Document g2pgNEm0B4Go4ejgb7VGbgoNa

FILE NAME: Westinghouse (WH) DATE: 0000 DOC#: WH113 DOCUMENT DESCRIPTION: Conference Proceedings - National Safety Congress - The Control of Fumes in Shipyards /\ . ' 4 lia d JU T IO M A l SA FETY C H O K ESC N a tio n a l S a ty C o u n c il. In c . to H o A W a d w W h , C kicao I Cofft& a. 1W3. Bottonai W * r Coundl * Mated Is M JL A Foreword i Tialo[!Ed T n aftirm F.ip o n tian i of the S2tad National of the Naftkuml Safety Safety tubed m two vohanea. V o t e I contain. the jeet and Industrial Section aeanons. Vohane II Public Safety. Child Edocation, Home Safety and Safety session*. Farm Vohune I is distributed to aS members of the Council Volume II is sent to those members who arc believed to be interested chiefly in the sessions it contains. The Transactions are a record of the proceedings of the Congress, condensed and edited for i d i n m purpose*. They are therefore an abridged version of the papers and discussions. The original manuscripts, some of which have drawings and charts too expensive to reproduce here, are available m the files of the National Safety ConndL The National Safety Council, at its Congresses, seeks to eliminate fmn. discussion matters which are : at pertinent to the aims of the Congress, ar which may be contrary to thc Council's policies. How*\ it cannot accept responsibility for all views expressed, ether m the discussions of the Congress itself or in this record of them. Extra copies of Volume I may be obtained by Council members at the following rates: 1 to 10 copies at $2.00each; 11 or more copies at $1.75 each. Extra copies of Volume II are 75 cents each. t h e n a t io n a l sa fe t y c o u n c il . 89 N ot* Wockur M i* CONTI Volumi O dSX O ei ESI National Safety Council, Inc. * Honorary M m htri As^ joatiox or b o * a* i n n . E x e u n t * ' W. H. Camdo* Kotarr V\. Ceicneu. Lew R. Paln a Officer (1942-1943) Cul John Stilwul. President 1. W. Mills , Vice-Prendent (or Ftoancc end T m carar (, T H ixlmith. A sti Vut-P rttU rm l for Fimtmtt m .isst Treasurer. ` 3 . B McCillqcb, Assistant Treasurer Walt S. P aix*. Vicc-Pnadort for Tnifoariil Safety Ltw R. P alml. Vice- President for Transportation >A. V. R oow uxs, Vice-President (or Hone and Farm Seiet) Ji net Let E. S u n , Vice-President (or C o n n i t ) Coancilt K. T. Solenstex, Vice-President (or Kembmhi|> I.im ii J. Sueixsox, Nice-Pretide (or P ttfk Seiet) Da Lewis A. Wilson, V ia-Preadem for Education Kld H. Dia u o u , Executive Vice-President, Menacing Director and Secretary R. L. Foexi.v. Assistant Secretary Oificsn (1M3-1SM) ( .i , John milwcli., President I. \V. Muxaw, V ke-Pm idm t for Finane* and Treasurtr I. |i. HUM1.1 II, Assistant Treasurer B B- Mi Cixloch, Assistant Trcasvcr H axold L. M uru, Vice-Predent for Home and Farm WiLTit >. Pa im , Vice-President lor Industry li t,i l.rj K S kijl. Vice-President (or Local Satrty Organ: eattuns K T. Soeixsox, Vice-President lor Mcmberthip Da T. H. Hlald, Vice-President for Schools and Colleges I n J. Suaaxsox, Vicc-Prceidc (or Traffk i.rw K. pALMta Vic-President (or Transportstion Nid H. Dlasjoax. Executive Vice-Presidcnt R. 1_ Fon.vir, Secretary the e: Membe: Do J W. ( Fo L * i C. A Ni R J* K T. H W W Jo T I ;i F. 1 C IV "dUBUiraiMI BOARD (1943-1944) At Large H .J Cat. H n.iT A. HI A. V. B e a v a Fein*. H im N i Bm b Tra Beck Co. N w Hevea, M Gvikoa Dctowc Regia A Irai Bene ReBway Co, J v i a L a E. S o w . A f r ik a Coart. Qevdaad. Ohio Txcoooas F. S u rra. Oliver Iron Steri Gorp, "* Elliot! Service C t New YoA City. e. UL 10. Co. ( New York ,,... at New York, lac. C H. Watoon. U D n Brookfield Canter W u u a B. Wat, Badie Station KVOC. - Okie. V. A. Z iavB t U. S Determent of Labor. Waabapton. D C. (Ftraenteve* et tbc Conference of Local Safety Orgnrneatflaa) C in a a 11. B u n t K an al Ctjr Safety C a n a l. K w a i Gty, M e C. A. H ic u t Hoary Vogt Maekiae Co, Loakrilk. Ky L E. MatBoatre . M im rio iem Safety Trattai. Boom . M u t B umba. E. Pi u i t . Stodebakor C e p , Saadi Bead. lad. F t a H. R w a A n , N evati Safety Coancil, N evati. K. i H t m G. ScMAoma, Scheinet Bruthrrt Co, Erie. Pa Cam. L Sn it i, Greater Ckvefand Safety Coancil. Cleveland. Ohio ( Representative at tAe Conference of Sectioul VV. F. B e n i, Consolidated Edioon Co. ef Nev York, Ine.. Nr* York City l. C. L l'ACax, Appolachiu E ketnr Power Co, Blaefield, W. Va. IL H. FtK C M t, Repabik Steel Corp., Cleveland. Oh. W. A Haiau. Bethtcbon Steel Co, Bethlehem, Pa. W a t* MacLathuax. Electrical Easpbyen Association, Toronto, Out.. Canada .T. C . R. C. Steattox, A Security Branch. Chicago, IU. C. E. Wooumt. General Motors Corp . Mclroee P ati, IB. vi The lit The y C*M Of I tiram i acoro of te m i ih the inai for Del W arpon Victoey. C ee|T afety < leans be victory .j the An  THE EXECUTIVE Members Dmals B. Aim iw n c , M.D, Metropolitan Life Insurance r o , Nr Yoch-Gty ' J. 1. Bakasm. Cue--hint Engineer, Oucago, IB. IWallace N. Ba u b , Palh--n Scaxlard Car M-- rfifttrint Co, Chicago. IIL Folks Bacxn. Rhinelander Paper Co., Rhinelander, Wu. L J. Burse*, Chicago, Hilwaokec, St. Paal 4 Pacific Railroad. * Chicago, 1IL C W. BaoQL i>T, Hinsdale, DL A. J. R. C irri, Portland Ccmrm Association, Q u a | >, 1U. S 'o H Dm o t x , Nation*: Safety Council, Inc, Chicago, III. R. EL Lukovan. Standard Oil Co. of California, San Francisco. Calif. Jam ' L. F tt'ia , American Red Croat, Washington. I). C. jr u s H. Hatty, National Conaeratim 3orcaa. New York City. T. L vu Hazlbtt, M D , Wcstingboasc Electric & Manufacturing Co, Eaat Pittsburgh. Pa. H. T. Heals, Ph.D, Illinois InMitetc of Terhnulog}, '/hirago, 111. W. A Jam s, Chase Braaa 4 Copper 0>. Inc, Waicrbery, Conn. W. Draa K u n a , Lumbermens Mutual Casualty O , Oucago. 111 Johx L Lone, The Delaware 4 Hadvn Railroad Corp, Albany. I N. Y. J. WlUAit) Lota. Atlantic Refining Co, Philadelphia. Pa. Taos. H. U acDokalp, Public Reeds Administrat* n. Washington. - D. C L W. M am as. Industrial G kntt Co. Danville, 111. Haboib L U n a , EL I. do Pont 4c Nemours 4 t o , Wilmingrou. Del. Josn J. Naso, Office of Secretary of Sute. Springfield, III. E uoi Nias, Federal Security Agency, Washington. D. C. WAt era 5. Paikk. Aetna Lvife 4 Affiliated C f" Conn C E P tm anxr. American Hut' H ats " . . ' . . . . Marin* Stction 4411 iiu n after Lading to quickly Sip sea* oat regard I would like to say that the inter* from between hi leg. The aboard ead est aad support of our management has of the line passes throagh a block then been excellent over a cleat. Several taraa of tbe liac Safety aboard a lake freighter is a. are always taken arooad tbe cleat broad subject bat possibly you are now On the cad of each h iiia g boom a aware of some of the problems with which lifc'ht has beea installed, tbe rays of which we are confronted each operadeg season. are directed downward aad brightly Q W ith lake freighters performing such lummatn tbe surface oa which the deck an im portant role m the transportation hands hs^fe to k n d Since putting these system of both the United States and rules 1 effect is 193d, the most serious Canada, it is imperative that the present aspccraidineendt arnekploe.rted to date has beea a amvaonidpaobwleerpesrhsoorntaagl einjiusrineos.t aTghgirsacvhaatelldenbgye M You alt know that the access of safety is being m e t Lake freighters are carrying work depends upon the support received record cargoes of ore aad caul cargoes front company management, aad ia this vital to our war program. TH U RSD A Y AFTERNOON' SESSIO N O ctobey 7,1943 Prrtidimf.- tt. L. H artnett Regional Safety Consultant, U. S. Maritime Philadelphia. Pa. _h-v Th* Control ol Finn-- in Shipyards 1 -*V i W ILLIAM K. LAW SZNCK ; New York Shipbuilding C orp. Csmdso, NT. J . . . . ... : M a* ^ articles have been pnblished on manent iD effect to anyone associated w ith . this -snbgret mehiding au k s of statistics; welding, tacking, burning or heating. ' u bovyuT r T am sure th at every shipyard ia . thin raairtry today has acquired knowledge New Method am ] thr owal>;experience aad information uo- - You may be interested to hear of a de- v . < K l h % ^ i m d on by pioneers ia ship velopmcnt new to us at our plant. I t may 4 weMmg^nutiLh i s assumed that cvcryooc be new to some of you also. I refer to knows th e most satisfactory fume flimina- carbon arc burning ia connection with / d o s j f l l a l of vendlatioo by exhaustion. smoothing off the large countersunk heads y c. 'Extensive experiment daring tbe past of tap bolts in arm or plate decks. These .1 decade^ritk different types of equipment heads were formerly chipped and ground proved th a t die surest method was to re- off flush with the deck plates. This was a A a e v r id e trao ile s t h i source. Blowers long, tiresome, rough and costly job. By a . i exhautm g devices were developed ac* the use of the ca Son arc, they are burned t cpoirradtiosr^sfekvtwtedithwsitahtismfaectatol rfyumreesufillttse.rsRweisll oinffg siso nthecaetsosanrlyy, ithsums aclul tatimngouthnet otifmgerianndd d givcOmme* protection 'when fume con- labor to a minimum. (5/16* carbon, 400 ccatestiest-are low.. rv,..-- - - . am pc, 7000' F.) .y l*cc*Jmo w ith other ~shipyards and O f course, the fume and dust hasard 4 . hemvyrwdoseries muck es*e is being exer- had to receive special consideration. This c*ed by plant medical staffs in coutine was accomplished by the nsc of a cc re u re-checks and re-examiaatkwu of workers pressed air jet, which blows the slag and p _ exposed *o welding fumes. In so far as we carbon residue into exhauster funnels j kaow.'w e still can booestly state that we located at the ends of two 3* metallic . . have n o t had one case of lasting or per flexible tubes vitta powerful portable ex- 1 I .... . . J?* HI2 :2 nd Sational Safety Congrtu, 1943 haustcrs at the outlet cad* of these u a t tubes. Thia equipment is kidded easily along the deck as required and is kept close to the job at all tinea, even eliminat ing the necessity for the tue of respira tors. Seasonal Haaarda Many other fane* ataat be controlled in shipyards. One of the teatonal haaarda in oar own plant will have to receive at* tenboa before the ade >it of cold weather, which ia just aronad tfet o n e . Men will bnild fa ts in any load of a reccptack ia spite of aafety n o t and t operition. and w ill aae fuel, auch aa charcoal or coke, without topping to realiae the danger in* . vofared and the aecesaky for proper n a t r hboo. The resulting rarbon dkrride aad carbon monoxide gate* are both deadly and create oxygen deficiencies. We recently itsacd a oobes ia coanccboo with thia hazard aad posted'i t coospicuotuly. I t stated that if any fire pots were found on ship contracts, plant pro ; tcctkec men should aoucdsately cobtact t ^safety inspector aad he governed by tus Vrdeoasan aa to the rcmtural of mate. 1 Fhnrao F ra n Vino . . think we ahonld mention the danger `" 'if frnnes from fires in ships on the ways, while andcr constracboa, aad m the water -afte r benching. Many of the fires may vh* trivial bat there is always the possibility 'ofm en being trapped ty smoke aad toxsc -.iames and enable to get oat from below decks. This is when the trained safety -'inspector or a good watch force n an . cornea into the picture. He must qoaddy doe a mask, hook on a fife rope aad go '-'down to make sore everyone is oat. He , m int be followed -a ckncly as possible by Vanother- own with a powerful electric fansp. It any deficiency of oxygen ia saw pected, aa oxygen breathing mask most W m Vcatatabeu must be provided at '-ones; smoke sad fn w s most be exhausted and a fresh aapply of air blown in. Mach coaid be added about the allowable concentration for carbon aad carbon dioxide, bat the point to remember is that carbon ia the number ooe poison kflkr, both la industrial and non-occupational life, following doac apoo aoto codesta aa a cause of death. I t ia true that wher ever there ia anoka yoo may aoapect carboo monoxide. By all meant take no chaarea, Don't wait for a chemist's report on the tam pka of air from suspected areas. Vcntihstal Cooataaf alertncaa on the part of watch force men and aafety aspecters ia an absolute necessity to combot aoch haaarda The edneaboo of the men by their soperviaora and the aec of warning poatcra ia recommended, hot above all, vratilatina by exhaasbon and the introdoebon of a fresh supply at ak - ia-im perative andcr these dangcrooa oandibona. Several nar row escapes from death have been experi enced in liitiliiiilitaig dne to the thoughtleaaneaa of the men and not because of ignorance. They forget to think The use of asdhbon cement, if h con tains toobc s o h a t^ n c h aa carbon tetra- premubons are taken to properly m leguard them ander inch hazardous eoodiboas, A huge shipyard recently expert- r r i co M n flti wnicB wers w w n w to the attention of the plaat health com mittee aad the management. The result was that the sabre .apply was r a distilled aad a sab sb n te safe solvent provided. Urns ctinunabag the fanzard without loss of material. Thia demonstrate* again that carefal planning will assure safety with production.-always aw m niog pair. The oac of water repellent asbestos in sulaboa has recently replaced some types of omtcrial formerly need in ship work. For protectsoo agamet dust or possible asbeatosis from eocb material, it ia rcc- oramended (bat both on ships mod in shops, o r where the material is prepared, it be dampened aad that dast respirators be worn, also that ped al veabbbou be providedt. Periodic medical rramtwaboo of those exposed to soch hazards is also accessary. ' \ blasting aad shot blasting, with ha sOkoaia hazard, can be done safely If provision is made for standard sand bkat^ rooms or cabinets. Special veotUa- -tead e s t i a it her* .pect car- .'o't e m m pics V entilate I of watch -;r il an a haaarda sx soperpoeter is reatifaition ction of s Jve under Temi u r* ca ciperi - thoaghtjc c u ic of . if it eoo* non tetra* -cavalca* e rif alo*' <m eoaffa Jy experi* re b m g b t alth eoa* The* m a h . re-dklted nmd, thss jt loss e f doto in* - TP* .hip work, -r poM&fe ir m ree* > S a i io reputd H respiratori . ha' .m tuirioa rds U ab .dag, with Je safely fard aaad -al vcata- Morin* Stetion 403 boa mast be provided, with frcqneat in spections of all oqaipcaant h r an experi enced mfety inspector or supervisor. This check-op mast sever he neglected. Regalar periodic ram in a dona, saciadis f X -raya ars m ssikinry. The less* anspirica of s leaking face piece can he easily detectad hy the operator aa sbo ati be reported at ooca to tha a l ^ r begins la cat a s f , ha will realize at one* d a t Ms sqaipmaaC is not sak . P eana sad dast front friction w a s ia t shops arecaa y rtm oveii hy proper ea* - haoet vsadkdoa sad shoald be a rria d hy -iacts from tke mschiae to dast collectors oat of the shops if, poea&k- Plstiag roani fumea, witfa esoder vea- tSatsag systcnss aow svtilshlr, ars ao fooger s probi-'m in aay ap to date slpyard. A few years ago, bowever, a differeat story epold be told. y ' ia p siafag s|i ititiretirras lava pcoridtd far tin aae flaw s s t the posa of origin cad general veo-t*d-- sti-oa--to--sapply fresh sir to w o - -- rm * ipM iit Lacqocr spraytag, if dons ia approved booth, properly veadkm d, presents ao gr eater problem. When cleaning cam* poaads are besag aaed/chem kal cartridge will give protection if con* are low. The ate of OB dif* icrcat type fires m ast he considered, Fames from tin issa of the wrong ones a n y cu n e tha death of erijr by foe th benefit of firemea, watch farce men, and aaiety k sp ortnea, The ose of astrae- rive posteri s a i beffarne is alea a dvissiL Pmalgatioa of refrigeratoe epscsa in ahjpc pnctkaO y ready far delivery is ha- Precaotioos m ast be tiken to mfegoard m eri wboo doty k k to o pta sad veatOsm inch spacci after faatiga* tio a ^ They mast^ wasr ^aB-wrvfcn^ g ai >- .V , , . > ^ * " tioa eqaipeseat aad, H a o M xn ctrM \ >ia saspscted. aa oatygea brcathiag , ! along with a h . -r W hen working la large shops where large platan are sprayed, after titty a r a p k e e d m racha front the ptrklhsg :tanks, the a te af air f in riapfci l ora is rsrnm m m lsf. ss thess sress sre too huge for eficieat e r beast veadktioa. How ever. craac opera tors hsndlmg material ia sack locations, eepertslfy above padding tanks, shoald be providsd with respireton . Fan* may be placed is the crane cabs to -blow fames aad vapor away from the Aa k it I ia v sarih tk a of ships A ; n to impress manage- - with the necessity for co-oprath e ' by the engineering department aad drawing r o ts u far the early snttalk - tioM of aa antch of the ahipe permanent ventilatsoa system as possible, especially in engine and fck r rooms. Present coo- traction of naval vessels practically pro* furnished for any -Job hi which dast foams or smoke from : aay aabaeace eootaiaiag k ad is breathed daily, for e x sa p k ; when welding, cutting. or straightening where k metal, coated with paint ooa: ta h u ^ kad~. Spcdal vendbrioa, oamg local exbaast hoods o r tubing kept oot leas than t* front tin job aad drawiag 300 d a discharged where the cootaausnted air will not be breathed, n bibita the ase of temporary ventilabon anits, doe to the inaccessibility of tach n n ^H and the impossibility of bringing hi fresh sir, especially after they are cloned to. The Importance of the avaJkbihty of trained ventikdoo men - m ast be eoa* jidcred. Their services arc vital la the . avoidance of delays ia maintaming eon- 1. ttaaoaa prediction. T he elindaatioo of fames by their alertness to tach hasards v sad iaeeaveak-Kes will help to minimise *;r-. absenteeism sad assire delivery of ahipe two types of vt v of schedule, thas assariag a quicker ' : local exbaast . to*.> .. r,'v ic to ry . - : iS- mH* UH 32nd S a ikm a l S a ftty C ongrus, 1943 We must not forget the importance of program will be of vital interest to those organized first aid crew trained in the who have had no previous shipyard ex u>c of initiator, resusciutort and ap perience. proved methods cf artificial respiration. These crews with portable emergency equipment must be available and ready to act at a moments notice. Before closing 1 want to mention Use ventilation standards as recommended in the U. S. N ary Department--U. S. Mari time Commission. "Safety and Industrial Perhaps one ot the most im portant Health Manual in Contract Shipyards'* a methods of impressing employees, espe recent issue, and the "1021 Answers to cially new ones, *ith the idem of danger Industrial Health and Safety Problems'* front respiratory and other hazards is published this year by O w p u im u l through safety instrnctsoo in orientatioa Hasards, lac. They arc most helpful and - rif-'j classes before they start to work. This is timely -publications and sbonld be avail being done in many industrial plants w'th able to everyone connected with safety marked success. We believe that such a programs in any industry. C ru * Safety LIEU Tr.. CoOMDR. L . F. KENOLE, U J J f. (S et) I , ,v-..-t c;.rAan-esusravfeeytyosfhtohwe sintfhoartmtahteioren iast ahawnedalotnh minatyhebesilmevpelilfeidcaatitonthoesfethreulersuleasrcs;oFthiresyt of material on this serious subject. I t has may be easily understood by all operators; * --V ^tX rheen exhaustively studied and Reported, secondly, in the adequacy of the rules to ^ ' i. A s-you know, standards of safety have cover all modems; third, in the standard!- , y^j^v';_:been set up by the /m e n a s Society of sation of the equipment used; and, fourth, Mechanical Engineers, by the Bureau of in providing weight indicators to supple Yards and Docks of the Navy D epart ment on the part of the operators. X ijv-i:- ment, by the National Safety Council, by the American Standards Association, by the s ta te s in their Industrial Accident Commissions and by the insurance carriers for private concerns. It should be apparent then, that since these extensive standards cover the design cf the structure and the safety of the mechanical equipment and prc.ective devices, cranes may be acquired, It requires jo ^ m e n t to make, the rules fit into one's own crane problems. It is recommended that they be perused thor oughly. so that sets of rules and instruc tions may be made out for each activity with extraneous material eliminated from the instruction books issued to the opera tive personnel. redesigned and overhauled with a maxi- for Dioriplino { - mum of assurance that from the items of design every 'm ono hazard to health and We find it is better to base your dis w fety will be eliminated. cipline on a violation of a rule rather than upon an incident. This establishes in the - - Critidom t i Pruet t Raise minds of the operating personnel a reali - From tb* above sources there may also zation of the significance of a published b e gained a well-rounded set of rules rule o r regulation. Although the violation .covering inspection and te st Not only is of a rule may not result in an accident, the this information available from these continued violation of a published rule will sources, but methods of reporting, check eventually lead to a serious incident After ing and inspection can be set up, so that an incident of serious nature, its effect has i-' .*r.. ' positive assurance may be had that these a disciplinary aspect If the rules arc ade quate, concise, and understandah'e and are i mi k ianni--muUm. . . s sta. Ln.darId* /s- wofifll * bt e. m-----a---i?n---t--a---i-n- ed. \ comolied with bv oersonnrl nn inrwtrn M arine Section 1942-ms Cenarli Ckt C u i E. Hw mm. U in b ft MrTannaw, la c . New York, N. Y. V u r Gammi Ck -W . C G u a m ; Pittsbcrc h S tarifaip Co, O rrriinri. Ohio. A dvistrj Co to (,.Part Grattai Chmrmtn,) P r y Q. P c u u , Waterfront E a p k ^ trf A tM c a in of diwe rPaSac&ificci4* San FnooicaL f**i*T ' Cattai* EarnAtm C H au e* , J a , United States P. ft L Apency. la c . New York, N. Y. Catta:* E. W. F a s i, J t , Socco?*Vacano OQ Gx, la c . New York, N. Y. Jo s B o n n , The A ttaatk lUfimni Co, Philadriphie, Pa. Cattaia Feajtk H . Coe**, The Dataware, Lackawanna ft Westen R. R. Co, Hnbnfcm, N. J. A r a m M. Tone, Goaatftinf E a*. New York, N. Y A n isim* Gmund C U r a n (Errmtdar Caammittrr d d e ilin > > F u in c J. Tatuo. A a o iICewcheat Marine Institele. la c . New York, N Y. arm (M nmhtrtkip) Ca e r r w H . Cu u m a x . The Iof the Pfcet of New York. New York; N. Y. Arxiotomt Gomm i : Steel C o, (Ship Cmutractiu m d R ipa") D i m K a n itu , BctbUbca A. Antrim * firorrA Mariae D ept, The T< ___ u te _ PabSr RAatinu>--T . E. Bvckasa* , York; N. Y. ' Cmurai \, Mammut ! Co D .C . r>--E. P. H n css, U. & Srcrotaoj- Bjuol U . GL W icx. rasa of S h a m New York. N. Y. News --Cattai E u a c n a n ; United Stated P. ft L Apeocy, . V N e w Y n k ,N :;Y . \ vV' . 1 ; AaenaAL L d L W. . U. S. Coast G aud. Washioc- V^f'T * (E ) B . N. r, U. S. Coast Goard, -W ollam F . Jotm, Goif OB Gorp, New York, N. Y. . . . .J . ILuaow , Block Disssaad Steanatp Gorp, Wes* , r+Cmf R tfim'<A.H . S c a a w i, Freeport Salphar Co, Port Solpfcnr, la . D irm i*. Gaif Rrpirn E. P. fecxAM. lfkeiwippi Shipping Co, New Orkane, ' . f l w k c i k d k J k y Ea r s J . Baim i Waterfront Finpio/m Assn, of Soothero Cali- fo rc a ,Leng Beach, CaL *" . Dirrrtrr,Gramt U h u R tpirm A .T . Wooa, Lake Carrier* Association, Oesefaad. Ohio. . M r ^ w a f i e r Rrpiom Jo W. M cG im , Canada S ta a e b p Lines, L td , Montreal, Dirottar. Ohi* Riaat Rapir G. Q. G a f f a , D m o Cocp, Neri Island Piltdairph, Pa. Anitim U Dirottar, Ohi Esser Arpie--J. E. J aocma , McCrady-Rodgers C o, Phtsbargh, , . .. /rtwMf Wm*tomj s Lt orn A. Biastceam; Orici, Shfety .. ; Son, Corps of v SPECIAL SERVICE COMMITTEES far tar Adaasurauat rf ihr A morirmi MtrzkmU Ut i--Rzas Aa- S. la tra , U. S. Nary ( R tl) , U. S Maritane Conwiisticn,,;.". Waskkmtnv D. C i' , ; v ` ; -v - / ` 'H -A-.-tr-r: 3&4 2nd Xational Safety Congress, 1943 ' Chiitritu.ti, Committee on Operations of Listers and Cargo Vessels--Gictai* Locax Ciesa*, Is tmr.-an btm nptiup Co., New York, N. Y. ' ChotrmLJt. Stevedoring Committee-- John W. U cG&ato, Jx, Jot W. McGrath Corp, New York, S . Y. i . Chatrman, Statistics and Contests Committee--ButjamU< H. S c r, The Travelers lo w * ance Co, New York, N. Y. - Chotrman. Poster Committee--John Wucht, American Export ; N .J. . |w Jersey Gty, - Assistant Chairman, Poster Committee--A. T. JoHNSUf, American Export 1 r~~ \ i - New York, N. . . ^Chairman, Publicity ant! Publications Committee--Hait j . Hauhhc, "Mariae Progress," ':-vSU>*w York, N. Y. \ /{^ Chairman, Engineering and Minimum Standards Committee--A. Jf m ye, Marine Ot&CC oi Amne, New York, N. Y. ' > . ' Chairman, Tankers Committee--Jambs E Moss, The Atlaatic f> Philadelphia, Pa. t f . S . Sooty, Y ards Safety Commuter--E. B. Laxdbt, U. S. N ary, Washington, - . . S, . ' \ ; ^ h a irw io n , Maritime Anheiations Committee--F rame C Geeoobv, Waterfront Employers' ' ' -'-^ Association ai San Francisco, San Francisco. (nlA . ,,Special.Maritime Advisir--P sonsum H. L. Scwaxo, Yale University,.School of . in*. New H ares, Ccna. . ' V '_ ^ S^ P S O A L GOVERNMENT COMMITTEES FOR Sa f e t V IN NATIONAL -'^ Ig D E F E N S E , SHIPBUILDING, INSPECTIONS, AND PERSONNEL TRAINING Xaval Committee for Safety m National Defense--Rbak Asmaai. C W. F ishul. Navyr Washington, D. C. . | " i;~Chmrmmn, New S&ip Design and Construction Committee--Rsab Aomdui. H. L. Vicxxav, V. UTS. Nary, Commissioner, U. S. Maritime Commission. Washington, D. C ^i^C hatrm an, Technical Committee, (Design and Accident Prevention Measures)--Jambs L. U. S. Maritime Commission, Washington, D. C - * Ship Inspections Committee and U. S . Government Be . S. Const Gesrd, Washington, D. C --Iaptaiv R. S. . 'Chairman, Committee m Education and Training of Ship Personnel--T eltaa Kjtigmt. W ^i-rslWar Shipping Administration, Washington, D. C. V. .--. O ... - . * ... 'StpSiS-- - '* 2 ? 3 V ^ v * ;Vf -%.. \ ..s Lut? \p. .'orp, Nrw . a Ir.jjrcriey City. Line, Inc, Prof rrv" ne O tfiu M Delphi, Pa. ^u h isg tO B , ; Employer1 ot Engineer* A TION*AL RAIDING W. Fum o, L. V icxrar, s)--Jaspa L. iiTAC R. S. rtrv-K jncM T , Marin* Section 385 Ottica 1943>1944t Gemmi Chairman W. G G a t m , Pittsburgh Steamship Co, Qertiaad, Ohio. Vice-Gammi Chairman Q i t n Kcnimu, Bethlehem Steel Company, Bethlehem, Pa. Advisory Commutai (Pott Gammi Chairman)-- G uu E H im . I k n h It ilclrn m n . la c. New York, N. Y. Brao 0 . Piaciuta, Waterfront Employers' Association ctf the Pacific Coast. San Francisco, Catifansau - G ut. Epwasb C H oucx. J a , United States P. It L Arency, Inc, New York, N. Y. C art. SL W. F a n , J a , S oaatyV aaam Ofl Co, la c. New York, N. Y. Job* S. H tnm a, The Atlantic Refining Co, Philadelphia. Pa. G ut. F u n R Gkan, The Delaware, Lackawanna ft Western R. R. Company, Hoboken, N. J. A xraoa M. Tone, Coasaldag Engineer, 17 Battery Place, New York, N. Y. Attilio* Gammi Chairman (Esternava Commutai Aetivitias in Nam ynk>--Wiu_uu> F. Joints, Geli Oil Corp, Ncw York. N. Y. . r A ttirim i Gammi Chairman (M ns i n 'i h ~E . P. Htarare. U. S. Employees* Compensa* t b C m nw m o, Washington, D. G Assistant Gammi Chairman (Ship Construction ami Rapair) Wa i m t . Lawss-ncx, New York Shipbaildiag Corporati. Camden, New Jersey. J Astuto** Gammi Chairman (Marma Indastrial Relations)--T. E. Buchanan, The Texas Company, New York, N. Y. *' Assistant Gamrol Chairman (Public Relations>--Conxxuos H. O uaghan, Maritime - v ; Assodation oi the P o rted New York, New York, N. Y. v : V Assistant General Chairman, (Posters)--A. R Scgsoce, Freeport Sulphur Company, ' . --v Port Solpfanr, l a .^ ^ y ie a ^ h a in m m (Potters)--Ralph E. H vm ota, Walter Butler Shipbuilders, Inc, Superior, :S ^ \ S ettatm j' IlAnoen U . G. W ta^, American Bureau of Shipping. New York, N. Y .; -v ' Editor, Marim Noam Letter--Core. Hcsct Blacbstoiii, United States P. ft L Agency, :1;v : Inc. San F rancisco, CslHorms. " . -.r. . . A ; A ttistm t Editor, Marine Nona Letter-- . F. Lancs, Bethlehem-Alameda Shipyard, Ahifr -; . meda. California. Admiralty-omd Maritime Counsellor--HAxav Eiknbach, 111 John S t, New York, H. Y. . Chairman, Coastal Ragiona--Vux APMlMAa R. R. W axsche, Commandant..U. S, Coast Guard.. Washington. D. C Affittomi Chairman, Const! Regions--Q rt. (E ) R N . P n a sw , District Coast Gawd Engineer, Third Nasal District, New York, N. Y. Director, Atlantic Region--Tnwooax G n u s, Federal Shipbuilding ft Dry Dock Com7 pany, Kearny, New Jersey. - Assistant Dirottar, Atlantic Region--John M. Tcsas, Newport News Shipbuilding ft / Dry Dock Company. Newport News, Virginia. . Director, Gulf Region -Joseph F. Zocca, Consolidated Steel Crp, Orange, Texas. . Assistant Director. Gulf Region--E. P. Ricbab*, Mississippi Shrppi ig Co., Hibernia Bank ' Bide-, New Orleans, L a y Director, Pacific- Rcgign--J ames E McDonad, Permanente Metals Corpi, Richmond, : California. ' ' Assistant Director. Panic Region--S. T. Smith, Consolidated Steel Corporation, Loe Angeles California. . Director, Great Lakes Region--A. T. W oos Lake Carriers' Association, Cleveland, Ohio. Director, Canadian Region--John W. M cG im n, Canada Steaaihip Lines, L td, Mon* treat. P. Q , Canada. . ,, ' Director, Ohio Riser Region--G. O. G u m s, Draro Corps Pittiburgh, Pa. . , , Assistant Director, Ohio River Region--J. E. Jackman, McGady-Rodgers Company,' Pittsburgh, P a Director. AO Inland IVat enraye Llots A. BlanchAn, Safety ft Accident Prcrentiou . Branch. Corps of Engineers. U. S. At, Washington, D. C ' s 47,V;'". % f / it* * * 7UC*J V Jind Saiional Safety Congress, 1943 r s? SPECIAL SERVICE COMMITTEES , .L- /lisww-rmnU of ike American Scrtent M arvu--HlAA H X , (R u i). Chainna. . S. M a n ti G-- . C t e ^ ^ C ^ i i ^ e on Operations of Um~* a n i Corge V essels-C u * . Im a m Cmmsso, ; c . W. McGoatb, J a , J<*n W . McGrath C e p , C ^ l Z ^ J L Z ' r Cento*, Conmulle-- B ajA M m H. S , T h. T rarek rt W a n 1 ; f C^ ' ^ L mmitU^ lXVa L ******** T*mV* ^ r": fcmktiaf Company, Inc, T ^ H irib . t "M aste ^ p 5 S ^ ^ ^ iS 2 L d ^ e f <N K rY ^ M- Y. ^ H kT JfUt-Chormon, Publicity orni P ublierons CommUie-- JL C Baainw i. S eattk -T aoe S * * * Commue-- A. J .S mit* , Marine Often C ^ J ^ T r 'c J ^ c Z l L ^ J o n ts E. Mom, The Atlantic Refi Company. PM*- *>r-.- .r*-. fc`T * -- *" ' ^ U o e itim e Associations ConnmSt-- ^ n K C ^ M S x n r , Waterfront E-ptoyerV potion M Son1Francato, San Franose^ vatoorasa. . . . ' ' W -y^sprntfU ontim e Aoiso-- T oons* I L L . Sowaa* Yale L n m r w , School of Bn- ^/./oeorin^ New Harcn, C a n ^ ; ____ . a * c** Wbm ^> r^ a S S r C W n i - Y ^ V M r r t u i - u Cw o m w M I a * J. S W . M ` : '^ i f c t y A ff ta n t C o, New York, n . Y. . /WVWBM\IENT COMMITTEES FOR SA FE T * IN NATIONAL INSPECTIONS. AND PERSONNEL TRAINING c S m S Z T i). sT Z S e ^ g f ^ _ ^ ,c JJLim L ', - ' - 'Cliiii*wnn. 5k> Inspecte* ComumtteeonJ U. S. Government D m tm i T# r t S i f r S ! ! : * * - j rTM ~ ,W * ' - A/ mni Cni l oa. Waahmjton, D. G .. ITOT. **--- . . -: .- ~.V:.:. - .. ly* V i;.\--rv*i>'i f -'_-_V -. - . :.: V ''*./ . / _;. .* < i /