschemicals used at your Parkersburg plant \ A: Yes, DMP (dimethyl formamide) and HFA (hexafluoroacetone). 5 EIDO79432 1 000037 : sl 33. Q: What products are sold perfluorooctanocate) ? by Du Pont using C-8 (ammonium A: Various fluorocarbon resin and dispersion products. A: No 34. Q: Is there any problem involved with coated with fluorocarbon resin? cookware which hasbeen 35. Q: Will Du Pont be notifying its customers of the most recent A: Yfeisn.dings reported by 3M? " 36. 0: Htaivoensw?omen been removed from exposure at all Du Pont locaA: gNor,ounndo.t at those locations where blood levels are at back- R4I/B1//d8j1p ' 32 2 -~ EID079433 . 000038 Le FINAL COMMUNICATIONS PACKAGE g E. I.0U PONT 0 NEMOUR&S ComPANY WILMINGTON, DELAWARE 19898 PoLyMER PRODUCTSOERARTMENT April 6, 1981 PERSONAL AND CONFIDENTIAL ER.. DE.. RI.ILA.l JJ..TC.. WN.I JR.I HP.. JE.. JFl. NW. JE.. AD.. LH.AFL. MD.. CA.. **HJ. FH.. **BJ.| WF.. BDOREELXTEELR RLIUCNHDAGRADASR,D JR. SBEMSIPTEHRKA' DIER_sGCRHAW/M. ROCCONI MSEEYREERNSRETZ ARARIONNEHSALT BCLHUAMMBPENREGY PSEMRICTIHVAL SSAHNODOEKRS- CHS-314 TCOADNDFIE-LDWAS-H.CIWRKCSL.EVILLE MGELLEVITIZN -- GCEHREMSATYNUTPARRUKN : WJ.. RE.. GJI. AFl. CB.l WD.. RJ.. LP.. AB.L CL.. WF.. RE. ARlILA.l iA.. GC.. AC..BC.. *WH.. GC.. JC.. DB.. TGIABTSUOMN- -ADAMDIMNIN HSACPHMKUATZ- L-EGLAELGAL RDAERRMHART-INEOR - ER MSCTOWCUEELNL -- PPAA MDCADERUS-IFC&KF- CRSD HFERNEDNRCIHX - - CF&P&F WRRHIOGDHETS -- FFIIBBRR MHIAKVEELNL--IENXTPL. STATION PGRAILFMFEIRTH- C-&P2HOTO DEVRAINNSKWA-TEDRORD-REGCEHNTEVA SRHOABFIENRSON- S- PGREUNANECVEA C-8 PERFLUOROOCTANOATE 4s beinAgttuascedhedcoisimpthleemefnitnalcoermppolroayteeeacctoimomnmsicraetliaotnisvepatcokargeecentthat ofcitnadnionagtse.by 3M on the teratogenic potential of ammonium perfluoroemployeeItcocmomnutnaiicnastitohnes,comqmuuenstiicoantsionasndscahnesdwuelres,, maepdpiraoprsitaatndebycstaattieomnesnta,ndaColeotrtdeirnatoiuotniinCoimnmgitatcetei,vitainedsleofttetrhse FtCo-1c4u3stoCmoemrmsu.ni- Please destroy all previous drafts. of moadks RDI/is . MEANNEURFGAYCT&UREINNVGIRODNIMVEINSTIAOLN AFFAIRS Zz g Attachments *Employee Communication for individual site only. 3 Theraewo'rlsd of things we're doifg.something about EIDO79439 000039 INDEX Commmication Schedule Employee Communications Washington Works Circleville Germay Park Chestnut Run - Fluoropolymers Chestnut Run - Elastomers Experimental Station PaPrhloitno, PrBordeuvcatrsd and Rochester Questions and Answers - Employees Media Standby Statement Questions and Answers - Media FCC-o1m4m3ittCeoemmunications and Coordination Letters to Customers Page No.* 1 2 4 6 7 8 9 10-15 16 17-27 28 30 *Refers to number in upper right hand corner of page. : ~ EIDOT9440 000040 PERSONAL & CONFIDENTIAL C-B -EMPLOYEECOMMUNICATION Timetable: Mashington Works Line Supervision through 2nd Line First Line Supervision * Wage Roll Initial Communication E..T. 3/31 09:00 an 09:00 an 12:00 Other Domestic Locations e Supervision - Same as above * Wage Roll - Same as above Foreign Locations Europe Japan : "4/2 AM. (local) 4/2 A.M. (local) NOI:adw 3/30/81 e----" g - g EID079441 = 000041 "tt "" FINAL - 3/31/81 - WASHINGTON WORKS - EMPLOYEE COMMUNICATION We have been informed by the 3M Company about the preliminary results of a new animal study involving the fluorosurfactant, C-8, which is an essential material that has been used for more than 20 years in Fluoropolymer resins manufacture at Washington Works. 3M is our principal supplier for this chemical. We were advised on March 20, 1981 that C-8, also known as FC-143 or ammonium perfluorooctanoate, caused birth defects in the unborn when fed by stomach tube to female rats in a laboratory experiment. This was a preliminary study designed to deternine dosage limits prior to a full-scale study on C-8's potential to cause birth defects in rats. At this time, ve do not know the significance, if any, of the preliminary animal experiment as it may relate to employee exposure. Further studies are planned to define possible repro- ductive effects. . As a precaution, based onthe. new study we have decided that until further information is obtained, all female employees will be removed from areas where there is potential for exposure to C-8 and loaned immediately to other divisions. These female employees will consult with our Plant Medical Division, and those of non childbearing capability will be given the option to return to the fluoropolymer area. Women of childbearing capability will be allowed to bid for other plant jobs after a permanent plant g ' g S ) - EIDO79442 000042 ett -2- posting has been made. Present pay rates will be maintained and vacation selections previously made will be honored for those females reassigned. : During the period that C-8 has been used at Washington Works, there has been no known evidence that our employees have been exposed to C-8 levels that pose adverse health effects. A preliminary acceptable exposure limit of 0.01 mg/m3 (0.56 parts per billion) was established which we believe has adequately protected our employees. There is no evidence to suggest there is any impairment of the male reproductive function. 3M first notified us in 1978 that exposure to C-8 could result in elevated organic fluoride levels in the blood of its employees and that these elevated levels could persist for extended periods of time. At that time, we notified employees, embarked on an extensive program to reduce exposure levels, and began blood monitoring analyses. Employees have been kept advised on new developments and of blood test results. We ask your cooperation with job reassignments and participation in a program for additional blood sampling. We will inform you promptly as new information is obtained. [I . 5 g . EIDO79443 = | 000043 QUESTIONS AND ANSWERS (To be used as needed to answer questions) tIhfeychsehroeuladvebeanryeqfueersrteidontso npoltantanmsawneargeedmebnetl.ow . Ql. HhoawvemanbyeenfemeaxlpeoseedmpltooyeCe-8s7 at your Parkersburg plant may AOL. Aebxopoustur(e5.0)* worked in areas where there is potential for Q02. Hiafvethyeoyuhasvaempelleedvattheedbloorogadniocf tFhleusoerideemplloeyveeelss? to determineI 402. pSaormte bouftonuortexalilstienmgplopyroegersamhsa.ve been sampled as Q03. Do they have levels of C-8 above normal? 403. Yes, some do.x QQ4. Are any of the fifty female employees pregnant? 04. Yes, two that we knowof .% QS. bAreeentheexrpeoseadnytofoCr-m8eranemdplwohyoeeasreyomuowknproewgnoafnwt?ho may have A05. Yes, one that we know of. Q06. What have you advised these pregnant women to do? A06. Vpehyshiacvieanadvfiosreadntheexspelaenmaptliooyneeosf ttohecpoontseunlttiatlheripslkasntand wTihlelexhaacvte stihgenmifciocnasnuclet oalfsothewitahnimtahleirtesptersroensaulltsphytsoictihaen. phruumdaenntoftfosperilnigminisateyeatnyunkfnuorwtnh.er Heoxwpeovseurr,e wcehatbelreiseuvletsitin \ - aroeodobtlaeivneelds. greater than background until additional data Z *Adjust for other sites. g . EIDOTo444 . 000044 Q07. What is the background level? A07. wIinthourlietxtlpeericehnacnecewiftohr pboltoeondtitaelstsexpcoosnudruec,tedorgaamnoincg employees fluoride blood levels ranged up to 0.4 PPM. Q08. Have you attempted to locate former female employees to advise them of the 3M Company's animal study which indicated that C-8 may be teratogenic? A08. We are in the process ofreviewing our employment records and where appropriate, former employees will be notified. Q09. DeomplyooyueehsavewhohdhakvneobweleedngeexopfoseDdu PtoontC-8empwlhooyseeeschiorldrfeonrmer suffered birth defects? A09. We Du know Pont. of n In o evid light e nce of 3o4f rbeisurltths ,dewfeectwsil lcauisnevde sbtyi gaCt-e8 afturther. QL0. Do you former heamvpeloyaeneysknwohwolehdagvee obfeen3MeCxopmopsaendytoempCl-8oyweheosseor children suffered birth defects? Al0. No. We are not knowledgeable of the pregnancy outcome of any 3M employees or former employees who were exposed to C-8. Qll. What is the possibility that employees or former employees of childbearing age with elevated organic fluoride levels may give birth to children with defects? All. Ve do mot know, but we are taking appropriate steps to avoid further exposure. Q12. eImspltohyeereesaneyxpoisneddictaotioC-n8 tmhaaty hmaavlee esmupflfoeyreeeds loorss foofrmer male reproductive function? Al2. WmdeaulcethiavvleeabnsooyrsaittneodrmiycoraatniiiotmsnalsfthuaentcxtpioCos-n8e.dhatsToheaCn-8reewfpefrreoecdtucctloinovseetlhyeormgeaaxnlaseminroefedprtoah-end wteoreC-8noremxaplo,surwei.th no evidence of abnormalities attributable QI3. Are there any tests that can assure the fetus is all right? Al3. There are no tests which can assure that the fetus is all Z riinghsto.me cTahseerse. are tests which can detect fetal abnormalities 8g : . EID079445 000045 nee "3 : z Ql4. Wwhhoathaavdevibceeendoexwpeosheadv,e faobrouwtombeencomofingchpirledgbneaanrti?ng capability, 5 Al4. pThhyissiciisana. peArnsyonaqluesstuibojnesctofbeatwpeeernsotnhaelwnoamtaunreanwdilhlerbe on'an individual basis. handled Ql5. Wiinlltiemel?evated organic fluoride levels in the blood decrease ALS. Yes. Ql6. Hloewvellso?ng does it take for these levels to fall to background Al6. It is not known at this time. Blood sampling is continuing. Ql7. Cfalnuoreimdpeloyleeevselsanddonfaotremebrloeompdlosyaefeesly?with elevated organic Al7. Belloeovdateddonabtlionogd ilsevealsdefoferrC-a8bleoropwthioonh.avePewrosroknesd wihnoahreaavseeof pdoetteenrtmiianledexsphoosuulrdenotto Cd-o8nataendbltoheodbluonotdilletvheelbhlaosodnoltevbeelen of C-8 returns to background levels. QI8. Have you resampled employees' blood recently? * Al8. Yperso,graamn.d we are taking additional samples in an ongoing QU9. Were the levels lower in the recent blood samples? * A19. So far there is no obvious trend with the data available. Q20. Itshetahreerae? danger to the families of employees who work in A20. By of pfeorlsloonwailngprtohteecetsitoanbliesqhueidpmepnrtactaincdesfoalnldowpirnogcegdouordesp,ersuosenal hfyagmiileyn.e practices, there should be no hazard to the employee's *Adjust for other sites. > ~ EIDOT9446 000046 See -4- 3 Q21. Wthhaetfoipresrtat3iMngrepporrotcediunre1s97w8e7re instituted by Du Pont after A21. `tWue teidncbrleoaosdedmounsietoorfinpgersaonndalaiprrostaemcptliivneg perqougirpammesn,t, instiimproved Ahdoduisteikoeneaplingengainndemeardiengcperrotgarianmseqauriepmuenndtermodwaiyf.ications. Q22. What plan naodwd?itional changes in operations procedures do you A22. sThiitsuathiaosn.not been determined. We are reviewing the Q23. Are you looking for a substitute for C-8? 423. Yes, we have been for some time. Q24. What are the possible substitutes? A24. Ve have not identified one at present. Q25. Why did the 3M Company test C-8 for teratogenicity? A25. Wceompuonudnedrsstmaanddetbhyat3MC-8andisthcahtemiincaelalryliseirmiltaerstitnogowtehreer found to be teratogenic. Q26. When did Du Pont learn of the latest study results? A26. March 20, 1981. Q27. nHaostiftiheed?appropriate Federal regulatory agencies been A27. Yes. It notified EisPAouorf utnhdeerssttuadnydianngd itthsat re3Ms,ultosu.r supplier, has Q28. What were the birth defects noted by 3M in the unborn fetus? A28. rEeyqeuidreefde.cts are reported but complete testing will be ---- ~ EIDOT947 =i 000047---- oe -5- Q29. What.additional animal testing is planned? : A29. C3-M8prteelriamtionlaorgyy erevsaullutastiownisllofbelacboonrdautcotreyd atnoimiadlesntitofycaonsfaifrem exposure level for females. Q30. Wthoaxtinsi?s Du Pont's policy on employing women around embryo A30. Woofmpenoteonfticahliledxbpeoasruirneg tcoapatbeirlaitotgyenasrewhaelrleoweadsatfoewoerxpkosiunreareas atLlehlveoeswleed1lsevtekolnswo.owrnkWaonimndenatrheoeafsexcwphhoieslrudrebeesasraficenagnlbeceva`epmlaasbiinaltriaetiynneoadtrebkennlooowtwn or wwhheorearethneotpotoefntcihailldebxepaorsiunrgescaapraebilaibtoyvecasnafweorlkeveilns.areaWsomeonf potential exposure to teratogens. Q31. HsatserDiluiPzoedn?t ever required or suggested that an employee be A3L. No. Q32. Atrheatthaerereemabnryyoottohxeirc?chemicals used at your Parkersburg plant A32. Yes. DUF (dimethyl formamide) and HFA (hexafluoroacetone). Q33. Icsoattehderweitahnyfplruoobrloecmarbionnvorlevseidnw?ith cookware which has been A33. Fo. Q34. WfiilnldinDgusProenptorbteednobtyify3Mi?ng its customers of the most recent A. Yes. Q35. DDoeeespwaDtuerP,ontNemwanJuefrascetyurpelanftl?uorinated surfactants at its A35. Yaerse,'chbeutmictahlesley adrieffmeraennutfafcrtourmedC-b8y(dFiCf-1f4e3r)e.nt technology and - i . EID079448 = 000038 we -6- Q36. Is it possible that people working with fluoropolymer dispersions may be exposed to fluorinated surfactants and develop high blood fluoride levels? A36. Du Pont employees working with fluoropolymer dispersion Products have been tested and show norma)background level of blood fluoride. TR3 Q37. hIafppseinnsterteod thfeluoC-r8ocadrubroinn products g sinterin do g no or t o contain C-8, ther heating what opera- tions? A37. It is removed in processing. Q38. A38. Does Du Pont monitor airborne exposure levels? Yes. Q39. A39. Have women been removed from areas with potential for exposure at all Du Pont locations? Each site is taking appropriate action. EIDO79449 : 000049 "Final - 4/3/81 | 3 i SFTCA-N1D4B3Y SETXAPTOESUMREENT We have been informed by the 3 Company about the results of a preliminary animal study involving the fluorosurfactant, ammonium perfluorooctanoate, also known as FC-143. 3M is our principal supplier for this chemical, which Du Pont uses in certain manufacturing processes. We were advised that FC-143 caused defects in unborn rats when fed by stomach tube to female rats in a laboratory experiment. This was a preliminary study designed to determine dosage limits prior to a full-scale study on FC-143's potential to cause birth defects in rats. We are considering all implications of the results of the preliminary 3M study. Additional test work is planned by 34 and Du Pont. At this time we do not know the significance, if any, of this experiment as it relates to employees with potential for exposure. During the many years we have used FC-143, there has been no known evidence of adverse health effects from employee exposure. As a safeguard, however, where appropriate, Du Pont has reassigned female employees of childbearing potential. Female employees of childbearing potential are not being reassigned at other locations where blood sampling and air monitoring indicate there is no cause for concern. - EIDOTMSO z CRE 5 TNtoOoTEbm:eediaaDdrd.riensqBsureuidcreiebsyW. oDrfK.ararKhac,rorrhop,ofractthoeentMmaeecddtiiccRaaollgernDaitvR.uirseiM.oonr,riFsow,rillPiunbqrlueiiscrpioensd 8 s nAaftfuarier,s c(o7n7t4a-c9t561J)o.hn LF.orStnoownemleld,icaPlubliincguAirfifeasirsof (a77c4o-r1p8o43r)a.te 000050 -2- 3 QO1. At which Du Pont plants have you reassigned female employees 3 to avoid potential exposure to FC-1432 : ; AOL. At Parkersburg, West Virginia, and Circleville, Ohio. : Q02. How many female employees have been reassigried at each plant? R02. About 50 at Parkersburg and 1 at Circleville. Q03. Are any of these employees pregnant? R03. Yes, two that we know of at Parkersburg. Q04. Are there any former employees you know of who may have been exposed to FC-143 and who are now pregnant? : A04. Yes, one that we know of at Parkersburg. Q05. What have you advised these pregnant women to do? R05. We have advised these employees at Parkersburg to consult the plant physician for an explanation of the potential risks and, if they wish, to consult also with their personal physician. The exact significance of the animal test results to human offspring is yet unknown, but we believe the likelihood of risk is small. However, we believe it is prudent to eliminate any further exposure until additional data are obtained. Q06. Have you sampled the blood of these employees to determine if they have elevated organic fluorine levels? A06. Some but not all female employees have had blood samples taken and analyzed as part of our existing program. -- . EID079451 B 000051 i. 3 07. Do they have above-normal organic fluorine blood levels? 207. Yes, some have above-background levels. n) Q08. Have you attempted to locate former female employees to advise them of the 3M Company's animal study which indicated that FC-143 may be teratogenic? A08. We are reviewing our employment records and, where appropriate, former employees will be notified. 09. Do you have any evidence that Du Pont employees or former employees who have been exposed to FC-143 have had children who suffered birth defects? 209. We have no evidence of birth defects caused by FC-143 at bu Pont. In the light of the IM study, ve will investigate further. 10. Do you have any knowledge that 3 employees or former employees who have been exposed to FC-143 have had children who suffered birth defects? AL0. We are not aware of any adverse pregnancy outcomes among 3M employees or former employees with potential for exposure to Fe-143. Qll. that is the possibility that employees of childbearing potential with elevated organic fluorine levels may give birth to children with defects? - All. There is very little likelihood thit employees would bear . children with defects due to exposure to FC-143, even if it : EIDOT9452 8 000052 3 is a teratogen, because their exposure was at relatively low levels. However, until more facts are known about FC-143 and higher-than-background organic fluorine blood levels, we believe it is prudent to remove females of : childbearing potential from the risk of potential exposure. Ql2. Is there any indication that male employees or former employees exposed to FC-143 may have suffered loss of reproductive function? . x Al2. We have no indication that PC-143 has an effect on the male reproductive system or its function. The reproductive organs of male laboratory animals exposed to FC-143 were examined and were normal, with no evidence of abnormalities attributable to FC-143 exposure. Q13. Are there any tests that can assure the fetus is all right in the case of an expectant mother who was exposed to FC-143? Als. There are no tests which can assure the fetus is all right. There are some tests which can detect fetal abnormalities in some cases. Ql4. What will you advise females of childbearing potential who have been exposed about becoming pregnant? Al4. This is a personal matter between the woman and her personal physician. Du Pont physicians will give full cooperation -- to employees' personal physicians.. Any other matters of a personal nature will be handled on an individual, confiden 3 tial basis. g EIDO79453 : 000053 -s- i Ql5. What is the background level? Al5. In our experience with blood tests conducted among employees with little chance for potential exposure, organic fluorine blood levels have ranged from 0.0 parts per million to 0.4 ppm. Ql6. Will elevated organic fluorine levels in the blood decrease in time? . Als. Yes. Q17. How long does it take for these blood levels to fall to background levels? Al7. We do not know at this time, but we believe the rate of decline is relatively slow. Q18. Can employees and former employees with elevated organic fluorine blood levels donate blood safely? Als. A person who has elevated organic fluorine blood level should not donate blood until the organic fluorine blood level returns to background levels. A person who has worked in an area of potential exposure to FC-143 and whose blood level has not been determined should not donate blood until the organic fluorine level has been determined to be no higher than background. - 3 EIDOTI4SE B=! : 000054 Q19. I understand an employee at the Parkersburg plant suffered " a miscarriage. Was this related to FC-143 exposure? ? Al9. We have no information that indicates a higher risk of miscarriage due to exposure to FC-143. : 020. Have you resampled employees' blood recently? A20. Yes, we have and are taking additional samples in an ongoing program. Q21. Were the levels lower in the recent blood samples? A2l. So far, there is no obvious trend, with the data available. 22. What operations procedures were changed by Du Pont after you first learned that exposed employees may have elevated organic fluorine blood levels? A22. Ve increased the use of personal protective equipment, insti- tuted blood monitoring and air sampling programs, improved housekeeping, and made certain equipment improvements. Addi- tional engineering programs are under way. . 23. What additional changes in operations procedures do you plan now? 223. This has not been determined. We are reviewing the situation. Q24. Are you looking for a substitute for FC-143? a2. Yes. i Q25. What are the possible substitutes? ! A25. We have not identified one at present. . R EIDOT94SS 8; . : 000055 -- 26. Why did the 3M Company test FC-143 for teratogenicity? z A26. We understand FC-143 is chemically similar to other compounds made by 3M and that in earlier testing these other compounds ; (a pexfluorosulfonic acid and a perfluoroalcohol) were found to be teratogenic. Q27. What were the birth defects noted by 3M in the unborn fetus? A27. Eye defects were noted, but complete testing will be required. 028. What additional animal testing is planned? A28. FC-143 teratology evaluations of laboratory animals will be conducted to confirm results of the preliminary 3M study and to identify a safe exposure level for female employees of childbearing potential. Q29. When did Du Pont learn of the preliminary teratology study results on FC-1432 A29. March 20, 1981. Q30. Has the appropriate Federal regulatory agency been notified? A30. It is our understanding that 3M, our supplier, has notified the Environmental Protection Agency of the study and its . results. @31. What is Du Pont's policy on employing females around teratogens? A3L. Women of childbearing potential are allowed to work in areas of potential exposure to teratogens where a safe exposure - level is known and the exposure can be maintained below these levels. Women of childbearing potential are not allowed to 5 work in areas where safe levels are not known or where the 2 ~ EIDO79456 000056 -8- i potential exposures are above safe levels. Women who are z not of childbearing potential can work in areas of potential + exposure to teratogens. 32. Has Du Pont ever required or suggested that an employee be sterilized? A32. No. Q33. Are there any other embryotoxic chemicals used at your Parkersburg plant? 233. Yes. DMP (dimethyl formamide) and HFA (hexafluoroacetone). Q34. How is FC-143 used at Du Pont? A34. This is a water soluble compound used for its ability to modify the wettability of materials. Q35. What products are made by Du Pont using FC-143? A35. Various fluoropolymer resins, perfluoroelastomers, and Polyimide films. 36. Is FC-143 found in any of these products as supplied to the marketplace? A36. Yes, fluoropolymer dispersions contain up to one-half percent of FC-143. 37. What are uses for the dispersion? 237. Fluoropolymer dispersions are used to coat various fibers and --- metals. In most but not all of the coating operations, the FC-143 is destroyed by a sintering process. Sintering is a 5 8 . EIDO79457 000057 ot 2i -9- 4 high-temperature curing process used in all fluoropolymer coating processes except in the manufacture of some fiber and fluoropolymer resin combinations. Q38. Are there any applications where FC-143 is not destroyed? A38. Yes, in packings, gaskets, and industrial filtration products. Q39. Where are gaskets and packings used? A39. We don't know all the places. However, we can assume that any operations where liquids are being transported might use pump packings, valve stem packings, and gaskets. Q40. What industrial filtration products use dispersions? M40. Some industrial power plants use filter bags to collect finely divided coal ash. Many filter bags are made of woven glass fibers coated with dispersions which are not sintered. Q41. If packings and gaskets are used in systems to transport liquids, could they come into contact with liquids intended for human consumption? Adl. We believe most of the applications involving our dispersions in packings and gaskets are industrial operations. Du Pont does not recommend the use of unsintered dispersions in appli- . cations where the material would come into contact with food, beverages, or potable water. 8 . EIDO79458 . : 000058 e- i SE 25 2 3 Q42. You said Du Pont does not recommend such uses, but has the Company ever communicated this caution to customers? M2. Yes. We advise customers orally and in writing that articles coated with fluoropolymer dispersions which are sintered should be in compliance with the Food and Drug Administration regulation (21 CFR 177.1550) for food contact. We advise customers that coatings that are not sintered will not comply with the FDA regulation. : 043. Are any consumer products made and sold by Du Pant involved in this concern? M3. No. Based upon our experience in monitoring the blood levels of our employees who work in areas where formulated products containing FC-143 are used, we do not believe there is cause for concern. For our industrial customers for fluoropolymer dispersions, we have communicated safe handling procedures for these materials. We will, of course, review this subject in greater depth and update our advice if further study warrants any changes in recommended procedures. Q44. Is there any problem involved with cookware which has been coated with nonstick finish? Ad4. No, since cookware coatings are sintered, thereby destroying the FC-143. Q45. Will Du Pont be notifying its customers of the most recent findings reported by 3u? 2 . EIDOT9459 22 : 000059 Cae te 2 -1- i Q46. Does Du Pont manufacture fluorinated surfactants at its - Deepwater, New Jersey, plant? Ad6. Yes, but these are manufactured by different technology and are chemically different from FC-143. Q47. Is it possible that people using fluoropolymer dispersions may be exposed to FC-143 and develop elevated organic fluorine blood levels? A47. Du Pont employees using fluoropolymer dispersion products who have been tested show no elevation over background levels. Q48. Are there other manufacturers of products competing with and similar to fluoropolymer dispersions? M48. Yes, both in the United States and in other countries. Q49. Are they aware of the 3 study of FC-143? ? M49. We have suggested to 3M that it advise all of its FC-143 customers. Q50. Is FC-143 used in the manufacture of fluoropolymer resins at any Du Pont plants other than Parkersburg? ASO. Yes, at Dordrecht, The Netherlands, and at a joint venture, Mitsui Fluorochemicals Company, Ltd., in Japan, which is managed by our Japanese partner. QS1. Are female employees at Dordrecht and in Japan being reas- signed or relocated? . ASL. There are no female employees at Dordrecht who have the > potential for exposure to FC-143. We are advising our z Japanese partner for apperpoprrioatperiate |action. EIDO79460 g - 000060 Ca Pr -12- i Q52. Are there other Du Pont plants where FC-143 is used? AS2. r(eNfOeTrE:medPilaantinmqauniargieerssofshaoulcdormpeornattieonnaotnulryethienivrolvsiintgesotahnder sites to Public Affairs.) Small quantities of PC-143 or FC-143-containing materials are used at the Chambers Works in Deepwater; Germay Park, Chestnut Run, and the Experimental Station in Wilmington, Delaware; Philadelphia; Toledo, Ohio; Parlin, New Jersey: Fairfield, Connecticut; Richmond, Virginia; Brevard, North Carolina; Rochester, New York; Mechelen, Belgium; and Ajax, Canada. Q53. Why haven't you reassigned female employees of childbearing potential at these sites? AS3. Some of these sites do not employ females in areas of potential exposure to FC-143. In other instances, Du Pont employees using fluoropolymer dispersion products who have been tested show no elevation of organic fluorine blood levels above background. or JLStowell:as) ---- . EIDO79461 000061 BE,me CHIEED TSE BESRRRA J. R. GIBSON - ADMIN. i 3 E. I. ou Pont o Nemours & Company. WILMINGTON. DELAWARE 19898 . March 31, 1981 J.T. W. R. H. E. F. N. F. E. A. L. SMITH/N. J. IRSCH DE GRAW/M. ROCCONI SERENBETZ/J. W. RAINES ARONHALT/E. D. CHAMPNEY FRENCH/A. B. PALMER - C&P DADE/W. R. HENDRIX - F&F R. L. RHODES/A, A. WRIGHT - TF A. C. HAVEN - INTL G. A. HAPKA - LEGAL B. C. MC KUSICK - CR&D B. W. KARRH - ER J. L. STOWELL - PA EECCC--11O4433 MCOMM MUNIUCATNIONI S&&CCCOOOOA RRDDIIT NNAATTII IOONNCOCOOMMMNMIITTS TTEEEE Following are the committee members: DEPT. PPD NAME J. T. Smith N. J. Irsch WW.. KR.. NDaecGeraw HJ.. WE.. RSaeirneensbetz C&P F&F FIBR IL LECAL CRSD ER PA EF.. DN.. ACrhoanmhpanlety F. E. French A. B. Palmer A. L. Dade W. C. Haaf R. L. Rhodes A. A. A. C. Wright Haven G. A. Hapka B. C. McKusick B. W. Karrh J. L. Stowell to reviewThsitsatucso.mmittee will meet each day at 10:00 a.m. in D-12015 z TONS 4 40 34 ing are dm seein scout 000062 questions Industrial Department Committee to Walt Raines (in his absence, members H. E. will direct all Serenberz) for 8 2 documentation all committee and development of members informed. consistent answers. He willkeep . EIDO79462 Ce fT. SMITH, ET AL -2- March 31, 1981 1 questions.J. LH.oweSvteorw,ellsuwcihllqubeestpiroinmseanaddvianssowrerosn msehdoiualdreallsaotedbe | communicated to J. W. Raines. = for all meDrd,icaB.l Wq.uesKtairornhs.will serve as the corporate spokesperson Each site should designate a principal spokesperson to avoid conflicting comments. Merc J. W. RAINES ENERGY & ENVIRONMENTAL MANUFACTURING DIVISION AFFAIRS JWR:1ldr EID079463 8 : 000063 am CC: W. J. BV.ANRHHOODEEVSEN ~- TFF&DF Lo E. 1. ou Pont be NEMOURS 5 Company 2 WILMINGTON, DELAWARE 19898 PERSONAL & CONFIDENTIAL FED PERSONNEL April 1, 1981 : AMCMUOSNTIOUMMERPAEDRVFILSUOORRYOOCLTEATNTOEARTE customers T(hLeisten5c0l6o2s)edonletThtuerrsdiasy,beiAnpgrilmai2.led to all domestic mfainnudfiancgtsuroebTthaeoifnpoeuudrrpboysfeltuhoiesro1ptoMolyCamodemvrpisaenryeosuoirnnsctahunesdtsodumiresfrpasecrtosafinotenxspu.seerdimTheienntatlhe ifenmfaolremapteirosnonsnueplplileodcabtyed 3iMnhaosurrdeisruletcetd riensinthmeanruefaascstiugrnimnengt aroefas. cstuesptsomesrhso: ulwTdhheociuosnnetfionrrumeesaitnitsoonafnoodlbltodawiisnpetedhresitiroondesaxtiesitniinnsgduibcgsaoetoqedusenmtatnhuapftraococtueursrsiinngg procedures. a result oAfLLthiqsuesatdivoinssoryorleitntqeuririsehsoulwdhicbhe rmaeyferberedgenteo:rated as F. N. Aronhalt (774-6349) or in my absence: : RR.. WH.. MGoeourdeer (7(7747-47-318278)8) 2 FENnAc:ldofsaure NF.ATIN.ONAARLONSHALAELST MANAGER FLUOROPOLYMERS DIVISION bl There's a word of things we're doing something about EIDO79464 i 000064 rT Pe Ro E. I. bu Pont oe Nemours & Company ; WILMINGTON," DELAWDELAwARE 19898 PoLvmER PRoGUCTS DEPARTHENT Apri| l 2, 1981 % Dear Customer: : 2she surfactOnantMaracmhmon20i,um19p8e1r,flutoheroo3cMtaCnocmaptaen,y, alosuor supplier known as of PC-143, advised defects us in that this material has the unborn when fed by been found to stomach tubes cause birth to female rats in a laboratory facture of most experiment. Du Pont of its' fluoropolymer uses PC-143 resins. in the manu- psrioggnirfaimcatnocMeduecothfermmotirhneee t3tMehseetxipnsegarfiemmtueysntto.fbeouAcrsonmpdaautrcettreiodafltsto,hedbeototenhrgmoiiDnnuegPtohnte's . mHeanstkse.ll Laboratory and 3M are now planning more detailed experi- levels measured in non-exposed employees. Female persoinei in no With significant the exception of aqueous dispersions, there residual FC-143 in any of the fluoropolymer is 0r.e4s5i%nsbywhwiecihghwte'sFeCl-l1.43. AqAuenoaulsysidsispoefrstihoensormgaanyicconftlauionrinuep ctoontent finabrthiecatbilnogod foifnisDhuedPopntrodpuecrtssonnsehlowswhnooueselevaaquteioouns ovdeirspetryspiiocnasl in tthheesepreacraeuastioanreofnotreabsesiinggnirnegassfiegmnaelde. perHsoownevneerl, iwne thheavearetaasken where our resins are manufactured and FC-143 itself is handled. At this time, if you Procedures previously given to are following the Safe Handling you, it does not appear that 2PTcnhredaocncogemvedemsuewrniedilsnltyh(oaaaudttvrtiyaspoceruhoecdyc)eoo.usntsiiinnfPuguetrhtoehptreeoerrafatosrilteoulndosiawensyatrheecarheawSnaagrfbeeresainnHtigaenndcd.oolunirdnugWcerteedcdo ommendations. ? . your convensiheonucled. you have any questions, please contact us at Yours very truly, FNAzafa Frank N. Aronhalt NFaltuioornoaplolySmaelress MDainvaigseiron z g - EID079465 ! There's a world of things we're doing something about 000065 ft ~~ Tg DRAFT OF LETTER TO CUSTOMERS OF: i Textile Fibers - uPnrsoiduncttesredconsttaatien.ing Teflon dispersions in an 5 Apral 2, 1981 Dear - On March 20, 1981, the 34 Company, our supplier of the surfactant ammonium perfluorooctancate (FC-143), advised us the material has been found to cause birth defects when fed by stomach tube to female rats in a laboratory experiment. Du Pont has used FC-143 in the manufacture of its fluoropolymer resins for many years and has not experienced any known human-related problems. Our manufacturing process is such that only the fluoropolymer dispersions contain any residual FC-143n,s 0.45% by weight. These dispersions are used as impregnants in the family . of Teflon and Kevlar packing yarns sold by Du Pont. Residual levels of FC-143 are present in these packing yarns. Other forms of Teflon fiver are not known to contain residual FC-143. As part of Du Pont's ongoing program for determining the safety of the materials used in the manufacture of or contained 1n the products we sell, we have been monitoring the organic fluorine content of the blood of the personnel involved with . producing fibers. Our findings are: ! At Du Pont's facilities which use fluoropolymer disper- 3 sions containing FC-143 in a manner similar to yours, g we have found no elevation of the organic fluorine ~ content over that of unexposed people. 0066 We intend to conduct more testing to determine the signi- i ficance of the 3M experiment as it relates to our employee exposure and the products we sell. We have reviewed our procedures for handling fluoropolymer dispersions in our plants and plan no changes. At this point in time, it does not appear to us that changes 4n your operations are warranted when handling impregnated packings. We Will keep you informed of any further developments. o3 . EID079467 = 000067 em ee = PID E. I. ou Pon 0& Nemours & Compa WianaTon Became se reams roveaes romans #5842 3, 130 i = : see sie. As part of Du Pont's ongoing program to survey the safety of all our materials, we think you should be advised of a March 20, 1981 announcement from the 3M Company, our surfactant supplier. 3M informed us that based on preliminary laboratory experiments involving a pure surfactant, birth defects resulted EEetntShainnrTipecroeBreDhe i feds Teeslits trations by Du Pont to manufacture fluoropolymers which, in In-depth investigation of the presence of this surfactant in coatings determined that the 3M surfactant was destroyed at TATIL1OEyNouYareSfeolmloweinng ogur wsecomsseetnedseidabl"eSafperiRdaensdlipneegsiPneeactizes" normal curing temperatures and no detectable residue remained. guide, changes in your manufacturing operations are not required. OW.Sho.ul.d you have any questions, plesse contact us at your A copy of the guide is attached. Changes may be advisable if you are not following these recommended practices and our repre sentatives will be available to discuss them with you. -- Very truly yours, rBS iicchahraerbd i bo. rGray TEFLON is Du Pont's registered trademark. EID079468 : 000068 Larter y E.1.0u Pont 0E NeMouRs & COMPANY WILMINGTON, DELAWARE 19858 - April 3, 1981 Dear Mr. President: (FC-143) weThbeuy34frCoommpaInMyharsecceanutsleydtboilrdthusdetfheacttsa ifnluroartossuirnfaactant lianbgorreadtioernyt tienstd.ispTehrisisonpsroduuscetd itso maakmeinoorur (ilmepssregtnhaanted0.5flpueorrcoecnatr)bon felt. normal heatIttriseaotumrentbeloifefourthiamtprtehegnaFtCe-d143felitss.desWteroyaerde nionwthteesting ptroodsuecet.if Waenywirlelsidlueet yoofutkhneowcoamsposunodoncaasn wbee gdeettedcteefdiniitnivoeurrefsiunlitssh.ed Sincerely, MC/sew SMAIKLEEScMoAcNoAGER - INDUSTRIAL `ELECCOTMRPOONSIICT/EISNDU&STCROIAATLINGS SPECIALTY PRODUCTS DIVISION 8 EIDO79469 2 BETTER THINGS FOR BETTER LIVING. THROUGH CHEMISTRY 000069 o:o = WHOPRHOAPDOSWEODRWKCAEOSDMHMIUNINGNITCOFALNTUWOIOROORNPKOSTLOYMFEERMSALAERSEA we have As some follow-up to our original communication on C-8 additional information pertaining to questions (FC-143) that - have been asked. informed in such This is in accord with our practice of matters as new information is obtained. keeping you There have been fumors Fluoropolymers have had children that with two women who worked in birth'defects. We are not aware of any f two women human birth defects attributable to FC-143. We do who worked in this area before or during pregnancy know whose aware children reportedly of this information had defects detected after 3M notified us at of birth. We the animal became study. We do not know whether there ing this matter further, and is ve 2 relationship. are considering We are ibvestigat additional studies. . employees Some employees have asked of childbearing potential what advice we have for female who have been exposed to FC-143 & about becoming pregnant. the potential effects of Until FC-143 we on have additional information about the human fetus, we think this is 2 matter of sufficient concern that, as a has an organic fluorine blood level above precaution, a female who backround level should consult We will wpriotvhidheeralplersionnfaolrmapthiyosniciweanhapvreioorn tFoC-c1o4n3temtoplaetmpilnogyeperse'gnpanecry--. sonal physicians. who have Another question is what ve have told female employees mentioned they are considering voluntary sterilization. The plant physician and area supervision strongly recommend against sterilization have told them that we for job-related reasons. "Emaecnth, wohemranswehnioorriatiys,edhetrhispays,ubajnedcthehrasbebneeefnittsoldarethaftullhyerpernoptleocyt-ed " . 2nd that there was no need to even consider a surgical procedure. The was women were a personzl told that whether matter that would or not they elected such surgery have to be decided by them in - consultation with their husbands and their personal physicians. } /4a33/81 R EIDOTITO 32 000070 em em wd 1 E. I. ou Pont oe Nemours & Company 5 WILMINGTON, DELAWARE 19898 3 PoLvMER PRODUCTSDEPARTMENT April 14, 1981 PERSONAL & CONFIDENTIAL J ` ER.. DE.. DBROEEXLETLER I. A. LUNDGAARD JW.. ER.. TGIABTSUOMN--AADDHMIINN J. PF. SCHMUTZ - LEGAL | JR.. LC.. RBIECSHPAERRDRSA, JR. 3. 7. suite GC.. AD.. DHEAPMKAART-INLOEGA-LER B.W. RAR-RERE. WP.. R3.. DMEEYGERRASW/M. ROCCONI JRIP.. L. MSCTOCWEULL-E-PNPAA 3E.. wE..RSAEIRNEENSBETZ Rl D. INGALLS AB.. LC..DMCAK-UDSIFCEaKF- CR&D W. R. HENDRIX - Per FE.. DN.. ACRHOANMEPANLETY J. Al BLUMBERG RFI. HE.. FRHROEDNECSH -- FCiIPBR A. A. WRIGHT - FIBR LEH.. AF.. sPMEIRTCeIVAL AW.. GC.. HMAIVKEENLL--IENXTPL. STATION - _DM.. AC.. SSAMNODOEKRS- CHS-314 .AC.. CB.. PGRAILFMFEIRTH- C-aPPHOTO `JH.. FH.. CTAONDFDIE-LWDAS-H.CIWRKCSL.EVILLE WHK.. CG.. DEVRAINNSKW-ATEDRORD~RGECEHNTEVA- 3B.. WP.l MGLEELIVTIZN -- CGHEERSMTAYNUTPARRKUN C.D. ROBINSON - GENEVA C-8 PERFLUOROOCTANOATE and AAntstwaecrshedpraerpea;red(1)totaheddrfeisnsaladSduiptpiloenmaelntamlediSatanqdubeystiQounesstitohnast mcauyrreanrtilsye furnoduerw(a2)y tatheWaSsuhpipnlgemteonntaWlorkEsm.ployee Communication Attachment . M7a%nufacTtruacrhing Division i} . Se . EDOTMTL =2 LL 000074 Dredfo : rion pH- 4/13/81i A3 #1 2 SUPPLEMENTAL STANDBY QtAs =1 FC-143 EXPOSURE - 4(7N3O/T8E1:. TThheesye aGdidArsesasreadsduiptpiloenmaelntaqluesttoiotnhse tfihnaatlmasytanadribsyeoffrom a supplemental communication to Washington Works employees.) QOL. Is it true that two women who worked in the FC-143 area at your Parkersburg plant have had children with birth defects? AOL. We are not aware of any human birth defects attributable to ammonium perfluorcoctancate, also known as FC-143. We do know of two women who worked in this area before or uring pregnancy whose children reportedly had defects detected at birth. We do not know whether there is a relationship. We are investigating this matter further, and we are considering additional studies. 02. Can you be more specific about these two defects? 202. (Refer question to Dr. Bruce W. Karrh of the Medical Division.) 5 | EIDOT94T2 8 000072 . ze a 4 Q03. What have you told female employees who have mentioned 1 they were considering sterilization? 2 203. The plant physician has told them that we strongly 4 . recommend against sterilization for job-related reasons. : Each woman who raised this subject was told that her employment, her pay rate, her seniority, and her benefits would be fully protected and there was no need even to consider a surgical procedure. The women were told that whether or not they elected such surgery was a personal matter that would have to be decided by them in comsulta- tion with their husbands and their personal physicians. Q04. Despite these assurances, did any of the female employees who were reassigned from the FC-143 area subsequently decide to be sterilized? R04. Yes, a few did at Parkersburg. This was their personal decision. I emphasize that each had beea told individually that we strongly recommend against sterilization for job-related reasons because it was not necessary QVS. How many exactly? aos. Four. 006. What happened to the women who decided to be sterilized? - AO6. Each of them had the option of either accepting reassign- z returning to her previous work assignment. . & EIDOTTS 000073 "a. A 1 Q07. "Are there any other female employees who were reassigned ? from the FC-143 area who in retrospect were not of child- : bearing potential? ) AO7. Yes, we have been told by our plant physician that some women in this area later presented evidence that they were : not of childbearing potential at the time of the reassign- ment. They also had the option of accepting reassignment or returning to their previous jobs. Q08. How many exactly? R08. Nine. Q09. Will you give me the names of the women who chose : sterilization? ) R09. No. To do so would be an invasion of their privacy. Q10. What will you advise female employees of childbearing potential about becoming pregnant if they potentially were exposed to FC-143? | ALO. As a precaution, a female who has an organic fluorine blood level above the background level should consult with her personal physician prior to contemplating pregnancy. Until we have additional information about the potential effects of FC-143 cathe human fetus, wethinkthis is a v necessary precaution. We will provide all information we ! aid in this decision. RN 3 EIDO79474 000074 -4- i Qll. What products are involved with FC-143? All. q(uNeOsTEt:ionThtihastrmeesnptoinosnes shthoeuldtrbadeemuasrekd, on"lTyeflionn"r.espoAnsgeenetroala qstuaensdtbiyo.n) can be answered by A35 through Add of the 4/3/81 FC~143 is made by several different companies in the : manufacture of a variety of fluoropolymer dispersions, including some of Du Pont's "Teflon" products. Any Du Pont fluoropolymer dispersion used in consumer products goes through a process that destroys FC-143, with the Possible exception of come plumbing packing materials. CE : . EIDO79475 2a 000075 02+ Ls PJEoDTe SMITH YJ =onVAaA some=o=n -: a . WEPOROHPAODSWEODRCKEODMMUINNIFCLAUTOIORNOPOTLOYMFEERMSALEASREA E- As follow-up to our original communication on C-8 (FC-143) 2 we have some additional information pertaining to questions that - # bave been asked. This is in accord with our practice of keeping you informed in such Eatters as mew information is obtained. sr There have been rumors that two wosen who worked in Fluoropolyzers have hed children with birth defects. We are not suare of any husan birth defebts attributable to PC-143. We do know of tuo wosen who worked in this ares before or during pregnancy whose children reportedly had defects detected at birth. We became auaze of this information after 3M notified us of the animal study. %e Gc Dot know whether there is a relationship. We ars investizat-- ing this matter further, and we are considering additional studies. . Some employees have asked what advice ve have for female employaes of childbearing potential who have been expssed to FC-143 _ about becoming_pregnant. Until we have additional information about the potential effects of FC-143 on the human fetus, we think this is a matter of sufficient concern that, 2s a precaution, a female who has an organic fluorine blood level above background level should _ + consult with her personal physician prior to contemplating pregnancy. We will provide all information we have on FC-1%3 to employees per-- sonal physicians. ae = . . Another question is what ve have told female esployees who have mentioned they are considering voluntary sterilization. The plant physician and area supervision have told ti-u that we _ strongly rectrmend against sterilization for job-relited reasons. Zach woman who raised this subject has been told that her ewploy- ment, her seniority, her pay, and her benefits are fully protected and that there vas no need to even consider a surgical procedure. The women were told that whether or not they elected such surgery was a perscasl matter that vould have to be decideZ by them in [4302a 2 ~ EID079476 : 000076 CE "SUPERVISORY INFORATMAINOUANL . DoEX 2 a4 ATTACHMEVNiT April 15, 1981 TO: ALLSUPERVISION . PERSON MuBET divisions,th1esfoalrleoswuinlgt ogufitdheelinneeesdthaovmeobveeesnodmeevTeElFoLpeOdN.Sfemales to other Pleasecrmmicatetheguidelinestoall wagerollerployees reporttoiynoug. I. equ Movi esFrromTeEFIdOW + rFeeqmuliersedwtiondboidnoonthGaatveehMoeudsiecPaolsatpipnrgovaaslthtoousgthatyhewyilwlebree Gemfroo m thteire Grod up. : TGheasetemeplhBoioydeuCeassardre:eto illoutthefollowing onthe C 21.. MMmabrkerblaolclkG"rIouapnsrexeceqptuTitEoFrLbeOiNddS" 3. Wamalblsheifrts IT. WhoMayBidToTEFTOW OcnaplaybmiallieteymwpillolybeeesaollrovfeedmtaloeemmvpleotyoeeTsEoFLfONnSo.n-childbearing : bFeymeanldeeomfpGlaotyeeheosumsuesptohsatvinegappperroivoadltforboemctohnesiMdeedriecda.l Division III. VacToa Be n Postc edAi tGae tehos use 4/20/81 o TFiElFaImOeWnts -=~ 186RNeepwlvaacceamnecnitess o Pucmoe&ewSerevicres ~- 41NNeewwvvaaccaanncciyes BUTACTTEandC&Pwillbetaking areducticnofforceofoneeach. C . . . . : 3 2 ~ EDO079477 8g 000077 : ,. a IV. Gatehouse Bidding Procedures A. General OSniextBeUeInATCEIFTIEONanfdemoanleeCsswPielmlpbleoyreeeqwuiilreldbteorebqiudifrreodmtToEbFLiGdNbSe.causeof NaormmeldGautechootfusfieobroicdend.ingprocedureswillbefollowedexcept i the caseTotencushqualifiedemployeesbidvoluntarilytoTEFLONto ill . Cv. : VI. B. MovesRequiredTo FillRemainingTEFIONVacancies quIfalTiEFfLiOeNdUvtaiclaintcyiPesooalreemprlootyefeisl,lleedavsoltusnetnairoirlPylbaynqtuSaelrivfiiecdembaidldeeGrrsoourp employees willberequiredto moveto TEFLONS. e eImfpGlaoyteehsourseeqBuiirdeCdatrodsnhoavveetonoTtEbFeLeOnNe,nstheirfedtbpryelfeeraesntcseesnwiiolrlmbaelteaGkreonp firnodimctahteeidr.GroupJobRequestcardsbasedon most.desiredshiftJob LsehaosultdseenntieorrmaaGlaetGerhoouuspeeBmpildoCyaeredslwihsotmianygbsheirfetqpurierfeedrtenocmeosvieftdoiTfEfeFrLeOnNt thances ListedontheirGroupJobRequest Cards. cow servicerorTEFLOwW Fermiesrequired 1 HoveFromTEFTOW TTEEFFLLOANNGfermoaulpSeesrrevqiucieorerdptroimoorvGertooupoStehrevridcieviisnitohnesiwrinlelwudsieveiistihoenwrtihtehiirn ldaisvtistihornefeoyreGarrosu,wpbhiicdhdeivnegrpiusrpgorseeast.er,as theirGroup Serviceinnew AmceuwtdailvGirsioounp.SeArcvtiucaelwGirlolusptSaerrtvaitcew"zielrlob" uenulseesdsiprfisohreGbrioduspoSuetrviocfehienr + newdivisionandlaterbidsbackper "GreenBook"procedure. ScheduledVaca FortTEi FLOoV Fenmalses Vtaocoatthieorndseliectvioniswpisrlelvbiioeuohsolnnyomraesdd.eby TEFLONfemalesrequired to move bIefaTlElFoIwOeNdtfoetraalkeescaha"nfgierssthcihfotiscien" vmaocviantgiotnopoetrhieordd(iavniysinounms,erthoefywill dciovnisseicuotnipvreowcoerdkudraeys.s). Anyothervacationdaysreschemdisut floelldow O : ! z g 2 EIDO79478 000078 .3- . a VII. PayProtFe orTcEFt LQNi Feomalnes TtEoFoItOhNeSrfdeirvailseisocnusrwrienltllhyaavbeotvheeZiornreaItVeowhfopaaryeprreoqteucitreedditonmthoevier newdivision until: VIII. 1. They have seniority tobe asuccessful hidder onan equivaZolnee Jnobt. 2. They voluntarily bid cut of new division, or 3. Theyareinvolvedin areductionofforce totheUtilityPool. Ipnroecaecduhrcea.se,employeepayratewillbe downgraded per "Green Book" iningof personMoev)es . All movesresultingfromGatehousePostingwillbemadeimmediately. C. E. Ifyouhave Allman (4258) or any questions about E. M. Bond(4304). the aboveguidelines, please call EMPLOYEE RELATIONS DEPARDENT aT. 2:30 NE ET 5 2 EID079479 000079 a sR " a iaold ATTAGaa vip . Le cc: WJ.. TRB.. "SmDietGhr/aNw./.M. J.RocIcrosncdh i. [ipad, *y AU= P !a FH.. NE.. ASreornehmablett/zB/.J. D.W. ChRaaimnpense.y % : Fl E. French/A. B. Palmer, CAP E. I. 0b Pont 0E Nemo&Cuomrpasny ADL Dade/w, R. Hendrix, FF 4 WILMINGTON,DELAWARE 19698 TL Bele4s imi, B x : rovvuENiFRDUTSDEPARTMENT 5G. 8A. HMaepRkuaa,icLkegaSelRan *: LRES nn B3.l LW.l KSatrorwhe,ll,ERPA ; < JA ' PERSONAL AND CONFIDENTIAL IE ON\WORKS May 4, 1981 :: BLOODCOMSMAUMNPILCIANTGIORNESSULTS Works peRressounlntesl.areAsavyaoiulahbalveefrionndicbaltoeodd, seammpplloiynegesofsWhaosuhldingtbeon : informed of the results prompely. of the cOoumtmluinniecdatbieolno:w is the recommended method and content containiSnugpearvciasridonwiwtilhlthepasrsesouulttse.avelopes from Plant Medical capabiliWthyenwhtohewerreseulrtesassairegnegdiveonr rtoelofcemaatleeds forfomchthieldbfelauroiron-g pchaybsoincsianavewsh,o wtihlely wbiellavabielaebnlceourtoagecdonstuolttawliktwhitthhemt.he Iptlanits icnltanicwiiplaltedadvtihsaet tthhiesm waogualidn btehgaitnvWeeddnoesmdoaty.knoTwhethpelasnitgniphfyiscia-nce oRsfeusrutelhtes"bpiwrtiellclihmabirenaarayvpariaolngairbmalaelhaeisxn'pboseseeuvnreerasltasamrocintetdhrsea.lcatHeHaseskwetilolllhuLmaabadovnriasetexoproy-. : CtohmeeaultthawtitLh cthheelyraorwencpohnytseimcpilaant,ingndprecghnaatnctyh,eytahske.y tshheoiurld : - _ physician to contact the Du Pont plant physician. = EtshseenccolamTlmhlneyi,"tpylacnuhtissipnhgCyostmihmceuinaaintctawaticilholendacdocvnoitmsamecustnicscaehtlatiocntagedas3phpayrsegicucailudtea.inosn,in 2 ;! prgnancy be deferred until there is additional information. 1! . EID079480 =i Thaarw'orsd of tingswe'e dingsomethaibonugt 000080 L.=. .. J. H..Todd i la May 4, 1981 : A their `sFuoprermvailseisonawnidllfempaalssesaolfonngont-hcehielndvbeelaopreisngwipotthentthiealb,lood = 8% . tahneaplylsaenstasphyinsicthieanpwasitl,l bweitharrthaengeodffeirf tthheatemcpolnosyueletatdeisoinrewsitiht.TMTM. 5`3% #5n7"eed beJegivuennderrsetlaantdivethatto dtohenatpilnagntblfoeoedl.s thPartevinoousfurctohmemruniacdav-ice i5E clons wich employees have covered this sibject satisfactorily. <I 3 AtBDtIa/cihsment <ENE5R.GYm&olElNiVsIRONMENTAL AFFAIRS 3 MANUFACTURING DIVISION : "S Eo794st | / 000081 EI WASHINGTON WORKS EPC LLAANNTO PH`PYHSM YISCICIIAM ANS''U COMMN UNICI ATIOC N TTOOA CCOOMMMMT UUNNITI Y PPHHYO YSSIICN IAANNSS On March 20, 1981, we were advised by the 3M Company that FC-143, or Ammonium Perfluorooctancate, caused birth defects in the unborn when fed by stomach tubes to female rats in a laboratory experiment. The defects noted were lenticular opacities in fetuses of the exposed animals. 3M is our prime supplier for this chemical. This was a preliminary study designed to determine dosage limits prior to a full-scale study on FC-143's potential to cause birth defects in rats. At this time, we do not know the significance, if any, of the preliminary animal exposure as it may relate to employee exposure. Further studies are planned to define possible reproductive effects. As a precaution, we removed all female employees of childbearing capability from areas where there was a potential - for significant exposure to FC-143. During the period that FC-143 has been used at Washington Works, there has been no known evidence that our employees have been exposed to levels posing an adverse health effect. At exposure levels experienced by our employees, there is no evidence to suggest there is any impairment to the male reproductive functions. 3 ' 8 EIDOT9482 000082 one 2 Some of our employees have asked what advice we have for female employees of childbearing capability who have been exposed to FC-143 about becoming pregnant. Until we have addi- tional information about the effects of FC-143 on the human fetus, we think that under some conditions, it may be prudent for a female employee who has had jobs in which there was significant potential for exposure to FC-143 (those that have just been reassigned) to defer pregnancy. However, there are many factors to be considered in such a decision. We would be glad to discuss each individual case with you if you desire. We believe levels of exposure have been safe, but we want to confirm that. We do know that FC-143 can be detected at low levels in the blood of our employees who have exposure potential to this material, and that these elevated blood levels decrease with time. Since this information may change as test results are obtained, please call me 50 you can obtain the latest information - before you advise patients. mr ~ EID079483 - s 000083 ATnAcwmNT x om ETTTEER BES PID PAYSICAL EXAMINATION EMPLOVER/APPLICAOPNY : EEE : NAME (P.R. #) oss-------------- [ emo [| wa we [| wows] Ararofyouraxamitionwll mtyourrlphysinH you ees. TTTGeena 0Wohry co re ecomentoFdaahketaihmoiornnes., PHYSICAL EXAMINATION REPORT. mFelunorrine (omwetas.u_rAeDdFAaLs 1C-988)1.blood sample had ( ) som organic - ESaFvayoRoiunthzE aevnteFwfRoaEry vFqouueistfOiooSnsseR,eTYp.leLa.seRFOohvaevree, yH Ko.uDr.supB ervisionr mate an em We od10dni o, oo. : 1 2 2: EID079484 000084 EE ATTACRAENT X (Supernate letter to Chemical Waste Management, 6/9/81) BCC: CD.. LK.. HDouonvcearn,, EWZiNlmington P8.LAJ.. PRaelimlelry,, LLeoguavliers RJ.. JHK.. BToudrdg/eGr./C.T.R.RoCsaennplbuenldl RWCINTD. TDaayrlnoerll/T. L. Schrenk PJ.a TF.hiDstoluegthotny In Turn: WL0.RD..BoDawletron HA.LRD.. RSatmosletyenberg JR:IE3.. DHainksieclola 1/h3e0w14 EID079485 000085 E. 1. bu PoNT DE NEMOURS & COMPANY PanKenPs.aOu.RaB,oxW.12V1a7. 2ei01 PoLYMER rROGUCTS OErARTMENT June 9, 1981 Chemical Waste Management 5c/0o4 LOihboertLyiqSuitdreeDtisposal, Inc. Fremont, Ohio 43420 Gentlemen: . The purpose of this letter is to provide toxicity information on one of the ingredients contained in the supernate 1iquid waste which you handle for this plant. The 3M Company, supplier of the surfactant ammonium perfluorooctanoate, also known as FC-143, has advised us that this material has been found to cause defects in the unborn when fed by stomach tubes to female rats in a laboratory experiment. This surfactant is used in the manufacture of fluoropolymer resins and is present at a concentration of approximately 0.1 to 0.3% in the supernate waste which you handle. Much more testing must be conducted to determine the significance of the 3M experiment. As part of the ongoing program to determine the safety of our materials, both Du Pont's Haskell Laboratory and 3M are now planning detailed experiments. Analysis of the organic fluorine content in the blood of Du Pont personnel who fabricate finished products using the dispersions which contain this ingredient show no elevation over typical levels measured in non-exposed employees. Female personnel of childbearing capability who worked in areas where the resins containing the ingredient are manufactured or the ingredient is handled have been reassigned to other work areas. Our product bulletins caution that skin contact should be avoided with dispersion containing the surfactant and the material should be washed off with water if splashed on the skin. Eye protection should be used and if splashed in the eyes should be flushed out with water and medical attention sought to insure that the material has been removed. These precautions are advised in handling the waste. Since the supernate {s loaded and unloaded outdoors, no special ventilation should be required. Dreathing waste vapors when opening the loading hatch, inspecting the liquid level, etc., should be avoided. Theraewo'rsd of thingswe're doing something about 2 EID079486 000086 .. + Lnemcai waste managemenc -e - rs vy vn The Waste Characterization Forms outlining the properties of this waste have been changed to include these cautions and are attached. Please sign and return two copies of this letter where indicated under accepted. If you have any questions concerning this information or need additional information, please call me at 863-4271. | Very truly yours, 4 Huston Environmental Control Consultant Washington Works Accepted: Chemical Waste Management c/o Ohio Liquid Disposal, Inc. 504 Liberty Street Fremont, Ohio 43420 ACH:how Attachment 13014 . > g 8 . EID079487 ~ 000087 Lo. I. mW ASTI COMGIIITION Dts Wesgor Ww otoncinnioyo_ _WaWsOhSinSgTtSonELWorks' APPROVED --e on Cfufpy we-- s or msyy_ Supermate -_-- py 535 C30T B05 TOT gman coo: hCos Nee mr. comestzoy - o--_A. Awiwon ocotmecrsosomas CC.QTToOAEmIMNsCSLAm.B"TcmoexN ecmmmmmI ao[toimomn: psoaosemsteaatvse 1. _=Wa= ter n_gmae 0 # 94.330 0 98.0 290.00 4g 60 Ls _ . " _--_gEmow -_ 10 -- aT os ---- es eee TT = 3. TBACE CRORES YOT LISTID ABOVE (1) GY a. is n_x PcSrTXs5eer @ a;ax___ xk . m e2rT Tursxe oT==2__ Ammonium Bydroxide, Citric Acid, Duporol, C-8 (ammonium perflucrooctancat*e,) 7. esGilasssBmead2s,49SCodi(uummn: som ame ums muss as orze2_ sLoxquumss TEFLONsludgISe TfHEoErAmDaUSitTIsNiGtoiAmnZeAD IF itand CONTAINERS _redispersible. AZZ 075vEDY omnis mss Nf, Touz or nce mas Ae LIQUIDS 4 SLOGES : LIQUID/SOLID ZRASES: CA TEE WASTE 22 76077 yes % FRED LOVING LIQUID LATER, aaszs + Pass or covtanea 20RD Yes (vow 5 --#1 v. comemr (acs GEC 308, 0 307 oe 312 I. zorsizEs (cman > COUSTI(E72F) IGmans S5GAL. 30-GaL. sTIm. TT3ER oats nes (aon (oor. > y comostrz (sD cm) (osm (2_ _or: 2 osaA cagnycoar orSS aAzL,. E PazLs - -- A290. 7. 722 Covmanves_45,000 ras. seears1.0 -- c0wo0o0nm8,(FE)v0) _Ammonia RzicTorE, Toxic_See orem, remarks below > 3 IT. 0.0.7. sEzPernc yavz_-- Process Water (Spent) D.9.T. RAZAZD CLASSIFICATION NotRe 82 us. 50,--_-- gulated4 wo.----rie----m-- = TIT. VOLE (FOR PLANING PURSOSTS ONLY) ATHnISaREQ_U--EST,---------- 1x. aRavoreuegennsootteTedSiopoenncattaattltaacchhheeeaddltcshhheeceostnt.s.iderations = . *Ovsaaleally Sound only Rav. 2/31 +t EID079488 000088 ATTACHIENT TO WCF DUP 10T SUPERNATE - DUP-10T WASTE octanoate,Thaels3o kCnoomwpnanya,s FsCu-p1p4l3i,erhaosf found to cause defects in the unborn athdevisseudrfausctatnhtatamthmiosnimuamtepreiraflluohraos-been when fed by stomach tubes to female rats finluaorolpaobolryamteorryreesxipnesriamnedntf.s 0.3% fn the supernate waste prTehissentsuratfaac.tcaonntceinstruasteidonino`fthaeppmraonxuifmaactteulrye 0o.f1 which you handle. Much more testing must be to ocnognodfincgtepdrotgoradmetteormidneetertmhienesigtnhiefiscaafnectey ooff otuher m3aMteerxipaelrsi,menbto.th DAus Ppoarrtt'sof the HtahsekeolrlganLiacborfaltuoorryineandcon3Mtenatre fnnowtheplbalnonoidngofdeDtuailPeodntexppeerrsoinmneenlts.whoAnfaalbyrsiicsateof eflienviasthieodnproovdeurcttsypiucsailngletvheelsdimsepaesrsuiroendsfwnhincohn-ecxopnotsaeidn tehmipsloyienegsr.edieFnetmalsehow no cpoenrstoaninneilngofthechiilndgbreeadireinntg acraepabmialniutfyactwuhorewdorokredtheinianrgeraesdiwehnetreisthheandrleesdinshave been reassigned to other work areas. wOiftfhwidtihspwOeaurtrsieorpnro{icdfouncsttpaliabnsuihlnelgdetitonnhsethsceauurtfsikaiocnnt.antthEayatendspkritonhteeccomtanitteoarncitaslhsohuosluhdlodubldebebuesaevdwoaisdanheddedif ssopulgahsth.edto ininsthuereeytehsat shthoeulmdatbeerifallushhaesd advised in handling the waste. boeuetnwirtehmovweadt.er Tanhdesemedpirceaclautaitotnesntiaorne ventilatioSnincsehoutlhde bseupreerqnuaitreed1.s ToBardeeadthianngd wuansltoeadevdapoorustdowohresn, onpoenispnegcitahle Toading hatch, inspecting the 11quid level, etc., should be avoided. juhotw) : 8 . EIDO79489 000089 ya ATTACHMENT XT (Letter, A. C. Huston to Carl G. Beard II, June 9, 1981) BCC: D. B. JK.. DReuinlclayn,, LWeiglamlington RJ.. HIo. TWeovdodd/aGu.,'T.LoRuoviseernslund RWoY TJ.C DBuarrgneerl/lC/.T.`RL.. CaSmcphbreelnlk RJ.NF.u Taylor Doughty PI.n TTuhrins:tleton TWD..AD..BoDawletron AH.LRD.. RStaomlsteeynberg RJ.. EJ:. DHiaNnsieclola /1h3e0w3 . EIDO79490 2 : 000090 " E.1. ou Pont oE Newouns 5 Company PamxenP.sa0.nsB,oxW.12V1a7. 26101 POLYMER FROGUCTS DEPARTMENT -- CERTIFIED MAIL RETURN RECEIPT REQUESTED Mr. Carl G. Beard II, Director W. Va. Air Pollution Control Commission 1558 Washington Street, East Charleston, West Virginia 25311 Dear Mr. Beard: This letter is to inform you of toxicity information we have received from our supplier of the surfactant ammonium perfluorooctanoate, also known as FC-143, which is present in small quantities in eight vents from our fluoropolymers processes. The total venting of this material is about 1% pounds per hour. The 3M Company has advised us that this material has been finounad prteolicmaiunsaerydelfaebcotrsationrytheexpuenrbiomrenntw.hen fed by stomach tubes to female rats Much more testing must be conducted to determine the significance of the 3M experiment. As part of the ongoing program to determine the safety of our materials, both Du Pont's Haskell Laboratory and 3M are now planning more detailed experiments. However, we have taken the precaution of reassigning female personnel of childbearing capability to areas outside those in which fluoropolymer resins are manufactured or FC-143 is handled. apparent adverse affects in humans. At this time, we do not know the significance, if any, of the preliminary animal experiment. FC-143 has been in use for decades without If you need any additional information, please let me know. ACH:zhew 13034 (N) Zr Very truly yours, (." C." Huston Environmental Control Washington Works Consultant z . EID075491 2 There's aword of tingswe're doing something about 000091 rl ATTACRHEXNIT (C-8 Letter to David W. Robinson from A. C. Huston, June 9, 1981) BCC: D. K. Duncan, Wilmington B. J. Reilly, Legal R, F. Rocheleau, Louviers J. H. Todd/G. T. Rosenlund R. J. Burger/C. R. Campbell W. T. Darnell/T. L. Schrenk R. N. Taylor JP.. FT.hiDstoluegthotn=y In Turn: W0.. 0K.. DBaoiwteorn A. R. Stolteaberg H. D. Ramsey J. J. DiNicola R. E. Hansel [hw 1306A : ~ EID079492 000092 KF Fp. -. CC: EJPacAk, RJ.egiSocnhraImImT, Regional Adm, rd PJeErNmiItNPrograms Monitoring Unit, E. I. ou PoNT oepoNhEMOUR&S COMPANY P.0. Box 1217 P6htihlaadnedlpWhailan,utPeSntnrseyeltvsania 19106 PanenseuRa. W. Va. 2ei0r CW.. VRao.nalDdiv.Sanodfy,WatSeurpeRrevsiosuorrces PORE PONG CEPMTRNT P63a2r1kerEsnbeurrsgo,n WAVvenu2e6101 : RETURCNERTRIEFCIEEIDPTWARIELQUE-STED June 9, 1981 DW.aviVda.W.DivRiosbiionnsono,f CWhaiteefr Resources C1h20a1rleGsrteoenn.briWeVr 2S5t3r1e1et Dear Sir: from our Tshuipsplileertteorf tishetosurifnafcotrantyouamoofnituomxicpietryfluionrfooorcmtaatniooantew,e ahlasvoe krneocweniveads cFCo-n1c4e3n,tratwihoinch ofisabopurtese0n.t1 mign/L.our Thoeutf3allCom0p0a5ny (hpaesrmiatdvi(sWeVd000u1s27t9h)at inthisa mtautbeersiatlo hfaesmalbeeenratfsounidn tao pcraeulsiemidneafreyctlsabfonrattohrey uenxbpoerrnimwehnetn. feDdu bPyonsttomusaecsh FC-143 in the manufacture of fluoropolymer resins. the 3M exMpuecrhimneonrte. teAsstipnagrtmuosft tbhee coonngdouicntgedprtoogrdaemtetromidneetertmheinesitghneifiscaafnectey ooff doeutraimlaetderieaxlpse,ribmoetnhts.Du PHoonwte'vserH,aswkeellhaLvaebotraakteonrythaend pr3Hecaaurteionnowofplarnenaisnsgignmionrge ffelnuaolreopopleyrmseornnerlesionfs acrheilmdabneuafraicntgurceadpaobrilFiCt-y143toisarheaansdleodu.tside those in which preliminarAyt tanhiimsaltiemxep,eriwmeentd.o noFtC-1k4n3owhasthebeesnigniinfiucsaencef,or idfecaadney,s woifthotuhte apparent adverse affects in humans. If you need additional information, please let me know. Very truly yours, AC1H30:6h4ow AE.nvi.ronHmuesnttoanl Control Consultant Vashington Works 2 There's a world of things we're doing something about EID079493 8 000093 Ue - ATTACHMENT XIII cor plane seat rManufeactuiringnSupts Terie ports Power & Services Supt aug 4, 1580 . wo Dw5Tk4.: EGoann HTEL aSemyen LoLiine mov: . 3. suc TJousgto--Tn fotlovingTnsecheastettaecrhed meso i co be comunicated to your smplerees on the ALL supervision after 8:00 bt = August & . AL) Emplogees ater 11:00 AX ~ August 5 Fluoropolyomcmheesr aDivispieornesicaiaryacheasveaetshpeloypieoensd.uhsoespfioireaserlPyrovgoernk:ed tihnere appropriate, please commnicate with those employees on the same schedule. e mSuint/ase br . EID079494 l 000094 July 31, 1981 70: FLUOROPOLYMERS PRODUCTION, TECHNICAL AND MECHANICAL SUPERVISION OM: 2. J. BmER -8 Room wuisleld to coAsmmufnoilclaotweuptotoempprleovyieoeuss.coAmsmunaidcdaittiioonnsa,l inform you. , tihnifsormiantfioornmgtisionavaisilatboleb,e ve Blood Sempling vo-luntary.The blood sampling progres for C-8 has been expanded. The program is : dPaursrosidiuagcgnteidnoonrt,moalMthaeiphnytFselinucaoanrlcosep.olaynnderTsechDniivcisailonpse,rsowninlell,beinsacmlpuldeidngansnuupaelrlvyision E # NDaiendvwisdpiueorrnimsnangewnittlhlePbrfeiordsustcatmqpiuloaenrdtweaargs,esorsooelnclonadsemppqluraoarycteteiercs,alinanudptohneateFnl1tu2eormrioonpngotlhyt,mheertshleonb anoually during physicals. owimlelnbehorehsaavueplleedftinTEfFoLurONmonotrhwshoawnderseonsuasmlpllyeddiurniAngprpihlyssincdaMlsa.y, 1981, Oemtphleoryeseesl,ecwtieldlibnedivsiedmupallesd wahnonuahlalvye.lefe TEFLON, including some former available,C-8 blood results will be provided to individuals ss results are time. A Tbheutsterfarc,ompvaerihsaovne sweielnl nboe opbovsisoiubsletvrietahd othfeC-a8bovleeveslasmpliinnbglopordogrvaimt.h ' 1 . EID079495 ] 000095 F`LTUEOCRHONPIOCLAYLMEARNSD PMERCOHDAUNCITCIAOLN', SUPY -2- Ju 31, 1981 Toxicity Studies Being condAudcdtietdionaatlHeassbkreyloltLoaxbiocratteostriinegs, (tihnecl3udinCgompiannhyaldaattieonwasstudbiaesse,d oinsly on .- ingestion of C-8 by the test animals). -8 Replacement and test AraeplaagcreemsesnitvemaptreorgiraalmsisfourndCe-8r.vayTbhyisReisnecalrucdhesantdoxTieccihtnyicsatluditoesdeavtelop Haskell Laboratories. Aix Monitoring personal aTnhde aaivresmosnaimtploersinwgilplrobgerecaolilnecFtleudoraotpoliynmcerresaseids bferienqgueencxipeasn.ded.TheBoth ptheersoanraela ssaammpplleess wwiillll ddeetteerrmmiinnee tahveeraegxeposCu-recolnecveenltroaftivoan:siouisn vjaobriotuosurs, while locations. Station, hTahse bsepeencifsiect uGpC itnesttheforTEFCL-8ONinLaabi.r, dTehviselowpieldl patrovtihdeeEmxopreerimaecnctuarlate and timely results. n2/1a1kbr . . EIDO79496 8 ! 000096 LE ATTACHMENT XV. Ape 6, 1561 PERSONAL CONFIDENTIAL WA BOER FROG: Y. L. POWER, H.D. eaployes woTrhkeinfgollfoawiTnEgFLiOsVDwhwahto Texbparseiscsaedllay ddiessciursesetdo wuintdhergeoach& ftuebmaalle gation: 1. 1TaisntraongSloyviatdivoinseidn athpeaaretihactulatro aurnedaerogfo achetuPblalantligiaatmiootn Jmuesditcatollmyain- Suseifiiaie. 2. %"TnhoseyatwiwoentraheielwnyoowntieitfnhiwoehduotcvotenhrcieenkrincniognngsciaCd-re8erifnungldltyubbeaalbliouetvLeigtachtheiaotcnontvsheeerqyyuevnesrcheeosrrteloayfctatihfnitgser rEoicdeedrurvee.s"y caTreufrgueldlytwhheaatnottheytovmearkeecaonnsyidrearsihngd.ecieions snd to con 3. Ihfavtihnegy1icnsdoinset.ed upon tubal ligation, we couldn't prevent them from 4. PSreovceerdaluroefdtohnee waonmyewnayst-amtoesdtthsattatetdheythvaetrethceoynshiaddernoingdehsaivciengtothhaivse Siditional children. 5. I 41d not discuss or mention disability benefits. TLPimah . i . EID079497 000097