Document dnovwGg1vQqJn4vd6XpNa3nye
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 Laboratory Request Number-U2279
A nalytical Laboratory Report
FROM THE
26-Week Capsule Toxicity Study with Perfluorooctanesulfonic Acid Potassium Salt
(T-6295) in Cynomolgus Monkeys
ON THE
Determination of the Presence and Concentration of Perfluorooctanesulfonate (PFOS) in Liver and Serum Samples
Project Identification 3M Medical Department Study: T-6295.7
Covance In-Life Study: #6329-223 Analytical Study: FACT TOX-030 3M Laboratory Request No. U2279
Study Completion Date At signing
Total Number o f Pages 233
3M Environmental Laboratory
Page 1
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
GLP C o m p lia n c e S ta tem en t
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
Study Title:
Analytical Laboratory Report from the 26-Week Capsule Toxicity Study with Perfluorooctanesulfonic Acid Potassium Salt (T-6295) in Cynomolgus Monkeys on the Determination of the Presence and Concentration of Perfluorooctanesulfonate (PFOS) in Liver and Serum Samples
Study Identification Number:
FACT TOX-030, T-6295.7, Covance #6329-223
This study was conducted in compliance with United States Environmental Protection Agency Good Laboratory Practice (GLP) Standards 40 CFR Part 792, with the exceptions in the bulleted list below. All raw data and samples for this study are retained in archives at the 3M Lab and will be retained for a period of at least ten years. The analytical phase completed at the 3M Lab was performed in accordance with 3M ET&SS Standard Operating Procedures.
Exceptions to GLP compliance:
There were two study directors in this study. This study was designed as two separate studies. The in-life phase study was considered to end at the generation and shipment of specimens. The analytical study was considered to start at the receipt of these specimens for analysis. This resulted in having two separate study directors, one for each phase of the same study. However, since the technical performance of each phase was entirely separate, no effect is expected from this exception.
On a few occasions, data were not recorded or corrected exactly as required by the GLPs.
The 3M TOX 030 protocol states in the Regulatory Compliance section that "This study will be conducted in accordance with the United States Environmental Protection Agency Good Laboratory Practices Standards, 40 CFR 792, with the exception that analysis of the test material mixture for concentration, solubility, homogeneity, and stability will not be conducted, and is the responsibility of the Sponsor." Analyses were, however, completed on the concentration and homogeneity of the test material mixture, according to non-GLP validated methods, and are included in this report. As per the protocol, solubility and stability determinations were not conducted.
Study Director
}& i
Date
c'>
Study Sponsor
Date
3M Environmental Laboratory
3M Environmental Laboratory
Page 2
Page 2
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
GLP Stu d y -- Q u a l ity A ssurance Sta tem en t
Study Title:
Analytical Laboratory Report from the 26-Week Capsule Toxicity Study with Perfluorooctanesulfonic Acid Potassium Salt (T-6295) in Cynomolgus Monkeys on the Determination of the Presence and Concentration of Perfluorooctanesulfonate (PFOS) in Liver and Serum Samples
Study Identification Num ber
FACT TOX-030, T-6295.7, Covance #6329-223
The analytical phase of this study has been inspected by the 3M Lab Quality Assurance Unit (QAU) as indicated in the following table. The findings were reported to the study director and management.
In s p e c t io n D a t e s
December 01/98
P hase
Sample receipt
Date Reported to
M anagement
S tu o y D ir e c t o r
1/17/00
1/17/00
March 19,22,23/99
Analysis
3/25/99
3/25/99
October 14/99
May 3,8-12,15-19,22-26,29-31/00, June 1,2,5,7,8/00
June 1,5,7,12-16/00
Extraction Data
Draft report
10/20/99 6/14/00 6/16/00
10/20/99 6/14/00 6/16/00
September 14/00
Draft report
9/14/00
9/14/00
/
/ QAU Representative
C( U
Date
,
3M Environmental Laboratory
3M Environmental Laboratory
Page 3
Page 3
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
S tu d y P ersonnel and C ontributors
Study Director
Andrew M. Seacat, Ph.D. 3M Medical Department 3M Center, Building 220-2E-02 PO Box 33220 St. Paul, MN 55133-3220 (651)575-3161
Sponsor
3M Toxicology Services - Medical Department 3M Center, Building 220-2E-02 St. Paul, MN 55133-3220
John L. Butenhoff, Ph.D., Sponsor Representative
Analytical Chemistry Laboratory
Liver and Serum Analyses 3M Environmental Technology and Safety Services (3M ET&SS) 3M Environmental Laboratory (3M Lab) Fluorine Analytical Chemistry Team (FACT) 2-3E-09 935 Bush Avenue St. Paul, MN 55106
Kristen J. Hansen, Ph.D., Principal Analytical Investigator
Contributing Personnel
David R. Bamidge Lisa A. Clemen Kelly J. Dorweiler Mark E. Ellefson Sara E. Estes Barb A. Gramenz Sarah A. Heimdal Cari S. Hewitt Marlene M. Heying
Harold O. Johnson Kelly J. Kuehlwein Sally A. Linda Michael D. Livingston Joseph C. Pilon Scott R. Post Ian A. Smith Anh-Dao Vo Bob W. Wynne
In-life Testing Laboratory
Covance Laboratories, Inc. 3301 Kinsman Boulevard Madison, W l 53704-2595
Peter J. Thomford, Ph.D., In-Life Phase Study Director
3M Environmental Laboratory
3M Environmental Laboratory
Page 4
Page 4
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Table of Contents
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
GLP Compliance Statem ent........................................................................................................................... 2 GLP Study-- Quality Assurance Statement................................................................................................... 3 Study Personnel and Contributors.................................................................................................................. 4 Introduction and Purpose................................................................................................................................ 6
Test System ..............................................................................................................................................6 Specimen Collection and Analysis.......................................................................................................... 7 Specimen R eceipt............................................................................................................................................7 Dose Confirmation Analyses................................................................................................................... 8 Materials and M ethods.................................................................................................................................... 8 Chemical Characterization...................................................................................................................... 8 Method Summaries..................................................................................................................................8 Analytical Equipment................................................................................................................................9 Deviations............................................................................................................................................... 10 Data Quality Objectives and Data Integrity.................................................................................................. 10 Data Summary, Analyses, and Results........................................................................................................ 1 1 Summary of Quality Control Analyses Results....................................................................................11 Summary of Sample R esults................................................................................................................ 12 Statistical Methods and Calculations............................................................................................................ 12 Statement of Conclusion................................................................................................................................12 List of Attachm ents.........................................................................................................................................12 Attachment A: Control Matrix Characterization and Dose Confirmation Analyses...................................13 Attachment B: Protocol and Deviation Summary.........................................................................................15 Attachment C: Extraction and Analytical Methods...................................................................................... 43 Attachment D: Data Summary Tables........................................................................................................ 179 Attachment E: Data Spreadsheets............................................................................................................. 188 Attachment F: Example Calculations..........................................................................................................225 Attachment G: Interim Certificate of Analyses.......................................................................................... 226 Attachment H: Report Signature Page.......................................................................................................233
3M Environmental Laboratory
3M Environmental Laboratory
Page 5
Page 5
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
Introduction and Purpose
CsFi7------- S------- O
O
Perfluorooctanesulfonate (PFOS)
CAS Number 2759-39-3
Chemical Formula: CaF,7S03
Molecular Weight: 498.98
The purpose of the analytical phase of this study is to determine the presence and concentration of PFOS (CbF17S 0 3') in liver and serum specimens collected during the study of Cynomolgus monkeys orally dosed with perfluorooctane sulfonic acid potassium salt (T-6295).
Test System
The test system species and strain selected was the Cynomolgus monkey from Covance Research Products, Inc., identified using a collar tag. At the initiation of treatment, the Cynomolgus monkeys were young adult to adult, and weighed approximately 3-5 kg.
Twenty-two male and 22 female Cynomolgus monkeys were used as the test system in the present study. Four groups of test animals were established according to dosage levels. Group 1 consisted of control Cynomolgus monkeys that did not receive the test substance, but received the equivalent amount o f lactose in gelatin capsules as that administered to the Group 4 animals. Groups 2, 3, and 4 were administered daily with 0.03 (low dose), 0.15 (mid dose), and 0.75 (high dose) mg respectively, of T-6295 per kg of body weight/day (mg/kg/day) triturated with lactose in gelatin capsules (see Table 1 for Dosage and Group Characteristics).
Table 1. Dosage and Group Characteristics of Test System in Study T-6295.7
STUDY GROUP
Number of A nimals
Total
Dosage Level Dosage Ratio
(mg/kg/day)
(w:w)a
Total: Test System Group 1 (Control) Group 2 (Low Dose) Group 3 (Mid Dose) Group 4 (High Dose)
22 males 22 females
6 males 6 females
4 males 4 females
6 males 6 females
6 males 6 females
44* -- 12 0 8 0.03 12 0.15 12 0.75
--
-- 1:499 1:39 1:39
a Test substance triturated with lactose * 48 animals were included in the baseline sera collection, but 44 animals were assigned for treatment
3M Environmental Laboratory
3M Environmental Laboratory
Page 6
Page 6
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
All treatment groups were dosed for a minimum period of 26 weeks. Sera specimens were collected from all test animals at various time points during the in-life phase of the 26-week study and sent to the 3M Lab for analysis (see Attachment D, Tables D-1a, D-1b).
Four animals each from Groups 1,3, and 4 were designated as recovery group animals. Treatment was discontinued and the animals were monitored for elimination of compounds for one year post treatment. The recovery groups were observed after the cessation of treatment until February 25, 2000 (Week 79) for Group 1 and Group 4 recovery animals, and until March 7, 2000 (Week 80) for Group 3 recovery animals.
Specimen Collection and Analysis
In the analytical phase reported here, liver and sera specimens collected from all test animals were sent to the 3M Lab and analyzed for the presence of PFOS (some samples were analyzed to determine the presence of EtFOSE, PFOSA, POAA, PFOSEA, M556, PFOSAA, and the monoester; however, these data were collected for informational purposes only, and are not reported). Specimens other than serum and liver tissues were collected and received from Covance Laboratories (6329-223), but were not part of the current scope of analysis determined by the study director and sponsor. Additional analyses of feces are being completed and will be issued as an amendment to this final report.
Blood specimens were centrifuged within one hour of collection. The serum was then harvested and stored in a freezer set to maintain specimens at -60 to -80C until shipped to the 3M Lab. Liver specimens collected from each animal were flash frozen in liquid nitrogen and then stored in a freezer set to maintain specimens at -60 to -80C until shipped to the 3M Lab. Liver and sera specimens were shipped to the 3M Lab frozen and on dry ice. Liver specimens from Group 3 (3/01/00) and Group 4 (9/22/99) recovery animals were collected via biopsy.
Sera and liver samples were extracted using an ion-pairing reagent and methyl-tert-butyl ether (MtBE). Liver samples were homogenized prior to the extraction procedure. Sample extracts were analyzed using high-pressure liquid chromatography-electrospray/tandem mass spectrometry (HPLCES/MS/MS) in the multiple response mode. PFOS levels were quantitated by external standard calibration. Analytical details are included in this report.
Specimens Collected from Study Groups 1 through 4 (through 2/25/99): Serum Specimens-- 550 specimens: 9-14 specimens/animal Liver Specimens-- 30 specimens
Specimens Collected from the Recovery Group from 2/27/99 to 3/07/00: Serum Specimens-- 224 specimens: 18-20 specimens/animal Liver Specimens-- 12 specimens from Group 3 and Group 4 animals (8 via biopsy)
S pecim en Receipt
Specimens were received from Covance Laboratories periodically, during the in-life phase of this study, from August 1998 through March 2000. Specimens received were frozen and on dry ice. Specimens were logged in with the 3M Lab and transferred to freezers for storage at either -55C 1Q-20C or -20C 10C.
Control matrices used in liver and sera analyses performed during TOX-030 were obtained from commercial sources and are presented in Attachment A (see Table A-1). Samples analyzed at the 3M Lab will be maintained for a period of 10 years and will be stored at the laboratory at -20C 10C.
3M Environmental Laboratory
3M Environmental Laboratory
Page 7
Page 7
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-112279
Dose Confirmation Analyses
Dose confirmation analyses were performed on lactose dose samples (1:39 and 1 499) collected on 8/11/98 during the in-life phase of the study: the results are presented in Attachment A (see Table A-2, A-3). The dose confirmation data were collected according to a method that was not fully validated.
Dose confirmation was performed by diluting the lactose dose samples (1:39 - 1,000x and 1:499 1,000x) with Miili-Q water, then extracted using the ion-pair procedure, diluted 1:50 and 1:5 respectively into the linear range of the instrument. For each sample (top, middle, bottom), a matrix spike was prepared (approximately 5000 pg/g and 400 pg/g) by spiking the dose solution and then diluting and extracting as described above. In all cases, samples were analyzed versus an unextracted curve using HPLC-ES/MS/MS. The instrumental parameters and analytical conditions described in ETS-8-5.1 were used for dose solution analyses. The average dose level measured was confirmed to be 99 27% of the target concentration. Matrix spikes were recovered at >60%.
Materials and M ethods
Chemical Characterization
Table 2 presents information regarding characterization of the test substance used in the in-life phase of this study, and the analytical reference substance used in the analytical phase of this study.
Table 2. Characterization of Test and Analytical Reference Substances in Study FACT TOX-030
C h e m ic a l N a m e Source Ex p ir a t io n D ate
S t o r a g e CoNomoNs
C h e m ic a l L o t N u m b e r P h y s ic a l D e s c r ip t io n P u r it y
T est Substance
K P F O S Potassium Perfluorooctanesuiforiate 3M Specialty Chemicals Div.
8/31/2001
Frozen <-10` C
217 FC-95, White crystalline
powder 86.9%
A nalytical Reference S ubstances
K P F O S Potassium Perfluorooctanesulfonate
3M Specialty Chemicals Div.
T H P FO S 1H.1H.2H.2Hperfluorooctanesulfonic add
ICN Biomedics, Inc.
8/31/2001
1/01/2020
Frozen <-10"C
Ambient temperature
171
59909
53406
White crystalline powder
Brown powder
Brown waxy solid
86.4%
N/A N/A
Reserve samples of the analytical reference substance will be stored at the 3M Lab for a period of 10 years, as will any reserve samples of test substance returned from the in-life phase of the study.
Method Summaries
Following is a brief description of the latest methods used during the analytical phase of this study by the 3M Lab. Detailed descriptions of the methods used in this analytical phase are located in Attachment C. As the present analytical phase of this study progressed, more advanced methods evolved and earlier methods were used with deviations until amendments to the protocol were written. Changes to the methods included the use of methyl-fert-butyl ether (MtBE) instead of ethyl acetate, curves plotted by linear regression weighted 1/x instead of unweighted curves, a reduction in the size of the analytical column from 100mm to 50mm, gradient changes, and faster HPLC cycle times. A summary of protocol and method deviations is presented in Attachment B (see Table B-1) of this report.
3M Environmental Laboratory
3M Environmental Laboratory
Page 8
Page 8
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
Preparatory Methods:
ETS-8-6.0, "Extraction of Potassium Perfluorooctanesulfonate or other Fluorochemical Compounds from Liver for Analysis using HPLC-Electrospray/Mass Spectrometry"
Liver samples were homogenized in water. An aliquot of each homogenate was spiked with THPFOS and extracted using an ion-pairing extraction procedure. An ion-pairing reagent was added to the sample and the analyte ion pair was partitioned into MtBE. The extract was transferred to a centrifuge tube and put onto a nitrogen evaporator until dry. Each extract was reconstituted in 1.0 mL of methanol and passed through a 0.2 pm nylon filter, using a 3 cm3 disposable plastic syringe into glass autosampler vials.
ETS-8-4.1, "Extraction of Potassium Perfluorooctanesulfonate or Other Fluorochemical Compounds from Serum for Analysis Using HPLC-Electrospray/Mass Spectrometry"
Sera samples were spiked with THPFOS and extracted using an ion-pairing extraction procedure. An ion-pairing reagent was added to the sample and the analyte ion pair was partitioned into MtBE. The MtBE extract was removed and put onto a nitrogen evaporator until dry. Each extract was reconstituted in 1.0 mL of methanol and passed through a 0.2 pm nylon filter, using a 3 cm3 disposable plastic syringe into glass autosampler vials.
Analytical Methods:
ETS-8-7.0, "Analysis of Potassium Perfluorooctanesulfonate or other Fluorochemicals in Liver Extracts Using HPLC-Electrospray/Mass Spectrometry"
ETS-8-5.1, "Analysis of Potassium Perfluorooctanesulfonate or Other Fluorochemical in Serum Extracts Using HPLC-Electrospray/Mass Spectrometry"
The analyses were performed by monitoring one or more product ions selected from a single primary ion characteristic of a particular fluorochemical using HPLC/ES/MS/MS. For example, molecular ion 499, selected as the primary ion for PFOS (CaF1?SOr ) analysis, was fragmented to produce ion 99 (FS 03-). Tne characteristic ion 99 was monitored for quantitative analysis.
Analytical Equipment
The actual analytical equipment settings used in the present analytical phase of this study varied slightly during actual data collection. The following is representative of the settings used during the analytical phase of this study.
Liquid Chromatograph: Hewlett-Packard Series 1100 Liquid Chromatograph system Analytical column: Keystone Betasil" C,e2x50 mm (5 pm) Column temperature: Ambient Mobile phase components:
Component A: 2mM ammonium acetate in water Component B: methanol Flow rate: 300 pUmin Injection volume: 10 pL Solvent Gradient: 10 minutes
3M Environmental Laboratory
3M Environmental Laboratory
Page 9
Page 9
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
Start at 10%B Hold at 10%B for 1.0 minute Increase to 95%B over 4.5 minutes Hold at 95%B for 2.0 minutes Return to 10%B over 0.5 minutes Hold at 10%B for 2.0 minutes
Mass Spectrometer Micromass API/Mass Spectrometer Quattro II" Triple Quadrupole system Software: Mass Lynx" 3.2 Cone Voltage: 60V Collision Gas Energy: 40-60eV Mode: Electrospray Negative Source Block Temperature: 150C 10C Electrode: Z-spray Analysis Type: Multiple Reaction Monitoring (MRM)
Table 3. Negative Ions Monitored in FACT TOX-030
Target Analyte
Primary Ion (amu) Product Ion (amu)
PFOS THPFOS
499.0 j 99.0 427.0 ; 80.0
Deviations
It should be noted that as the analytical phase of this study progressed, method parameters were evaluated to improve analyses. Earlier methods were used with deviations until amendments to the protocol were written. Deviations from the original protocol and methods are documented in the Attachment B (see Table B-1).*
Da ta Q uality O bjectives and Data Integrity
The following data quality objectives (DQOs) were indicated in the protocol for this study:
Linearity: The coefficient of determination (r2) equal to or greater than 0.98 Limits of Quantitation (LOQ): The Method Detection Limit (MDL) for PFOS is 12 ppb for serum
and 15 ppb for liver. The LOQ is equal to the lowest acceptable standard in the calibration curve.
Duplicate/Acceptable Precision: Precision was reproducible to within 30% Spike/Acceptable Recoveries: 70-130%
Confirmatory Methods: Indeterminate samples may be re-analyzed using a confirmatory method If a confirmatory method is used, an amendment to this protocol should be written.
Demonstration of Specificity: Specificity to be demonstrated by chromatographic retention time and mass spectral daughter ion characterization.
3M Environmental Laboratory
3M Environmental Laboratory
Page 10
Page 10
o
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-03 laboratory Request Number-U227
Report No. FACT TOX-030 Laboratory Request Number-U2279
Data Summary, A nalyses, and Results
Data quality objectives for the analytical phase of this study outlined in the 3M Lab protocol for FACT TOX-030 (see Attachment B) were met with the exceptions noted in this report.
Summary of Quality Control Analyses Results
Linearity: The coefficient of determination (r2) of the standard curve was >0.985.
Calibration Standards: Quantitation of the target analytes was based on linear regression analysis (unweighted - prior to 3/5/99, unweighted or 1/x weighted-3/5/99 to 3/19/99, and 1/x weighted-3/19/99 to end of the study) of two extracted matrix curves bracketing each group of samples, except as noted in the deviation summary. High or low points on the curve may have been deactivated to provide a better linear fit over the curve range most appropriate to the data. Low curve points with peak areas less than two times that of the extraction blanks were deactivated to disqualify a data range that may have been significantly affected by background levels of the analyte. Occasionally, a single mid-range curve point that was an obvious outlier was deactivated. Quantitation of each anaiyte was based on the response of one specific product ion using the multiple response-monitoring mode of the instrument (see Attachment C).
Limits of Quantitation (LOQ): The LOQ is equal to the lowest acceptable standard in the calibration curve (defined as a standard within 30% of the theoretical value), and is at least two times the analyte peak area detected in the extraction blanks. This value does not exceed the validated LOQ of the method for data that is accepted (see Attachment D, Table D-6).
Table 4. Determ ination o f PFOS LOQ in TOX-030 Analyses
A n a t o e -M a tr ix
LOQ
PFOS-Sera PFOS-Liver
4 .3 9 -1 5 .2 ng/mL 2 6 .9 -6 0 .1 ng/g
Blanks: All blanks were below the lower limit of quantitation for the compounds of interest. To simplify analyses that were complicated by endogenous levels of fluorochemicals in unexposed monkey sera, rabbit sera was selected as a suitable surrogate matrix.
Duplicate/Acceptable Precision: Precision was determined by analysis of MS/MSD and was reproducible to within 30%.
Matrix Spikes: Matrix spikes and matrix spike duplicates were extracted with each set of samples and analyzed during analytical runs at the 3M Lab. All sera matrix spikes were within 30% of the theoretical concentration. Matrix spikes prepared in liver were compliant within 30%, with the exception of one spike that was prepared with Day-393 samples and had a low recovery. The matrix spike was reextracted and the recovery was within 30% of the theoretical concentration.
Spike/Acceptable Recoveries: Spike recoveries of 30% of expected values were achieved for all matrix spikes prepared in sera. With one exception (noted earlier), matrix spikes prepared in liver were within 30%.
Use of Surrogates: The surrogate (THPFOS) was added to all samples and standards. THPFOS was not used for quantitation, but was used to monitor for gross instrument failure. After 11/04/99, the surrogate response of each analytical run was verified to determine that it did not vary more than 50% from the mean within each analytical run. No problems were observed with these data.
3M Environmental Laboratory
3M Environmental Laboratory
Page 11
Page 11
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2273
Report No. FACT TOX-030 Laboratory Request Number-U2279
Assuming spike recovery studies form a suitable indication of endogenous analyte recovery, data are quantitative to 30%. The validity of this assumption has not been verified by other techniques.
Summary of Sample Results
Samples from Control Animals: Low levels of PFOS were often detected in the sera and liver of the control animals. These levels were significantly lower than those found in the low dose test animals.
Samples from Dosed Animals: In general, PFOS levels found in the sera and liver of the test animals increased with dose group. PFOS levels increased as dosage increased; significant differences between male and female PFOS levels were not observed in sera. However, Group 4 males had notably higher PFOS levels in liver samples than Group 4 females. Detailed sample data is presented in Attachments D and E.
Sta tistic a l M ethods and Calculations
Statistical methods were limited to the calculation of means and standard deviations. See Attachment F for example calculations used to generate the liver and serum sample data in TOX-030.
Sta tem en t of C onclusion
Under the conditions of the present analytical phase of this study, PFOS was detected in the sera and liver samples of Groups 2, 3, and 4 animals. The Control Group 1 animals showed minimal amounts of PFOS. PFOS levels increased as dosage increased; significant differences between male and female PFOS levels were not observed in sera. However, Group 4 (high dose) males had notably higher PFOS levels in liver samples than Group' 4 females. Data quality objectives for the analytical phase of this study outlined in the 3M Lab protocol for FACT TOX-030 (see Attachment B) were met with the exceptions noted in this report.*
List of A ttachm ents
Attachment A: Control Matrix Characterization and Dose Confirmation Analyses Attachment B: Protocol and Deviation Summary Attachment C: Extraction and Analytical Methods Attachment D: Data Summary Tables Attachment E: Data Spreadsheets Attachment F: Example Calculations A ttachm ent G: Interim Certificate of Analyses Attachment H: Report Signature Page
3M Environmental Laboratory
3M Environmental Laboratory
Page 12
Page 12
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
Attachment A C o ntro l M a trix C haracterization and D ose Confirmation A nalyses
Tabla A-1. Characterization of the Control Matrices Used for Liver and Sera Analyses In Study FACT TOX-030
Control Matrix
Source Expiration Date Storage Conditions Chemical Lot # Physical Description
Control Matrix
Source Expiration Date Storage Conditions Chemical Lot # Physical Description N/R-- not recorded
Rabbit S erum
Sigma Chemicals 01/01/2010 Frozen -20*0 118H8418
Rabbit Serum
Rabbit Liver
Coming Hazleton 12/01/1999
Frozen -20C F00007
Rabbit Liver
Ra b bit S erum | M o nkey Serum Monkey Serum
Sigma Chemicals ) Lampire Biological
01/01/2010
N/R
Frozen -20C
Frozen -50C
47H4641
111022515
Sierra Biomedical 01/01/2010 Frozen -20C #LY2N0
Rabbit Serum
Monkey Serum
Monkey Serum
Rabbit Liver
N/R 12/01/1999 Frozen -20"C
N/R
Rabbit Liver
Rabbit Liver
Coming Hazleton 01/01/2010 Frozen -20C F00005
Rabbit Liver
Rabbit Liver
Coming Hazleton 01/01/2010 Frozen -20C F00009
Rabbit Liver
Monkey Serum N/R
01/01/2010 Frozen -20"C
N/R
Monkey Serum
M onkey Liver
Siena Biomedical 01/01/2010 Frozen -50*C N/R
Monkey Liver
3M Environmental Laboratory
3M Environmental Laboratory
Page A-1
Page 13
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
Table A-2. Lactose Dose Verification (PFOS) for Study 6329-223-- 8/21/99
EXPECTED CONC.
(ng/m L)
MEASURED CONC.
(ng/m L)
%REC. FOR
ng/m L
Ex p e c t e d Calc. Co nc.
(MS/S)
M easured Calc. Conc.
(pg/g)
A verage
S td D eviatio n
%Rec. for pg/g
1:39 Dose (25000 p p m PFOS)
Top Middle Bottom
580 500 500
479 650 422
j 83% I 130% I 84%
1:499 Dose (2000 p p m PFOS)
Top Middle Bottom
410 404 400
305 287 272
74% i 71% I 68%
25000
20647
25000
32537
25000 I 21108
24764 6736 27% average / std. deviation=
83% 130% 84% 99% 27%
2000 2000 2000
1490 1425 1361
1425 64.5 5% average / std. deviation=
74% 71% 68% 71% 3%
Actual MS Concentration-Actual background concentration, divided by expected, times 100 (Spiked too low which accounts for the wide differences in recovery)
Table A-3. Lactose Dose Verification (PFOS-- Matrix Spikes) for Study 6329-223-- 8/21/99
Expected
Conc.
(ng/mL)
Actual
Conc.
(ng/mL)
%Rec.
FOR
ng/mL
Calculated Conc. (pg/g)
Expected Co n c . (pg/g)
A ctual Calc. Co nc.
(pg/g)
Average
STD D eviatxdn
1:39 D o s e (25000 p p m PFOS) MS
Top Middle Bottom
604 524 524
507 84% 485 92% 438 83%
21858 24252 21889
10.8 12.5 12.5
1 :499 D o s e (2000 p p m PFOS) MS
Top 606 475 78% 2320 j 9.77
Middle
600
447 75%
2217 i 9.92
Bottom
596
440 74%
2202 ! 10.0
* This value is an outlier and was not used in any calculations
12.1
-82.8 7.82
!
22666 1374 6%
8.30 7.93 8.41 2246 64.5 3%
%Rec. FOR pg/g
A verage
112% -664* 63%
I
87%
85%
80%
84%
83%
3M Environmental Laboratory
3M Environmental Laboratory
Page A-2
Page 14
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Attachment B Protocol and D eviation S ummary
Report No. FACT TOX-030
la b o r a to r y R e q u e s t N um be r-U 2 27 9
Report No. FACT TOX-030 Laboratory Request Number-U2279
Tabla B-1. Deviation Summary for FACT TOX-030
D e v ia t io n
MtBE was used as an extraction solvent instead of ethyl acetate. Pipette was used instead of Oxford dispenser.
Curves plotted by linear regression weighted 1/x rather than by linear regression as specified in the protocol.
A second extracted matrix curve was not used to bracket samples.
Recorded extraction method FACT-M -1.0 rather than FACT-M-1.1. Followed extraction method ETS-8-6.0 rather than FACT-M-1.1. Followed analytical method ETS-8-7.0 rather than FACT-M-2.1. Followed analytical method ETS-8-5.0 rather than FACT-M -4.1. Samples extracted using 0.5 mL rather than 1.0 mL due to insufficient sample. Followed extraction method ETS-8-4.0 rather than FACT-M-3.1. Matrix spikes were not spiked with standard (Used as blanks).
Continuing calibration standards were not spiked with standard due to analyst error.
Samples extracted using <0.5 mL due to insufficient initial sample volume.
Dates of Occurrence
2/5/99, 2/9/99, 5/18/99.6/11/99
10/14/99 2/13/99,3/5(99, 3/1299, 3/1999, 3/2099, 3/2199,3/2399, 3 9 499, 3/25/99, 4 /7 9 9 ,4 /1 1 9 9 , 4/1299, 4/1799, 5/1999, 5/2299, 6 9 9 9 , 6/1499
3/5/99, 3 9 9 9 . 3/1599, 3/16/99, 5/19/99, 5/22/99. 10/2699, 1/21/00,
3/24/00, 4/27/00
6/1199
10/14/99. 10/25/99,1/19/00, 3/22/00 7/2999, 10/2099, 10/2299, 10/26/99,
10/2799, 1/28/00, 3/24/00, 3/2890 3 /0 5 9 9 ,3 9 8 9 9
10/2599
3/0299, 3/0399
11/3/99
11/3/99
2/599, 2 9 9 9 , 3 9 9 9 , 3 9 9 9 , 3/1099, 3/1299, 3/1599, 3/1699, 4/699,4/899,
8/2599, 11/399, 4/21/00
Impact on Study
No negative impact on the study-- MtBE improved the absolute recoveries and shortened extraction time.
No negative impact on the study.
No negative impact on the study-- 1/x weighted curves improved the precision and accuracy of analysis.
No negative impact on the study-- The accuracy of calibration checks analyzed every five to ten samples was monitored to ensure continued accuracy of the analysis. The QC provided by the calibration checks is sufficient and the data quality will not be adversely affected.
No negative impact on the study--N ew method was followed, even though old method was recorded. No negative impact on the study-- New validated method provides improvements in precision and extraction time. No negative impact on the study-- New validated method provides improvements in precision, accuracy and analysis time. No negative impact on the study-- New validated method provides improvements in precision, accuracy and analysis time. No negative impact on the study-- Studies indicate that data quality is not jeopardized using 0.5 mL of sera. No negative impact on the study-- New validated method provides improvements in precision and extraction time. Adequate CX3 was prepared with the sample s e t unspiked samples pose no negative impact on the study. Mid-level curve standards were substituted as Q C for the non spiked calibration check standards; the unspiked calibration standards pose no negative impact to the study. Studies indicate that data accuracy and precision may be affected when sera samples less than 0.5 mL were extracted. Data reported from extraction of samples less than 0.5 mL is noted in the data tables.
3M Environmental Laboratory
3M Environmental Laboratory
Page B-1
Page 15
3m M e d ic a l 3DMeEpnvairrotnmmeenntatl TSechtnuodlogyy:
and Services
T - 6 2PPOO9 5Bo.x7 233331
Report No. FACT TOX-030 1l;aboratory Request Number-U2279
St. Paul. M N 55133-333311
612 778 6442
Protocol #FACT-TOX-030
3M
Study Title
Perfluoroo2c6t-aWneeeSkCuCylfnoaonpmiscuoAllegcuTidsoxMPiocoitntayksseSiyutsumdySawltith(T-6295) in
PROTOCOL
Author
Lisa Clemen
Date:
January 25, 1999
Performing Laboratory
3M Environmental Technology & Safety Services 3M Environmental Laboratory 935 Bush Avenue St. Paul, MN 55106
Laboratory Project Identification
FACT-TOX-030
3M Environmental Laboratory
3M Environmental Laboratory
Page 1 of 9
Page 16
3m Medi ii ccaall Deeppaarrtt mmeenntt Stt uu ddyy:: TT-- 66229955 .. 77
R e p o rt N o. FACT TOX-030 la b o r a to r y R e q u e s t N um be r-U 2 27 9
Protocol #FACT-TOX-030
Study Identification
Perfluoroo2c6t-aWneeeSkuClfoanpiscuAlecTidoxPioctitayssSiutumdySawltith(T-6295) in Cynomolgus Monkeys
Test Material
Perfluorooctane sulfonic acid potassium salt (T-6295)
Sponsor
3M Toxicology Services - Medical Department 3M Center, Building 220-2E-02 St. Paul, MN 55144-1000
Sponsor Representative
Andrew Seacat, Ph.D. 3M Toxicology Services Telephone: 612-575-3161 Facsimile: 612-733-1773
Study Director
Kristen Hansen, Ph.D. 3M Environmental Technology and Safety Services Building 2-3E-09 651-778-6018
Study Location(s) In vivo Testing Facility
Analytical Testing Laboratory
Covance Laboratories, Inc. 3301 Kinsman Boulevard Madison, Wisconsin 53704 3M Environmental Laboratory Building 2-3E-09 935 Bush Avenue St. Paul, MN 55106
Proposed Study Timetable Study Initiation Date Study Completion Date
January 25,1999 January 25, 2000
3M Environmental Laboratory
3M Environmental Laboratory
Page 2 of 9
Page 17
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Protocol #FACT-TOX-030
1. Study
Tcywneonmtyo-lsgiuxswmeoeknkceaypss.ule toxicity study with potassium perfluorooctane sulfonic acid (T-6295) in
2. Purpose
This analytical study is designed to determine levels of potassium perfluorooctanesulfonate (PFOS) in the liver and serum of cynomolgus monkeys. Additional tissues or fluids may be analyzed. The in-life portion of this study was conducted at Covance Laboratories, study #6329223.
3. Regulatory Compliance
This study will be conducted in accordance with the United States Environmental Protection Agency Good Laboratory Practices Standards, 40 CFR 792, with the exception that analysis of the test material mixture for concentration, solubility, homogeneity, and stability will not be conducted, and is the responsibility of the Sponsor.
4. Quality Assurance
The 3M Environmental Laboratory Quality Assurance Unit will review the protocol and audit study conduct, data, and Final report to determine compliance with Good Laboratory Practice Standards and with 3M Environmental Laboratory Standard Operating Procedures.
5. Test Material
5.1 Refer to Covance Laboratory protocol for study #6329-223.
6. Control Matrices
6.1 Identification Monkey liver and serum and/or rabbit liver and serum, traceability numbers will be recorded in the raw data and included in the final report
6.2 Source Covance Research and/or Sigma Chemical 6.3 Physical Description Monkey liver and serum and/or rabbit liver and serum 6.4 Purity and Stability Not applicable 6.5 Storage Conditions Frozen at -20 C 10 C or -55 C 10 C
6.6 Reserve Matrix A portion of the control matrix will be retained in the archives for as long as the quality of the preparation affords evaluation, but not longer than ten years following the effective date of the final test rule (if applicable).
6.7 Disposition Matrices will be retained per GLP regulation. Certain matrices (feces, urine, and blood) may be disposed after QAU verification.
3M Environmental Laboratory
3M Environmental Laboratory
Page 3 of 9
Page 18
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Protocol #FACT-TOX-030
6.8 Safety Precautions Refer to MSDS for chemicals used. Wear appropriate laboratory attire, and follow adequate precautions for handling biological materials and preparing samples for analysis.
7. Reference Material
7.1 Identification Potassium perfluorooctanesulfonate (PFOS), lot #s 171,215, or 217 (equivalent lots)
7.2 Source 3M Specialty Chemicals
7.3 Physical Description White powder
7.4 Purity and Stability Responsibility of the Sponsor
7.5 Storage Conditions Room temperature
7.6 Reserve Material A reserve sample from each batch of PFOS used in this study will be retained as long as the quality of the preparation affords evaluation, but not longer than ten years following the effective date of the final test rule (if applicable).
7 .7 Disposition Unused reference material will be retained for use by the 3M Environmental Laboratory and will be discarded when the quality of preparation no longer affords evaluation.
7.8
lSaaboferattyorPyraetctiareu, taiondnsfolRloewferadtoeqMuaStDe
S for chemicals precautions for
used. Wear appropriate handling biological materials
and
preparing samples for analysis.
8. Test S ystem
Cynomolgus monkeys were used as the test system, and were maintained and dosed as described in Covance protocol #6329-223. Group 1 control animals did not receive the test substance. Groups 2, 3, and 4 received the test substance daily for 26 weeks, at concentrations of 0.02, 0.5, and 2.0 mg/kg/day, respectively. Refer to Covance protocol #6329-223 for tabular presentation of data. Two animals each from Groups 1, 3, and 4 were designated as recovery animals and were allowed at least a 13 week, which may be extended, recovery period after cessation of treatment.
9. Specimen and Sample Receipt
The 3M Environmental Laboratory will receive homogeneity samples for dose analysis and specimens of the following body tissues and fluids from the indicated points in the study. All specimens will be packed on dry ice for shipping.
3M Environmental Laboratory
3M Environmental Laboratory
Page 4 of 9
Page 19
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Protocol nFACT-TOX-030
Body tissue/fluid
Collected
Expected # of specim ens
Serum - all animals
7 days prior to treatment
616 from main
7 days post treatment
study
every two weeks during treatment 24 additional from
and recovery
recovery
Urine and feces - recovery animals Day zero of recovery
24 urine
6, 30, and 90 (with a potential 180) days of recovery
24 feces
Liver - all animals
After termination of the study 44
Total number of test animals: 32 Total number of control animals: 12 Specimens sent to 3M Environmental Laboratories will be received and tracked according to applicable Standard Operating Procedures.
10. Preparatory Methods
10.1 FACT-M-l.O, Extraction of Potassium Perfluorooctanesulfonate or Other Anionic Fluorochemical Surfactant from Liver for Analysis Using HPLC-Electrospray/Mass Spectrometry
10.2 FACT-M-3.1, Extraction of Potassium Perfluorooctanesulfonate or Other Fluorochemical Compounds from Serum or Other Fluid for Analysis Using HPLCElectrospray/Mass Spectrometry
10.3 If preparatory methods other than those listed above are used, an amendment to this protocol will be written. Any deviations from these methods will be documented and included with the study data.
11. Analytical Methods
11.1
FACT-M-2.0, Analysis of Fluorochemicals in Liver Extracts Using HPLCElectrospray/Mass Spectrometry
11.2 FACT-M-4.1, Analysis of Potassium Perfluorooctanesulfonate or Other Fluorochemicals in Serum or Other Fluid Extracts Using HPLC-Electrospray/Mass Spectrometry
11.3 If analytical methods other than those listed above are used, an amendment to this protocol will be written. Any deviations from these methods will be documented and included with the study data.
3M Environmental Laboratory
3M Environmental Laboratory
Page 5 of 9
Page 20
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
Protocol IfFACT-TOX-030
12. D a t a Q u a l it y O b j e c t iv e s
The number of spikes/duplicates, use of surrogates, and information on other data quality indicators are included in the analytical methods. In addition, the following criteria will be met:
12.1 Linearity r2 > 0.98
12.2 Limits of detection / quantitation
12.2.1 Method Detection Limit (MDL) for PFOS a) Serum: I2ppb
b) Liver: 15 ppb
12.2.2 Practical Quantitation Limit (PQL) - Equal to the lowest standard in the calibration curve
12.3 Duplicate acceptable precision < 30% for the method 12.4 Spike acceptable recoveries 10% - 130% 12.5 Use of confirmatory methods Indeterminate samples will be re-analyzed using a
confirmatory method. If a confirmatory method is used, an amendment to this protocol will be written. 12.6 Demonstration of specificity Chromatographic retention time, mass spectral daughter ion characterization.
13. Sub-Contracted Anal ysis
13.1 All analyses as detailed in this protocol will be performed at 3M Environmental Laboratories, Building 2-3E-09, 935 Bush Avenue, St. Paul, MN 55106.
13.2 An amendment to this protocol will be written if analyses are performed at laboratories other than the 3M Environmental Laboratory.
14. Statistical Analysis
Averages and standard deviations will be calculated. The statistical methods that will be used are described below:
14.1 Data transformations and analysis Data will be reported as the concentration (weight/weight or weight/vol) of PFOS or metabolite per tissue or fluid.
14.2
cSotnacteinsttricataiol nasnoavleyrstiismeS,taantidstsictasnudsaerdd
may include regression analysis of deviations calculated for the concentrations
within each dose group. If necessary, simple statistical tests, such as Student's t test,
may be applied to evaluate statistical difference.
3M Environmental Laboratory
3M Environmental Laboratory
Page 6 of 9
Page 21
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Protocol #FACT-TOX-030
15. Report
A report of the results of the study will be prepared by 3M Environmental Laboratory. The report will include, but not be limited to, the following, when applicable:
15.1 Name and address of the facility performing the study
15.2 Dates upon which the study was initiated and completed
15.3
A statement of compliance by the Study Director addressing any exceptions to Good Laboratory Practice Standards
15.4 Objectives and procedures as stated in the approved protocol, including any changes in the original protocol
15.5 The test substance identification by name, chemical abstracts number or code number, strength, purity, and composition or other appropriate characteristics, if provided by the Sponsor
15.6
Stability and the solubility of the test substances under the conditions of administration, if provided by the Sponsor
15.7 A description of the methods used to conduct the test(s)
15.8 A description of the test system
15.9
oAf
description the data
of
any
circumstances
that
may
have
affected
the
quality
or
the
integrity
15.10 The name of the Study Director and the names of other scientists, professionals, and supervisory personnel involved in the study
15.11 A description of the transformations, calculations, or operations performed on the data, a summary and analysis of the analytical chemistry data, and a statement of the conclusions drawn from the analyses
15.12 Statistical methods used to evaluate the data, if applicable
15.13 The signed and dated reports of each of the individual scientists or other professionals involved in the study, if applicable
15.14 The location where raw data and the final report are to be stored
15.15 A statement prepared by the Quality Assurance Unit listing the dates that study inspections and audits were made, and the dates of any findings reported to the Study Director and Management
If it is necessary to make corrections or additions to a final report after it has been accepted, the changes will be made in the form of an amendment issued by the Study Director. The amendment will clearly identify the part of the final report that is being amended, the reasons for the amendment, and will be signed by the Study Director.
3M Environmental Laboratory
3M Environmental Laboratory
Page 7 of 9
Page 22
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Protocol #FACT-TOX-030
16. Location of Ra w Data, Records, and Final Report
Original data, or copies thereof, will be available at 3M Environmental Laboratory to facilitate audits of the study during its progress and before acceptance of the final report. When the final report is completed, all original paper data, including those items listed below, will be retained in the archives of 3M Environmental Laboratory for at least a period of time as specified by regulation, and as established by 3M Environmental Laboratory Standard Operating Procedures.
16.1 The following raw data and records will be retained in the study folder in the study/project archives according to 3M Environmental Laboratory Standard Operating Procedures: 16.1.1 Approved protocol and amendments 16.1.2 Study correspondence 16.1.3 Shipping records 1 6 .1 .4 Raw data
16.1.5 Approved final report (original signed copy) 16.1.6 Electronic copies of data 16.2 The following supporting records will be retained separately from the study folder in the archives according to 3M Environmental Laboratory Standard Operating Procedures: 16.2.1 Training records 16.2.2 Calibration records 16.2.3 Instrument maintenance logs 16.2.4 Standard Operating Procedures, Equipment Procedures, and Methods
17. Specimen Retention
Specimens will be maintained in the laboratory specimen archives for a period of time as specified by regulation or as long as the quality of the preparation affords evaluation, but not longer than ten years following the effective date of the final test rule (if applicable), and as established by 3M Environmental Laboratory Standard Operating Procedures.
18. Protocol Amendments and deviations
Planned changes to the protocol will be in the form of written amendments signed by the Study Director and the Sponsor's Representative. Amendments will be considered as part of the protocol and will be attached to the final protocol. All changes to the protocol will be indicated in the final report. Any other changes will be in the form of written deviations, signed by the Study Director and filed with the raw data.
3M Environmental Laboratory
3M Environms:ntal Laboratory
Page 8 of 9
Page 23
3ra Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Protocol #FACT-TOX-030
19. A ttachments
19.1 Attachment A Preparatory and analytical methods
20. Signatures
T' ff-
Andrew Seacat, Ph.D., Sponsor Representative
Kristen Hansen, Ph.D., 3M Environmental Laboratory Study Director Date
3M Environmental Laboratory
3M Environmental Laboratory
Page 9 of 9
Page 24
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
GLP Study Protocol Amendment
Study Number: pAcT- Tox- ojo CoWrxL ( ,W - 2 2 1
Study Title: 2L Link Ccp.uL Tox r-L U J LI
r \ .i
' S t u c b j b O i f h P FO S. IA C v y ' D I * s i g i l i I M n k ^ I
Study Director: kru UQnJ6h Amendment Date: Oj'iji')
Amendment Number:
This amendment modifies the following portion of the protocol:
SeoliDo 10 frtp w aW ^ Methods And -Sec-linn II 'A'laluylicxl NVeThods
"TA-e.se.
l i i l FACT- t n - l . l Ckn. FACT- fi-A I &5 ike scrum e .x lf& C -'h o n A n t i
k c J m tiU cls. 7 h t
hr<, W n u p a lt d ^ ETS- 8-H.O
And. ETS - 8- 5. b. V\eJC u p d a lti -mel-hodf (ill L . ust or
re-mAmivi^
Serum x^Tfic-Lons And Analyse,
Approved by:
tl [3 T >
Date
3M Environmental Laboratory
Page 25
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
26-Week Capsule Toxicity SStutduydwyitThitPleerfluorooctane Sulfonic Acid Potassium Salt (PFOS, T-6295) in Cynomolgus Monkeys
PROTOCOL AMENDMENT NO. 2
AmAepnrdilm29e,n1t9D99ate:
Performing Laboratory
3M Environmental Technology & Safety Services 3M Environmental Laboratory 935 Bush Avenue St. Paul, MN 55106
Laboratory Project Identification
ET&SS FACT-TOX-030 LIRN U2279
3M Environmental Laboratory
3M Environmental Laboratory
Page 26
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
Protocol FAC T-TO X-030 Amendment 2
This amendment modifies the following portion(s) of the protocol:
1. PROTOCOL READS: In amendment 1, section 10 Preparatory Methods and Section 11 Analytical Methods were updated to ETS-8-4.0 and ETS-8-5.0 as the revised serum extraction and analytical methods.
AMEND TO READ: These methods were revised on 4 /^ /9 9 to ETS-8-4.1 and ETS-8-5.1 which will be used for all future analyses.
wREeiAgShOtiNng:
The methods were for initial curves.
revised
for
clarification
and
to
include
linear
regression,
1/x
Amendment Approval
Andrew Seacat Ph.D., Sponsor Representative
________________________ -----------------------------------------------
Kris J. Hansen Ph.D., Study Director
3M Environmental Laboratory
3M Environmental Laboratory
Date
Page 27
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Study Title
26-Week Capsule Toxicity Study with Perfluorooctane Sulfonic Acid Potassium Salt (PFOS, T-6295) in Cynomolgus Monkeys
PROTOCOL AMENDMENT NO. 3
Amendment Date:
June 03, 1999 3M EnvironPmeernftoarlmTeinchgnLolaobgoyr&atSoarfyety Services
3M Environmental Laboratory 935 Bush Avenue St. Paul, MN 55106
Laboratory Project Identification
ET&SS FACT-TOX-030 LIRN U2279
3M Environmental Laboratory
3M Environmental Laboratory
Page 28
3m Medical Department Study: T-6295.7
R e p o rt N o. FACT TOX-030 la b o r a to r y R e q u e s t N um be r-U 2 27 9
Protocol FA C T-TO X-030 Amendment 3
This amendment modifies the following portion(s) of the protocol:
1. PROTOCOL r e a d s : Section 10 Preparatory Methods and Section 11 Analytical Methods list FACT-M-1.0 and FACT-M-2.0 as the liver extraction and analytical methods. AMEND to read: These methods were revised on 06/03/99 to FACT-M-1.1 and FACT-M-
2.1 which will be used for all future analyses. REASON: The methods were revised for clarification and to expand on the list o f target analytes.
Amendment Approval
Andrew Seacat Ph.D., Sponsor Representative
7
Date
Kris J. Hansen Ph.D., Study Director
3M Environmental Laboratory
3M Environmental Laboratory
Date
Page 29
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Study Title
26-Week Capsule Toxicity Study with Perfluorooctane Sulfonic Acid Potassium Salt (T-6295) in Cynomolgus Monkeys
PROTOCOL AMENDMENT NO. 4
Amendment Date:
April 25, 2000
Performing Laboratory
3M Environmental Technology & Safety Services 3M Environmental Laboratory 935 Bush Avenue St. Paul, MN 55106
Laboratory Project Identification
FACT Tox-030 ET&SS LRN-U2279
3M Environmental Laboratory
3M Environmental Laboratory
Page 30
3m Medical Department Study: T-6295.7
R e p o rt N o. FACT TOX-030
la b o r a to r y R e q u e s t N um be r-U 2 27 9
Protocol LRN-U2279 Amendment Number 4
This amendment modifies the following portion(s) of the protocol:
1. Protocol reads: The sponsor for the present study was identified as Andrew Seacat, Ph.D. Amend to read: The role of sponsor for the present study was reassigned to John L. Butenhoff, Ph.D. as of the date of signature approval of this protocol amendment. Reason: To ensure that the study director does not also carry the duties of study sponsor, the sponsor role was reassigned. In this manner, personnel responsibilities and workload are more evenly balanced.
2. Protocol reads: On page 2 of the protocol, Kris Hansen is identified as the study director for the analytical phase of the study. Peter Thomford is also identified as a study director, but for the in-life phase of the study (see Covance Laboratories Protocol 6329-223).
Amend to read: On page 2 of the protocol, Andrew Seacat will be identified as the study director, Kris Hansen will perform the duties of the principal analytical investigator, and Peter Thomford will be identified in the final report as the principal in-life investigator as of the date of signature approval of this protocol amendment.
Reason: The original study design identified two study directors; one for the in-life phase of the study and one for the analytical phase of the study. The role of study director has been reassigned in an effort to ensure compliance with Good Laboratory Practice Standards that outline study personnel requirements.
3. Protocol reads: 10. Preparatory Methods: 10.1 FACT-M-1.1, "Extraction of Potassium Perfluorooctanesulfonate or Other Fluorochemical Compounds from Liver for Analysis Using HPLCElectrospray/Mass Spectrometry" Amend to read: 10. Preparatory Methods: 10.1 ETS-8-6.0, "Extraction of Potassium Perfluorooctanesulfonate or Other Fluorochemical Compounds from Liver for Analysis Using HPLCElectrospray/Mass Spectrometry" Reason: The method was revised to include extractions of other tissue types and the use of methyl-fe/t-butyl ether (MtBE) instead of ethyl acetate in the extraction process.
4. Protocol reads: 11. Analytical Methods:
3M Environmental Laboratory
3M Environmental Laboratory
Page 31
3m Medical Department Study: T-6295.7
R e p o rt N o. FACT TOX-030
la b o r a to r y R e q u e s t N um be r-U 2 27 9
Protocol LRN-U2279 Amendment Number 4
11.1 FACT-M-2.1, "Analysis of Fluorochemicals in Liver Extracts Using HPLCElectrospray/Mass Spectrometry"
A m end to r ead:
11. Analytical Methods: 11.1 ETS-8-7.0, "Analysis of Potassium Perfluorooctanesulfonate or Other Fluorochemical Compounds in Liver Extracts Using HPLCElectrospray/Mass Spectrometry"
Reason:
The method was revised to include curves plotted by linear regression weighted 1/x and a reduced cycle time from 13.5 minutes to 9.0 minutes.
5. P r o t o c o l r e a d s : 8. Test System Refer to the Covance protocol #6329-223 for tabular presentation of data. Two animals each from Groups 1, 3, and 4 were designated as recovery animals and were allowed at least a 13 week, which may be extended, recovery period after cessation of treatment.
A m en d to r e a d :
8. Test System A tabular presentation of the test system data will be included in the final report for this project (FACT Tox-030). Four animals each (two/gender) from Groups 1, 3, and 4 were designated as recovery animals and were observed for a recovery period after cessation of treatment until study cut-off on March 7, 2000 (Week 80). The observation and analysis of the recovery group III animals beyond the cut-off date of this study will be reported in a new long-term recovery study.
Reason:
Additional animals were assigned to the recovery group following approval of the protocol for FACT Tox-030. A new study will report the long-term recovery of the remaining animals from recovery group III (mid-dose group).
6. P r o to c o l r e a d s :
9. Specimen and Sample Receipt: [Sample Receipt Table] Expected # of Specimens: Serum-all animals: 616 from main study, 24 additional from recovery Urine and feces-recovery animals: 24 urine, 24 feces Liver-all animals: 44 Collected: Urine and feces-recovery animals: Day 0, 6, 30, 90 (potential 180) Total number of test animals: 32
3M Environmental Laboratory
3M Environmental Laboratory
Page 32
o CM
3m Medical Department Study: T-6295.7
Report No. FACT TOX-
laboratory Request Number-U2 Protocol LRN-U2279
Amendment Number 4
A m end to read:
9. Specimen and Sample Receipt: [Sample Receipt Table] # of Specimens: Serum-all animals: 516 from main study, 280 additional specimens from recovery Liver-all animals: 42 (eight specimens via biopsy from recovery group) Total number o f test animals: 32 Total number o f animals: 48 (12 animals in control group) Note: 4 animals were not assigned to a study group. Day 0 serum specimens were collected. Specimens of body tissues and fluids other than serum and liver specimens will be collected and received from Covance Laboratories (6329-223 Study T-6295.7).
Reason:
Additional animals were assigned to the recovery group following approval of the protocol for FACT Tox-030. The recovery period has been extended for the recovery group. Specimen collection figures shown are through the end of the study 3/07/00.
Amendment Approval
John L. Butenhoff, Ph.D., Sponsor Representative
Date
Andrew Seacat, Ph.D., Incoming Study Director
_K h ~ ^2------
Kristen J. Hansen, Ph.D., Outgoing Study Director
Dale L. Bacon, Laboratory Manager
Date
7JJW
rA
Date
3M Environmental Laboratory
3M Environmental Laboratory
Page 33
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
26-Week Capsule Toxicity Study with PerSflutuordoyocTtaitnlee Sulfonic Acid Potassium Salt (T-6295) in Cynomolgus Monkeys
PROTOCOL AMENDMENT NO. 5
AmAeugnudsmt 1e4n, t2D00a0te: 3M EnvironPmeernftoarlmTienchgnLoalobgoyr&atSoarfyety Services' "
3M Environmental Laboratory 935 Bush Avenue St. Paul, MN 55106
LaborEaTto&rSySPFroAjCeTct-TIdOeXn-t0i3fi0cation Covance #6329-223 LIMS #U2279
3M Environmental Laboratory
3M Environmental Laboratory
Page 34
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Protocol TOX-030 Amendment 5
This am endm ent modifies the following portion(s) of the protocol:
1. PROTOCOL R e a d s : 2. P u r p o s e : This analytical study is designed to determine levels of potassium perfluorooctanesulfonate (PFOS) in the liver and serum of cynomolgus monkeys. Additional tissues or fluids may be analyzed. AMEND TO R e a d : Add that select feces samples will be analyzed for PFOS at Centre.
REASON: Feces samples were added after the original protocol was written.
2. PEnrvoitrooncmoelntraleLaadbso:raStotruydy Locations(PAGE 2): Analytical Testing Laboratory:. 3M A m e n d TO r e a d : 3M Environmental Laboratory and Centre Analytical Laboratories Inc. (Centre), 3048 Research Drive, State College, PA 16801 REASON: Analyses o f feces are assigned to Centre, in addition to the analyses o f other tissues at the 3M Environmental Laboratory.
3. P r o t o c o l r e a d s : S e c t io n s 10. P r e p a r a t o r y M e t h o d s , 11. A n a l y t ic a l M e t h o d s a n d 12. D a t a Q u a l it y O b j e c t iv e s
AF lmu oe rnodc hteom irc aela
dR:esiAdudeds
to in
these sections Monkey/Rat
the most Feces by
current version of "Determination of LC/MS/MS," Centre method number
00M-023-003, with ar. LOQ in feces o f 10 ng/g. The method will incorporate an initial
homogenization step immediately after adding the extraction solvent, using a micro-
homogenizer, to allow for complete dispersion of the specimen in the solvent.
REASON:
analytical
T o specify the validated m ethod to be used
lim its. NOTE: LC/MS/MS is an ab b reviation
for
for
feces analyses along w ith its "liquid chrom atography/m ass
spectrom etry/m ass spectrom etry."
4 . Protocol reads: Section 10. Preparatory Methods and 11. 3M Analytical Methods
A m e n d TO READ: Change to specify that the most current version of the methods listed should be used.
mR EeAthSoOdNs
:shToouldspbeeciufysedthdaut ritnhge
most appropriate version the course o f the study.
of
the
preparatory
and
analytical
3M Environmental Laboratory
3M Environmental Laboratory
Page 35
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030
laboratory Request Number-U2279
Protocol TOX-030
Amendment 5
5. PisRtOheTOPCriOnLcipraelaAdnsa:lTythiceaalmInevnedsetdigaptroortofocorlth(Ae menetnirdemsteundty#.4) states that Kris J. Hansen, Ph.D.
ACMenEtNreDfoTrOfreceeasda:nAaldydseEs.naksha Wickremesinhe, Ph.D. as the Principal In-Wcjn^ves^tigator at (4)/7.V/^^. ,
REASON: To specify the PAI at Centre for feces analysis.
6. Protocol reads: Section 16. Location of Raw Data, Records and Final Reports
AEnmveirnodnmTOenrtaelaLda:bAordadtotrhieast,
Centre w together
ill w
forward all ith copies o
original study-specific raw data to f appropriate facility-specific raw
3M data
applicable to this study. Centre will maintain a copy of the applicable study-specific raw
data, protocol and analytical report in the Centre archives, as well as all original facility
records.
REASON: T o sp e c ify th e arch ival req u irem en t for th e p o rtio n o f th e data d e v e lo p e d by C en tre.
7. Protocol reads: Section 17. Specimen retention
Adimreecntodr,
TaOll
fReEcAesDs:peAcidmdentshaotf
after the analytical report this study will be returned
on feces is signed by the study to 3M Environmental Laboratory.
These specimens may then be discarded by written direction of the study director. Specimens
of serum and urine may also be discarded by written direction of the study director after the
analytical report for the 3M Environmental Laboratory analyses is signed by the study
director.
TRoeaspseocnif:y the handling of all biological fluids, and to define when the quality assurance verification is considered complete.
3M Environmental Laboratory
3M Environmental Laboratory
Page 36
3m M<& 4 a DeP ^ ent
1 7410 884 9122
Report No. F A C ^ -0^gg
gWM^SlS^/Ma M O
101S-':3331PM
ECWENTLRAEBm2f-l3lEYT-0I9CAL*
LA
B14
231
laboratory
i
Nu^er-U2279
MO. 338 (7B2
Amendment Approval
5Protocol TQX-030 Amendment
Joh_n_L. ButtnhoSJ PbU./S-p---o---M---,c--r'
ve
I
; .--at
II*'
3MEnwonmantaf Laboratory
3M Environmental Laboratory
!/
Page 37
*1-
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
26-Week Capsule Toxicity Study with PerSflutuodroyocTtaitnlee Sulfonic Acid Potassium Salt (T-6295) in Cynomolgus Monkeys
PROTOCOL AMENDMENT NO. 6
ASmepetenmdbmeren1 1t ,D2 0a0te0 : 3M EnvironPmeernftoarlmTeinchgnLoalobgoyr&atSoarfyety Services
3M Environmental Laboratory 935 Bush Avenue St. Paul, MN 55106
LaborEaTto&rySSPFroAjCeTctTIdOeXn0ti3f0ication Covance #6329-223 LIMS #U2279
3M Environmental Laboratory
3M Environmental Laboratory
Page 38
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Protocol TOX 030 Amendment 6
This am endm ent modifies the following portion(s) of the protocol:
l.
Protocol read
c8o.nceTnEtrSaTtiSonyss toef
s
m0
.::0G2,ro0u.5p,sa2n,d32,.a0nmd g4/kregc/deiavye,drethspeetcetsitvesulyb.stance
daily
for
26
weeks,
at
AGrmoeunpds 2t,o3r, eanadd :4 received the test substance daily for 26 weeks, at concentrations o f 0.03, 0.15, and 0.75 mg/kg/day.
R
T
eesat
ssuobns:tance
doses
were
changed
after
protocol
was
written.
The
Covance
protocol
reflects
the actual doses of test substance that were given.
P rotocol reads:
The amended protocol (Amendment Number 4, section 2.) states: On page 2 of the protocol, Andrew Seacat will be identified as the study director, Kris Hansen will perform the duties of the principal analytical investigator, and Peter Thomford will be identified in the final report as the principal in-life investigator as of the date of signature approval of this protocol amendment. APemteernTdhtoomrfoeraddw: ill remain as the Covance Study Director for the purpose o f issuing the Covance final report for the in-life phase of the study. SRteuadsyodnir:ectorship was not relinquished by Covance for the in-life phase of the study, since the animal experimental phase was completed before Amendment Number 4 was issued.
Amendment Approval
John L. Butenhoff, PH.D., Sponsor Representative
c
Date
Andrew Seacat, Ph.D., Study Director
Date
3M Environmental Laboratory
3M Environmental Laboratory
Page 39
3m M e d e ^ ^ e B e p a r g g r i g j i t S g ^ Y A B 2 - ^ 0 # a 71, 410 804
RePrt No. FACT TOX-030
lanoratory Request Numb-^22 7SC)06
Study Title
ProtoAcmoleTnOdmXe-0n3t 07
26-week Capsule Toxicity Study with Perfluorooctane Sulfonic Acid Potassium Salt (T-6295) in Cynomolgus Monkeys
Protocol Amendment No. 7
Amendment Date:
September 14,2000
Performing Laboratory
3M Environmental Technology and Safety Services 3M Environmental Laboratory 935 Bush Avenue St. Paul, MN 55106
Laboratory Project Identification
ET&SS FACT-TOX-030 Covance #6329-223 LIMS #U2279
3M Environmental Laboratory
3m, Med&^0parl0ai33t
-7 ! 410 8B4 gi22 Report No. FACT TOX-03 0 lacoratory Request Numbed,02$79 egg
Amendment Approval
ProtoAcnowl TnOdmXe-0n3t 07
John L. Butenhoff, Fh.D., Sponsor's Representative Andrew Seacat, Ph.D., Study Director
Date (V /Daa>te
'I
/*
>jns'
:;'
i
3M Environmental Laboratory
Sflf
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Attachment C Extraction and A nalytical M ethods
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
3M Environmental Laboratory
3M Environmental Laboratory
Page C-1
Page 43
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03G laboratory Request Number-U227S
3M Environmental Laboratory
M ethod E x tr a c tio n of P o tassium Perfluo ro o ctanesulfo nate or o th er
F lu o r o c h em ic a l C o m po unds fro m L iver fo r A nalysis using HPLC-
E lec tr o spra y/M ass Spec tr o m etry
M ethod Num ber: ETS-8-6.0
Author: Lisa Clemen, Robert Wynne Approved By:
Adoption Date: Revision Date: Lift
~Vvh ci
Date
Group Leader Technical Reviewer
Date
C/hVi
Date
1.0 S c o p e a n d A p p l ic a t io n _____________________________________________________________________ 1.1 Scope: This method is for the extraction of potassium perfluorooctanesulfonate (PFOS) or
other fluorochemical compounds from liver.
1.2 A pplicable C om pounds: Fluorochemical surfactants or other fluorinated compounds.
1.3 vMaalitdraitcieosn: rRepaobrbt.it, rat, bovine, and monkey livers or other tissues as designated in the
Word 6.0/95
ExtractionEoTfSP-F8O-6S.0from Liver
Page 1 of 14
3M Environmental Laboratory
Page 44
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
2.0 S u m m a r y o f M e t h o d __________________________________________________________________________ 2.1 This method describes the procedure for extracting potassium perfluorooctanesulfonate
(PFOS) or other fluorochemical surfactants from liver, or other tissues, using an ion painng reagent and methyl-/eri-butyl ether (MtBE). In this method, seven fluorochemicals can be extracted: PFOS, PFOSA, PFOSAA, EtFOSE-OH, PFOSEA, M556, and surrogate standard. An ion pairing reagent is added to the sample and the analyte ion pair is partitioned into MtBE. The MtBE extract is transferred to a centrifuge tube and put onto a nitrogen evaporator until dry. Each extract is reconstituted in 1.0 mL methanol then filtered through a 3 cc plastic syringe attached to a 0.2 pm nylon filter into glass autovials. 2.2 These sample extracts are analyzed following method ETS-8-7.0 or other appropriate methods.
3.0 D e f in it io n s _____________________________________________________________________________________ 3.1 PFOS: perfluorooctanesulfonate (anion o f potassium salt) C3F17S 0 3 3.2 PFOSA: perfluorooctane sulfonylamide CgFpSOjNH-, 3.3 PFOSAA: perfluorooctane sulfonylamido (ethyl)acetate C8Fl7SO;N(CH;CH3)CH:CO, 3.4 EtFOSE-OH: 2(N-ethylperfluorooctane sulfonamido)-ethy! alcohol
C8F]7S 0 2N(CH2CH3)CH2CH20H 3.5 PFOSEA: perfluorooctane sulfonyl ethylamide C8F17SO:N(CH:CH3)H 3.6 M556: C8F17S 0 2N(H)(CH2C 00H ) 3.7 Surrogate standard: 1H-1H-2H-2H perfluorooctane sulfonic acid
4.0 W a r n in g s an d C a u t io n s______________________________________________________________________ 4.1 Health and Safety Warnings:
4.1.1 Uhasnedulinnigvearnsaiml palretcisasuuteio, nwsh, iecshpemcaiayllcyonlatbaoinraptoarthyocgoeantss., goggles, and gloves when
5.0 I n t e r f e r e n c e s _______________________________________________________________________________ 5.1 There are no interferences known at this time.
6.0 E q u ip m e n t ____________________________________________________________________________________ 6.1 The following equipment is used while performing this method. Equivalent equipment is
acceptable. 6.1.1 Ultra-Turrax T25 Grinder for grinding liver samples 6.1.2 Vortex mixer, VWR, Vortex Genie 2 6.1.3 Centrifuge, Mistral lOOOorlEC 6.1.4 Shaker, Eberbach or VWR
ExtractionEoTfSP-F8O-6S.0from Liver
Page 2 of 14
3M Environmental Laboratory
Page 45
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
6.1.5 Nitrogen Evaporator, Organomation 6.1.6 Balance (sensitivity to 0.100 g)
7.0 S u p p l ie s a n d M a t e r ia l s ______________________________________________________________ 7.1 Gloves 7.2 Dissecting scalpels 7.3 Eppendorf or disposable pipettes 7.4 Nalgene bottles, capable of holding 250 mL and 1 L 7.5 Volumetric flasks, glass, type A 7.6 I-CHEM vials, 40 mL glass 7.7 Plastic sampule vials, Wheaton, 6 mL (or appropriate size) 7.8 Centrifuge tubes^ polypropylene, 15 mL 7.9 Labels 7.10 Oxford Dispensor - 3.0 to 10.0 ml 7.11 Syringes, capable of measuring 5 pL to 50 pL 7.12 Graduated pipettes 7.13 Syringes, disposable plastic, 3 cc 7.14 Syringe filters, nylon, 0.2 pm, 25 mm 7.15 Timer 7.16 Crimp cap autovials and caps 7.17 Crimpers Note: Prior to using glassware and bottles, rinse 3 times with methanol and 3 times with Milli-
QviTMals.water. Rinse syringes a minimum of 9 times with methanol, 3 rinses from 3 separate
8.0 R e a g e n t s a n d St a n d a r d s __________________________________________________ _ _ _ _______ 8.1 Type I reagent grade water, Milli-QTM or equivalent; all water used in this method should
be Milli-QTM water and be provided by a Milli-Q TOC PlusTM system 8.2 Sodium hydroxide (NaOH), J.T Baker or equivalent 8.3 Tetrabutylammonium hydrogen sulfate(TBA), Kodak or equivalent 8.4 Sodium carbonate (NaXOj), J.T. Baker or equivalent 8.5 Sodium bicarbonate (NaHC03), J.T. Baker or equivalent 8 . 6 Methyl-fer/-butyl ether, Omnisolv, glass distilled or HPLC grade 8.7 Methanol, Omnisolv, glass distilled or HPLC grade 8 . 8 Liver, frozen from supplier 8.9 Dry ice from supplier
8.10 Fluorochemical standards
8.10.1 PFOS (3M Specialty Chemical Division), molecular weight = 538
ExtractionEoTfSP-F8O-6S.0from Liver
Pane 3 of 14
3M Environmental Laboratory
Page 46
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
8.10.2 PFOSA (3M Specialty Chemical Division), molecular weight = 499
8.10.3 PFOSAA (3M Specialty Chemical Division), molecular weight = 585
8.10.4 EtFOSE-OH (3M Specialty Chemical Division), molecular weight = 570
8.10.5 PFOSEA (3\1 Specialty Chemical Division), molecular weight = 527
8.10.6 M556 (3M Specialty Chemical Division), molecular weight = 557
8.10.7 Surrogate standard: 4-H, perfluorooctane sulfonic acid (l-H .l-H , 2-H, 2-H CgF13S 0 3H) molecular weight = 428
8.10.8 Other fluorochemicals, as appropriate
8.11 Reagent preparation
NOTE: When preparing larger volumes than listed in reagent, standard, or surrogate preparation, adjust accordingly.
8.11.1 d11i00s0sN0olsvmoeLddi.ubmeSatkoheryredcrinoonxatida1ienL(inNNgaaO5lg0He0n):meWLboeMtitgliehl.lia-QppTMroxwiamteart,elmy i2x0u0ngtilNaalOl sHo.liPdosuarreinto a
8.11.2 110NNsoNdaiOumH hsyodlurtoioxindein(tNoaaO1H0)0: mDLilvuotelu1m0eNtriNc afOlaHsk 1a:n1d0.diMluteeastuorveo1lu0mmeLuosifng Milli-QTM water. Store in a 125 mL Nalgene bottle.
8.11.3 0.5 M tetrabutylammonium hydrogen sulfate (TBA): Weigh approximately 169 g pooHff NT1Ba0OAuHsin,intaogddaaps1plorLowvxloiymlubametceealtyuris4ce4cttohonet5pa4HinmicnLhgaon5f0g0e1s0maNLbrNMuapOitlllHyi)-.Q(WD'Mihlwuilateeteatrdo.dAvinodgljuutmhsteetlowasitthmL Milli-QTM water. Store in a 1 L Nalgene bottle.
8.11.3.1
TBA requires a check prior to each use to ensure pH = 10. needed using 1 N NaOH solution.
Adjust as
8.11.4 0ap.2p5roMximsoadtieulmy 2c6a.r5bgonoaftseo/sdoiduimumcabribcoanrbaotena(Nteab,Cuf0fe3r) a(nNda2X1.003/gNoafHsCod0i3u)m: Weigh bQiTMcarwboatneart.e S(NtoarHe CinOa,)1inLtoNaalg1 eLnevobloutmtlee.tric flask and bring to volume with Milli-
8.12 Standards preparation
8.12.1 Prepare PFOS standards for the standard curve.
8.12.2 Prepare other fluorochemical standards, as appropriate. Multicomponent fluorochemical standards are acceptable (for example, one working standard s1o.1lu0tipopnmcoEnttraOinSiEng-O1H.0.0) ppm PFOS, 1.02 ppm PFOSA, 0.987 ppm PFOSAA, and
8.12.3 Weigh approximately 100 mg of PFOS into a 100 mL volumetric flask and record the actual weight.
8.12.4 B(prgin/mgLto).volume with methanol for a stock standard of approximately 1000 ppm
8.12.5 Dilute the stock solution with methanol for a working standard 1 solution of approximately 50 ppm.
ExtractionEoTfSP-F8O-6S.0from Liver
3M Environmental Laboratory
Page 4 of 14
Page 47
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
8.12.6 Dapiplurtoex.th5e.0stpopcmk .solution with methanol for a working standard 2 solution of
8.12.7 aDpiplurtoex.th0e.5s0topcpkmso. lution with methanol for a working standard 3 solution of
8.13 Surrogate stock standard preparation
8.13.1 Weigh approximately 50-60 mg of surrogate standard l-H.l-H, 2-H, 2-H, C3F,3S0 3H into a 50 ml volumetric flask and record the actual weight.
8.13.2 Brpipnmg .to volume with methanol for a surrogate stock of approximately 1000-1200
8.13.3 Prepare a surrogate working standard. Transfer approximately 1.0 ml of surrogate
stock to workijig
ast1a0ndmarl dvoolfum10e-t2r0icpfplams.k
and bring to volume with Record the actual volume
methanol for transferred.
a
9.0 S a m p l e H a n d l in g ____________________________________________________________ _ 9.1 All samples are received frozen and must be kept frozen until the extraction is performed.
10.0 Q u a l it y C o n t r o l ______________________________________________________________ 10.1 M atrix blanks and method blanks
10.1.1 An aliquot of 1.0 mL methanol is used as a solvent blank. 10.1.2 aEsxtmraectht otwdobl1a.n0kms.L aliquots of Milli-QTM water following this procedure and use
10.1.3 Easxtmraacttritxwbola1n.k0sm. LReafleiqrutoots11o.f1.l6iv.er homogenate following this procedure and use
10.2 M atrix spikes
10.2.1 Pthreepaacrceuraancdyaonfatlhyezeexmtraatrcitxiosnp.ike and matrix spike duplicate samples to determine 10.2.2 Prerceepiavreedewacithhsepaikche usasminpglea sseatm. ple chosen by the analyst, usually a control liver
10.2.3 cAEaxdlipdbeirtcaitotenidoanlcocsnupcrikevnees.trmataioynbsewinilcllufadlledinatnhde mmaidy-rfaalnlgien othfethleowin-irtaianlgceaolifbtrhaetioinnitciaulrve.
10.2.4 Prepare one matrix spike and matrix spike duplicate per 40 samples, with a minimum of 2 matrix spikes per batch.
10.3 C ontinuing calibration verifications
10.3.1 Pinrietpiaalrceacliobnrtaintiuoinngcucravleib. ration verification samples to ensure the accuracy of the
10.3.2 Prepare, at a minimum, one continuing calibration verification sample per group
of 10 samples. and extracted.
For example, if a sample set = 34,
four verifications are prepared
3M Environmental Laboratory
ExtractionEoTfSP-F8O-6S.0from Liver
Page 5 of 14
Page 48
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U227S
10.3.3 Prepare each continuing calibration verification from the same matnx used to prepare the initial curve.
10.3.4 The expected concentrations will fall within the mid-range of the initial calibration curve. Additional spikes may be included that fall in the low-range of othnelyintihtieallocwaliebnrdatoiofnthceurcvaeli.brTahtiiosniscunrevcees(sfaorryeixfatmheplaen, a5lypsptbm-us1t0q0upapnbti,tartaethuesring than 5^ppb - 1000 ppb).
11.0 C a l ib r a t io n a n d S t a n d a r d iz a t io n ________________________________________________________ 11.1 Prepare m atrix calibration standards
11.1.1 WmLeisgMh ialplip-QroTMximwaatteelry. 4G0rigndoftolivaehroimntoogaen2e5o0ums sLolNutailogne.ne bottle containing 200 11.1.2 If 40 g is not available, use appropriate amounts of liver and water to ensure a 1:5
ratio. 11.1.3 Refer to 13.0 to calculate the actual density of liver homogenate and the
concentration of solid liver tissue dispersed in 1.0 mL of homogenate solution. 11.1.5 Add 1 mL o f homogenate to a 15 mL centrifuge tube. Re-suspend solution by
hshoamkoinggenbeeotuwseesnoluatliiqounoitns w15hmileLpcreenptarriifnuggeattuobtaels.of eighteen 1 mL aliquots of 11.1.6 Two 1 mL aliquots, or other appropriate volume, serve as matrix blanks. 11.1.7 tThyepeincadlloyfuthseistsheectsitoannd, atordspcoiknec,einntrdautpiolnicsataen,dtwspoikstinangdaamrdoucuntrsveliss,tefodrian tToatablleof1, at
eighteen samples, two matrix blanks, and two method blanks. 11.1.8 wRhefiecrhtloisvtsaltihdeatwioonrkrienpgorrtasnEgeTsSa-n8d-6t.h0eaLnidneEarTCS-a8li-b7r.0a-tVio-n1RoarnAgett(aLcChRm)enfotrB,
calibration curves. 11.1.9 sUtasnedAarttdasc. hRmeefenrt tCo a1s3.a0ntoaicdailncuclaaltceualacttiunagl cthoencceonntcreanttiorantsioonfsPoFfOthSeinwocrakliibnrgation
standards. 11.2 sTuorreoagcahtewworokriknigngstsatnadnadradr,dbfloarnkth,eorcocnocnetnintruaitnigonvetoriffiaclal twiointh,iandtdheapcparliobprraitaitoenacmuoruventraonfge 5
ppb - lOOOppb.
ETS-8-6.0 Extraction of PFOS from Liver
3M Environmental Laboratory
Page 6 of 14
Page 49
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
11.3 Extract spiked liver homogenates following 12.14-12.25 of this method. Use these standards to establish each initial curve on the mass spectrometer.
Table 1 Approxim ate Spiking Amounts for Calibration Standards
Working Standard (Approx. Cone.)
0.50 ppm 0.50 ppm 0.50 ppm 0.50 ppm 0.50 ppm 5.0 ppm 5.0 ppm 5.0 ppm 50 ppm
Hi
Approx, final cone, of PFOS in liver
- Blank
2 0.005 ppm
4 0 . 0 1 0 ppm
1 0 0.025 ppm
2 0 0.050 ppm
40 .
0 . 1 0 0 ppm
1 0 0.250 ppm
2 0 0.500 ppm
30 0.750 ppm
4 1 . 0 0 ppm
12.0 P r o c e d u r e ____________________________________________________________________________________ 12.1 Obtain frozen liver samples. 12.2 Cpuetrafporpmroexdimquatieclkyly1, gnootfallilvoewriunsgintghealdiviessretcotitnhgawsc.alpel. This part of the procedure is best 12.3 Weigh the sample directly into a tared plastic sampule vial. 12.4 Record the liver weight in the study notebook. 12.5 Return unused liver portions to freezer.
12.6 Add 2.5 mLs o f water to sampule vial. 12.7 Grind the sample. Put the grinder probe in the sample and grind for about 2 minutes, or
until the sample is homogeneous. 12.8 Rinse the probe into the sample with 2.5 mLs water using a pipette. 12.9 Ta2k2e. the grinder apart and clean it with methanol after each sample. Refer to AMDT-EP-
12.10 Cwaepighthte, lsiavmerpIlDe ,adndatevoarntdexafnoarly1s5t sineictoianlds.s. Label the sampule vial with the study number,
ExtractionEoTfSP-F8O-6S.0from Liver
3M Environmental Laboratory
Page 7 of 14
Page 50
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
12.11 Pipette 1.0 mL, or other appropriate volume, of homogenate into a 15 m l polypropylene centrifuge tube. Label the centrifuge tube with the identical information as the sampule vial. Refer to attached worksheet for documenting the remaining steps.
12.12 Pipette two 1 mL aliquots ofMilli-QTM water to centrifuge tubes. These will serve as method blanks.
12.13 Spike all sampjes, including blanks and standards ready for extraction with surrogate standard as described in section 1 1 .2 .
12.14 Spike each matirx with the appropriate amount of standard as described in 11.1, or Table 1 ocofnthtiantusiencgticoanl,ibfroartitohne cstaalnibdraartdios.n curve standards. Also prepare matrix spikes and
12.15 Vortex mix the standard curve samples, matrix spike samples, and continuing calibration samples for 15 seconds.
12.16 Check to ensure 0.5 M TBA reagent is at pH 10. If not, adjust accordingly.
12.17 To each sample, add 1 mL 0.5 M TBA and 2 mL of the 0.25 M sodium carbonate/sodium
bicarbonate buffer.
12.18 Using an Oxford Dispenser, add 5 mL methyl-teri-butyl ether.
12.19 Cap each sample and put on the shaker at a setting of 300 rpm, for 20 minutes.
12.20 Centrifuge for 20 to 25 minutes at a setting of 3500 rpm, or until layers are well separated.
12.21 Label a fresh 15 mL centrifuge tube with the same information as in 12.10,
12.22 Remove 4.0 mL of the organic layer to the fresh 15 mL centrifuge tube.
12.23 hPouutrse.ach sample on the analytical nitrogen evaporator until dry, approximately 1 to 2
12.24 Add 1.0 mL to each centrifuge tube using a graduated pipette.
12.25 Vortex mix for 30 seconds.
12.26 FAiltttearchinato0a.21p.5mmnLylgolnasms easuhtofvilitaelrotrolaow3-cvcolsuymrinegaeuatonvdiatrlawnhsfeenr tnheecessasmarpyl.e to this syringe.
12.27 mLaatbreixl ,thfienaalutsoovlviaelnwt, iethxtrthaectsiotunddyanteu,mabnedr,ananalimysat(lsn) upmerbfeorrmanindggtehnedeerx,trsaacmtiponle. timepoint,
12.28 Cap and store extracts at room temperature or at approximately 4 C until analysis.
12.29 Complete the extraction worksheet, attached to this document, and tape in study notebook or include in study binder, as appropriate.
ExtractionEoTfSP-F8O-6S.0from Liver
3M Environmental Laboratory
Pace 8 of 14
Page 51
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
13.0 D a t a A n a l y s is a n d C a l c u l a t io n s ___________________________________________________ __ 13.1 Calculations:
13.1.1 tCenalsceuplaartaeteth1e.0avmerLagaeliqduenotssityofohfotmheolgievnearthe.omogenate by recording each mass of Average density (mg/mL) = Average mass (mg) of the aliquots 1.0 mL aliquot
13.1.2 edCqiasuplaceutrilosanetd:e sthoelidamtiossuunet poefrlimveLr o(mf hg)ompeorge1n.0atmeLsuhsopmenosgieonna)tues(ionrgctohnecfeonltlroawtiionng of g of Liver x Average density* o f homogenate (mg/mL-) (g of Liver + g of Water) * refer to 13.1.1 for details.
13.1.3 sCtaanlcdualradtes uacstinuagltchoenfcoelnlotrwaitniognesqoufaPtiFonO:S and other fluorochemicals in calibration uL of Standard x Concentration (ug /mL) = Final Concentration (ug/g or mg/kg) mg Liver/ 1 mL homogenate* of PFOS in Liver *refer to 13.1.2 for details.
14.0 M e t h o d P e r f o r m a n c e _______________________________________________________________________ 14.1 The method detection limit (MDL) is analyte and matrix specific. Refer to MDL report for
specific MDL and limit of quantitation (LOQ) values (refer to Attachments B and C). 14.2 The following quality control samples are extracted with each batch of samples to evaluate
the quality of the extraction and analysis. 14.2.1 Method blanks and matrix blanks. 14.2.2 Mpraetcriisxiosnpiokfethaendexmtraatcrtixionsp. ike duplicate samples to determine accuracy and 14.2.3 oCfotnhteiniuniintigalccaalilbibraratitoionnvceurrifviec.ation samples to determine the continued accuracy
14.3 Refer to section 14 of ETS-8-7.0 for method performance criteria.
15.0 P o l l u t io n P r e v e n t io n a n d W a st e M a n a g e m e n t _______________________________________ 15.1 ShloiacgmahtpeBldeTiwUnatcshoteentliaasbindoeirsrapst,oorsayend.d iunsebdiohglaazsasrdpicpoenttteaiwnearsst,e filsadmimspaobsleedsionlvbernotkwenasgtleasiss dcoisnptoasineedrsin
ETS-8-6.0 Extraction of PFOS from Liver
3M Environmental Laboratory -
Page 9 of 14
Page 52
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
16.0 R e c o r d s ________________________________________________________________________________________ 16.1 Complete the extraction worksheet attached to this method, and tape in the study notebook
or include in the 3-ring study binder, as appropriate.
17.0 T a b l e s , D ia g r a m s , F l o w c h a r t s , a n d V a l id a t io n D a ta _______________________________ 17.1 Attachment A, Extraction worksheet 17.2 Attachment B, MDL/LOQ values and summary 17.3 Attachment C, Calibration standard calculation and concentration worksheet
18.0 R e f e r e n c e s ___________________________________________________________________________________ 18.1 The validation report associated with this method is ETS-8-6.0 & 7.0-V -l. 18.2 AMDT-EP-22, "Routine Maintenance of Ultra-Turrax T-25"
18.3 FLAivCerTf-oMr -A1n.1a,ly"sEisxtUrascintigonHoPfLPCF-OESlecotrroOstphrearyA/MniaosnsicSpFelcutorroomcehtermy"ical Surfactants from
19.0 A f f e c t e d D o c u m e n t s _______________________________________________________________________ 19.1 ETS-8-7.0, "Analysis o f Liver Extracts for Fluorochemicals using HPLC-Electrospray
Mass Spectrometry"
20.0 R e v isio n s RNuevmisbieorn.
Reason For Revision
ReDvaistieon
ExtractionEoTfPSF-8O-6S.0from Liver
3M Environmental Laboratory
Page 10 of 14
Page 53
3m Medical Department Snudy: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Study tr Matrix BWokx/DU ay
Date Spiked/Analyst
ccv
MS MSD
Surrogate Std approx, ppm actual ppm
#
-
FC Mix Std FC Mix Std approx. 0.5 ppm approx. 5 ppm actual ppm actual ppm
##
FC Mix Std approx. 50 ppm actual ppm
U
ft
Comments
;1-
---
-
--
-
-
-
i
i
Blank
Liver Homogenate:
Liver Extraction M ethod
S td tf
:
-
-
Liver amount =
SDike surrogate and S tandard m ix. V ortex 15 sec.
Pipette 1 m L of Liver Solution
Pipette 1 m L o f t0 .5 M T B A , pH 10. pH =
Std. tt
Pipette 2 m L of 0.25 N a->CO y0.25M N aH C O t Buffer
Std.
Dispense 5ml of M ethyl-t-Butyl Ether
TN-A-
Shake 20 min.
Shaker Speed
Centrifuge 20-25 mm.
Centrifuge Speed
Remove a 4 m L aliquot of organic laver
Put on Nitrogen Evaporator to drvncss
Evaporator Temperature
A dd 1.0 m L o f M ethanol
TN-A-
Vortex
FCiltoenr tu.
s3Ci0nagsle.acV.3cecrifBi-cDatsiov nr isn
guesewdiththae 0s.a2mu me
mS RaItrNixitearsifnotor
athu et o sstaamnpdlaervdi aclurve.
-
-
Attachment B: MDL/'LOQ Values
3M Environmental Laboratory
ETS-8-6.0
Extraction o fP F O S from L iv er
-
-
-
-
-
-------------------- ----------------------- j---------------------------------
-
-
-
g
D ate & Initials
Page 11 of 16
Page 54
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
M DL/LOQ values for rabbit liver
Compound MDL LOQ Linear Calibration Range (LCR)
(PPb) (ppb) Approximate concentrations to be used for preparing the
Standard Calibration Curve
PFOS 8.45 26.9 30 ppb - 1200 ppb
PFOSA
3.50 11 .1 1 2 ppb - 1 2 0 0 ppb
PFOSAA
24.6 78.3 30 ppb - 1200 ppb
EtFOSE-OH 108 345 60 ppb - 900 ppb*
M556 82.3 262 60 ppb - 1 2 0 0 ppb
PFOSEA
33.9 108 30 ppb- 1200 ppb
MDL/LOQ values in rat, bovine, and monkey liver were not statistically determined. Two curves in each o f these-matrices were extracted and analyzed with the rabbit liver curves to determine equivalence. Responses in the rat, bovine, and monkey liver curves were equivalent to the rabbit responses, therefore, their MDL and LOQ will be assumed to be equivalent to those values as determined for the rabbit liver.
R* eEfetrFtOoSLEO-OQHSeusmtimmaartyesaonndlyMfDorLMstDudLyainndELTOSQ-8.-6D.0id&no7t.0m-Vee-tl cfroirtefruiarthfoerr vinafloidramtiaotnio.n
Compound: PFOS
Liver matrix
Prepared Range of LCR from Range of LCR from Range of LCR from
range of average ave curve low std low std high std high std
standards
(ppb) (ng/mL)
(ppbc)u(rnvge/mL)
(ppb) (ng/mL)
(ppbc)u(rnvge/mL)
(ppbc)u(rnvge/mL)
(ppbc)u(rnvge/mL)
(ppbc)u(rnvge/mL)
Rabbit j 6.19 - !237 12 -1200 12 - 1200 6 - 300 12 - 300 60 -1200 60 -1200
Compound: PFOSA
Prepared
Liver matrix
srtaanndgearodfs
(ppb) (ng/mL)
Rabbit 6.19 - 1237
Range of average curve
(ppb) (ng/mL)
12 - 1200
LCR from ave curve
(ppb) (ng/mL)
12 - 1200
Range of low std curve
(ppb) (ng/mL)
12 - 300
I.CR from low std curve
(ppb) (ng/mL)
12-300
Range of high std (ppbc)uirnvge/mL) 60 - 1200
LCR from high std curve
(ppb) (ng/mL)
60 - 1200
Compound: PFOSAA
Prepared Range of
Liver range of average
matrix Rabbit
standards
i!
(ppb) (ng/mL)
6.16-1232
(ppbc)u(rnvge/mL) 12 -1200
1
LCR from ave curve
(ppb) (ng/mL) 30 - 1200
Range of low std curve
(ppb) (ng/mL)
30 - 900
LCR from low std (ppbc)u(rnvge/mL) 60 - 900
Range of high std curve (ppb) (ng/mL)
N7A
LCR from high std curve
(ppb) (ng/mL)
N7A
Attachment B: MDL'LOQ Values
3M Environmental Laboratory
ETS-8-6.0 Extraction of PFOS from Liver
Page 12 of 16
Page 55
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Compound: EtFOSE-OH
Prepared Range of Liver range of average matrix standards curve
(ppb) (ng/mL) (ppb) (ng/mL)
Rabbit 6.17 - 1235 3 1-900
LCR from ave curve
(ppb) (ng/mL)
31-900
Range of low std curve
(ppb) (ng.'mLl
N/A
LCR from low std curve
(ppb) (ng/mL)
N/A
Range of high std curve
(ppb) (ng/mL)
N/A
LCR from high std curve
(ppb) (ng/mL)
N/A
Compound: PFOSEA
Prepared Range of
Liver range o f average
matrix s t a n d a r d s
curve
(ppb) (ng/mL) {ppb) (ng/mL)
Rabbit 6.17- 1235 - 31 - 1200
LCR from ave curve
(ppb) (ng/mL)
31 - 1200
Range of low std curve
(ppb) (ng/mL)
N/A
LCR from low std curve
(ppb) (ng/mL)
N/A
Range of LCR from high std high std curve curve
(ppb) (ng/m L ) --(ppb) (ng /m L )
N/A N/A
Compound: M556 Prepared
Liver range of matrix standards
(ppb) (ng/mL)
Rabbit 6.17- 1235
Range of average curve
(ppb) (ng/mL)
31 - 1200
LCR from ave curve
(ppb) (ng/mL)
60 - 1200
Range of low std curve
(ppb) (ng/mL)
N/A
LCR from low std curve
(ppb) (ng/ml.i
N/A
Range of high std curve
(ppb) (ng/ml.)
N/A
LCR from high std curve
(ppb) (ng/mL)
N/A
Artachmen: C: Standard Calculations
ETS-8-6.0
Extraction ofPFOS from Liver
3M Environmental Laboratory
Page 13 of 14
Page 56
3m Medical Department Study: T-6295.7
Report N o . FACT TOX-C30 laboratory Request Number-U2279
Ion Pair Standard Curves - Tissue
Prep date(s): ASanmalpyltee(ms)a: trix: SMTFFFuCCCaerrtrgmmmhoeoiiigtxxxdaa/ssstrnetttedddavsltyiaaasdtpppieopppa(nsprrr):ooop:xxxr...o05x5..0.05.000100pp0pppmmppmp::m: :
ESFBtiqlanaunanidlkpasmlorivdlevneenrtn/uintdmuaembnnedtbrife:TireN:r::
Actual concentrations of standards in the FC mix
PFOS PFOSA PFOSAA EtFOSE PFOSEA Std cone Std cone Std cone Std cone Std cone ug/mL ug/mL ug/mL ug/mL ug/mL 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500 0.500
5.00 5.00 5.00 5.00 5.00 5.00 5.00 5.00 5.00 5.00 5.00 5.00 5.00 5.00 5.00 50.0 50.0 50.0 50.0 50.0
M556 Std cone Std cone ug/mL ug/mL 0.500 0.500 0.500 0.500 0.500
5.00 ! 5.00 5.00 50.0
All Am't spiked
mL 0.002 0.004 0.010 0.020 0.040 0.010 0.020 0.030 0.004
All Density 0.1g67 0.167 0.167 0.167 0.167 0.167 0.167 0.167 0.167
Calculated concentrations of standards in the sample matrix
PFOS PFOSA PFOSAA EtFOSE PFOSEA M556
Surrogate
Final Final Final cone Final Final Final Std cone Std cone
cone cone ng/g cone cone cone ng/g ng/mL
n5.g9/9g n5.g9/9g 5.99 n5.g9/9g n5.g9/9g n5.g9'9g
| . 100
12.0 12.0 12.0 12.0 12.0 12.0
29.9 29.9 29.9 29.9 29.9 29.9
Surrogate
59.9 59.9 59.9 59.9 59.9 59.9
Final cone
120 120 120 120 120 120
ng/mL
299 299 299 299 299 299
0.500
599 599 599 599 599 599
898 898 898 898 898 898
TT98 1198 1198 1198 1198 1198
All Am't spiked mL 0.005
Validated ranges - approximate concentrations
L iv e r 1 PFOS i PFOSA PFOSAA
Rabbit
5-1000 ppb j 5-1000 ppb j 5-1000 ppb
Bovine
Estimates only, use rabbit values.
Rat Estimates only, use rabbit values.
M onkey
F.stimates only, use rabbit values.
EtFOSE-OH
5-1000 ppb
11
POAA
5-1000 ppb
i!
PFOSEA
5-1000 ppb
Attachment C: Standard Calculations
ETS-8-6.0
Extraction of PFOS from Liver
3M Environmental Laboratory
Page 14 of 14
Page 57
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
3M Environmental Laboratory
M ethod
A n a l y sis of P o tassium Perfluoro octaivesulfonate or O th er Flu o r o c h em ic a ls in L iv er E xtracts U sing H P L C -E lectrospray/M ass S pectrom etry
M ethod Number: ETS-8-7.0
ojlziinAdoption Date:
Author: Lisa Clemen, Glenn Langenburg
Revision Date:
Approved By:
Laboratory Manager A / A /A ----------
Group Leader _Te_c_h_n__ic_a_l__R_evriiel/wmetr*-___________________________
7 A ^ /f ;
Date ...
Date
O lh 'ih 'i
Date
1.0 S c o p e a n d A p p l ic a t io n _______________________________________________________________________ 1.1 SHcPoLpCe:-elTehctirsomsperthayo/dmiassfsorsptehcetraonmaelytrsyis. of liver extracts for fluorochemical surfactants using
1.2 oAtpheprliicoanbizleabCleomcopmopuonudnsd: sF. luorochemical surfactants or other fluorinated compounds, or
1.3 rMepaotrrti.ces: Rabbit, rat, bovine, monkey liver, or other tissues as designated in the validation
Word 6/95
Analysis of LivEeTrSE-x8t-r7a.c0t Using ES/MS
Page 1 ot'10
3M Environmental Laboratory
Page 58
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
2.0 S u m m a r y o f M e t h o d _________________________________________________________________________ 2.1 This method describes the analysis of fluorochemical surfactants extracted from liver using
HpePrLfoCrm-eeledctbryosmproanyit/omrainsgs sapseicntgrolemieotnryc,hoarrascimteirliasrticsyostfeampaarstiacpuplarropflruiaotreo. chTehme iacnaal,lyssuicshisas the perfluorooctanesulfonate (PFOS) anion, m/z = 499. Additionally, samples may be danetaelcytziendg udsaiungghatetraniodnesmomf tahsesssepleeccttreodmpeatreernttoiofnu.rther verify the identity of a compound by
3.0 D e f in it io n s _____________________________________________________________________________________ 3.1 sAytsmteomssphaellroiwc PforresvsaurrioeuIsomnieztahtoiodns o(Af iPoIn)i:zaTthioenMbiycruotmiliazsinsgQvuaartitorousIIsotruirpcleesq, upardorbueps,olaend
interfaces. These include but are not limited to: Electrospray Ionization (ESI), Atmospheric tPercehsnsuiqrue ecshoecmciucrasl aItonatizmaotisopnhe(rAicPcpIr)e,sTsuhreerm(i.oes.pnraoyt ,uentdce.rTahveaciounuimza)t.ion process in these
3.2
pETrhleeescssteurrocehs,pawrrgaheyedrIedobrnyoipziolaenttissonianre(sEoplSru,otdiEouSncIe)ad:rebatymratehnteshfeoardprpeoldifctiaootnitoihzneatogifoasna
pphearfsoervmiaedtinatyacthmaorsgpehdedrircoplets. strong electrical field.
3.3 TMhaessAPSIpeQcutraottmroetIIrytr, iMpleasqsuaSdpreucptroolemmeatesrs s(MpeSct)r,oTmaentedremis eMquaispspSedpewcittrhomtweoteqru(aMdrSu/pMolSe): mchaasrsgeserlaetcitoiv(emd/ze)teacntdorssuabnsdeqauceonltlliysidoenteccetlel.d.IoAnssianrgelseeMlecStimvealyy bdeisecmrimplionyaetdedfobryiomnass to detection or an ion may be selected in the first quadrupole, fragmented in the collision cell, and these fragments may be analyzed in the second quadrupole.
3.4 C onventional vs. Z-spray probe interface: The latest models of Micromass Quattro II triple quadrupole (post 1998) utilize a "Z-spray" conformation. The spray emitted from a probe is orthogonal to the cone aperture. In the conventional conformation it is aimed dnemloieratceitnccrottolemydnpeaa.nat tctTihebhelaeorcueowgntihhtehetahsopeanemrectoeuan.rnfeoiH,gthuaoferwtraee,trvibopeunrat,siossZinn-dlsgyipffrtwehariryteohncutosg,imhmthpaieloatnmoreresnttuythsosotueadsmnsdpsoacft(ohio.newp.veaeZryna-ttsiinipoornntah,ayelclccceoooaummnnipptneoogrnn,eeannnttdss aarree compatible with other Z-spray systems, etc.)
3.5 M ass Lynx Software: System software designed for the specific operation of these Quattro II triple quadrupole systems. Currently MassLynx has Windows 95 and WindowsNT 4.0 ivnesrtsriuomnse.ntA(lMl vicerrosimonasssaQreusaitmtriolaIrI. trFiporlemqouraedrdueptaoilles MreafesrsLtoynthxeomr aMnuasaslLsypnexcifNicTtoUstheer's Guide).
4.0 W a r n in g s a n d C a u t io n s______________________________________________________________ 4.1 Health and Safety W arnings:
4.1.1 Uemseplcoayustiaonvowltiathgethoefvaoplptargoeximcaabtleelsy f5o0r0t0heVporlotsb.e. When engaged, the probe
Analysis of LivEeTrSE-x8t-r7a.c0t Using ES/MS
3M Environmental Laboratory
Page 2 of 10
Page 59
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
4.1.2 When handling samples or solvents wear appropriate protective gloves, eyewear, and clothing.
4.2 Cautions: 4.2.1 Operate the solvent pumps below a back pressure of 400 bar (5800 psi). If the back pressure exceeds 400 bar, the HP1100 will initiate automatic shutdown. 4.2.2 Do not run solvent pumps to dryness.
5.0 I n t e r f e r e n c e s _____________________________________________________________________________ _ 5.1 To minimize interferences when analyzing samples, Teflon shall not be used for sample
storage or any part o f instrumentation that comes in contact with the sample or extract.
6.0 Equipment__________________________________________________________________________ 6.1 mEqoudiipfimcaetnitonlisstiendtbheelroawwmdaatyabaes mmoetdhifoideddeinvioartdioenrst.o optimize the system. Document any
6.1.1 MeleicctrroomsparsasyQiuoantitzraotiIoIntrsiopulercqeu. adrupole Mass Spectrometer equipped with an 6.1.2 HP1100 low pulse solvent pumping system, solvent degasser, column
compartment, and autosampler
7.0 S u p p l ie s a n d M a t e r ia l s ______________________________________________________________________ 7.1 Supplies
7.1.1 High purity grade air regulated to approximately 100 psi (house air system) 7.1.2 HinPtLheCraanwadlyattiacal column, specifics to be determined by the analyst and documented 7.1.3 Capped autovials or capped 15 ml centrifuge tubes
8.0 R e a g e n t s a n d S t a n d a r d s____________________________________________________________________ 8.1 R eagents
8 .1 .1 Methanol, HPLC grade or equivalent 8.1.2 Milli-QTM water (ASTM type I), all water used in this method should be ATSM
tvyepnedoI,ror equivalent, and be provided by a Milli-Q TOC Plus system or other 8.1.3 Ammonium acetate, reagent grade or equivalent
8 .1.3.1 When preparing different amounts than those listed, adjust accordingly. 8.1.3.2 2.0 mM ammonium acetate solution: Weigh approximately 0.300 g
ammonium acetate. Pour into a 2000 mL volumetric container containing 2000 mL Milli-QTM water, mix until all solids are dissolved. Store at room temperature.
Analysis of LivEeTrSE-x8t-r7a.c0t Using ES/MS
Page 3 of 10
3M Environmental Laboratory
Page 60
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
8.2 Standards 8.2.1 Typically two method blanks, two matrix blanks, and eighteen matrix standards are prepared during the extraction procedure. Refer to ETS-8-6.0.
9.0 S a m p l e H a n d l in g _______________________________________________________________ ______________ 9.1 aFrreesshtomreadtriinx csatapnpdeadrdasutaorveiaplrseporarceadppweidth1e5acmhl acnenaltyrsifius.geEtxutbraecstuedntsiltaanndaalrydssis.and samples 9.2 tIefmanpearlyastuisrew, iollrbreefdrieglearyaetded, eaxttraapcptreodxsitmanadtealryd4sanCd, usanmtilpalensamlysaiys bcaenstboerepderaftorromoemd.
10.0 Q u a l it y C o n t r o l ______________________________________________________________________ _ 10.1 M ethod B lanks'and M atrix Blanks
10.1.1 eSaoclhvebnattcbhlatnoksd,etmeremthionde bcolanntkams, iannadtimonatorrixcabrlraynokvsera.re prepared and analyzed with 10.1.2 Analyze a method blank and a matrix blank prior to each calibration curve. 10.2 Matrix Spikes 10.2.1 rMecaotrviexrsypeikffeicsieanrecyp.repared and analyzed to determine the matrix effect on the 10.2.2 rMecaotrviexryspfiokreedaucphliacnaatelystea.re prepared and analyzed to measure the precision and the 10.2.3 mAninailmyzuemaomfa2trsipxikspeiskpeearnbdatmcha.trix spike duplicate per forty samples. With a 10.2.4 trMhaenatgirneixiotisfaplthickeaeliinabinrtdaiatlimocnaatlrciiubxrrvaspeti.ioknAe cdduduripvtlieio.cnaatel scpoinkceenctornacteionntrsawtioilnl sfamllaiyn ftahlel imnitdh-eralnogwe- of 10.3 Continuing Calibration Checks 10.3.1 oCfotnhteincuailnibgrcaatiloibnracutirovne.verifications are analyzed to verify the continued accuracy 10.3.2 oAnneaplyezrebaatmchid. -range calibration standard every tenth sample, with a minimum of
11.0 C a l ib r a t io n and S t a n d a r d iz a t io n __________________________________________________ 11.1 Analyze the extracted matrix standards prior to and following each set of sample extracts.
The average of two standard curves will be plotted by linear regression (v = mx + b), weighted 1/x, not forced through the origin, using MassLynx or other suitable software. 1 1 . 2 sItfatnhdeacrudrcvuerdvoee(sifnnoetcmeseseatrrye)qaunidrermeaenntaslypzeer.form routine maintenance or reextract the
Analysis of LivEeTrSE-x8t-r7a.c0t Using ES/MS
3M Environmental Laboratory
Page 4 of 10
Page 61
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
11.3 For purposes of accuracy when quantitating low levels of analyte, it may be necessary to use the low end of the calibration curve rather than the full range of the standard curve. cEaxlaibmraptlieo:n wcuhrevneactotenmsipsttiinngg otof qthueansttaitnadtearadpspfrrooxmim5apteplby t1o0 1p0p0bpopfbanraatlhyetre,thgaennetrhaetefuall range of the curve (5 ppb to 1000 ppb). This will reduce inaccuracy attributed to linear regression weighting of high concentration standards.
12.0 P r o c e d u r e s ___________________________________________________________________________________ 12.1 A cquisition Set up
12.1.1 Set up the sample list. 12.1.1.1 Assign a sample list filename using MO-DAY-last digit of year-increasing letter of the alphabet starting with a 12.1.1.2 Assign a method (MS file) for acquiring 12.1.1.3 Assign an HPLC program (Inlet file) 12.1.1.4 Type in sample descriptions and vial position numbers
12.1.2 To create a method click on method in the Acquisition control panel then mass RasppeepacrctotrpioormniaeMtteeormnhaitesoasredisin.ngg)As. afSnuedltl sIsecolanenicztaisStiIuoRsnu(MaSllioyndgceloeallsIeocantpepRdreoacploorrinadgtienwgai)nthdormthMaeRsSsMItRos(4.M9Su9altovirpeloether GafrcUaqgIumDiseEintitToanOtiomDneAtihnTofoAdr.mAIaCftMQionUSI/mMSIaSTyIibOnesNtcrouflomlreecantdetdsdi.atiroReneeafmleripntlfoooyMremdica,rtaioodmndaiatsinsodnMaMlapRssrMLody.uncxt ion
12.1.3 Tmyaptriicxalsltyanthdearadnsa. lytical batch run sequence begins and ends with a set of extracted 12.1.4 aSfatmerpelveesrayreteannthalsyazmedplwe.ithSoalcvoennttinbulainnkgscashlioburladtiobne avnerailfyiczaedtiopneriniojdecictaedllysttaondard
minoclnuidtoerdpaossssuibclhe. analyte carryover and are not considered samples but may be 12.2 U sing the Autosam pler
12.2.1 Set up sample tray according to the sample list prepared in Section 1 2 .1 .1 . 12.2.2 Set-up the HP1100/autosampler at the following conditions or at conditions the
analyst considers appropriate for optimal response. Record actual conditions in the instrument logbook: 12.2.2.1 Sample size = 10 pL injection 12.2.2.2 Inject/sample = 1 12.2.2.3 Cycle time = 9 minutes
Analysis of LivEeTrSE-x8t-r7a.c0t Using ES/MS
3M Environmental Laboratory
Patte 5 of 10
Page 62
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
12.2.2.4 Solvent ramp conditions
Time MeOH
0.00 min. 1.0 min. 4.5 min. 6.5 min. 7.0 min. 9.0 mi.
40% 40% 95% 95% 40% 40%
2.0 mM Ammonium acetate
60% 60% 5% 5% 60% 60%
12.2.2.5 Press the "Start" button.
12.3 Instrum ent Set-up 12.3.1 Refer to ETS-9-24.0, "Operation and Maintenance of the Micromass Quattro II ITornipizlaetQiounaSdoruuprcoele,"MfoarssmSopreecdtreotamilest.er Fitted with an Atmospheric Pressure 12.3.2 Check the solvent level in reservoirs and refill if necessary. 12.3.3 tCuhnheseatcitpkis.ftahTcethosertyat'ii,pndlseihsssaosussltedemeblbeclaeflpatihtllewarpiytrhoabnteothajeangdegnrededpolefadctgheeetshp.eroIsfbtatehi.nelUetisspseisastnefeoeluycneadppitieolclaebreyto. check 12.3.4 Turn on the nitrogen. 12.3.5 Ohepaetenrsth. e tune page. Clicks on operate to initiate source block and desolvation 12.3.6 Open the Inlet Editor. 12.3.6.1 Set HPLC pump to "On" 12.3.6.2 Set the flow to 10 - 500 uL/min or as appropriate 12.3.6.3 Observe droplets coming out of the tip of the probe. A fine mist should be ethxepetilpleodfwthitehpnroobneitirfongoenmliesatkiisnogbasreoruvnedd the tip of the probe. Readjust 12.3.6.4 Allow to equilibrate for approximately 10 minutes. 12.3.7 The instrument uses these parameters at the following settings. These settings may change in order to optimize the response: 12.3.7.1 Drying gas 250-400 liters/hour 12.3.7.2 ESI nebulizing gas 10-15 liters/hour 12.3.7.3 HPLC constant flow mode flow rate 10 - 500 pL/min 12.3.7.4 PHrPeLssCuries <o4p0er0abtianrg(cTohrirsepctalrya.)meter is not set, it is a guide to ensure the 12.3.7.5 Source block temperature 150 12.3.7.6 Desolvation temperature 250
Analysis of LivEeTrSE-x8t-r7a.c0t Using ES/MS
Pase 6 of !0
3M Environmental Laboratory
Page 63
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
12.3.8 Ptarpinedt tihnetotutnhee pinasgter,umwietnht iltosgp. arameters, and store it in the study binder with a copy 12.3.9 MeCnladicskssLaomynnpxslteavrneturbmsuiobtnteosrn,irniencfletuhrdeteoAsacapqllpursioaspimtripoialnteesCMtoonabtsresoLlaynPnaaxlnyeUzlesd(et.rh'iss Gmuaiydev)a.ryEanmsuornegstart and
13.0 D a t a A nalyses a n d C a l c u l a t io n s 13.1 Calculations:
_________________________________________________ _
13.1.4 Calculate matrix spike percent recoveries using the following equation:
% Recovery = Observed Result - Background Result x 100 Expected Result
13.1.5 Calculate percent difference using the following equation:
% Difference = Expected Cone. - Calculated Cone, x 100 Expected Cone.
13.1.6 Calculate actual concentrations in matrix (jag/g):
(ng o f PFOS calc, from std. Curve x Dilution Factor) x 1 ug
(Initial Weight of Liver (g)
1000 ng
Final Volume (mL)
14.0 M e t h o d P e r f o r m a n c e ______________________________________________________________________ 14.1 Method Detection Limit (MDL) and Limit of Quantitation (LOQ) are method, analyte, and
matrix specific. Refer to ETS-8-6.0, Attachm ent B for a listing of current validated MDL and LOQ values. 14.2 Solvent Blanks, M ethod Blanks and M atrix Blanks 14.2.1 Sstoalnvdeanrtdbilnanthkes,cmaleibthraotdiobnlacnukrsv,ea. nd matrix blanks must be below the lowest
14.3 Calibration Curves 14.3.1 The r value for the calibration must be 0.980 or better.
14.4 M atrix Spikes 14.4.1 Matrix spike percent recoveries must be within 30% of the spiked concentration.
14.5 Continuing Calibration Verification 14.5.1 Continuing calibration verification percent recoveries must be within 30% o f the spiked concentration.
14.6 If criteria listed in the method performance section are not met, maintenance may be performed on the system and samples reanalyzed or other actions as determined by the analyst. Document all actions in the appropriate logbook.
Analysis of LivEeTrSE-x8t-r7a.c0t Using ES-'MS
3M Environmental Laboratory
Page 7 of 10
Page 64
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
14.7 fIofodtantoateadreotno tbaeblreespoarntdeddiwschuesnsepderifnorthmeatnecxet corfittehreiarehpaovret.not been met, the data must be
15.0 P o l l u t io n P r e v e n t io n a n d W a s t e M a n a g e m e n t ___________________________________ 15.1 Sample extract waste and flammable solvent is disposed in high BTU containers, and glass
pipette waste is disposed in broken glass containers located in the laboratory.
16.0 R e c o r d s _______________________________________________________________________________________ 16.1 hEeaacdhepraogrehgaennderwartietdtenforona tshtuedpyagmeu: ststhuadvyeotrhperfoojleloctwninumg binefro,ramcqatuiiosnitiionnclmudeetdhoedit,her in the
integration method, sample name, extraction date, dilution factor (if applicable), and analyst.
16.2 Print the tune page, sample list, and acquisition method from MassLynx to include in the appropriate study folder. Copy these pages and tape into the instrument runlog.
16.3 Plot the calibration curve by linear regression, weighted 1/x, then print these graphs and
store in the study folder.
'
16.4 Panrdintstdoarteaininttehgersattuiodny sfuomldmera. ry, integration method, and chromatograms from MassLynx
16.5 Summarize data using suitable software (Excel 5.0+) and store in the study folder, refer to Attachment A for an example of a summary spreadsheet.
16.6 Back up electronic data to appropriate medium. Record in study notebook the file name and location of backup electronic data.
17.0 T a b l e s . D ia g r a m s , F l o w c h a r t s , and V a l id a t io n D ata___________________________ 17.1 Attachment A: ETS-8-7.0 Data summary spreadsheet
18.0 R e f e r e n c e s ___________________________________________________________________________________ 18.1 FACT-M-2.1, "Extraction of Potassium Perfluorooctanesulfonate or Other Fluorochemical
Compounds from Liver for Analysis Using HPLC-Electrospray/Mass Spectrometry" 18.2 EIoTnSiz-a9t-i2o4n./0M, a"OsspSerpaetcitornomanedteMr QaiunattetnroanIcIetroipfltehqeuMadicrruopmolaessSyAsttmemossp"heric Pressure 18.3 The validation report associated with this method is ETS-8-6.0 & 7.0-V-l
19.0 A f f e c t e d D o c u m e n t s _______________________________________________________________________ 19.1 ETS-8-6.0, "Extraction of Potassium Perfluorooctanesulfonate or Other Fluorochemical
Compounds from Liver or Fluid for Analysis Using HPLC-Electrospray/Mass Spectrometry"
Analysis of LivEeTrSE-x8t-r7a.c0t Using ES/MS
3M Environmental Laboratory
Pane 8 of 10
Page 65
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
20.0 R ev isio n s
Revision Number
Reason For Revision
Revision
D ate
ETS-8-7.0 Analysis of Liver Extract Using ES/'MS
3M Environmental Laboratory
Pace 9 of 10
Page 66
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Laboratory Study #
S tu d y :
Test Material: Matrix/Final Solvent: _ Method/Revision: Analytical Equipment System Number: Instrument Software/Version: Filename: R-Squared Value: Slope: Y Intercept: Date of Extraction/Analysh Date of Analysis/Analyst:
Group Sample# Concentration Dose ng/g
Initial Wt. g
Dilution Factor
Final Cone, "g/g
Group/Dose: Taken from the study folder. Sample#: Taken from the study folder. Concentration (ng/g): Taken from the MassLynx integration summary. Initial VVt. (g): Taken from the study folder. Dilution Factor: Taken from the study folder. Final Cone, (ug/g): Calculated by dividing the initial volume from the concentration
Attachment A: Summary Spreadsheet Analysis of LivEeTrSE-x8t-r7a.c0t Using ES/'MS
3M Environmental Laboratory
Page 10 of !0
Page 67
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
3M Environmental Laboratory
M ethod E x tr a c tio n ,of P o tassium Perfluo ro o ctanesulfo nate o r O th er
HPLC-F l u o r o c h e m i c a l c o m p o u n d s f r o m S e r u m f o r A n a l y s is U s i n g
E lectro spray/M ass S pectro m etry
M ethod Num ber: ETS-8-4.1
Adoption Date: 03/01/99
Author: Lisa Clemen, Glenn Langenburg
Revision Date: 7 /3 7/99
___ 0 /JSApproved By:
Laboratory Manager
--
7 /?> ' Date
A i'^ IJ l -----------Group Leader Technical Reviewer
/W7Date
DCa't7e 9
s i
li
1.0 S c o p e a n d A p p l ic a t io n ___________ ____________________________________________________________ 1.1 oSrcoopthee:r Tflhuiosrmocehtehmodicaisl fcoormthpeouenxtdrsacfrtioomn osefrpuomta. ssium perfluorooctanesulfonate (PFOS) 1.2 A pplicable com pounds: Fluorochemical surfactants or other fluorinated compounds.
1.3 tMheatvrailciedsa:tioRnabrebpito,rrt.at, bovine, monkey, and human serum or other fluids as designated in
Word 6/95
ETS-8-4.1 Extraction of PFOS from Serum
3M Environmental Laboratory
Page 1 of 14
Page 68
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C3G laboratory Request Number-U2279
2.0 S u m m a r y o f M e t h o d ____________________________________________________________________
2.1 This method describes the procedure for extracting potassium perfluorooctanesulfonate
(PFOS) or other fluorochemical surfactants from serum, or other fluids, using an ion
pairing reagent and methyl-ieri-butyl ether (MtBE). In this method, seven
fluorochemicals were extracted: PFOS, PFOSA, PFOSAA, EtFOSE-OH, PFOSEA,
M556, and the sample
surrogate standard and the analyte ion
(see pair
3is.0pDaretfiitnioitnieodn
sin).toAMntBioEn.
pairing reagent is added The MtBE extract is
to
removed and put onto a nitrogen evaporator until dry. Each extract is reconstituted in 1.0
mL o f methanol, then filtered through a 3 cc plastic syringe attached to a 0.2 pm nylon
filter into glass autovials.
2.2 mTheethseodssa.mple extracts are analyzed following method ETS-8-5.1 or other appropriate
3.0 D e f in it io n s _____________________________________________________________________________________ 3.1 PFOS: perfluorooctanesulfonate (anion o f potassium salt) C8Fl7S 0 3` 3.2 PFOSA: perfluorooctane sulfonylamide C8F]7SO-,NH-.
3.3 PFOSAA: perfluorooctane sulfonylamido (ethyl)acetate C8F17S 0 3N(CH3CH3)CH2C 0 3'
3.4 EtFOSE-OH: 2(N-ethylperfluorooctane sulfonamido)-ethyl alcohol CsF17S 0 2N(CH2CH3)CH3CH30H
3.5 PFOSEA: perfluorooctane sulfonyl ethylamideCsFl?S 0 2N(CH3CH3)H
3.6 M556: C8Fl7S 0 3N(H)(CH2C 00H ) 3.7 Surrogate standard: 1H-1H-2H-2H perfluorooctane sulfonic acid
4.0 W a r n in g s a n d C a u t io n s ______________________________________________________________________ 4.1 H ealth and safety warnings
4.1.1 Use universal precautions, especially laboratory coats, goggles, and gloves when handling animal tissue, which may contain pathogens.
5.0 I n t e r f e r e n c e s _________________________________________________________________________________ 5.1 There are no interferences known at this time.
6.0 E q u ip m e n t __________________________________________________________________________
6 .1 Tachceepfotallbolwe.ing equipment is used while performing this method. Equivalent equipment is 6.1.1 Vortex mixer, VWR, Vortex Genie 2 6 .1 . 2 Centrifuge, Mistral 1000 or IEC
6.1.3 Shaker, Eberbach or VWR
ETS-8-4.1 Extraction of PFOS from Serum
3M Environmental Laboratory
Page 2 of 14
Page 69
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
6.1.4 Nitrogen evaporator, Organomation 6.1.5 Balance ( 0.100 g)
7.0 S u p p l ie s a n d M a t e r ia l s _______________________________________________________________
7.1 Gloves
7.2 Eppendorf ordisposable pipettes
7.3 Nalgene bottles, capable of holding 250 mL and 1 L
7.4 Volumetric flasks, glass, type A
7.5 I-CHEM vials, glass, 40 mL glass
7.6 Centrifuge tubes, polypropylene, 15 mL
7.7 Labels
*
7.8 Oxford Dispenser - 3.0 to 10.0 mL
7.9 Syringes, capable o f measuring 5 pL to 50 pL
7.10 Graduated pipettes
7.11 Syringes, disposable plastic, 3 cc
7.12 Syringe filters, nylon, 0.2 pm, 25 mm
7.13 Timer
7.14 Crimp cap autovials and caps
7.15 Crimpers
Note: Prior to using glassware and bottles, rinse 3 times with methanol and 3 times with Milli-QTM water. Rinse syringes a minimum of 9 times with methanol, 3 rinses from 3 separate vials.
8.0 R e a g e n t s a n d S t a n d a r d s ____________________________________________________________________ 8 .1 TbeypMeilIlir-eQaTMgenwt agtreardaenwdamtear,yMbeillpi-rQovTMideodr beqyuaivMalielnlit-;QalTl OwCatePrluussTMed siynstthemis method should 8.2 Sodium hydroxide (NaOH), J.T Baker or equivalent 8.3 Tetrabutylammonium hydrogen sulfate(TBA), Kodak or equivalent 8.4 Sodium carbonate (Na^Oj), J.T. Baker or equivalent 8.5 Sodium bicarbonate (NaHCOj), J.T. Baker or equivalent 8 . 6 Methyl-T-Butyl Ether, Omnisolv, glass distilled or HPLC grade 8.7 Methanol, Omnisolv, glass distilled or HPLC grade 8 . 8 Serum or blood, frozen from supplier 8.9 Fluorochem ical standards
8.9.1 PFOS (3M Specialty Chemical Division), molecular weight = 538 8.9.2 PFOSA (3M Specialty Chemical Division), molecular weight - 499
Extraction EoTf PSF-8O-4S.1from Scrum
Page 3 of 14
3M Environmental Laboratory
Page 70
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03C laboratory Request Number-U227S
8.9.3 PFOSAA (3\1 Specialty Chemical Division), molecular weight = 585
8.9.4 EtFOSE-OH (3M Specialty Chemical Division), molecular weight = 570
8.9.5 PFOSEA (3M Specialty Chemical Division), molecular weight = 527
8.9.6 M556 (3M Specialty Chemical Division), molecular weight = 557
8.9.7 Surrogate standard: 4-H, perfluorooctane sulfonic acid (l-H .l-H , 2-H, 2-H C8Fl3S 0 3H) molecular weight = 428
8.9.8 Other fluorochemicals, as appropriate
8.10 Reagent preparation
NOTE: When preparing larger volumes than listed in reagent, standard, or surrogate preparation, adjust accordingly.
8.10.1 10 N sodium hydroxide (NaOH): Weigh approximately 200 g NaOH. Pour into a d1i0s0so0 lvmeLd.beSatkoerre cinonata1inLinNga5lg0e0nme LboMttliel.li-QTM water, mix until all solids are
8.10.2 1 N sodium hydroxide (NaOH): Dilute 10 N NaOH 1:10. Measure 10 mL oflO NMiNllai-OQHTMswolautteiro.n Sintotoreain10a01m25LmvoLluNmaelgtreinceflbaostktlae.nd dilute to volume using
8.10.3 NoM01.0fa5iTOlulMiBsH-iQAn,tgTMeaitdnradatpwobp'sauarltotoeywlrxl.iaLlmymSvatbmooteelrouclenyamiui4unes4mteartitoch1hye5Lcdo4prNnHomtagaLlceignhneoiannsfnuegg1lbef05aso0tNt0eatlbNe(mrT.auLBOpAtMHly):i)(l.lWWi-DQheiiiTMlgluehteawadtapodtpeivnrro.golxAutihmdmejaueltsaewtsltyittomh1pL6H9ogf
8.10.3.1
TBA requires a check prior to each use to ensure pH = 10. Adjust as
... needed using 1 N NaOH solution.
8.10.4
0ap.2p5roMximsoadtieulmy 2c6a.5rbgonoafteso/sdoiduimumcabribcoanrbatoena(NteabjCuf0fe3r)
a(nNda
,C 21
0.03/gNoafHsCod0i3u)m: W
eigh
bicarbonate (NaHC03) into a 1 L volumetric flask and bring to volume with Milli-
QTM water. Store in a 1 L Nalgene bottle.
8.11 Standards preparation
8 .1 1 . 1 Prepare PFOS standards for the standard curve.
8.11.2 Prepare other fluorochemical standards, as appropriate. Multicomponent sf1lo.u1luo0rtiopocpnhmecmoEnitctFaaOilnSsitnEagn-Od1aH.0r.d0)spaprme aPcFceOpSta, b1l.e02(foprpmexaPmFOplSe,Ao,n0e.9w8o7rpkpinmg PstFanOdSaArdA, and
8.11.3 tWheeiagchtuaaplpwreoixgihmt.ately 100 mg of PFOS into a 100 mL volumetric flask and record
8.11.4 B(prgi/nmgLto).volume with methanol for a stock standard of approximately 1000 ppm
8.11.5 Dapilpurtoextihmeastteolyck50sopluptmio.n with methanol for a working standard 1 solution of
8.11.6 aDpiplurtoex.w5o.r0kpinpgms.tandard 1 with methanol for a working standard 2 solution of
Extraction EofTPSF-8O-4S.1from Serum
Page 4 of 14
3M Environmental Laboratory
Page 71
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
8.11.7 aDppilruotxe.w0o.5r0kipnpgmst.andard 1 with methanol for a working standard 3 solution of
8.12 Surrogate stock standard preparation 8.12.1 Weigh approximately 50-60 mg o f surrogate standard l-H .l-H , 2-H, 2-H, C8Fl3S 0 3H into a 50 mL volumetric flask and record the actual weight. 8.12.2 pBprmin.g `to volume with methanol for a surrogate stock of approximately 1000-1200 8.12.3 Pstroecpkarteo aa s1u0rrmogLatveolwuomrektirnigc sfltaasnkdaarndd. bTrrinagnstfoervoaplupmroexiwmitahtemlyet1hmanLoloffosruarrogate working standard of 100 ppm. Record the actual volume transferred.
9.0 S a m p l e H a n d l in g ______________________________________________________________________________
9.1 All samples are received frozen and must be kept frozen until the extraction is performed. 9.2 Allow samples to thaw to room temperature prior to extraction.
10.0 Q u a l it y C o n t r o l ____________________________________________________________________________
10.1 Solvent Blanks, M ethod blanks and matrix blanks
10.1.1 An aliquot o f 1.0 mL methanol is used as a solvent blank.
10.1.2 aEsxtmraectht otwdobl1a.n0kms.L aliquots ofMilli-QTM water following this procedure and use
10.1.3
Extract two 1.0 matrix blanks.
mL See
aliquots 11.1.4.
o
f
the
serum
following
this procedure and
use
as
10.2 M atrix spikes
10.2.1 Pthreepaacrceuraancdyaonfatlhyezeexmtraatrcitxiosnp.ike and matrix spike duplicate samples to determine
10.2.2 mPraetpraixrereeacecihvesdpiwkeithuseinagchassaammpplleesceht.osen by the analyst, usually the control
10.2.3 Expected concentrations will fall in the mid-range o f the initial calibration curve. Additional spikes maybe included and may fall in the low-range of the initial calibration curve.
10.2.4 Prepare one matrix spike and matrix spike duplicate per 40 samples, with a minimum of 2 matrix spikes per batch.
10.3 Continuing calibration checks
10.3.1 Prepare continuing calibration check samples to ensure the accuracy of the initial calibration curve.
10.3.2 Prepare, at a minimum, one continuing check per group of 10 samples. For example, if a sample set = 34, four checks are prepared and extracted.
10.3.3 Pthreepinariteiaelaccuhrvcoe.ntinuing calibration check from the same matrix used to prepare
Extraction EofTPSF-O8-S4.f1rom Serum
3M Environmental Laboratory
Page 5 of 14
Page 72
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
10.3.4 cTalhibereaxtpioenctceudrvcoe.ncAendtdriattioionnasl wspilikl efsallmwaiythbien itnhcelumdiedd-rtahnagt efaollf itnhethieniltoiawl-range of
the initial calibration curve. This is necessary if the analyst must quantitate using
to5hnpalnpybth-e
low end of 1000 ppb).
the
calibration
curve
(for example,
5
ppb -
100 ppb,
rather
11.0 C a l ib r a t io n a n d S t a n d a r d iz a t io n __________________________________________ ____
11.1 Prepare m atrix calibration standards 11.1.1 Transfer 1 mL of serum to a 15 mL centrifuge tube.
11.1.2 If most sample volumes are less than 1.0 mL, extract standards with matrix mvoalturmixe. sReeqcuoarldtoeatchhe ssaammppllee vvoolluummeeso. nDthoeneoxttreaxctrtaiocnt lsehsesetth. an 0.50 mL o f
11.1.3 bWethwileeepnraepliaqruiontgs.a total of twenty aliquots in 15 mL centrifuge tubes, mix or shake
11.1.4 Two 1 mL aliquots, or other appropriate volume, serve as matrix blanks. Typically use the standard concentrations and spiking amounts listed in Table 1, at the end o f this section, to spike, in duplicate, two standard curves, for a total of eighteen standards, two matrix blanks, and two method blanks.
11.1.5 Refer to validation report ETS-8-4.0 & ETS-8-5.0-V -1, which lists the working ranges and the Linear Calibration Range (LCR) for calibration curves.
11.1.6 csUtaaslniebdAraartttdiaosc.nhmsSteaeenndtSaDercdtasiso. nan1a3i.d0 itno ccaallccuullaattienagctthuealccoonncceenntrtraatitoionnssooffthPeFwOoSrkining 11.2 To each standard, blank, or continuing check, add appropriate amount of surrogate
w1 0o0r0kipnpgbs.tandard for the concentration to fall within the calibration curve range 5 ppb 11.3 tEoxtersatactblsipshikeedacmh aintriitxiasltcaunrdvaerdosnftohlelomwainssg s1p2e.c6t-r1o2m.1e6tero.f this method. Use these standards
Extraction EofTPSF-8O-4S.1from Scrum
3M Environmental Laboratory
Page 6 of 14
Page 73
3m Medical Department Study: T-6295.7
Report N o . FACT TOX-030 laboratory Request Number-U2279
Table 1
Approxim ate spiking amounts for standards and spikes
Using 1.0 mL of matrix
Working standard
pL Approx, final cone, of
(approx, cone.)
analyte in matrix
` - - Blank
0.500 ppm 1 0 0.005 ppm
0.500 ppm 2 0 0 . 0 1 0 ppm
5.00 ppm
5 0.025 ppm
5.00 ppm
1 0 0.050 ppm
5.00 ppm
2 0 0 . 1 0 0 ppm
50.0 ppm
5 0.250 ppm
50.0 ppm
1 0 0.500 ppm
50.0 ppm
15 0.750 ppm
50.0 ppm
20 .
1 . 0 0 ppm
12.0 P r o c e d u r e ____________________________________________________________________________________ 12.1 wOabttearibnaftrho.zen samples and allow to thaw at room temperature or in a lukewarm 12.2 pVoolrytperxompyixlenfoerc1e5ntsreicfuognedst,ubthee. n transfer 1.0 mL or other appropriate volume to a 15 mL 12.3 Return unused samples to freezer after extraction amounts have been removed. 12.4 Record the initial volume on the extraction worksheet.
12.5 wLaobrkelshtheeettufobredwoictuhmtheentsitnugdythneurmembeari,nsinamg sptleepIsD. , date and analyst initials. See attached 12.6 Spike all samples, including blanks and standards, ready for extraction with surrogate
standard as described in 1 1 .2 . 12.7 cS1opinniktitenhueaatincsgheccmtaioalitnbr,rixafotwirointthhesttachnaeldiabaprrpdarsti.oopnricautervaemsotaunndtaorfdss.tanAdlasrodparsepdaersecrmibaetdrixinsp1i1k.1es, oarndTable 12.8 Vortex mix the standard curve samples, matrix spike samples, and continuing calibration
samples for 15 seconds. 12.9 Check to ensure the 0.5 M TBA reagent is at pH 10. If not, adjust accordingly. 12.10 bTiocaerabcohnsaatembpuleff,eard. d 1 mL 0.5 M TBA and 2 mL of 0.25M sodium carbonate/sodium 12.11 Using an Oxford Dispenser, add 5 mL methyl-feri-butyl ether.
12.12 Cap each sample and put on the shaker at a setting of 300 rpm, for 20 minutes.
12.13 sCeepnatrraitfeudg.e for 2 0 to 25 minutes at a setting of 3500 rpm, or until layers are well
Extraction oEfTPSF-O8-S4.f1rom Serum
Page 7 of 14
3M Environmental Laboratory
Page 74
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
12.14 Label a fresh 15 mL centrifuge tube with the same information as in 12.5. 12.15 Remove 4.0 mL of the organic layer to this clean 15 mL centrifuge tube. 12.16 Phouutresa.ch sample on the analytical nitrogen evaporator until dry, approximately 1 to 2 12.17 Add 1.0 mL of methanol to each centrifuge tube using a graduated pipette. 12.18 Vortex mix for 30 seconds. 12.19 Asytrtiancghe.a 0F.i2lteprminntoyloan1.m5 emshL fgilltaesrstaouato3vicacl soyrrlionwge-vaonldumtreanasufetrovtihael swahmepnlenetocetshsiasry. 12.20 Label the autovial with the study number, animal number and gender, sample timepoint,
matrix, final solvent, extraction date, and analyst(s) performing the extraction. 12.21 Cap and store extracts at room temperature or at approximately 4 C until analysis. 12.22 nCootmebpoleotke otrheinecxlturdaectiinonstwudoyrkbsihnedeetr,,aatstaacphperdotporitahties. document, and tape in the study
13.0 D a t a A n a l y s is a n d C a l c u l a t io n s _______ ;________________________________________________ 13.1 Calculations
13.1.1 cCaalilbcuralatitoenacsttuanadl acrodnsceunstirnagtitohnesfoofllPowFOinSg, eoqruoatthioenr:applicable fluorochemical, in mLmLofosftastnadnadradrd+ xmcLonocfesnutrrraotigoanteosftastnadnadradrd+ (iungiti/aml Lm)a_t_r_ix__v_o_l_u_m__e__(m__L__)___=
Final Concentration (pg/mL) of PFOS in matrix
14.0 M e t h o d P e r f o r m a n c e _____________________________________________________________________ 14.1 TfohrespmeectihfoicdMdeDteLctainond lliimmiitt o(Mf qDuLan) tiistaatnioanly(tLe OanQd) mvaalturiexs s(pseeeciAfict.tacRhemferentotsMBDaLndreCpo).rt 14.2 The following quality control samples are extracted with each batch of samples to
evaluate the quality o f the extraction and analysis. 14.2.1 Method blanks and matrix blanks. 14.2.2 Matrix spike and matrix spike duplicate samples to determine accuracy and
precision of the extraction. 14.2.3 Cinoitniatilncuailnibgrcaatiloibnractuirovne.check samples to determine the continued accuracy o f the 14.3 Refer to section 14 o f ETS-8-5.1 for method performance criteria.
15.0 P o l l u t i o n P r e v e n t io n a n d W a s t e M a n a g e m e n t ____________________________ 15.1 Sample waste is disposed in biohazard containers, flammable solvent waste is disposed in
high BTU containers, and used glass pipette waste is disposed in broken glass containers located in the laboratory.
Extraction EoTf PSF-8O-4S.1from Serum
Page 8 of 14
3M Environmental Laboratory
Page 75
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03Q laboratory Request Number-U2279
16.0 R e c o r d s ___________________________________________________________________________
16.1 Cnootmebpoloetke otrheinecxlturdaectiinonthweo3r-krsinhgeesttuadttyacbhineddetro, tahsisapmpertohpordia,tae.nd tape in the study
17.0 A t t a c h m e n t s ____________________________________________________________________________ 17.1 Attachment A, Extraction worksheet
17.2 Attachment B, MDL/LOQ values and summary 17.3 Attachment C, Calibration standard concentration worksheet
18.0 R e f e r e n c e s _______________________________________________________________________ 18.1 The validation report associated with this method is ETS-8-4.0 & 5.0-V -l. 18.2 FACT-M-3.1, "Analysis of Serum or Other Fluid Extracts for Fluorochemicals using
HPLC-Electrospray Mass Spectrometry"
19.0 A f f e c t e d D o c u m e n t s ________________________________________________________________________
19.1 HETPLS-C8--E5.l1e,ctr"oAsnparalyysMis aosfsSSepruecmtroormOettrhye"r Fluid Extracts for Fluorochemicals using
20.0 R e v is io n s _____________________________________________________________________________________
RNeuvmisbioenr 1 '
Reason For Revision Section 12.21 Changed to include sample storage at room temperature. Section 12.13 Added the shaker speed. Sleescstitohnan121..017mFLi.nal volume is 1.0 mL; not adjusted for initial volumes
ReDvaistieon 04/02/99
Extraction EofTPSF-8O-4S.1from Scnim
3M Environmental Laboratory
Page 9 of 14
Page 76
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030
laboratory Request Number-U2279
Extraction Worksheet ETS-8-4.1
Study #
Surrogate Std
Matrix Box rt
approx, ppm actual ppm
Wk/Dav
U
DateSpiked/Analyst
CCV !
MS l
MSD !
. i'
--
j !1 i ! *i
FC-Mix approx. 0.5 pm actual ppm #
FC-Mix approx. 5 ppm actual ppm
TUt
FC-Mix approx. 50 ppm actual ppm
#
Comments
--
_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ i1_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ 1i i
-.
-
-
-
-
-
-
-
-
-
-
--
--
i -- --
Blank Std U amount =
Serum Extraction Method
:
Vortex 15 sec.
Pipette Matrix
Volume
mL
Pipette 1mL of 0.5 M TBA, pH 10. pH =
Std. U
Pipette 2 mL of 0.25 Na;>COy0.25M NaHCOt buffer
Std. #?
Dispense 5 mL of methyl-t-butyl ether
TN-A-
Shake 20 min.
Shaker speed:
Centrifuge 20-25 min.
Centrifuge speed:
Rempve a 4 mL aliquot of organic laver
Put on Nitrogen Evaporator to drvness
Temperature:
Add methanol
Volume
mL TN-A-
Vortex 30 sec.
FCioltnert.uCsianlg. Va e3rcicfiBc-aDtiosnvnsnugseedwisthamae0.m2uamtrifxiltaesr ifnotrosatd1.c5umrvLe.autosample via!
-
-
-
-
-
-
-1 mL
Date & Initials
Attachment A
Extraction EoTf PSF-8O-4S.1from Serum
3M Environmental Laboratory
Page 10 of 14
Page 77
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
MDL/LOQ values for rabbit serum
Com pound MDL LOQ Linear Calibration Range (LCR)
(PPb) (PPb) Approximate concentrations to be used for preparing the
Standard Calibration Curve
PFOS 1.74 5.55 5 ppb - 1000 ppb
PFOSA
1.51 4.79 5 ppb - 1000 ppb
PFOSAA
3.46 20.5 5 ppb - 1000 ppb
EtFOSE-OH 11.4 36.2 5 ppb - 1000 ppb
M 556 6.03 19.2 5 ppb - 1000 ppb
PFOSEA
5.71 18.2 5 ppb - 1000 ppb
MDL/LOQ values in rat, bovine, monkey, and human serum, and monkey plasma were not statistically
determined. Two curves in each of these matrices were extracted and analyzed with the rabbit serum
curves to determine equivalence. Responses in the rat, bovine, monkey, and human were equivalent to
the rabbit responses, therefore, their MDL and LOQ will be the same values as determined in rabbit
serum.
Please see LOQ Summary and MDL study in ETS-8-4.0 & 5.0-V-l for further information.
Attachment B: MDL/LOQ Summary
ETS-8-4.1
Extraction of PFOS from Serum
3M Environmental Laboratory
Page 11 of 14
Page 78
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Compound: PFOS Prepared range
Rabbit Serum of standards (ppb) (ng/mL)
Full Range Low Curve High curve 1/X
0.995 - 978 4.94 - 248 97.8 - 978 0.995 - 978
Compound: PFOSA , Prepared range
Rabbit Serum of standards (ppb) (ng/mL)
Full Range Low Curve High curve 1/X
0.993 - 976 4.93 - 97.6 24.8 - 976 0.993 - 976
Compound: PFOSAA Prepared range
Rabbit Serum of standards (ppb) (ng/mL)
Full Range Low Curve High curve 1/X
0.991 -974 4.92 - 247 49.2 - 974 0.991 - 974
LCR from curve (PPb) (ng/mL)
24.8 - 978
4.94 -248
97.8-978 4.94 - 978
% Recovery Range
83-108 85-104 85-106 94-111
LCR from curve (n(gP/PmbL) )
4.93 - 976
4.93 - 97.6
24.8 - 978 4.93 - 976
% Recovery Range
88-103 87-105 93-102 94-103
LCR from curve (PPb) (ng/mL)
24.7 - 974 9.74 - 247
97.4 - 974
9.74 -974
% Recovery Range
81-111 97-107 85-108 95-115
RSD Range
4.67-11.0 5.34-12.0 4.84-9.80 4.60-10.5
RSD Range
5.10-14.7 9.85-14.7 5.08-13.9 5.10-14.5
RSD Range
4.18-10.6 6.38-21.8 4.33-12.5 4.11-23.2
Attachment B: MDL/LOQ Summary
ETS-8-4.1
Extraction of PFOS from Serum
3M Environmental Laboratory
Page 12 of 14
Page 79
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Compound: EtFOSE-OH
Prepared range Rabbit Serum of standards
(ppb) (ng/mL)
Full Range
0.993 - 976
Low Curve
4.93 - 97.6
High curve
49.3 - 976
1/X 0.993 - 493
Compound: PFOSEA
Prepared range Rabbit Serum of standards
(ppb) (ng/mL)
Full Range
0.993 - 976
Low Curve
4.93 - 248
High curve 1/X
49.3 - 976 0.993 - 976
Compound: M556
Prepared range Rabbit Serum of standards
(ppb) (ng/mL)
Full Range Low Curve High curve 1/X
0.993 - 976 4.93 - 97.6 97.6 - 976 0.993 - 976
LCR from curve (n(gP/PmbL) )
49.3 - 976
9.76-97.6
97.6 - 976
9.76 - 976
% Recovery Range
77-110 97-107 90-109 86-111
LCR from curve (n(gP/PmbL) )
24.8 - 976
9.76 - 248
49.3 - 976 9.76 - 976
% Recovery Range
96-106 91-110 86-106 95-117
LCR from curve (n(gp/pmbL) )
24.8 - 976
9.76-97.6 97.6 - 976
9.76-976
% Recovery Range
88-106 100-105 81-111 97-110
RSD Range
11.2-25.5 14.1-21.3 11.5-19.6 11.1-21.2
RSD Range
10.1-16.2 11.8-19.5 10.2-18.2 10.1-19.1
RSD Range
4.82-17.9 5.95-18.2 5.11-9.74 4.77-19.5
Attachment B: MDL/LOQ Summary
3M Environmental Laboratory
ETS-8-4.1 Extraction of PFOS from Serum
Page 13 of 14
Page 80
3m Medical Department Study: T-6295.7
Report N o . FACT TOX-030 laboratory Request Number-U22 79
Ion Pair Standard Curves - Fluids
Prep date(s):
Standard number:
Analyte(s):
Equipment number:
Sample matrix:
Final solvent and TN:
Blank fluid/identifier:
Method/revision:
Target analyte(s): _
FC mix std approx. 0.500 ppm:
FC mix std approx. 5.00 ppm:
FC mix std approx. 50.0 ppm:
Surrogate std approx. 100 ppm:
Actual concentrations of standards in the FC mix
SuPtdgF/cmOoSLne 0.500 0.500 5.00 55..0000 55550000....000
PFOSA Sut0dg.5/cm0o7Lne 0.507
5.07 5.07 5.07 5500..11 50.1 50.1
PEOSAA Sut0dg.5/cm3o2Lne 0.532
5.32 5.32 5.32 5533..22 53.2 53.2
EtFOSE Sut00dg..55/cm00o11Lne
55..0011 5.01 5500..11 50.1 50.1
PSFut0dgO.5/cmS2o1ELnAe 055...5222111 552.2.11 5522..11 52.1
M556 Sut0dg.5/cm0o1Lne 0.501
55..0011 5.01 55550000....1111
All All
Am't Final voi
spiked mL mL
0.0200 . 0 1 0
| ;
1.015 1.025
0.005 ! 1.010
0.0200 . 0 1 0
i
1.015 1.025
0.005 1.010
0.010 1.015
0.015 1.020
0.020 1.025
Calculated concentrations of standards in the sample matrix
PFOS - PFOSA
PFO SA A E tFO SE PFO SE A
M 556 S urrogate
Final cone Final cone Final cone Final cone Final cone Final cone Std cone
ng/m L 4.93 9 .7 6
ng/m L
5 .0 0 9 .8 9
ng/m L 5.24 10.4
ng/m L 4.94 ; 9.78
ng/m L 5.01
9.93
ng/m L ; 5.13 ' 10.2
ng/m L 100
24.8 : 25.1
26.3
24.8
25.2 : 25.8
S urrogate
49.3 i 50.0
52.4
49.4
50.1 i 51.3
Final cone
97.6 98.9
104
97.8
99.3 102
ng/m L
248 . 251 263 248 252 ! 258 500 493 500 524 494 501 ! 513
735 ! 746
782 : 737
749 1 766
976 ; 989
1038 978 993 ! 1017
A ll A m 't spiked
mL 0.005
Validated ranges - approximate concentrations
S eru m
PFOS
PFOSA
PFOSAA
E tF O SE -O H
PFOSEA
M S56
R abbit
5.00-1000 | 5.00-1000 | 5.00-1000 | 5.00-1000 | 5.00-1000 | 5.00-1000
B ovine
E stim ates only. U se values for rabbit.
Rat E stim ates only. U se values for rabbit.
M onkey & Plasm a E stim ates only. U se values for rabbit.
H um an
E stim ates only. Use values for rabbit.
Attachment C: Ion Pair Standard Curves
ETS-8-4.1
Extraction of PFOS from Serum
3M Environmental Laboratory
Page 14 of 14
Page 81
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
3M Environmental Laboratory
M ethod
A n a ly sis q f Po tassium Perfluo ro o ctanesulfo nate or O th er F lu o r o c h em ic a ls in Ser u m E x tra cts U sing H P L C -E lectrospray/M ass Spectrom etry
M ethod Num ber: ETS-8-5.1
Author: Lisa Clemen, Robert Wynne Approved By:
Adoption Date: 03/01/99 Revision Date:
Laboratory Manager
Group Leader
/-/? .---------------
TechnicaAl RCebvmietw<e-r
Date Date Date
1.0 Sc o p e a n d A p p l ic a t io n _________________________________________________________________ 1.1 Sucsionpge:HPTLhCis-emleectthroodspdreasyc/rmibaesss tshpeecatnraolmyseitsryo.f serum extracts for fluorochemical surfactants 1.2 oAtpheprliicoanbizleabCleomcopmopuonudnsd:sF. luorochemical surfactants or other fluorinated compounds, or
1.3 M atrices: Rabbit, rat, bovine, monkey, and human serum, or other fluids as designated in the validation report.
Word 6/95
ETS-8-5.1 Analysis of Serum Extract Using ES/MS
Page 1of 9
3M Environmental Laboratory
Page 82
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
2.0 S u m m a r y o f M e t h o d ________________________________________________________ ________ __ 2.1 This method describes the analysis of fluorochemical surfactants extracted from serum or
other fluids, using HPLC-electrospray/mass spectrometry, or similar system as appropriate. Tfluheoraoncahleymsiiscaisl,pseurcfohramsetdhebypemrfoluniotrooroincgtaanessiunlgfloeniaotne (cPhFarOaSct)erainsitoicn,omf a/zp=ar4t9ic9u.lar Additionally, samples may be analyzed using a tandem mass spectrometer to further verify the identity o f a compound by detecting daughter ions of the parent ion.
3.0 D e f in it io n s ___________________________________________________________________________ _ 3.1 A tm ospheric Pressure Ionization (API): The Micromass Quattro II triple quadrupole
systems allow for various methods of ionization by utilizing various sources, probes, and interfaces. These include but are not limited to: Electrospray Ionization (ESI), Atmospheric Pressure chemical ionization (APcI), Thermospray, etc. The ionization process in these techniques occurs at atmospheric pressure (i.e., not under a vacuum).
3.2 E lectrospray Ionization (ES, ESI): a method o f ionization performed at atmospheric pressure, whereby ions in solution are transferred to the gas phase via tiny charged droplets. These charged droplets are produced by the application of a strong electrical field.
3.3 M ass Spectrom etry, M ass Spectrometer (MS), Tandem Mass Spectrometer (M S/M S): The API Quattro II triple quadrupole systems are equipped with quadrupole mass selective detectors. Ions are selectively discriminated by mass to charge ratio (m/z) and subsequently dspeteeccifteicd.fraAgmsinengtlaetiMonS imnfaoyrmbaeteiomnp. loyed for ion detection or a series (MS/MS) for more
3.4 C onventional vs. Z-spray probe interface: The latest models of Micromass Quattro II triple quadrupole systems (post 1998) utilize a "Z-spray" conformation. The spray emitted from a probe is orthogonal to the cone aperture. In the conventional conformation it is aimed directly at the cone aperture, after passing through a tortuous pathway in the counter electrode. Though the configuration is different, the methods of operation, cleaning, and cmnooamtincpotaemtnipabnalectiewblaietrhewstihothemsoeanmoeteha.enroHtZho-ewsrpe,rvbaeuyrt,soyZns-tlsyepmrwasiy,thectoscmi.m)piloanresnytsstaemnds c(oi.nev.,eZnt-isopnraaly ccoommppoonneennttss aarree
3.5 M ass Lynx Software: System software designed for the specific operation of these Quattro II triple quadrupole systems. Currently MassLynx has Windows 95 and WindowsNT 4.0 (vMerisciroonms.asAslQl vuearttsrioonIsI atrriepsleimqiulaard.ruFpoorlemMoraessdLeytanixlsosreeMtahsesLmyannxuaNl TspUecsiefric'stGo uthideei)n.strument
4 .0 W a r n in g s a n d C a u t io n s _____________________________________________________________ 4.1 Health and Safety W arnings:
4.1.1
Use caution with the voltage cables for the probe. When engaged, the probe employs a voltage of approximately 5000 Volts.
4.1.2 aWndhecnlohthanindgl.ing samples or solvents wear appropriate protective gloves, eyewear,
ETS-8-5.1 Analysis of Serum Extract Using ES.'MS
Page 2 of 9
3M Environmental Laboratory
Page 83
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
4.2 Cautions: 4.2.1 Do not operate solvent pumps above capacity of 400 bar (5800 psi) back pressure. If the back pressure exceeds 400 bar, the HP 1100 will initiate automatic shutdown. 4.2.2 Do not run solvent pumps to dryness.
5.0 _I n t e r f e r e n c e s ._____________________________________________________________________ 5.1 To minimize interferences when analyzing samples, teflon should not be used for sample
storage or any part o f instrumentation that comes in contact with the sample or extract.
6 .0 E q u ip m e n t ______________________________________________________________________________ 6.1 mEqoudiipfimcaetnitonlisstiendthbeelroawwmdaatyabaes mmoetdhiofideddeinvioartdioenrst.o optimize the system. Document any
6.1.1 MeleicctrroomsparsasyQiuoantitzraotiIoIntrsiopulercqeuadrupole Mass Spectrometer equipped with an 6.1.2 cHoPm1p1a0r0tmloewnt,paunlsde asuotlovseanmt ppulemr ping system, solvent degasser, column
7 .0 S u p p l ie s a n d M a t e r ia l s ________________________________________________________________ 7.1 Supplies
7.1.1 High purity grade nitrogen gas regulated to approximately 100 psi (House air system)
7.1.2 HPLC analytical column, specifics to be determined by the analyst and documented in the raw data.
7.1.3 Capped autovials or capped 15 mL centrifuge tubes
8 .0 R e a g e n t s a n d St a n d a r d s ______________________________________________________________ 8.1 Reagents
8.1.1 Methanol, HPLC grade or equivalent 8.1.2 Milli-QTM water, all water used in this method should be Milli-QTM water or
equivalent, and may be provided by a Milli-Q TOC Plus system or other vendor 8.1.3 Ammonium acetate, reagent grade or equivalent 8.2 Standards 8.2.1 pTryeppiacraeldlydtuwroingmtehtheoedxtbrlaacntikosn, tpwroocmedautrreix. bSleaenkEsT, aSn-d8-e4i.g1h. teen matrix standards are
9.0 Sa m p l e H a n d l in g _______________________________________________________________________ 9.1 Fresh matrix standards are prepared with each analysis. Extracted standards and samples
are stored in capped autovials or capped 15 mL centrifuge tubes until analysis.
Analysis of SerEumTSE-8x-t5r.a1ct Using ES/MS
3M Environmental Laboratory
Page 3 of 9
Page 84
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
9.2 Iafpapnraolxyismisawteillyl 4be Cd,eloaryeadt ,roeoxmtratcetmedpesrtaantudraer,dusnatnildasnaamlypsliesscacannbbeepreerffroirgmereadt.ed at
10.0 Q u a l i t y C o n t r o l _____________________________________________________________________ 10.1 Solvent Blanks, M ethod Blanks and M atrix Blanks
10.1.1 Seaoclhvebnattcbhlatnokds,etmeremthionde bcolanntkams ainnadtimonatroirxcbalrarnykosvearr.e prepared and analyzed with 10.1.2 Analyze a method blank and a matrix blank prior to each calibration curve. 10.2 M atrix Spikes 10.2.1 Matrix spikes are prepared and analyzed to determine the matrix effect on the
recovery efficiency. 10.2.2 Matrix spike duplicates are prepared and analyzed to measure the precision and the
recovery for each analyte. 10.2.3 Amninailmyzuema omfa2trsipxikspeiskpeearnbdamtcha.trix spike duplicate per forty samples, with a 10.2.4 tMheatirnixitisaplickaeliabnrdatmioantrciuxrvspe.ikAe ddduiptliiocnaatel scpoinkceencotrnacteionntrsawtioilnl sfamllaiyn ftahlel imnitdh-eralnowge- of
range of the initial calibration curve. 10.3 Continuing Calibration Verifications
10.3.1 Continuing calibration verifications are analyzed to verify the continued accuracy of the calibration curve.
10.3.2 Analyze a mid-range calibration standard after every tenth sample, with a minimum o f one per batch.
11.0 C a l i b r a t i o n a n d St a n d a r d iz a t io n __________________________________________________ 11.1 Analyze the extracted matrix standards prior to and following each set of extracts. The
average o f two standard curves will be plotted by linear regression (y = my + b), weighted 1/x, not forced through zero, using MassLynx or other suitable software. 11.2 If the curve does not meet requirements, perform routine maintenance or reextract the standard curve (if necessary) and reanalyze. 11.3 For purposes of accuracy when quantitating low levels o f analyte, it may be necessary to cuEasxleaibmtrhpaetleiloo:nwwceuhnredvneoacftottehnmesipcstatiilnnibggrtoaotfiqothnueacnsuttraitvnaedtearraadtphspefrrrootxhmiamn5attphepelybfut1lo0l r1pa0pn0bgpeopfobafnrtahatelhyestetra,tnhgdaeannredtrhacetuefruavlel. range o f the curve (5 ppb to 1000 ppb). This will reduce inaccuracy attributed to linear regression weighting of high concentration standards.
Analysis of SerEumTSE-8x-t5r.a1ct Using ES/MS
3M Environmental Laboratory
Page 4 of 9
Page 85
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
12.0 P r o c e d u r e s ____________________________________________________________________________ 12.1 Acquisition Set up
12.1.1 Cafolfriiclaekcnqoaunmirseitnaugrst,inbagnudtMtotnyOpi-enDiAtnhYesa-AlmacspqtluedisdigietiistoconrifpCytoeioannrtrs-so.almPpanleeln.uSmetbeurp, aasssaimgnplaemliestt.hoAds(sMigSn) 12.1.2 To create a method click on scan button in the Acquisition control panel and select
SIR (Single Ion Recording) or MRM. Set Ionization Mode as appropriate and mass to 499 or other appropriate masses. A full scan is usually collected along with the pSrIRodsu. ctSaiovne farcaqgumiseintitoantiomneitnhfoodr.mIaftiMonS/mMaSy binestcroullmecetnetds.arSeeeemMpilcoryoemd,aassdditional MMRasMsLy(MnxulGtiUplIeDREeaTcOtioDnAMToAniAtoCrQinUg)I.SITION for additional information and 12.1.3 Typically the analytical batch run sequence begins with a set of extracted matrix standards and ends with a set of extracted matrix standards. 12.1.4 Samples are analyzed with a continuing calibration check injected after every tenth sample. Solvent blanks should be analyzed periodically to monitor possible analyte carryover and are not considered samples but may be included as such. 12.2 Using the Autosampler 12.2.1 Set up sample tray according to the sample list prepared in Section 12.1.1. 12.2.2 Set-up the HPllOO/autosampler at the following conditions or at conditions the iannsatrlyusmt ecnotnsloidgebrosoakp:propriate for optimal response. Record actual conditions in the 12.2.2.1 Sample size = 10 pL injection 12.2.2.2 Inject/sample = 1 12.2.2.3 Cycle time = 13.5 minutes 12.2.2.4 Solvent ramp =
Time 0.00 min. 8.50 min. 11.0 min. 12.0 min.
MeOH 40% 90% 90% 40%
2.0 mM Ammonium acetate
60% 10% 10% 60%
12.2.2.5 Press the "Start" button. 12.3 Instrument Set-up
12.3.1 Refer to ETS-9-24.0 for more details. 12.3.2 Check the solvent level in reservoirs and refill if necessary
ETS-8-5.1 Analysis of Serum Extract Using ES/MS
3M Environmental Laboratory
Page 5 of 9
Page 86
3m Medical Department Study: T-6295.7
Report No. FACT T0X-C3C laboratory Request Number-U2279
12.3.3 Check the stainless steel capillary at the end o f the probe. Use an eyepiece to check the tip. The tip should be flat with no jagged edges. If the tip is found to be unsatisfactory, disassemble the probe and replace the stainless steel capillary'.
12.3.4 SaOpebtpsrHeorPxvLiemCdartpoeuplymlept1s0tcomo"minOiunntg"es.o.Suettothf ethfelotwip toof 1th0e-p5r0o0beu.LA/mllionwortoaseqaupiplirborpartieatfeo.r 12.3.5 Taruomunoditththeetinpitorfogthene.prAobfein. eRmeaisdtjushstouthlde tbipe eoxfptehlelepdrowbiethifnnoonmitrisotgiesnolbesaekrivnegd. 12.3.6 Tchhaenignestirnuomrednetrutoseosptthimesiezepathraemreesteprosnaste:the following settings. These settings may
12.3.6.1 Drying gas 250-400 liters/hour 12.3.6.2 ESI nebulizing gas 10-15 Iiters/hour 12.3.6.3 HPLC constant flow mode, flow rate 10 - 500 pL/min 12.3.6.4 Pressure <400 bar (This parameter is not set, it is a guide to ensure the
HPLC is operating correctly.) 12.3.7 Cfuarrtheefur.llCy ognunideectththeepvroolbtaegientcoatbhleesotpoenthinegp.roIbnes.ert probe until it will not go any 12.3.8 tParpinedt tihnetotutnhee pinasgter,umwietnht iltosgp.arameters, and store it in the study binder with a copy 12.3.9 Using the cross-flow counter electrode in the ES/MS source is recommended for
the analysis o f biological matrices. 12.3.10CbMulaitctsoksnLo.ynnEsxntasvruetrrbesuisottntaorsnt, asiennedthaeepnpdArcosaqpmruiiapstileteiMonnuamCssboLneyrtrnioxnlcUPluaSdnEeesRl a('tSlhl iGssaUmmIapDylEevs)a.troyPbraeemsasontnahgleyzsteadr.t
13.0 D a t a A n a l y s is a n d C a l c u l a t io n s _________________________________________________ 13.1 Calculations:
13.1.4 Calculate matrix spike percent recoveries using the following equation: % Recovery = Observed Result - Background Result x 100
Expected Result
13.1.5 Calculate percent difference using the following equation: % Difference = Expected Cone. - Calculated Cone, x 100
Expected Cone. 13.1.6 Calculate actual concentration of PFOS, or other fluorochemical, in matrix
(pg/mL): fng of PFOS calc, from std. Curve x Dilution Factor) x 1 ug
(Initial Volume of matrix (mL) + mL o f Surrogate Standard) lOOOng Final Volume (mL)
Analysis of SerEuTmS-E8-x5tr.a1ct Using ES/MS
3M Environmental Laboratory
Page 6 of 9
Page 87
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
14.0 M e t h o d P e r f o r m a n c e _______________________________________________________ ________ _ 14.1 mMMaeDttrLhioxadsnpDdeeLctieOfciQct.iovnPallLeuaiemsse.itse(Me EDTLS)-a8n-4d.1L,imAitttaocfhQmueannttitBa,tifoonr (aLlOisQtin) garoefmcuertrheondt, vaanliadlyattee,dand 14.2 Solvent Blanks, M ethod Blanks, and M atrix Blanks
14.2.1 Sloowlveesnt tstbalnadnakrsd, minetthheodcablilbarnaktsi,onancdurmvaetrix blanks values are must be below the 14.3 C alibration Curves
14.3.1 The r2value for the calibration curve must be 0.980 or better. 14.4 M atrix Spikes
14.4.1 Mcoantcreinxtrspatikioenp. ercent recoveries are must be within 30% of the spiked 14.5 Continuing Calibration Verifications .
14.5.1 cCoonncteinnturiantgiocna.libration verification percent recoveries must be 30% of the spiked 14.6 If criteria listed in this method performance section isn't met, maintenance may be
performed on the system and samples reanalyzed or other actions as determined by the analyst. Document all actions in the appropriate logbook. 14.7 Ifofodtantoataerdeotno btaebrleespoarntdeddwishcuenssepderifnortmheatnecxet corfittehreiarhepaovret.not been met, the data must be
1 5 .0 P o l l u t i o n P r e v e n t io n a n d W a s t e M a n a g e m e n t ___________________________________ 15.1 Sample extract waste and flammable solvent is disposed in high BTU containers, and glass
pipette waste is disposed in broken glass containers located in the laboratory.
16.0 R e c o r d s _______________________________________________________________________________ 16.1 Each page generated for a study must have the following information included either in the
header or hand written on the page: study or project number, acquisition method, ainntaelgyrsat.tion method, sample name, extraction date, dilution factor (if applicable), and 16.2 aPpripnrtotphreiattuensetupdaygef,olsdaemr.plCe olipsty, tahnedseacpqaugiessitaionnd mtaeptehoindtofrtohme iMnsatrsusLmyennxt rtounilnocgl.ude in the 16.3 Plot the calibration curve by linear regression, weighted 1/x, then print these graphs and store in the study folder. 16.4 Print data integration summary, integration method, and chromatograms, from MassLynx, and store in the study folder.
Analysis of ScrEumTSE-8x-t5r.a1ct Using ES/MS
3M Environmental Laboratory
Page 7 of 9
Page 88
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
16.5 Sum m arize data using suitable software (Excel 5.0) and store in the study folder, see A ttachm ent A for an example of a summary spreadsheet.
16.6 Back up electronic data to appropriate medium. Record in study notebook the file name and location of backup electronic data.
17.0 T a b l e s . D ia g r a m s . F l o w c h a r t s , a n d V a l i d a t i o n D a t a _____________________________ 17.1 Attachment A: ETS-8-5.1 Data summary spreadsheet.
18.0 R e f e r e n c e s ____________________________________________________________________________ 18.1 FACT-M-4.1, "Extraction of Potassium Perfluorooctanesulfonate or Other Fluorochemical
compounds from Serum for Analysis Using HPLC-Electrospray/Mass Spectrometry 18.2 ETS-9-24.0, "Operation and Maintenance of the Micromass Atmospheric Pressure
Ionization/Mass Spectrometer Quattro II triple quadrupole Systems" 18.3 The validation report associated with this method is ETS-8-4.0 & 5.0-V-l,
19.0 A f f e c t e d D o c u m e n t s _________________________________________________________________ 19.1 ETS-8-4.1, "Extraction o f Potassium Perfluorooctanesulfonate or Other Fluorochemical
Compounds from Serum for Analysis Using HPLC-Electrospray/Mass Spectrometry"
20.0 R e v is io n s ______________________________________________________________________________
RNuevmi1sbieorn.
Section 6.1.2 ClarificationRoeaf sHonP1F1o0r0Rseyvstiseimoncomponents. Section 11.1 Average of two curves, not standard values, are used for pSleoctttiionng 1li2n.e2a.r2.r4egCrleasrsiifoicnatainodn aodfdseodlvtehnet 1r/axmwp.eighting of the curve. Section 17.1 Changed from attachment B to A.
R04eD/v0ai2sti/eo9n9
Analysis of SerEuTmSE-8x-t5r.a1ct Using ES/MS
3M Environmental Laboratory
Page 8 of 9
Page 89
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Laboratory Study #
TSteusdtyM: aterial: Matrix/Final Solvent: Method/Revision: Analytical Equipment System Number: Instrument SoftwareAversion: Filename: R-Squared Value: Slope: DYaItneteorfcEepxtt:raction/Analyst: Date of Analysis/Analyst:
Group Sample# Concentration Dose ug/mL
Initial Voi. mL
Dilution Factor
Final Cone. ug/mL
Slope: Taken from linear regression equation. Group/Dose: Taken from the study folder. Sample#: Taken from the study folder. Concentration (ug/mL): Taken from the MassLynx integration summary. Initial Volume (mL): Taken from the study folder. Dilution Factor: Taken from the study folder. Final Cone. (ug/mL): Calculated by dividing the initial volume from the concentration
Attachment A: Summary Spreadsheet
ETS-8-5.1
AnalysisofSerumExtractUsing ES/MS
3M Environmental Laboratory
Page 9 of 9
Page 90
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
3M Environmental Laboratory
M ethod
E x t r a c t i o n -o f P o t a s s i u m P e r f l u o r o o c t a n e s u l f o n a t e o r O t h e r Flu o r o c h em ic a l co m po unds fro m Serum fo r A nalysis U sing H P L C -
E lectro spray/M ass Spec tr o m etry
M ethod Number: ETS-8-4.0
Adoption Date: 3 / / / / 7
Author: Lisa Clemen, Glenn Langenburg
Revision Date:
Approved By:
Laboratory M anage/
'kiTl-i-G---r--oyu/Ap
vA -cLeader
'
------------------------------------------------------------------------------
37 A Date
m.3 / 1
Date
c;
y .4 y l i u s Technical Reviewer
y /y Date
1.0 Sc o p e a n d A p p l ic a t io n 1.1 Scope: This method is for the extraction of potassium perfluorooctanesulfonate (PFOS)
or other fluorochemical compounds from serum. 1.2 A pplicable com pounds: Fluorochemical surfactants or other fluorinated compounds.
1.3 tMheatvrailciedsa:tioRnabrebpito,rtr.at, bovine, monkey, and human serum or other fluids as designated in
Word 97 SR-1
Extraction EofTPSF-8O-4S.0from Serum
3M Environmental Laboratory
Page I of 13
Page 91
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
2 .0 S u m m a r y o f M e t h o d __________________________________________________________________________
2.1 This method describes the procedure for extracting potassium perfluorooctanesulfonate (PFOS) or other fluorochemical surfactants from serum using an ion pairing reagent and e5x.0tracmteLd:ofPFmOetSh,yPl-FfeOrfS-Abu, tPylFOethSeArA(M, EtBtFEO).SEIn-OthHis, PmFeOthSoEdA, s,eMve5n56fl,uaonrdocshuermroigcaatles were astnaanldyaterdio(nsepea3ir.0isDpeafrintiittiioonnesd).intAonMiotnBEp.airTihnge MreatBgeEntexistraadcdt eisdrteomthoevesdamanpdlepauntdonthteo a nitrogen evaporator until dry. Each extract is reconstituted in 1.0 ml of methanol, then filtered through a 3 cc plastic syringe attached to a 0.2 pm nylon Filter into glass autovials.
3.Q D e f i n i t io n s
______________________________________________________________________
3.1 PFOS: perfluorooctanesulfonate (anion of potassium salt) CsFpSOj'
3.2 PFOSA: perfluorooctane sulfonylamide C8F 17SO2NH2
3.3 PFOSAA: perfluorooctane sulfonylamido (ethyl)acetate C8F17S0 2N(CH2CH3)CH2C0 2 '
3.4 EtFOSE-OH: 2(N-ethylperfluorooctane sulfonamido)-ethyl alcohol C 8 F ,7 S 0 2N(CH2CH3)CH2CH20H
3.5 PFOSEA: perfluorooctane sulfonyl ethylamide C8F |7S0 2 N(CH2CH3)H
3.6 M556: C8F 17S02N(H)(CH2C 00H )
3.7 Surrogate standard: 1H-1H-2H-2H perfluorooctane sulfonic acid
4.0 W a r n in g s a n d C a u t io n s
________________________________________________________
4.1 Health and safety warnings
4.1.1 hUasnedulinnigvearnsiaml aplreticsasuutei,onwsh,iecshpmecaiayllcyonlatabionraptaotrhyocgoeantss., goggles, and gloves when
5.0 I n t e r f e r e n c e s
___________________________________________________________________
5.1 There are no interferences known at this time.
6.0 E q u i p m e n t _______ ____________________________________________________________________
6.1 Tachceepfotallbolwe.ing equipment is used while performing this method. Equivalent equipment is 6.1.1 Vortex mixer, VWR, Vortex Genie 2
6.1.2 Centrifuge, Mistral 1000 or IEC 6.1.3 Shaker, Eberbach or VWR
6.1.4 Nitrogen evaporator, Organomation 6.1.5 Balance ( 0.100 g)
Extraction EofTPSF-8O-4S.0from Serum
3M Environmental Laboratory
Patte 2 of 13
Page 92
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
7.0 Su p p l ie s a n d M a t e r ia l s __________________________ 7.1 Gloves 7.2 Eppendorf or disposable pipettes 7.3 Nalgene bottles, capable of holding 250 mL and 1 L 7.4 Volumetric flasks, glass, type A 7.5 I-CHEM vials, glass, 40 mL glass
7.6 Centrifuge tubes, polypropylene, 15 mL 7.7 Labels 7.8 Oxford Dispenser - 3.0 to 10.0 ml 7.9 Syringes, capable of measuring 5 jjL to 50 pL 7.10 Graduated pipettes 7.11 Syringes, disposable plastic, 3 cc 7.12 Syringe Filters, nylon, 0.2 pm, 25 mm
7.13 Timer
7.14 Crimp cap autovials and caps 7.15 Crimpers Note: Prior to using glassware and bottles, rinse 3 times with methanol and 3 times with
sMepilalri-aQteTMviwalast.er. Rinse syringes a m---inimum of 9 times with methanol, 3 rinses from 3
8.0 R e a g e n t s a n d St a n d a r d s _____________________________________________________________ 8.1 TbeypMe iIllri-eQageMntwgartaedreanwdatmera,yMbiellpi-rQoTMvidoerd ebqyuaivMaleilnlit-;QalTl OwaCtePrluusseTMd isnysttheims method should 8.2 Sodium hydroxide (NaOH), J.T Baker or equivalent 8.3 Tetrabutylammonium hydrogen sulfate(TBA), Kodak or equivalent 8.4 Sodium carbonate (Na2C0 3 ), J.T. Baker or equivalent
8.5 Sodium bicarbonate (NaHCO), J.T. Baker or equivalent 8.6 Methyl-T-Butyl Ether, Omnisolv, glass distilled or HPLC grade 8.7 Methanol, Omnisolv, glass distilled or HPLC grade 8.8 Serum or blood, frozen from supplier
8.9 Fluorochem ical standards
8.9.1 PFOS (3M Specialty Chemical Division), molecular weight = 538
8.9.2 PFOSA (3M Specialty Chemical Division), molecular weight = 499 8.9.3 PFOSAA (3M Specialty Chemical Division), molecular weight = 585
8.9.4 EtFOSE-OH (3M Specialty Chemical Division), m olecular weight = 570
Extraction EofTPSF-8O-4S.0from Serum
Page 3 of 13
3M Environmental Laboratory
Page 93
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
8.9.5 PFOSEA (3M Specialty Chemical Division), molecular weight = 527
8.9.6 M556 (3M Specialty Chemical Division), molecular weight = 557
8.9.7 Surrogate standard: 4-H, perfluorooctane sulfonic acid (1 -H, 1-H, 2-H, 2-H CgF^SOaH) molecular weight = 428
8.9.8 Other fluorochemicals, as appropriate
8.10 Reagent preparation
8.10.1
10 N sodium hydroxide (NaOH): Weigh approximately 200 g NaOH. Pour into a 1000 mL beaker containing 500 mL Milli-QTM water, mix until all solids are
dissolved. Store in a 1 L Nalgene bottle.
8.10.2 1 N sodium hydroxide (NaOH): Dilute 10N NaOH 1:10. Measure 10 mL of 10 N NaOH solution into a 100 mL volumetric flask and dilute to volume using
8.10.3 0M.5illMi-QteTMtrawbautteyrl.amSmtoorneiiunmah1y2d5romgLenNsaullgfeantee (bToBttAle).: Weigh approximately 169 g of TBA into a 1 L volumetric containing 500 mL Milli-QTM water. Adjust to pH 10 using approximately 44 to 54 mL of 10 N NaOH (While adding the last mL of NaOH, add slowly because the pH changes abruptly). Dilute to volume with Milli-QTM water. Store in a 1 L Nalgene bottle.
8.10.3.1
TBA requires a check prior to each use to ensure pH = needed using 1 N NaOH solution.
10.
Adjust as
8.10.4 0a.p2p5roMximsoadtieulmy 2c6a.5rbgonoaftseo/sdoiduimumcabribcoanrabtoena(Nteab2CufOfejr) a(NndaiC21O.0j/Ng aoHf sCoCdibu)m: Weigh bicarbonate (NaHC0 3 ) into a 1 L volumetric flask and bring to volume with MilliQTM water. Store in a 1 L Nalgene bottle.
8.11 Standards preparation
8.11.1 Prepare PFOS standards for the standard curve.
8.11.2 Prepare other fluorochemical standards, as appropriate. Multicomponent fsloulourtioocnhecmonictaailnsintagnd1a.0rd0spaprme aPcFceOpSta, b1l.e02(foprpmexaPmFOplSe,Ao, n0e.9w87orpkpinmg PstFanOdSaArdA, and 1.10 ppm EtFOSE-OH.)
8.11.3
Weigh approximately the actual weight.
100 mg of PFOS
into
a
100 ml
volumetric
flask
and record
8.11.4 B(prgin/mg lt)o. volume with methanol for a stock standard of approximately 1000 ppm
8.11.5 Dilute the stock solution with methanol for a working standard 1 solution of approximately 50 ppm.
8.11.6 Dilute working standard 1 with methanol for a working standard 2 solution of approx. 5.0 ppm.
8.11.7 Dilute working standard 1 with methanol for a working standard 3 solution of approx. 0.50 ppm.
ETS-8-4.0 Extraction of PFOS from Scrum
3M Environmental Laboratory
Page 4 of 13
Page 94
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
8.12 Surrogate stock standard preparation
8.12.1 Weigh approximately 50-60 mg of surrogate standard 1-H, 1-H, 2-H, 2-H, C8F 13SO3H into a 50 ml volumetric flask and record the actual weight.
8.12.2 pBprmin.g .to volume with methanol for a surrogate stock of approximately 1000-1200
8.12.3
Prepare wstoorckkintog
aastsa1un0rdrmaorgldavtooelfuwm1o0re0ktripincpgmfsl.atasRnkdeaacnroddr.dbrTtihrneagnatscofteuvraolalupvpmorleuomxwimeithtartamenlyestfhe1rarmneoldl.offosruarrogate
9 .0 __S a m p l e H a n d l in g ____________________________________________________________________ 9.1 All samples are-received frozen and must be kept frozen until the extraction is performed.
1 0 .0 Q u a l i t y C o n t r o l _____________________________________________________________________
10.1 M ethod blanks and matrix blanks
10.1.1 aEsxtmraectht otwd obl1a.n0kms.l aliquots of Milli-QTM water following this procedure and use
10.1.2
Emxattrraixctbtlwanok1s..0
SmeLe
aliquots 11.1.4,
of the serum
following
this procedure
and use
as
10.2 M atrix spikes
10.2.1 Pthreepaacrceuraancdyaonfatlhyezeexmtraatrcitxiosnp.ike and matrix spike duplicate samples to determine
10.2.2 mPraetpraixrereeacecihvesdpikweithuseinacghassaammpplleesceht.osen by the analyst, usually the control
10.2.3
EcAaxdlpidbeirtcaitoteindoanlcocsnupcrikevnees.trmataioynbsewinilcl
lfuadlle
dinatnhde
mid-range may fall in
othf
ethleo
win-irtainalg
ecaolifbtrhaetioinnitciaulrve.
10.2.4 Prepare one matrix spike and matrix spike duplicate per 40 samples, with a minimum of 2 matrix spikes per batch.
10.3 Continuing calibration checks
10.3.1
Prepare and analyze continuing calibration check samples to ensure the accuracy of the initial calibration curve. If the percent difference between the initial curve
alansdt athcececpotnatbilneucinhgecckh.eck differ by >30%, re-analyze samples analyzed after the
10.3.2 Prepare one continuing check per group of 10 samples. For example, if a sample set = 34, four checks are prepared and extracted.
10.3.3 Pthreepinariteiaelaccuhrvcoe.ntinuing calibration check from the same matrix used to prepare
10.3.4 The expected concentrations fall within the mid-range of the initial calibration curve. Additional spikes may be included that fall in the low-range of the initial
Extraction EofTPSF-8O-4S.0from Serum
3M Environmental Laboratory
Pase 5 of 13
Page 95
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
calibration curve. This is necessary if the analyst must quantitate using only the 5lowppben-d 1o0f0t0heppcabl)i.bration curve (for example, 5 ppb - 100 ppb, rather than
11.0 C a l i b r a t i o n a n d S t a n d a r d iz a t io n _________________________________________________ __
11.1 Prepare m atrix calibration standards 11.1.1 Transfer 1 mL of serum to a 15 mL centrifuge tube. 11.1.2 Ivmfoamlturomixste. ssRaemeqcupoalrledtvoeoatlchuhemsseaasmmapprelleelevvsooslluuthmmaeenso.1n.0DthomeLneo,xtetxerxatrtcartaicotcntstlsaehnsesdeatthr. dans w0.i5th0 mmaLtroixf 11.1.3 While preparing a total of twenty aliquots in 15 ml centrifuge tubes, mix or shake between aliquots. 11.1.4 Two 1 mL aliquots, or other appropriate volume, serve as matrix blanks. Typically use the standard concentrations and spiking amounts listed in Table 1, at ethigehetneednosfttahnidsasredcst,iotnw,otomsaptrikixe,bilnandkusp, laicnadtet,wtowmo esttahnoddarbdlacnukrsv. es, for a total of 11.1.5 Refer to validation report ETS-8-4.0 & ETS-8-5.0-V-1, which lists the working ranges and the Linear Calibration Range (LCR) for calibration curves. 11.1.6 csUtaasleinbdAraatrttdiaoscn.hmsSteaeenndtSaDercdtasiso. nan1a3i.d0 itno ccaallccuullaattienagctthuealccoonncceenntrtraatitoionnssooffthPeFOwoSrkining
11.2 To each standard, blank, or continuing check, add appropriate amount of surrogate working standard for the concentration to fall within the calibration curve range 5 ppb 1000 ppb.
11.3 tEoxetrsatacbt lsipshikeeadchmaintritixialstcaunrdvaerdosnftohlelomwainssg s1p2e.c6t-r1o2m.1e6tero.f this method. Use these standards
Extraction EofTPSF-8O-S4.0from Serum
3M Environmental Laboratory
Page 6 of 13
Page 96
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Table 1
Approximate spiking amounts for standards and spikes
Using 1.0 ml of matrix
Working standard
pL Approx, final cone, of
(approx, cone.)
analyte in matrix
' - - Blank
0.500 ppm
10 0.005 ppm
0.500 ppm
20 0.010 ppm
5.00 ppm
5 0.025 ppm
5.00 ppm
10 0.050 ppm
5.00 ppm
20 0.100 ppm
5(1.0 ppm .5 0.250 ppm
50.0 ppm
10 0.500 ppm
50.0 ppm
15 0.750 ppm
50.0 ppm
20 .
1.00 ppm
12.0 P r o c e d u r e ____________________________________________________________________________ 12.1 Obtain frozen samples and allow to thaw. 12.2 Vpoolrytperxompyilxenfoerc1e5ntsreifcuognedstu, bthe.en transfer 1.0 mL or other appropriate volume to a 15 mL
12.3 Return samples to freezer after extraction amount has been removed. 12.4 Record the volume on the extraction worksheet. 12.5 Lwaobreklshtheeettufobre dwoicthumtheentsitnugdythneurmembeari,nsinamg pstleepIsD. , date and analyst initials. See attached 12.6 sStpanikdearadll assamdepslcersi,biendcliund1in1.g2.blanks and standards, ready for extraction with surrogate
12.7 Spike each matrix with the appropriate amount of standard as described in 11.1, or Table c1oinntitnhuatinsgecctaiolinb,rafotironthestacnaldiabrrdast.ion curve standards. Also prepare matrix spikes and
12.8 Vsaomrtpelxesmfoixr t1h5e ssetaconnddarsd. curve samples, matrix spike samples, and continuing calibration 12.9 Tbiocaerabcohnsaatembpuleff,eard. d 1 mL 0.5 M TBA and 2 mL of 0.25M sodium carbonate/sodium 12.10 Using an Oxford Dispenser, add 5 mL methyl-terf-butyl ether.
12.11 Cap each sample and put on the shaker for 20 minutes. 12.12 Cseepnatrraitfeudg.e for 20 to 25 minutes at approximately 3500 rpm, until layers are well
12.13 Remove 4.0 mL of the organic layer to a clean 15 mL centrifuge tube. Label this fresh tube with the same information as in 12.5.
Extraction EofTPSF-8O-S4.0from Serum
Page 7 of 13
3M Environmental Laboratory
Page 97
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
12.14 Put each sample on the analytical nitrogen evaporator until dry, approximately 1 to 2 hours.
12.15 Add 1.0 mL or other appropriate volume of methanol to each centrifuge tube using a gthreadeuxatrteadctipoinp.ette. Methanol volume to add equals the initial volume of sample used for
Note: If the initial volume is less than 0.500 mL the final methanol volume will equal 1.0 mL. 12.16 Vortex mix for 30 seconds. 12.17 Attach a 0.2 pm nylon mesh filter to a 3 cc syringe and transfer the sample to this syringe.
Filter into a 1.5 mL glass autovial or low-volume autovial when necessary. 12.18 Lmaabtreilxt,hfeinaaultsoovlivaelnwt,itehxttrhaecsttioundydantuem, abnedr, aannaimlyastl(sn)upmebreforramnidnggetnhdeeerx,tsraamctpiolne.timepoint, 12.19 Cap and store extracts at approximately 4 C until analysis. 12.20 Complete the extraction worksheet, attached to this document, and tape in the study
notebook or include in study binder, as appropriate.
13.0 D a t a A n a l y s is a n d C a l c u l a t io n s ________________________________________________ 13.1 Calculations
13.1.1 cCalaiblcrualtaiotenascttaunadlacrodnscuesnitnrgattihoensfoolfloPwFiOngS,eoqruaottihoenr: applicable fluorochemical, in mL of standard x concentration of standard (ug /mL)___________________ =
mL of standard + mL of surrogate standard + initial matrix volume (mL)
Final Concentration (pg/mL) of PFOS in matrix
1 4 .0 M e t h o d P e r f o r m a n c e _______________________________________________________________________
14.1 The method detection limit (MDL) is analyte and matrix specific. Refer to MDL report for specific MDL and limit of quantitation (LOQ) values (see Attachm ents B and C).
14.2 The following quality control samples are extracted with each batch of samples to evaluate the quality of the extraction and analysis. 14.2.1 Method blanks and matrix blanks. 14.2.2 pMraetcrisixiosnpiokfethaendexmtraatcrtixionsp. ike duplicate samples to determine accuracy and 14.2.3 Cinoitniatilncuailnibgrcaatiloibnractuirovne.check samples to determine the continued accuracy of the
15 .0 P o l l u t io n P r e v e n t io n a n d W a s t e M a n a g e m e n t _______________________________
15.1 Sample waste is disposed in biohazard containers, flammable solvent waste is disposed in high BTU containers, and used glass pipette waste is disposed in broken glass containers located in the laboratory.
Extraction EofTPSF-8O-4S.0from Serum
3M Environmental Laboratory
Page 8 of 13
Page 98
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
16.0 R e c o r d s ______________ _________________________________________________ _ 16.1 Complete the extraction worksheet attached to this method, and tape in the study
notebook or include in the 3-ring study binder, as appropriate.
17.0 A t t a c h m e n t s _______ ____________________________________________ ____________ 17.1 Attachment A, Extraction worksheet 17.2 Attachment B, MDL/LOQ values and summary 17.3 Attachment C, Calibration standard concentration worksheet
18.0 R e f e r e n c e s _______________________________________________________ __ 18.1 The validation report associated with this method is ETS-8-4.0 & 5.0-V-l.
19.0 A ffec ted D o c u m en ts
____________________________________________________________ ____
19.1 EHTPSL-C8--E5.l0ec, tr"oAspnraalyysMis aosfsSSepruecmtroormOettrhye"r Fluid Extracts for Fluorochemicals using
20.0 R e v is io n s ____________________ __________________________________________________________
RNeuvmisbioenr
Reason For Revision
ReDvaistieon
Extraction EofTPSF-8O-4S.0from Scrum
3M Environmental Laboratory
Page 9 of 13
Page 99
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030
laboratory Request Number-U2279
Extraction Worksheet ETS-8-4.0
Study #/matrix Surrogate Std approx. ppm actual ppm #
FC-Mix approx. 0.5 ppm actual ppm #
FC-Mix approx. 5 ppm a#ctual ppm
FC-Mix approx. 50 ppm actual ppm #
Date and Initials for
Std. or Comments
.--
_ ---
_
-
- .. -
-
_
1.
-
-
--
-
-- -
- --
--
--
-- -
- --
---
---
--
-
--
---
---
---
---
---
' Studv numher w acre the original worksheet is Inmteri
Blank
Std #
amount =
ml.
Serum Extraction Method__________________________;________________________________________ Date & Initials
V o rte x 15 sec.___________________________________________________________________________________________________________________________________
P ip e tte M a trix _________________________________________________V o lu m e ________________________m i______________________________________________
P ip e tte 1 m l o f 0 .5 M T B A , p H 10._______________________ S td . #
_____________________________________________
P ipette 2 ml o f 0.25 N a.C O ,/Q .25M N aH CO x buffer Std. #
D is p e n s e 5 m l o f m e th y l-t-b u ty l e th e r__________________________________ T N -A -
_________________________________
S h a k e 2 0 m in .______________________________________________________________________________________________________
C e n trifu g e 2 0 -2 5 m in._________________________________C e n trifu g e sp e e d :____________________________________________________________________
R e m o v e a 4 m l. a liq u o t o f o rg a n ic la y e r_________________________________________________________________________________________________ ___
P u t o n N itro g e n E v a p o r a to r to d rv n e ss E v a p o ra to r #:___________________________ T e m p e ra tu re :________________________________________
A d d m e th a n o l___________________ V o lu m e
m l_______________T N -A -
_____________________________
V o rte x 3 0 se c . _____________________________________________________________________________________________
F ilte r u s in g a 3 c c R -D s y rin g e w ith a 0 .2 u m filte r in to a 1.5 m l a u to s a m p le vial_______________________________________________________ M S / M S D / ____ C o n t . C h e c k s : S p i k e d _________u L o f a _________p p m s td ( ______________________ ) f o r a f in a l c o n c e n t r a t i o n o l _____________p p m . M S / M S D u s e d s a m p l e _______________________ . C o n t. C h e c k s u s e d s a m e m a tr ix a s f o r s td c u r v e . S u r r o g a t e S t a n d a r d : S p i k e d _______ u L o f a _________p p m s td (______________________) to a ll s a m p le s , s t a n d a r d s , a n d b l a n k s
Attachment A
ETS-8-4.0 Extraction of PFOS from Scrum
3M Environmental Laboratory
Page 10 of 13
Page 100
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03Q laboratory Request Number-U2279
M DL/LOQ values for rabbit serum
Compound MDL LOQ Linear Calibration Range (LCR)
(ppb) (PPb) Approximate concentrations to be used for preparing the
Standard Calibration Curve
PFOS 4.76 15.2 5 ppb - 1000 ppb
PFOSA
2.89 9.19 5 ppb - 1000 ppb
PFOS A A
2.94 9.33 5 ppb - 1000 ppb
EtFOSE-OH 13.2 41.9 5 ppb - 1000 ppb
M556 12.6 40.2 5 ppb - 1000 ppb
PFOSEA
11.1 35.4 5 ppb - 1000 ppb
MDL/LOQ values in rat, bovine, monkey, and human serum were not statistically determined. Two
curves in each of these three matrices were extracted and analyzed with the rabbit serum curves to
determine equivalence. Responses in the rat, bovine, and monkey were equivalent to the rabbit
responses, therefore, their MDL and LOQ will be the same values as determined in rabbit serum.
Pinlfeoarsme asteieonA. ttachment C (LOQ Summary) and MDL study in ETS-8-4.0 & 5.0-V-l for further
Ion Pairing Extraction of Fluorochemicals from Serum and Analysis by API/M S(M S) Summary Table: Limits of Quantitation
Compound PFOS PFOSA
Matrix All All
MDL 4.76 2.89
PFOSAA
All 2.94
EtFOSE-OH*
All
13.2*
PFOSEA
All 12.6
M556 All 11.1
* MDL and LOQ are estimates only for EtFOSE-OH.
LOQ 15.2 9.19 9.33 41.9* 40.2 35.4
Low std 25.1 25.0 25.0 50.0 25.0 25.0
High std 1002 1000 998 1000 1000 1000
Attachment B: MDL/LOQ
ETS-8-4.0 Extraction of PFOS from Serum
3M Environmental Laboratory
Page I I of 13
Page 101
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Compound: PFOS Prepared
Serum range of matrix standards
(ppb) (ne/mL)
Rabbit 1 .0 0 - 1002
Range of average curve
LCR from ave curve
(ppb) (riR/mU (pob) (ng/mL)
1.00 -1002 25.1- 1002
Rloawngestdof curve
(ppb) (ng/mL)
5.01-250
LCloRw fsrtodm curve
(pob) (ng/mL)
5.01-250
Range of high std curve
(ppb) ine/mL)
100-1002
LCR from high std curve
(pob) (ng/mL)
100-1002
Compound: PFOSA Prepared
Serum range of matrix (psptba)nd(nagr/mdsL) Rabbit 1.00- 1000
Range of average (ppbc)u(rnvge/mL)
1.00-1000
LCR from ave curve (ppb) (ng/mL)
10.0- 1000
Range of low std (ppbc)u(rnvge/mL)
5.00-100
LCR from low std (ppbc)u(rnvge/mL)
5.00-100
Range of high std (ppbc)u(rnvge/mL)
25.0 - 1000
LCR from high std (ppbc)u(rnvee/inL)
2 5 .0 - tOOG
Compound: PFOSAA
Prepared
Serum matrix
srtaanngdearodfs
(ppb) (ng/mL)
Rabbit
1.00 - 998
Range of average (ppbc)u(rnvge/mL)
1.00-998
LCR from ave curve
(ppb) (ng/mL)
25.0-998
Range of low std curve (ppb) (ng/mL)
4.99 - 250
LCR from low std curve (ppb) (ng/mL)
9.98 - 250
Range of high std (ppbc)u(rnvge/mL)
49.9-998
LCR from high std (ppbc)u(rnvge/mL)
99.8 - 998
Compound: EtFOSE-OH
Prepared Range of
Serum range of average
matrix
standards
(ppb) (ng/mL)
1j
curve
(ppb) (ng/mL)
Rabbit j 1.00-1000 1.00 -1000
LCR from ave curve
(pob) (ng/mL)
50.0- 1000
Range of low std curve
(ppb) (ng/mL)
5.00 -100
LCR from low std curve
(ppb) (ng/mL)
10.0 -100
Range of high std curve
(ppb) (ne/mL)
50.0-1000
LCR from high std curve
(ppb) (ng/mL)
100 -1000
Compound: PFOSEA Prepared
Serum range of matrix standards
(ppb) (ne/mL)
Rabbit 1.00 - 1000
Range of acvuerravgee
(ppb) (ng/mL) 1.00-1000
LCR from ave curve
(ppb) (ng/mL) 25.0-1000
Range of
low std
curve
(ppb) (ne/mL) 5.00 - 250
LCR from
low std
curve
(ppb) (ne/mL) 5.00 - 250
Range of hicguhrvsetd
(ppb) (ng/mL) 50 -1000
LCR from hciguhrvsetd
(ppb) (ne/mL) 50 -1000
Compound: M556 Prepared
Serum range of matrix (psptba)nd(nagr/dmsL) Rabbit 1.00 - 1000
Range of average curve
(ppb) (ng/mL)
1.00-1000
LCR from ave curve
(ppb) (ng/mL)
25.0-1000
Rloanwgestdof curve
(ppb) (ng/mL)
5,00 -100
LCR from low std (ppbc)u(rnvge/mL) 5.00-100
Range of high std curve
(ppb) (ng/mL)
100 -1000
LCR from high std curve
(ppb) (ng/mL)
100 -1000
Attachment B: MDL/LOQ
ETS-8-4.0 Extraction of PFOS from Serum
3M Environmental Laboratory
Page 12 of 13
Page 102
3m Medical Department Study: T-6295.7
Report No. FACT T O X -0 3 0
laboratory Request Number-U2279
Ion Pair Standard Curves - Fluids
Prep date(s):
Standard number:
SAanmalpyltee(ms)a: trix:
Equipment number: Final solvent and TN:
Blank fluid/identifier:
Method/revision:
Target analyte(s): _
FC mix std approx. 0.500 ppm:
FC mix std approx. 5.00 ppm:
FC mix std approx. 50.0 ppm:
Surrogate std approx. 100 ppm:
APcFtuOaSl conPceFnOtSraAtionsPFoOf sStAaAndarEdtsFiOnStEhe FPCFOmSiEx A
Std cone Std cone Std cone Std cone Std cone
M556 Std cone
ug/mL ug/mL ug/mL ug/mL ug/mL ug/mL
0.500 0.507 0.532 ; 0.501 1 0.521 0.501
0.500 0.507 0.532 I 0.501 : 0.521 : 0.501
5.00 5.07
5.32 ; 5.01 i 5.21 ' 5.01
5.00 5.07
5.32 1 5.01 ! 5.21 ; 5.01
5.00 5.07
5.32 .....5 01 1 5.21 ; 5.01
50.0 50.1 53.2 50.1 i 52.1 ! 50.1
50.0 50.1 53.2 50.1 [ 52.1 1 50.1
5. ; 50.1 53.2 50.1 ! 52.1 I 50.1
50.0 : 50.1 53.2 50.1 52.1 1 50.1
All All Ami Final vol spiked mL mL 0.010 : i.oi5 0.020 1.025 0.005 1.010 0.010 1.015 0.020 1.025 0.005 1.010 0.010 1.015 0.015 1.020 0.020 1.025
Calculated concentrations of standards in the sample matrix
FinnP49agF..l/97mOc36oLSne 4294..38 9479279374.35686
FPinnFagOl/mcSoLAne
5.00
9.89
i !1':
92592575805840..1.960190
1i 1
FPiFnn5ga1O.l/02mS.c44AoLnAe 5226..34 521260344 1708328
1 FEinnt4Fag.l/O9mc4SoLnEe j! 4929.47..488 ji! 942794.488 i 737 ! 978
: FPiFnn5gaO.l/0mS1cEoLnAe ;: 925.059..132
9925790954.13293
FinMa5l 5c6one ng/mL 5.13
10.2 25.8
! 51.3 ! 102
258 i 513 ' 766 1 1017
SSuntrdgr1/o0cmo0gLnaete SFuinrarlocgoantee
ng5/0m0L
Am'tAmslLpliked 0.005
Validated ranges - approximate concentrations
S eru m
PFOS
PFOSA
PFOSAA
R ab b it
25.1-1002 | 25.0-1000 | 25.0-998
B ovine
E stim ates only. U se values for rabbit.
Rat E stim ates only. U se values for rabbit.
M onkev
E stim ates only. Use values for rabbit.
H um an
E stim ates only U se values for rabbit.
E tF O S E -O H
PFOSEA
| 50.0-1000 1 25.0-1000
M 5S6 | 25.0-1000
Attachment C: Ion Pair Standard Curves
ETS-8-4.0
Extraction of PFOS from Scrum
3M Environmental Laboratory
Page 13 of 13
Page 103
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03Q laboratory Request Number-U2279
3M Environmental Laboratory
M ethod
A n a ly sis of P o tassium Perflu o ro o ctan esu lfo n ate or O th er F luo r o ch em ic als in S erum E xtra cts U sing H P L C -E lectrospray/M ass Spectro m etry
M ethod Number: ETS-8-5.0
Author: Lisa Clemen, Robert Wynne Approved By: Laboratory Manager
i b i ---------- -- Group Leader
; fi Technical Reviewer
Adoption Date: 7 / 1/-7 ;/ Revision Date:
11/ T 7
Date -?/' r - '\ Date
lill'r ,
Date
1.0 S c o p e a n d A p p l ic a t io n _______________________________________________________________________
1.1
uSscionpgeH: PTLhCis-emleectthroodspirsafyo/rmtahses
analysis of extracts spectrometry.
from
serum
for
fluorochemical
surfactants
1.2 oAtpheprliicoanbizleabCleomcopmopuonudnsd: sF. luorochemical surfactants or other fluorinated compounds, or
1.3 tMheatvraicliedsa:tioRnabrebpito,rtr.at, bovine, monkey, and human serum, or other fluids as designated in
Word 97 SR-1
ETS-8-5.0 Analysis of Serum Extract Using ES/MS
3M Environmental Laboratory
Page 1 of 9
Page 104
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
2.0 S u m m a r y o f M e t h o d _________________________________________________________________________ 2.1 TuanshiainslgymsHisePtihLsoCpde-erdlfeeoscrctmrrioebsdepsrbaythyme/maoannsaistloysrspiinsegcotrfaofsmliuneogtrrloeyc,ihooenrmsciihmcaairllaascrutresfyraisscttteiamcnotsafseaxaptpraparrctoitcpeudrliaafrrteo.mTsheerum,
fSlaumorpolcehsemmaicyaal,lssoucbhe aasnathlyezpedotuasssiniugmanpeArPflIu-oErSo/oMctSa/nMesSulsfyosntaetme (tPoFfOurSth)earnvioenri,fym/z= 499. compound identification.
3.0 D e f in it io n s _____________________________________________________________________________________ 3.1 AvatrmioousspmheerthicodPsreosfsiuorneizIaotnioinzabtiyounti(lAizPinIg): vTahrieouMsicsoroumrcaesss, pQruoabtetrs,o a1n3dsyisntteemrfsacaelslo. wThfoerse
include but are not Jimited to: Electrospray Ionization (ESI), Atmospheric Pressure chemical Ionization (APcI), Thermospray, etc. The ionization process in these techniques occurs at atmospheric pressure (i.e. not under a vacuum).
3.2 pErleescsturroes,pwrahyerIeobnyizioantiiozanti(oEnSo, cEcuSrIs):tharmouegthhotdheofprioondiuzcattiioonn opfetrifnoyrmcheadrgatedatdmroospplehtesriicn a strong electrical field.
3.3 TsMehlaeescsAtiPSvepIleQycutdraiotstcmrroiemItIrinysay, tsMetedambsssySamrpeaesecsqtrutooipmcpheeatdregrwe(itrMhatSqio)u,a(Tmdar/uzn)pdoaelnmedmMsausabssssesqeSluepecentcitvtlyreoddmeeteteetccettreodr(.Ms. ASI/oMsninsSg)al:ree MS may be employed for ion detection or a series (MS/MS) for more specific fragmentation information.
3.4 soCyrosthtneovmgeonsnt(aipolontsoatlt1hv9es9.c8Zo)n-useptiarlipazeyertpaurr"oeZ.b-seIpnirnatthyee"rcfcaoocnnevf:oernTmtihoaentialoalnte.csotTnmfhoeormdspearltsaiyoonfemMititiicsteradoimmfraeosdms dQairupeacrttotlrbyoeaIitIsthe ccoonnfeigauprearttiuorne,isafdteirffepraesnsti,ngthtehmroeutghhodastoorftoupouersaptiaotnh,wcaleyainninthge, acnodunmtearinetleecntarnocdee.arTe hthoeugshamthee. However, Z-spray components and conventional components are not compatible with one another, but only with similar systems (i.e. Z-spray components are compatible with some other Z-spray systems, etc.)
3.5 M ass L ynx Software: System software designed for the specific operation of these Quattro IvIesrysisotenms sa.reCsuimrrileanrt.lyFMorasmsLoryenxdehtaasilsWseinedtohwe sm9a5nuaanldsWpeicnifdiocwtosNthTe 4in.0stvruermsieonnts(.MAicllromass Quattro 13 MassLynx or MassLynx NT USER'S GUIDE).
4.0 W a r n in g s a n d C a u t io n s_____________________________________________________________________ 4.1 H ealth and Safety W arnings:
4.1.1 Use caution with the voltage cables for the probe. The probe employs a voltage of approximately 5000 Volts.
4.1.2 When handling samples or solvents wear appropriate protective gloves, eyewear, and clothing.
Analysis of SerEumTSE-8x-t5ra.0ct Using ES/MS
3M Environmental Laboratory
Page 2 of 9
Page 105
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
4.2 Cautions: 4.2.1 Do not operate solvent pumps above capacity of 400 bar (5800 psi) back pressure. If the back pressure exceeds 400 bar, the HP 1100 will initiate automatic shutdown. 4.2.2 Do not run solvent pumps to dryness.
5 .0 I n t e r f e r e n c e s ______________ ___________________________________________________________________
5.1 Tstoormagine iomriazneyinptaerrtfeorfeinncsetrsuwmheenntaatnioanlytzhinatgcsoammepsleisn, ctoenfltoanctshwoituhldthneotsabme pulseedorfeoxrtsraamct.ple
6 .0 E q u ip m e n t _____________ ________________________________________________________________
6.1 Equipment listed below may be modified in order to optimize the system. 6.1.1 Micromass Electrospray Mass Spectrometer 6.1.2 HP1100 low pulse solvent pumping system and autosampler
7 .0 S u p p l ie s a n d M a t e r i a l s ________________________________________________________ 7.1 Supplies
7.1.1 High purity grade nitrogen gas regulated to approximately 100 psi (House air system)
7.1.2 HPLC analytical column, specifics to be determined by the analyst 7.1.3 Capped autovials or capped 15 ml centrifuge tubes
8 .0 R e a g e n t s a n d S t a n d a r d s ______________________________________________________________ 8.1 Reagents
8.1.1 Methanol, HPLC grade or equivalent 8.1.2 Milli-QTM water, all water used in this method should be Milli-QTM water or
equivalent, and may be provided by a Milli-Q TOC Plus system or other vendor 8.1.3 Ammonium acetate, reagent grade or equivalent 8.2 Standards 8.2.1 Typically two method blanks, two matrix blanks, and eighteen matrix standards are
prepared during the extraction procedure. See ETS-8-4.0.
9.0 S a m p l e H a n d l in g ________________________________________________________________
9.1 Fresh matrix standards are prepared with each analysis. Extracted standards and samples are stored in capped autovials or capped 15 ml centrifuge tubes until analysis.
9.2 If analysis will be delayed, extracted standards and samples can be refrigerated at approximately 4 C until analysis can be performed.
Analysis of SerEumTSE-8x-t5ra.0ct Using ES/MS
3M Environmental Laboratory
Pago 3 of 9
Page 106
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03Q laboratory Request Number-U2279
10 .0 _Q u a l it y C o n t r o l _____________________________________________________________________ 10.1 Method Blanks and Matrix Blanks
10.1.1 Analyze a method blank and a matrix blank prior to each calibration curve. 10.2 M atrix Spikes
10.2.1 Analyze' a matrix spike and matrix spike duplicate per forty samples. With a minimum of 2 spikes per batch.
10.2.2 Eccauxlrpivbeerc.atteAidodnsdpciiutkiroevneca.olnscpeinkteractoinocnesnwtrialltifoanlls imn athyefamllidin-rtahnegeloowf-rthaengineitoiaf lthcealiinbirtaiatlion 10.2.3 See Sectipn 13 to calculate percent recovery. 10.3 Continuing Calibration Checks 10.3.1 cAhnaanlgyeze(a 3m0i%d-)rainngpeeackaliabrreaatioocncusrtasn, draelradtiavfetetroetvheeryintiteinatlhstsaanmdparled. cIuf ravsei,gsntiofpicathnet
rwuinll. bOenulysetdh.osTehseamrepmleasinainnaglyszaemdpbleesfomreustht ebelarsteaancacleypzteadb.le calibration standard 10.3.2 See Section 13 to calculate percent difference.
1 1 .0 C a l i b r a t i o n a n d S t a n d a r d iz a t io n ___________________________________________________ 11.1 Amneaanlyzoef ttwheoesxttarnadcaterdd vmaalutreisx, sattaneadcahrdsstapnrdioarrdtocoanndcefnotlrlaotwioinn,gweialclhbeseptlootfteedxtrbayctlisn. eaTrhe '
regression (r")for the calibration curve using MassLynx or other suitable software. 11.2 Tdihsecrre2tivoanluoef ftohretahneadlyastta asnhdoualpdpbroev0a.l9o8f0 tohre gPrreoajteecrt. LLeoawd.er values may be acceptable at the 11.3 Isftatnhdeacrudrcvuerdvoee(sifnnoetcmeseseatryre)qaunidrermeaennatsl,yzpee.rform routine maintenance or reextract the 11.4 uFEsoxeramtphuperleplo:owswesehnoednf oaafctcttuehmreapccatyilniwbgrhateotnioqqnuuacanuntrittviateatetrianatpghpelorrowthxialmenvatethleeslyofuf1l0lanrpaapnlbygteoe,foiaftntmhaleayytsetba,engdenanerecdreasctsuearravye.to
craanligberaotfiotnhecucurvreveco(5nspipstbintgo o1f0t0h0epsptabn).daTrdhsisfrwoimll r5edppubcetoina1c0c0uprpacbyraattthreirbuthteadn ttohelinfuelalr regression weighting of high concentration standards.
12.0 Pr o c e d u r e s ____________________________________________________________________________ 12.1 Acquisition Set up
12.1.1 Click on start button in the Acquisition Control Panel. Set up a sample list. Assign a filename using MO-DAY-last digit of year-sample number, assign a method (MS) for acquiring, and type in sample descriptions.
Analysis of SerEumTSE-8x-t5ra.0ct Using ES/MS
3M Environmental Laboratory
Page 4 of 9
Page 107
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
12.1.2 To create a method click on scan button in the Acquisition control panel and select StoIR49(9SionrgolethIeornaRppecrooprdriiantge)morasMseRs.MA. Sfueltl IsocnanizaistiounsuMalloydecoalsleacptepdroaplroinagtewaintdh mthaess SERs. Save acquisition method. If MS/MS instruments are employed, additional pMraosdsuLcytnioxnGfrUaIgDmEenTtOatiDonAiTnAforAmCaQtioUnISmITayIObNe cfoolrleacdteddit.ioSnaeel iMnfiocrrmomataiossn and MRM (Multiple Reaction Monitoring).
12.1.3 Typically the analytical batch run sequence begins with a set of extracted matrix standards and ends with a set of extracted matrix standards.
12.1.4 Samples are analyzed with a continuing calibration check injected after every tenth sample. Solvent blanks should be analyzed periodically to monitor possible analyte carryover and are not considered samples but may be included as such.
12.2 Using the Autosampler
12.2.1 Set up sample tray according to the sample list prepared in Section 12.1.1,
12.2.2 Set-up the HP1100/autosampler at the following conditions or at conditions the analyst considers appropriate for optimal response. Record actual conditions in the instrument logbook:
12.2.2.1 Sample size = 10 juL injection with a sample wash
12.2.2.2 Inject/sample = 1
12.2.2.3 Cycle time = 13.5 minutes
12.2.2.4 Solvent ramp =
.
Time 0 . 0 0 min. 7.5 min. 1 1 . 0 min. 1 1.5 min.
MeOH 40% 90% 90% 40%
2.0 mM Ammonium acetate
60% 10% 10% 60%
12.2.2.5 Press the "Start" button.
12.3 Instrum ent Set-up
12.3.1 Refer to ETS-9-24.0 for more details.
12.3.2 Check the solvent level in reservoirs and refill if necessary.
12.3.3 Check the stainless steel capillary at the end of the probe. Use an eyepiece to check the tip. The tip should be flat with no jagged edges. If the tip is found to be unsatisfactory, disassemble the probe and replace the stainless steel capillary.
12.3.4 Set HPLC pump to "On". Set the flow to 10 - 500 uL/min or as appropriate. Observe droplets coming out of the tip of the probe. Allow to equilibrate for approximately 1 0 minutes.
ETS-8-5.0 Analysis of Serum Extract Using ES/MS
3M Environmental Laboratory
Page 5 of 9
Page 108
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03G laboratory Request Number-U2279
12.3.5 Turn on the nitrogen. A fine mist should be expelled with no nitrogen leaking around the tip of the probe.
12.3.6 The instrument uses these parameters at the following settings. These settings may change in order to optimize the response: 123.6.1 Drying gas 250-400 liters/hour 12.3.6.Z ESI nebulizing gas 10-15 liters/hour 12.3.63 HPLC constant flow mode flow rate 10 - 500 juL/min 12.3.6.4 Pressure <400 bar (This parameter is not set, it is a guide to ensure the HPLC is operating correctly.)
12.3.7 Carefully guide the probe into the opening. Insert probe until it will not go any further. Connect the voltage cables to the probe.
12.3.8 Record tune parameters in the instrument log. 12.3.9 Using the cross-flow counter electrode in the ES/MS source is recommended for
the analysis of biological matrices. 12.3.10Click on start button in the Acquisition Control Panel (this may vary among
bMuattsosnL.ynExnsvuerresisotnasr,t saenedaepnpdrosparmiaptleeMnuamssbLeyrnixncUluSdEeRs 'aSll GsaUmIDplEes).toPbreessanthaelyszteadr.t
13.0 D a t a A n a l y s is a n d C a l c u l a t io n s ____________________________________________________ 13.1 Calculations:
13.1.4 Calculate matrix spike percent recoveries using the following equation: % Recovery = Observed Result - Background Result x 100
Expected Result 13.1.5 Calculate percent difference using the following equation: % Difference = Expected CEonxep.e-ctCedalcCuolnatee.d Cone, x 100 13.1.6 Calculate actual concentration of PFOS, or other fluorochemical, in matrix (|ig/ml):
(ng of PFOS calc, from std. Curve x Dilution Factor) x 1 tig (Initial Volume of matrix (ml) + ml of Surrogate Standard) 1000 ng
Final Volume (mL)
14.0 M e t h o d P e r f o r m a n c e _______________________________________________________________ 14.1 Method Detection Limit (MDL) and Limit of Quantitation (LOQ) are method, analyte, and
matrix specific. Please see ETS-8-4.0, Attachment B, for a listing of current validated MDL and LOQ values.
ETS-8-5.0 Analysis of Serum Extract Using ES/MS
3M Environmental Laboratory
Page 6 of 9
Page 109
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
14.2 M ethod Blanks and Matrix Blanks
14.2.1
Mpoestshibolde bcloanntkasmainndatmioantroirxcbalrarnykosvewr.illVbaeluaensalayrzeedexwpeitchteedactho fsaalml bpeleloswettfhoerlowest standard in the calibration curve.
14.3 M atrix Spikes
14.3.1 Mexaptercixtedsptiokefsalalrwe iathnianlyze3d0%witohfetahcehspsaikmepdlecosnecteanntdratthioenp.ercent recoveries are
14.4 Continuing Calibration Checks
14.4.1
Continuing calibration checks are analyzed at a minimum of after every 10 samples with each sample set. The percent recoveries are expected to fall within 30% of
the spiked concentration.
14.5 If any criteria listed in the method performance section isn't met, maintenance may be opanneratflhoyerstms.ueAmd lmolnaarctythieosnhssyesewtteiwmllitbahentddhoescasumammpelpenlsteerdreeasinunlattslhy-.ezeidnsotrruomtheenrt arcutniolongs, atshedemtearinmtienneadncbey ltohge, or
15.0 P o l l u t io n P r e v e n t io n a n d W a s t e M a n a g e m e n t _______________________________________
15.1 pSiapmetptleewexatsrteacitswdaisspteosaenddinflabmromkeanblgelsaosslvceonnttiasindeirsspolosecdateind hinigthheBTlaUbocroatnotrayi.ners, and glass
16.0 R e c o r d s ______________________________________________________________________________________ 16.1 Store chromatograms in the study or project folder. Each chromatogram must have the
fsotulldoywoinrgprionjfeocrtmnautmiobnerin, calcuqdueidsietiiothnermienththoed,hienatdegerraotriohnanmdetwhroidtt,ensaomnptlheencahmreo,meaxttorgarcatimon: date, dilution factor (if applicable), and analyst. 16.2 Plot calibration curve by linear regression and store in the study folder. 16.3 Print sample list from MassLynx and tape into the instrument runlog.
16.4 Print data integration summary from MassLynx and tape into the instrument runlog.
16.5 Cstoorpey iinnsatprpurmoepnritarteunsltougdypafogledse,ri.ncluding instrument parameters and sample results, and 16.6 Summarize data using suitable software and store in the study folder. 16.7 Banadckloucpateiolenctorfonbiacckduaptaetloecatprponroicprdiaattae.medium. Record in study notebook the file name
17.0 T a b l e s , D ia g r a m s . F l o w c h a r t s , a n d V a l id a t io n D a t a ______________________________ 17.1 Attachment B: ETS-8-5.0 Data reporting spreadsheet.
17.2 The validation report associated with this method is ETS-8-4.0 & 5.0-V-l.
Analysis of SerEumTSE-8x-t5ra.0ct Using ES/MS
3M Environmental Laboratory
Page 7 of 9
Page 110
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
18.0 R e f e r e n c e s ______________________________________________________________________________ _
18.1 IEoTnSiz-a9t-i2o4n./0M, a"sOspSepraetcitornomanedterMQauinattetnroanIIceSyosfttehme sM" icromass Atmospheric Pressure
19.0 A f f e c t e d D o c u m e n t s ____________________________________________________________________
19.1 ETS-8-4.0, "Extraction of Potassium Perfluorooctanesulfonate or Other Fluorochemical Compounds from Serum for Analysis Using HPLC-Electrospray/Mass Spectrometry"
20.0 R ev isio n s
Revision Number.
Reason For Revision
Revision Date
Analysis of SerEumTSE-8x-t5ra.0ct Using ES/MS
3M Environmental Laboratory
Page 8 of 9
Page 111
3m Medical Department Study: T-6295.7
Report N o . FACT TOX-030
laboratory Request Number-U2279
Attachment A
Laboratory Study #
Study: Test Material: Matrix/Final Solvent: Method/Revision: ` Analytical Equipment System Number: Instrument Software/Version: Filename: R-Squared Value: Slope: Y Intercept: Date of Extraction/Analyst: Date of Analvsis/Analvst:
Group Sample# Concentration Dose ue/idL
Initial Vol. ml.
Dilution Factor
Final Cone, iis/m l.
Slope: Taken from linear regression equation. Group/Dose: Taken from the study folder. Sample#: Taken from the study folder. Concentration fug/mLl: Taken from the MassLynx integration summary. Initial Volume (mL): Taken from the study folder. Dilution Factor: Taken from the study folder. Final Cone. fue/mLI: Calculated bv dividing the initial volume from the concentration
Analysis of SerEumTSE-8x-t5ra.0ct Using ES/MS
3M Environmental Laboratory
Page 9 of 9
Page 112
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
3M Einvironmental Laboratory
M ethod E x tr a c tio n o f Po tassium perfluo ro o ctanesulfo nate or O th er A nio n ic
F l u o r o c h e m ic a l Sur fa ctan ts fro m L iv er fo r A n a ly sis U sing H P L C -E lectro spray/M ass Spec tr o m etry
M ethod Number: FACT-M-1.0
Author: Lisa Clemen Approved By:
A doption Date: 5/? 6 / $ / R evision Date: yf/.-}
Group Leader
Date
ly
Technical
AR-eviewer
_______________________
.5'h l h i Y Date
1.0 S c o p e a n d A p p l ic a t io n _______________________________________________________________ 1.1 oStchoepr ef:luoTrhoicshmemetihcoadl siusrffoarcttahnetsexftrroamctiloivnero.f Potassium Perfluorooctanesulfonate (PFOS) or
1.2 A pplicable C om pounds: Fluorochemical surfactants or other fluorinated compounds.
1.3 M atrices: Rabbit, rat, bovine, and monkey livers or other livers as designated in the validation report.
Microsoft 7.0.1/95
FACT-M-1.0 Extraction of PFOS from Liver
3M Environmental Laboratory
Page 1 of 8
Page 113
3m Medical Department Study: T-6295.7
Report No. FACT TOX-G30 laboratory Request Number-U2279
2.0 Su m m a r y o f M e t h o d _____________________________________________________________ 2.1 Tfluhoisromcehtehmodicadlesscurrifbaecstahnotswfrtoomexltirvaecrt upsoitnagssiiounmppaeirrifnlugorreoaogcetnatnaensudlf5o.n0amteL(sPoFfOeSth) yolr other
acetate. An ion pairing reagent is added to each sample and partitioned into ethyl acetate. Four mLs o f extract is removed to a centrifuge tube and put onto a nitrogen evaporator until dry. Each extract is reconstituted in 1.0 mL methanol then filtered through a 3 cc plastic syringe attached to a 0 .2 pm filter into glass autovials.
3.0 D e f in it io n s ____________________________________________________________________________ 3.1 None.
4.0 _W a r n in g s a n d C a u t io n s ___________________________________________________________ 4.1 H ealth and Safety W arnings:
4.1.1 Upastehougneivnesr. sal precautions when handling animal livers, they may contain
5.0 I n t e r f e r e n c e s ___________ ._____________________________________________________________ 5.1 There are no known interferences at this time.
6.0 E q u ip m e n t __________________________________________________________________________ 6.1 Tachceepfotallbolwe.ing equipment is..u...sed while carrying out this method. Equivalent equipment is
6.1.1 Ultra-Turrax T25 Grinder for grinding liver samples 6.1.2 Vortex mixer, VWR, Vortex Genie 2 6.1.3 Centrifuge, Mistral 1000 or IEC 6.1.4 Shaker, Eberbach or VWR 6.1.5 Nitrogen Evaporator, Organomation 6.1.6 Balance
7.0 Su p p lie s a n d M a t e r ia l s ____________________________________________________________ 7.1 Gloves 7.2 Dissecting scalpels 7.3 Eppendorf or disposable pipettes 7.4 Nalgene bottles, capable of holding 250 mL and 1 L 7.5 Glass, type A, volumetric flasks 7.6 40 mL glass I-CHEM vials 7.7 Plastic sampule vials, Wheaton, 6 mL 7.8 Polypropylene centrifuge tubes, 15 mL 7.9 Labels
FACT-M-1.0 Extraction of PFOS from Liver
Page 2 of 8
3M Environmental Laboratory
Page 114
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
7.10 Syringes, capable o f measuring 10 pL to 50 pL 7.11 Glass, type A, volumetric pipettes 7.12 Graduated pipettes 7.13 Electronic pipettor, Eppendorf or equivalent 7.14 Timer 7.15 Disposable plastic 3 cc syringes 7.16 Filters, nylon syringe filters, 0.2 pm, 25 mm 7.17 Crimp cap autovials Note: PQriTMor wtoatuesri.ngRginlasseswsyarrinegaensdabmotitnleims,urminsoef39ttiimmeesswwiitthhmmeetthhaannooll,an3dri3nsteims efrsowmit3h sMepiallria-te
vials.
8.0 R e a g e n t s a n d St a n d a r d s ______________________________________________________________ 8.1 Reagents
8.1.1 Sodium Hydroxide (J.T Baker or equivalent), (NaOH) 10N: weigh approximately 200 grams NaOH. Pour into a 1000 mL beaker containing 500 liters (L) Milli-QTM water, mix until all solids are dissolved. Store in a 1 L nalgene bottle.
8.1.2 Sodium Hydroxide (J.T Baker or equivalent), (NaOH) IN. Dilute 10N 1:10. dMileuatseutroe v1o0lummLeoufstihneg 1M0NilliN-QaOTMHwsaotelur.tioSntoirnetoinaa101025mmLLvonlaulmgeentericboftltalsek. and
8.1.3 Tetrabutylammonium hydrogen sulfate (Kodak or equivalent), (TBA) 0.5M: Weigh approximately 169 grams of TBA into a 1 L volumetric containing 500 L Milli-QTM water. Adjust to pH 10 using approximately 64 mL 10N NaOH and dilute to NvoalOumHebwecitahusMe itlhlie-QpHTMcwhaatnegre. sAadbrduNptalyO.HSstolorwe liny awh1iLlenaadldgeinnge tbhoettllaes.t 1 mL of
8 .1.3.1 TneBeAderdequusiinregs IaNchNeacOkHprsioorluttoioena.ch use to ensure pH = 10. Adjust as 8.1.4 Sodium carbonate/Sodium Bicarbonate Buffer (J.T. Baker or equivalent),
a((NNndaa22dCCil00u33t/)eNatanodHvo2Cl1u0.0m3) ge0.ow2f5itMsho:dMiWuilmleii-gbQhiTMcaarpwbpoarntoeaxrti.em(SaNttoearlyHe 2Cin60.a53)1ginLotofnsaaolgd1eiLunmevobcloautrmtbleeo.tnraitceflask 8.1.5 PFOS (3M Specialty Chemical Division), molecular weight = 538.
8.1.6 Ethyl Acetate, Omnisolv, glass distilled or HPLC grade. 8.1.7 Methanol, Omnisolv, glass distilled or HPLC grade. 8.1.8 Liver and control liver, received frozen from testing laboratory. 8.1.9 Milli-QTM water, all water used in this method should be Milli-QTM water and may
be provided by a Milli-Q TOC Plus system.
8.2 Standards
8.2.1 Prepare PFOS standards for the standard curve.
FACT-M-1.0 Extraction of PFOS from Liver
Paee 3 of 8
3M Environmental Laboratory
Page 115
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
8.2.2 tWheeiagchtuaapl pwreoixgihmt.ately 100 mg of PFOS into a 100 mL volumetric flask and record 8.2.3 (Bnrgi/nmgLto).volume with methanol for a stock standard of approximately 1000 ppm 8.2.4 Dapilpurtoextimheastetolyck50sopluptmio.n with methanol for a working standard 1 solution of 8.2.5 aDpiplurtoex.th5e.0stpopcmk .solution with methanol for a working standard 2 solution of 8.2.6 aDpiplurtoex.th0e.5s0topcpkms.olution with methanol for a working standard 3 solution of
9.0 Sa m p l e H a n d l in g ______________________________________________________________________ 9.1 All livers are received frozen and must be kept frozen until the extraction is performed.
10.0 Q u a l it y C o n t r o l _______________________ ;____________________________________________ 10.1 M atrix Spikes
10.1.1 tPhreepaacrceuraancdyaonfatlhyezeexmtraatrcitxiosnp.ike and matrix spike duplicate samples to determine 10.1.2 Prepare each spike using liver chosen by the analyst, usually a control liver. 10.1.3 Expected concentrations will fall in the mid-range of the initial calibration curve. 10.2 C ontinuing Calibration Checks 10.2.1 Prepare and analyze continuing calibration check samples to determine the
continued linearity of the initial calibration curve. 10.2.2 Ofonuer cchheecckksisarpereppraerpeadrepderangdroeuxptroacftteedn. samples. For example, if a sample set = 34, 10.2.3 pPrreeppatrheeeiancithiaclocnutrinveu.ing calibration check from the same liver homogenate used to 10.2.4 Tcuhrevee.xpected concentration will fall within the mid-range of the initial calibration
11.0 C a l ib r a t io n a n d St a n d a r d iz a t io n ________________________________________________ 11.1 Prepare Liver H om ogenate to Use for Standards
11.1.1 Weigh approximately 40 g of liver into a 250 mL Nalgene bottle containing 200 mLs Milli-QTM water. Grind to a homogeneous solution.
11.1.2 aIf14:05 graitsion. ot available, use appropriate amounts of liver and water in keeping with
1 1 .1 .3 See section 13.0 to calculate the actual density of liver.
F A C T -M -1 .0 Extraction of PFOS from Liver
Page 4 of 8
3M Environmental Laboratory
Page 116
O G
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03 laboratory Request Number-U227
11.1.4 Add 1 mL o f homogeneous solution to a 15 mL centrifuge tube. Re-suspend homogeneous solution by shaking between aliquots while preparing a total of sixteen 1 mL aliquots of homogeneous solution in 15 mL centrifuge tubes.
11.1.5 Two 1 mL aliquots serve as matrix blanks. Use the standard concentrations and tsoptiaklinogf faomurotuenetns slaismtepdleisn. table 1 to spike, in duplicate, two standard curves for a
' Table 1 Approximate Spiking Amounts for Calibration Standards
Working Standard (Approx. Cone.)
0.50 ppm 0.50 ppm 0.50 ppm 5.0 ppm 5.0 ppm 5.0 ppm 50 ppm
pL Approx, final cone, of PFOS in liver
- Blank 4 0 . 0 1 0 ppm 2 0 0.050 ppm 40 0 . 1 0 0 ppm 10 . 0.250 ppm 2 0 0.500 ppm 30 0.750 ppm 4 1 . 0 0 0 ppm
11.1.1 See section 13.0 to calculate actual concentrations of PFOS in calibration standards. 11.2 Extract spiked liver homogenates following 12.14-12.24 of this method. Use these
standards to establish each initial curve on the mass spectrometer.
12.0 P r o c e d u r e s ____________________________________________________________________________ 1 2 . 1 oOtbhtearintisfsruoezse.n liver samples. In spent tissue, note that the liver has not been packaged with 12.2 Cut approximately 1 g of liver using a dissecting scalpel. 12.3 Weigh the sample directly into a tared plastic sampule vial. 12.4 Record the liver weight in the study notebook. 12.5 Label the sampule vial with the study number, weight, liver ID, date and analyst initials. 12.6 Add 2.5 mLs of water to sampule vial. 12.7 Gunrtiinldththeesasammpplelei.sPhuotmthoegegnreinoduesr. probe in the sample and grind for about 2 minutes, or 12.8 Rinse the probe into the sample with 2.5 mLs water using a pipette. 12.9 Take the grinder apart and clean it with methanol after each sample. Follow AMDT-EP-22. 12.10 Cap the sample and vortex for 15 seconds.
FACT-M-1.0 Extraction of PFOS from Liver
3M Environmental Laboratory
Page 5 of 8
Page 117
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
12.11 Pipette 1 mL homogenate into a 15 mL polypropylene centrifuge tube. Label the centrifuge tube with the identical information as the sampule vial. (See Worksheet for documenting the remaining steps.)
12.12 sSepcitkioenliv1e1r.1hoormToagbelneat1e.s with the appropriate amount of PFOS standard as described in
12.13 Pinisptertutme tewntob1lamnkLs.aliquots of Milli-QTM water to centrifuge tubes. These will serve as
12.14 bAudfdfer1. mL 0.5 M TBA and 2 mL of the 0.25 M sodium carbonate/sodium bicarbonate
12.15 Using a volumetric pipette, add 5 mLs ethyl acetate.
12.16 Cap each sample and put on the shaker for 20 minutes.
12.17 Centrifuge for 20 to 25 minutes, until layers are well separated. Set power on the centrifuge to approximately 3500 rpm.
12.18 Remove 4 mLs of organic layer, using a 5 mL graduated glass pipette, to a clean 15 mL centrifuge tube. Label this fresh tube with th same information as in 12.5.
12.19 hPouutresa.ch sample on the analytical nitrogen evaporator until dry, approximately 2 to 3
12.20 Add 1.0 mL of methanol to each centrifuge tube using a graduated pipette.
12.21 Vortex mix for 30 seconds.
12.22 Attach a 0.2 pm nylon mesh filter to a 3 cc syringe and transfer the sample to this syringe.
Filter into a 1.5 mL glass autovial.
'
12.23 mLaabtreilxt,hfeinaaultsoovlivaelnwt,itehxttrhaecsttioundydantuem, abnedr,aannaimlysatl(sn)uwmhboerpaenrfdorgmenedderth, esaemxtprlaecttiiomne. point,
12.24 Cap and hold for electrospray mass spectrometry analysis.
12.25 Complete the worksheet and tape to page of study notebook.
13.0 D a t a A n a l y s is a n d C a l c u l a t io n s ____________________________________________________ 13.1 Calculations:
13.1.1 eCqaulactuiolant:e the density of liver (mg) in 1.0 mL homogenate using the following g of Liver x Average weight of ten 1 mL aliquots (me) (g of Liver + g of Water)
FACT-M-1.0 Extraction of PFOS from Liver
3M Environmental Laboratory
Page 6 of 8
Page 118
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
13.1.2 fColalolcwuilnatge eaqcutuaatilonco:ncentrations of PFOS in calibration standards using the pL o f StmangdLarivdexr C/ o1nmceLnthroamtioonge(npagte/mL) = FoifnPaFl OCoSnicnenLtirvaetrion (pg/g or mg/kg) *Average weight of liver in solution as determined in 13.1.1, by weighing ten 1 mL homogenates of approximately 40 mg liver in 200 mL of Milli-Q water.
14.0 M e t h o d P e r f o r m a n c e _____________________________________________________________________
14.1 The method detection limit is equal to half the lowest standard in the calibration curve.
15.0 P o l l u t io n P r e v e n t io n a n d W a s t e M a n a g e m e n t ______________________________________
15.1 lhSoiacgmahtpeBldeTiwUnatcshoteenltiaasbindoeirsrapst,oorsayend.d iunsebdiohglaazsasrdpicpoenttteaiw'naerstse, filsamdimspaobseledsionlvbernotkwenasgtleasiss cdoisnptaoisneedrsin
16.0 R e c o r d s ______________________________________________________________________________________
16.1 Complete the extraction worksheet and tape into the study notebook.
17.0 T a b l e s , D ia g r a m s , F l o w c h a r t s , a n d V a l id a t io n D a t a ______________________________
17.1 The validation report associated with this method is FACT-M-1.0 & 2.0-V-l.
18.0 R e f e r e n c e s __________________________________________________________________________ 18.1 AMDT-EP-22, "Routine Maintenance of Ultra-Turrax T-25"
19.0 A f f e c t e d D o c u m e n t s ______________________________________________________________________
19.1 FMAaCssTS-Mpe-c2tr, o"mAentrayl"ysis of Liver Extracts for Fluorochemicals using HPLC-Electrospray
20.0 R e v is io n s
Revision Number.
Reason For Revision
Revision
Date
FACT-M-1.0 Extraction of PFOS from Liver
3M Environmental Laboratory
Page 7 of 8
Page 119
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030
laboratory Request Number-U2279
Extraction Worksheet for FACT-M-1
Study #
Sample
Number
set #
PFOS PFOS approx. 0.5 ppm approx. 5 ppm actual ppm actual ppm #W #W
PFOS approx. 50 ppm actual ppm #W
Date and Initials for Std.
- H ,0 Blank
- --
-
Liver Blank
-
-
-
-
-
-
1- - -
- --
- --
- --
-
-
-
- --
- --
- --
- --- -
- --
- --
- --
- --
-
-
-
- --
- --
1Studv number where the original worksheet is located.
Blank Liver Homogenate: Std#
Ltvcr amount =
g
Liver Extraction Method Vortex 15 sec.
:
Date & Initials
Pipette 1mL of Liver Solution
Pipette 1 mL of t0.5 M TBA, pH 10.
Std. #
Pipette 2 mL of 0.25 Na2COy0.25M NaHCO-* Buffer Std. #
Pipette 5 mL of Ethyl Acetate
TN-A-
Shake 20 min.
Centrifuge 20-25 min. Centrifuge
Speed
Remove a 4 mL aliquot of organic laver
Put on Nitrogen Evaporator to drvness Evaporator
Temperature
Add 1.0 mL of Methanol
TN-A-
Vortex 30 sec.
Filter using a 3cc B-D svringe with a 0.2um SRI filter into a 1.5 mL autosample vial MS/MSD/___Cont. Checks: Spiked______uL of a ______ppm std (_______________ ) for a final concentration of
_________PPm- MS/MSD used sample________________ , Cont. Checks used same homogenate as for std curve.
FACT-M-1.0 Extraction of PFOS from Liver
Page 8 of 8
3M Environmental Laboratory
Page 120
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
3M Environmental Laboratory
M ethod A n a ly sis o f F luo r o c h em ic a ls in L iv e r E x t r a c t s U sing
H P L C -E lectro spray/M a ss S pec tr o m etr y
M ethod Num ber: FACT-M-2.0
Author. Lisa Clemen
Approved By:
/3 7 Laboratory Manager
f/'sd'lv -- ----------
Group Leader
T
echVnj*i.caAl
R
(JlPvlk eviewer
Adoption Date: Revision Date: /\j//)
T 'A c / ? Date
/ VA Date
h ll'it
Date
1.0 S c o p e a n d A p p l ic a t io n ________________________________________________________________________
1.1 Scope: This method is for the analysis of extracts of liver or other tissues for fluorochemical surfactants using HPLC-electrospray/mass spectrometry.
1.2 A pplicable Com pounds: Potassium perfluorooctanesulfonate, anionic fluorochemical surfactants, or other ionizable compounds.
1.3 M atrices: Rabbit, rat, bovine, and monkey livers or other livers as designated in the validation report.
Word 7.0.1/95
FACT-M-2.0 Analysis of Liver Extract Using ES/MS
3M Environmental Laboratory
Page 1 of 8
Page 121
3m Medical Department Study: T-62 95.7
Report No. FACT TOX-030 laboratory Request Number-U2279
2.0 S u m m a r y o f M e t h o d ____________________________________________________________________ _____ 2.1 This method describes the analysis of fluorochemical surfactants extracted from liver using
HioPnLcCha-realecctterroisstpicraoyf/ma apsasrtsipcueclatrrofmlueotrroyc.hTehmeicaanla, lsyusicshiassptehrefopromtaedssibuymmonitoring a single vpeerrifflyuocroomocptoaunnesduildfoennatitfeic(aPtiFoOn.S) anion, M/Z= 499. Samples may also be screened to
3.0 D e f in it io n s __________________________________________________________________________________ ___ 3.1 None.
4.0 W a r n in g s a n d C a u t io n s ______________________________________________________________ _______ 4.1 H ealth and Safety W arnings:
4.1.1 Uinstoe cthaeutpioronbwe iDthOthNeOvToltTaOgeUcCaHbleTfHorEtPheRpOrBobEe,.tWherheenistrhieskvoolftaegleectcraibcalel sishopcluk.gged 4.2 Cautions:
4.2.1 oDvoerno4t00rubnasro, ltvheenHt Ppu1m10p0s wabilolvienictiaaptaecaituytoomf a4t0ic0 sbhaurt(d5o8w0n0. psi). If pressure goes 4.2.2 Do not run solvent pumps to dryness.
5.0 I n t e r f e r e n c e s __________________________________________________________________________________ 5.1 cToenfltoanctswhoituhldthneostabmepuleseodrfeoxrtrsaacmt.ple storage or any part of instrumentation that comes in
6.0 E q u ip m e n t ______________________________________________________________________________________ 6.1 Equipment listed below may be changed in order to optimize the system.
6.1.1 Micromass Electrospray Mass Spectrometer 6.1.2 HP1100 low pulse solvent pumping system and autosampler.
7.0 S u p p l ie s a n d M a t e r ia l s ______________________________________________________________________ 7.1 Supplies
7.1.1 Nitrogen gas, refrigerated liquid, regulated to approximately 100 psi. 7.1.2 HPLC column, specifics to be determined by the analyst. 7.1.3 Capped autovials or capped 15 mL centrifuge tubes.
8.0 R e a g e n t s a n d S t a n d a r d s______________________________________ 8.1 Reagents
8.1.1 Methanol, HPLC grade or equivalent.
Word 7.0.1/95
FACT-M-2.0 Analysis of Liver Extract Using ES/MS
Page 2 of 8
3M Environmental Laboratory
Page 122
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
8.1.2 Milli-QTM water, all water used in this method should be Milli-QTM water and may
be provided by a Milli-Q TOC Plus system.
*
8.1.3 Ammonium acetate, HPLC grade or equivalent.
8.2 Standards
8.2.1 Typically one H20 blank, one liver blank, and seven liver standards are prepared during the extraction procedure. See FACT-M-1.
9.0 S a m p l e H a n d l in g _______________________________________________________________________ 9.1 Fresh liver standards are prepared with each analysis. Extracted standards and samples are
stored in capped autovials or capped 15 mL centrifuge tubes until analysis.
9.2 Iafnaanlyasliyssicsanwiblel bpeerdfoelramyeedd., extracted standards and samples may be refrigerated until
10.0 Q u a l it y C o n t r o l
________________________________________________________________
10.1 M atrix Blanks and M ethod Blanks
10.1.1 Analyze a method blank and matrix blank prior to each calibration curve.
10.2 Matrix Spikes
10.2.1 Analyze a matrix spike and matrix spike duplicate with each analysis.
10.2.2 AcEuxdrpdveietc.itoendalcosnpcikenetcroanticoennstrwaitlilonfasllminaythfealml iind-trhaenlgoewo-rfathnegeinoitfiathlecainliibtiraalticoanlibcruartvieo.n
10.2.3 See section 13 to calculate percent recovery.
10.3 Continuing Calibration Checks
10.3.1
Analyze a change (
mid-range calibration standard after 30%) in peak area occurs, relative to
every tenth sample. the initial standard
cIuf ravse,igsntoifpictahnet
run. Only those samples analyzed before the last acceptable calibration standard
will be used. The remaining samples must be reanalyzed.
10.3.2 See section 13 to calculate percent difference.
10.4 System Suitability
10.4.1 aSsyssetsesmedsfuoirtaebaiclihtyru(ne..g. peak area, retention time and peak shape, etc.) will be
11.0 C a l ib r a t io n a n d S t a n d a r d iz a t io n ________________________________________________________ 11.1 Analyze the extracted liver standards prior to and following each set of extracts. The mean
of two standard values, at each standard concentration, will be plotted by linear regression for the calibration curve using MassLynx or other suitable software.
FACT-M-2.0
Analysis of Liver Extract Using ES/MS
3M Environmental Laboratory
Page 3 of8 Page 123
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
11.2 The r2 value for the data should be 0.98 or greater. Lower values may be acceptable at the discretion of the analyst.
11.3 If the curve does not meet requirements, perform routine maintenance or reextract the standard curve (if necessary) and reanalyze.
12.0 P r o c e d u r e s ______________________________ ;___________________________________________ __ 12.1 A cquisition Set up
12.1.1 Click on start button in the Acquisition Control Panel. Set up a sample list. Assign a filename using letter-MO-DAY-last digit of year-sample number, assign a method (MS) for acquiring, and type in sample descriptions.
12.1.2 TmSIoaRsc.sreeSsa.etetAIaosmnciazenathtiiosodnucsMluiacokldlyeoncaosslcaleapcnptreboduptartiloaontneginawnthditehmAtahcseqsuStoiIsRi4ts9io.9nSocarovonetthrmeorel tpahpaopndre.ol parnidateselect
12.1.3 tThyepsieccaollnydthseetsoamf sptalendliasrtdbs.egins with the first set of liver standards and ends with
12.1.4 sSaammppllee.s Saroelvaennatlybzlaednkwsisthhoaulcdonbteinaunianlgyzceadlibpreartiioodniccahlelycktoinmjeocnteitdorafptoersseivbeleryanteanlythte carryover and are not considered samples but may be included as such.
12.2 Using the Autosam pler 12.2.1 Set up sample tray according to the sample list prepared in section 12.1.1. 12.2.2 aSneta-luypsttchoenHsiPde1r1s00a/papurtoopsraimatpelfeorraotptthiemfaolllroewspinongsceo. nRdeictoiorndsaocrtuaatlccoonnddititioionnssthine the instrument logbook: 12.2.2.1 Sample size = 10 pL injection with a sample wash
12.2.2.2 Inject/sample = 1 12.2.2.3 Cycle time = 15 minutes 12.2.2.4 Solvent ramp =
Time 0 . 0 0 min. 7.5 min. 1 1 . 0 min. 11.5 min.
MeOH 45% 90% 90% 45%
2.0 mM Ammonium acetate
55% 10% 10% 55%
Note: soInftwthaisreinwstirthumae"nWt caoitninfigguforratiinolne,t tshtearrtu"nmmesussatgbeebseeftourep tohne t"hSetaerlet"ctbroustptornavis pressed on the HP Workstation.
12.2.2.5 Press the "Start" button.
FACT-M-2.0 Analysis of Liver Extract Using ES/MS
3M Environmental Laboratory
Page 4 o f 8
Page 124
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
12.3 Instrum ent Sep-up 12.3.1 Refer to AMDT-EP-31 for more details. 12.3.2 Check the solvent level in reservoirs and refill if necessary. 12.3.3 tChheetcipk.thTehsetatiipnlsehssousltdeeblecaflpaitllwariythantothjeagegneddoefdtgheesp. rIofbteh.eUtispeiasnfoeuynedptioecbeeto check unsatisfactory, disassemble the probe and replace the stainless steel capillary. 12.3.4 Set HPLC pump to "On". Set the flow to 10 - 500 uL/min or as appropriate. aOpbpsreorxviemdartoeplylet1s0 cmominiuntgeso. ut of the tip o f the probe. Allow to equilibrate for 12.3.5 Taruorunnodnththeetinpitorof gthene.prAobfein. e mist should be expelled with no nitrogen leaking 12.3.6 The instrument uses these parameters at the following settings. These settings may change in order to optimize the response: 12.3.6.1 Drying gas 250-400 liters/hour 12.3.6.2 ESI nebulizing gas 10-15 liters/hour 12.3.6.3 LC constant flow mode flow rate 10 - 500 uL/min 12.3.6.4 Pressure <400 bar (This parameter is not set, it is a guide to ensure the instrument is operating correctly.) 12.3.7 Carefully guide the probe into the opening. Insert probe until it will not go any further. Connect the voltage cables to the probe. 12.3.8 Record tune parameters in the instrument log. 12.3.9 tUhseinagnatlhyesicsroosfsb-fiololowgiccoaulnmteartreilceecst.rode in the ES/MS source is recommended for 12.3.10 Click on start button in the Acquisition Control Panel. Press the start button at taonpaloyfzesdam. ple list. Ensure start and end sample number includes all samples to be
13.0 D a t a A n a l y s is a n d C a l c u l a t io n s _________________________________________________________ 13.1 Calculations:
13.1.1 Calculate matrix spike percent recoveries using the following equation: % Recovery = Observed Result - Background Result x 100
Expected Result 13.1.2 Calculate percent difference using the following equation: % Difference = Expected Cone. - Calculated Cone, x 100
Expected Cone.
FACT-M-2.0 Analysis of Liver Extract Using ES/MS
3M Environmental Laboratory
Page 5 of 8
Page 125
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03G laboratory Request Number-U2279
13.1.3 Calculate actual concentration of PFOS anion in total liver (mg):
)f ug PFOS anion calc, from std curve'']
-V--------g---o--f--l-i-v1-e0--r0--0u--su-e-d-g--/f-o1--rm--a-gn--a--l-y-s--is--------- x T^otal mass of liver (g),
14.0 M e t h o d P e r f o r m a n c e _______________________________________________________________ _ 14.1 The method detection limit is equal to at least three times the baseline noise in the matrix
blank. 14.2 The practical quantitation limit is equal to the lowest standard in the calibration curve.
15.0 P o l l u t io n P r e v e n t io n a n d W a s t e M a n a g e m e n t ______________________________________ 15.1 Sample waste is disposed in biohazard containers, flammable solvent waste is disposed in
hcoignhtaBinTerUs caorentlaoicnaetresd, ainndthgelalasbsopriapteotrtye.waste is disposed in broken glass containers. All
16.0 R e c o r d s _______________________________________________________________________________________ 16.1 Store chromatograms in the study folder. Each chromatogram should have the following
information included either in the header or hand written on the chromatogram: study number, sample name, extraction date, and dilution factor (if applicable). 16.2 Plot calibration curve by linear regression and store in the study folder. 16.3 Print sample list from MassLynx and tape into the instrument runlog. 16.4 Print data integration summary from MassLynx and tape into the instrument runlog. 16.5 Copy instrument runlog pages, including instrument parameters and sample results, and tape into appropriate study notebook. 16.6 Summarize data using suitable software and store in the study folder. 16.7 Bloaccaktiounp oelfebctarcoknuipc edlaetcatrtoonaipcpdraotpar.iate media. Record in study notebook the file name and
17.0 T a b l e s , D ia g r a m s , F l o w c h a r t s , a n d V a l id a t io n D a t a _______________________________ 17.1 Attachment A: FACT-M-2 Data reporting spreadsheet 17.2 The validation report associated with this method is FACT-M-1.0 & 2.0-V -l.
18.0 R e f e r e n c e s ___________________________________________________________________________________ 18.1 AMDT-EP-31, "Operation of VG Platform Electrospray Mass Spectrometer"
FACT-M-2.0 Analysis of Liver Extract Using ES/MS
3M Environmental Laboratory
Page 6 of 8
Page 126
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
19.0 A f f e c t e d D o c u m e n t s _________________________________________________________________ __ 19.1 FACT-M-1.0, "Extraction of Potassium Perfluorooctanesulfonate from Liver for Analysis
Using HPLC-Electrospray/Mass Spectrometry"
20.0 R e v is io n s ______________________________________________________________________________________
NRuevmisbieorn.
-
Reason For Revision
ReDvaisteion
FACT-M-2.0 Analysis of Liver Extract Using ES/MS
3M Environmental Laboratory
Page 7 of 8
Page 127
3m Medical Department Study: T-6295.7
Report N o . FACT TOX-030 laboratory Request Number-U2279
Laboratory Study #
Study: Test Material: Matrix/Final Solvent: Method/Revision: * Analytical Equipment System Number. Instrument Software/Version: Filename: R-Squared Value: Slope: Y Intercept: Date of Extraction/Analyst: Date of Analysis/Analyst:
Group Sample# Concentration Dose ug/mL
Initial Vol. mL '
Dilution Factor
Final Cone. ug/mL
Slope: Taken from linear regression equation. Group/Dose: Taken from the study folder. Sample#: Taken from the study folder. Concentration (ug/mL): Taken from the MassLynx integration summary. Initial Volume (mL): Taken from the study folder. Dilution Factor: Taken from the study folder. Final Cone. (ug/mL): Calculated by dividing the initial volume from the concentration
FACT-M-2.0 Analysis of Liver Extract Using ES/MS
3M Environmental Laboratory
Page 8 of 8
Page 128
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
3M Environmental Laboratory
M ethod
E x t r a c t i o n -o f P o t a s s iu m P e r f l u o r o o c t a n e s u l f o n a t e o r O t h e r F lu o r o c h em ic a l co m pounds fro m L iv er for A nalysis U sing H PL C -E lectrospray/M ass S pe ctro m etry
M ethod Num ber: FACT-M-1.1
Author: Lisa Clemen, Glenn Langenburg Approved By:
D/./1--
Laboratory Manager
in L v fh ---------
Group Leader
C d s* A t h r u *
Technical Reviewer
Adoption Date: 05/26/98
Revision Date: ofela>hl
/?../? '
Date
C /tlO c)
Date Date
1.0 S c o p e a n d A p p l ic a t io n ________________________________________________________________________
1.1 Sotchoepref:luTorhoicshmemethicoadl cisomfoprotuhendesxtfrraocmtiolniveorf.potassium perfluorooctanesulfonate (PFOS) or 1.2 Applicable Compounds: Fluorochemical surfactants or other fluorinated compounds.
1.3 rMepaotrrti.ces: Rabbit, rat, bovine, and monkey liver or other liver as designated in the validation
Microsoft 6.0/95
FACT-M-1.1 Extraction of PFOS from Liver
3M Environmental Laboratory
Page 1 o f 15
Page 129
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
2.0 Su m m a r y o f M e t h o d _________________________________________________________________
2.1 This method describes the procedure for extracting potassium perfluorooctanesulfonate
(5P.0FOmS)l oorfoetthheyrl fatcueotraotec.heImn itchaislsmfreotmhodli,veservheonmfolugoernoactheeumsiincaglsanwieorne pexatirraincgtedre:aPgFenOtSa,nd
PFOSA, PFOSAA, EtFOSE-OH, POAA, PFOSEA, Dpaerftiintiiotinoends)in. toAnethioynl apcaeitrainteg. rFeaoguernmt ilsoafdedxetdratcot tahree
asanmd pFlCe -a8n0d7tmheonanoaeslyteter i(osneep3a.i0r is removed and put onto a nitrogen
evaporator until dry. Each extract is reconstituted in 1.0 ml of methanol, then filtered
through a 3 cc plastic syringe attached to a 0.2 pm nylon filter into glass autovials.
3 .0 D e f in it io n s _____________________________________________________________________________
3.1 PFOS: perfluorooctanesulfonate (anion o f potassium salt) C8F,7S 0 3'
3.2 PFOSA: perfluorooctane sulfonylamide C8F,7S 0 2NH2
3.3 PFOSAA: perfluorooctane sulfonylamido (ethyl)acetate C8Fl7S 0 2N(CH2CH3)CH2C 02"
3.4 EtFOSE-OH: 2(N-ethylperfluorooctane sulfonamido)-ethyl alcohol
C8F17S 0 2N(CH2CH3)CH2CH20H
'
3.5 POAA: perfluorooctanoate (anion of ammonium salt) C7FisCOO'
3.6 PFOSEA: perfluorooctane sulfonyl ethylamide C8F,7S 0 2N(CH2CH3)H
3.7 FC-807 monoester C8F i7S 0 2N(CH2CH3)CH2CH20 -P 0 3H)
3.8 Surrogate standard 1H,1H,2H,2H perfluorooctane sulfonic acid
4.0 W a rn in g s and C autions________________________________________________________________ 4.1 Health and safety warnings:
4.1.1 hUasnedulinnigvearnsaiml palretcisasuuteio, nits,measypeccoinatlalyinlapbaotrhaotgoernysc. oats, goggles, and gloves when
5.0 I n t e r f e r e n c e s _________________________________________________________________________
5.1 There are no known interferences at this time.
6.0 E q u ip m e n t _____________________________________________________________________________
6.1 Tachceepfotallbolwe.ing equipment is used while carrying out this method. Equivalent equipment is 6.1.1 Ultra-Turrax with T25 grinder attachment for grinding/dispersing/emulsifying 6.1.2 Vortex mixer, VWR, Vortex Genie 2 6.1.3 Centrifuge, Mistral 1000 or IEC 6.1.4 Shaker, Eberbach or VWR 6.1.5 Nitrogen evaporator, Organomation 6.1.6 Balance, ( 0.100 g)
ExtractioFnAoCf TPF-MO-S1.f1rom Liver
Page 2 of 15
3M Environmental Laboratory
Page 130
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
7.0 Su p p l ie s a n d M a t e r ia l s __________________________ ___________________________________ 7.1 Gloves 7.2 Eppendorf or disposable pipettes 7.3 Nalgene bottles, capable of holding 250 ml and 1 L 7.4 Wheaton 6 ml Plastic Sampule Vials 7.5 Glass, type A, volumetric flasks 7.6 40 ml glass I-CHEM vials 7.7 Polypropylene centrifuge tubes, 15 ml 7.8 Labels 7.9 Syringes, capable of measuring 5 pL to 50 pL 7.10 Glass, type A, volumetric pipettes 7.11 Graduated pipettes 7.12 Electronic pipettor, Eppendorf or equivalent 7.13 Timer 7.14 Disposable plastic 3 cc syringes 7.15 Filters, nylon syringe filters, 0.2 pm, 25 mm 7.16 Crimp cap autovials Note: QPTMriowr atoteur.sinRgingsleasssywrainrgeeasnadmbointtimlesu,mrinosfe93titmimeesswwitihthmmeeththaannool,l 3anrdin3setsimfreosmw3ithseMpairlalit-e
vials.
8.0 R e a g e n t s a n d St a n d a r d s _________________________________________________________ 8.1 ASTM Type I reagent grade water, Milli-QTM or equivalent; all water used in this method
should be Milli-QTM water and may be provided by a Milli-Q TOC PlusTM system. 8.2 Sodium hydroxide (NaOH), J.T Baker or equivalent 8.3 Tetrabutylammonium hydrogen sulfate (TBA), Kodak or equivalent 8.4 Sodium carbonate (Na^CO^), J.T. Baker or equivalent 8.5 Sodium bicarbonate (NaHC03), J.T. Baker or equivalent 8 . 6 Ethyl acetate, Omnisolv, glass distilled or HPLC grade 8.7 Methanol, Omnisolv, glass distilled or HPLC grade 8 . 8 Liver tissue, frozen from supplier 8.9 Control matrix or blank matnx for standards, QC checks, blanks, etc. 8.10 Fluorochem ical standards
8.10.1 PFOS (3M Specialty Chemical Division), molecular weight = 538 8.10.2 PFOS A (3M Specialty Chemical Division), molecular weight = 499 8.10.3 PFOS.AA (3M Specialty Chemical Division), molecular weight = 585
ExtractioFnAoCf PTF-OMS-lf.lrom Liver
Page 3 o f 15
3M Environmental Laboratory
Page 131
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
8.10.4 EtFOSE-OH (3M Specialty Chemical Division), molecular weight = 571
8.10.5 POAA (3M Specialty Chemical Division), molecular weight = 431
8.10.6 PFOSEA (3M Specialty Chemical Division), molecular weight = 527
8.10.7
FC-807 monoester (3M Specialty Chemical Division). FC-807 is a mixture of tmrioelsetceru,ladriewsteeirg,hatn=d 6m5o0noester fluorochemical components. The monoester
8.10.8 Surrogate Standard: 4-H, perfluorooctane sulfonic acid (l-H .l-H , 2-H,2-H C8FI3S 0 3H) molecular weight = 428
8.10.9 Other fluorochemicals, as appropriate
8.11 Reagent preparation
8.11.1 d11i00s0sN0olsmvoelddbi.uemaSktoehrryedcorinnoxtaaidi1neLin(NgNaa5Ol0gH0en)m:elWbMoetiitlgllehi-.QapTMprwoxaitmera, tmeliyx2u0n0tgil NalalOsoHli.dsPoaurer into a
8.11.2 1 N sodium hydroxide (NaOH): Dilute 10N NaOH 1:10. Measure 10 ml of 10N NaOH solution into a 100 ml volumetric flask and dilute to volume using Milli-QTM water. Store in a 125 ml Nalgene bottle.
8.11.3 0.5 M tetrabutylammonium hydrogen sulfate (TBA): Weigh approximately 169 pgrHam10s oufsiTngBAapipnrtooxaim1aLtevlyol4u4mteotr5i4c mcolnotafin10inNg N50a0OHmlaMndildlii-lQutTMe two avtoelru.mAedjwuistthto Milli-QTM water. While adding the last few m l's of NaOH, add slowly because the pH changes abruptly. Store in a 1 L Nalgene bottle.
8.11.3.1 nTeBedAedreuqsuiinrgesIaNcNheacOkHprsioolruttoioena.ch use to ensure pH = 10. Adjust as
8.11.4
0.25M Sodium approximately
carbonate/sodium bicarbonate buffer 26.5 g of sodium carbonate (Na;C 0 3)
(aNnda22C10.03/Ng
a o
HC03): W f sodium
eigh
bicarbonate (NaHC03) into a 1 L volumetric flask and bring to volume with Milli-
QTM water. Store in a 1 L nalgene bottle.
8.12 Standards
8.12.1 Prepare PFOS standards for the standard curve.
8.12.2 Prepare other fluorochemical standards, as appropriate. Multicomponent cflounotraoinchinegm1ic.a0l0 sptapnmdaPrFdOs aSr,e1a.0c2ceppptamblPeF(Oe.gS.Ao,n0e.9w8o7rkpipnmg sPtaFnOdSarAdAs,oaluntdio1n.10 ppm EtFOSE-OH.)
8.12.3 tWheeiagchtuaapl pwreoixgihmt.ately 100 mg of PFOS into a 100 ml volumetric flask and record
8.12.4 Bring to volume with methanol for a stock standard of approximately 1000 ppm (pg/ml).
8.12.5 Dapilpurtoextihmeastteolyck50sopluptmio.n with methanol for a working standard 1 solution of
ExtractioFnAoCf PTF-OMS-lf.lrom Liver
Page 4 of 15
3M Environmental Laboratory
Page 132.
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
8.12.6 Dilute the stock solution with methanol for a working standard 2 solution of approx. 5.0 ppm.
8.12.7 Dilute the stock solution with methanol for a working standard 3 solution of approx. 0.50 ppm.
8.13 Surrogate stock standard preparation 8.13.1 Preparer surrogate stock standard. Weigh approximately 50-60 mg o f surrogate astcatnudaal rwdei1g-hHt,.1-H, 2-H,2-H, C8F,3S 0 3H into a 50 ml volumetric flask and record the 8.13.2 Bring to volume with methanol for a surrogate stock of approximately 1000-1200 ppm. 8.13.3 Prepare a surrogate working standard. Transfer approximately 0.5 ml o f surrogate ssttaoncdkatrodo5f010m-2l 0voplpumm.etRrieccfolradskthaendacbturianlgvtooluvmoleumtraenwsfietrhremde. thanol for a working
8.14 Liver homogenate preparation
Note: The follo w in g procedure w ill be much easier to perform with frozen liver
tissue. Prevent tissuefrom thawing; keep stored on ice until excising a portion o f
it:
8.14.1 Weigh 40 g o f blank or control liver into a 250 ml Nalgene bottle containing 100 mis Milli-QTM water. Record the actual weight of liver and total volume o f water used. Grind the liver into a finely dispersed homogenate with an Ultra-Turrax T25 grinder (high speed for approximately 3 minutes or until sufficiently homogenized). Rinse grinder with an additional 100 ml of MilliQTM water, to bring the total volume of water added to 2 0 0 ml.
8.14.2 To determine the concentration of the blank liver homogenate, transfer ten 1.0 ml aliquots o f the homogenate to tared polypropylene tubes, and weigh each aliquot on a balance. The average density o f these aliquots is determined and then the concentration (g of liver/ml of homogenate) can be calculated as follows:
8.14.3 fgrams of liver] x fave, weight of 1 .0 ml of homogenate (density) (g/ml)] {[grams (g) of liver] + [grams (g) of water]}
8.14.3 Prepare sample livers as described in 8.3.1, but weigh out 1 g o f liver, homogenize with 2.5 ml of MilliQTM water, and rinse with another 2.5 ml of MilliQTM water. Use Wheaton 6 ml plastic sampule vials or appropriate receptacle. Rinse grinder unit after every sample with water and then with methanol. Label vials appropriately including study number, sample ID, liver weight, date, and analyst. Record all weights and volumes used. (Do not perform 8.3.2 fo r the sample liver
homogenates).
3M Environmental Laboratory
ExtractioFnAoCf TPF-MO-S1.f1rom Liver
Page 5 ofl5
Page 133
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
9.0 _Sa m p l e H a n d l in g _____________________________________________________________ _______ 9.1 All livers are received frozen and must be kept frozen until the extraction is performed.
10.0 ___Q u a l i t y C o n t r o l _______________________________________________________________ 10.1 M atrix blanks and method blanks
10.1.1 Efoxltlroawctintgwothi1s.0prmolceadliuqrueoatsndofutsheealsivmerathroixmbolgaennkas.teS(peereSpeacrteidonin181..114.2.1. -2) 10.1.2 Emxettrhaocdt tbwlaonk1s.0. ml aliquots of Milli-QTM water following this procedure and use as 10.2 M atrix spikes 10.2.1 Pthreepaacrceurriancdyaonfatlhyezeexmtraatrcitxiosnp.ike and matrix spike duplicate samples to determine 10.2.2 rPerceepiavreedewacithhsepaikche suasminpglelivseetr. chosenby the analyst, usually the control liver 10.2.3 AcEaxdlpidbeirtciatotenidoanlcocsnpucrikevnees.trmataioynbsefainllcilnudtehde manidd-mraanygefaollfitnhethieniltoiawl-rcaanligberaotifotnhecuinrviteia. l 10.2.4 Prepare one matrix spike and one matrix spike duplicate per 40 samples, with a
minimum of 2 matrix spikes per batch. 10.3 Continuing calibration checks
10.3.1 aPtthhcreeceepcipnaotrinateitbaianllenucdcainhlaigebncrackalh.yteizocekncdcouinfrftveiner.ubiIynfg>thc3ae0l%pibe,rrarcteeianontnadcliyhfzfeeecrkseansmacemplbpeelsetwsanetoaenleynzthesuderiaenfitttheirealtahcceucrulavrseatcayndof 10.3.2 pPrreeppaarree aonnde ecxhtercakctpfeorugrrcohuepckosf.ten samples. For example, if a sample set = 34, 10.3.3 Pusreedpatroeperaecpharceonthtieniuniintigalcacluibrvrea.tion check from the same blank liver homogenate 10.3.4 The expected concentrations fall within the mid-range o f the initial calibration
curve. Additional spikes may be included that fall in the low-range of the initial calibration curve. This is necessary if the analyst must quantitate using only the plopwb).end of the calibration curve (e.g. 1 0 ppb - 1 0 0 ppb, rather than 1 0 ppb - 1 0 0 0
11.0 C a l i b r a t i o n a n d St a n d a r d iz a t io n __________________________________________________ 11.1 P re p a re liv e r h o m o g e n a te s ta n d a rd s
11.1.1 T ra n s fe r 1 m l a liq u o ts o f b la n k /c o n tro l liv e r h om og en ate prepared in 8 .1 4 .1 -2 to 15 m l ce ntrifug e tubes.
3M Environmental Laboratory
ExtractioFnAoCf TPF-MO-S1.f1rom Li%'er
Page 6 of 15
Page 134
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
11.1.2 If the volumes of sample liver homogenates are limited, extract standards with liver homogenate volumes equal to the sample volumes. Do not extract below 0.50 ml o f liver homogenate. Record the sample volume on the extraction sheet.
11.1.3 tWubheisle, mpriexpoarrisnhgaaketobtaeltwoefetnweanlitqyuaoltisq.uots of liver homogenate in 15 ml centrifuge
11.1.4 Two 1 ml, or appropriate aliquots, serve as matrix blanks. Typically use the standard concentrations and spiking amounts listed in Table I (at the end of this asencdtitowno) tmoastpriixkeb,lainnkdsu.plicate, two standard curves, for a total of eighteen standards
11.1.5 Rtheefewrotroktinheg vraalnidgeastiaonndrLepinoretasrFCAalCibTra-tMion-l.Rl-aVn-g1e a(LndCRFA) fCorTc-Mali-b2r.a1t-iVon-1cuwrhviecsh. list
11.1.6 Use Attachment D as an aid in calculating the concentrations of the working standards. See Section 13.0 to calculate actual concentrations o f PFOS in calibration standards.
11.2 To each standard, blank, or QC check, add appropriate amount of surrogate working standard for the concentration to fall within the calibration curve range 1 0 ppb - 1 0 0 0 ppb.
11.3 Extract spiked liver homogenate standards following 12.6-12.16 of this method. Use these standards to establish each initial curve on the mass spectrometer.
Table 1
Approximate Spiking Amounts for Standards and Spikes
Using 1.0 ml of Liver
Working Standard (Approx. Conc.)
pL ... Approx. final cone, of PFOS in liver
- - Blank
0.500 ppm 4 0 . 0 1 2 ppm
0.500 ppm 10 0.030 ppm
0.500 ppm 2 0 0.060 ppm
0.500 ppm 40 0 . 1 2 0 ppm
5.00 ppm
1 0 0.300 ppm
5.00 ppm
2 0 0.600 ppm
5.00 ppm
30 0.900 ppm
50.0 ppm 4 1 . 2 0 ppm
50.0 ppm 6 1.80 ppm
12.0 P r o c e d u r e s ____________________________________________________________________________ 12.1 Obtain frozen liver samples and homogenize as described in 8.14.3.
12.2 Va o1r5temxlmpoixlyhpormopoygleennaetecefnotrri1f5ugseectounbde.s, then transfer 1 .0 ml or other appropriate volume to
12.3 Return liver homogenate samples to freezer after extraction amount has been removed.
3M Environmental Laboratory
ExtractioFnAoCf PTF-MOS-If.lrom Liver
Page 7 of 15
Page 135
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
12.4 Record the liver homogenate volume on the extraction worksheet. The final methanol volume will equal the initial homogenate volume. For example, if 1 ml of homogenate is transferred for extraction, then the final reconstitution methanol volume equals 1 ml.
12.5 wLaobrkelshtheeettufobredwoictuhmtheentsitnugdythneurmembeari,nliinvgerstIeDp,s.date, and analyst initials. See attached 12.6 dSepsickreibbeladnikn lSiveecrtihonom1o1g.1enoartTe aablilqeuIotisnwthitaht stehcetiaopnprfooprrtihaetecaalmiboruantitoonfcsutarnvdeasrtdanadsards.
Also prepare matrix spikes and continuing calibration standards. 12.7 Spike all samples, including blanks and standards, ready for extraction with surrogate
standard as described in Section 11.2. 12.8 Vortex mix the standard curve samples, matrix spike samples, and continuing calibration
samples for 15 seconds. 12.9 To each sample, add 1 ml 0.5 M TBA and 2 ml of the 0.25 M sodium carbonate/sodium
bicarbonate buffer. 12.10 Using a volumetric pipette, add 5 ml ethyl acetate. 12.11 Cap each sample and put on the shaker for 20 minutes. 12.12 Centrifuge for 20 to 25 minutes at approximately 3500 rpm, until layers are well separated. 12.13 cTernatnrsiffeurge4 tmubl eo.fLoarbgealntichilsayfreers,hutsuinbge wa i5thmtlhgersaadmuaeteindfogrlamsastpioipneattse,into12a.5cl.ean 15 ml 12.14 hPouutresa.ch..s.ample on the analytical nitrogen evaporator until dry, approximately 2 to 3 12.15 peAxidptrdeattc1et..i0onMm. letohraanpoplrvooplruiamtee veoqluuamlsethoef mineittihaalnvoollutomeeacohf lcievnetrrhifoumgeogtuebneatuesuinsgeda fgorratdhueated 12.16 Vortex mix for 30 seconds. 12.17 FAitlttaecrhinato0.a2 1p.m5 mnlylgolnasms aesuhtofviilatelr(otor alo3wc-vcoslyurminegeauatnodvitarlawnshfeerntnheecseasmsapryle).to this syringe. 12.18 Label the autovial with the study number, animal number and gender, sample timepoint,
matrix, final solvent, extraction date, and analyst(s) who performed the extraction. 12.19 Cap and store extracts at approximately 4 C until analysis. 12.20 Complete the extraction worksheet, attached to this document, and tape to page o f study
notebook or include in study binder, as appropriate. 13.0 D a t a A n a l y s is a n d C a l c u l a t io n s ___________________________________________________ 13.1 Calculations:
13.1.1 Calculate actual concentrations o f PFOS, or other appropriate fiuorochemical, in calibration standards using the following equation:
3M Environmental Laboratory
FACT-M-1.1 Extraction of PFOS from Liver
Page 8 o f 15
Page 136
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
ml o f Standard x Concentration of Standard (ug/mQ______ = Concentration of Blank Liver Homogenate (g/ml) (see 8.14.2)
Final Concentration (pg/g) of PFOS in Liver See Attachm ent D for a sample form to calculate the concentrations of standards.
14.0 M e t h o d P e r f o r m a n c e ________________________________________________________________
14.1 TspheecimfiecthMoDd Ldeatnecdtiloimn iltimofitq(uManDtiLta)tiisonan(LalOytQe )anvdalumeastr(isxeespAetctiaficch. mReenftesr Bto aMndDLC)r.eport for
14.2 The following quality control samples are extracted with each batch of samples to evaluate the quality o f the extraction and analysis.
14.2.1 Method blanks and matrix blanks
14.2.2 pMraetcriisxiosnpiokfethanedexmtraatcrtixiosnpike duplicate samples to determine accuracy and
14.2.3 Continuing calibration check samples to determine the continued accuracy of the
initial calibration curve.
'
15.0 P o l l u t i o n P r e v e n t io n a n d W a s t e M a n a g e m e n t ____________________________________
15.1 Sample waste is disposed in biohazard containers, flammable solvent waste is disposed in hloicgahteBdTiUn tchoentlaabinoerrast,orayn.d used glass pipette waste is disposed in broken glass containers
16.0 R e c o r d s _______________________________________________________________________________
16.1 Complete the extraction worksheet attached to this method, and tape into the study notebook or include into study binder, as appropriate.
17.0 A t t a c h m e n t s __________________________________________________________________________
17.1 Attachment A, Extraction worksheet 17.2 Attachment B, MDL/LOQ values 17.3 Attachment C, LOQ summary 17.4 Attachment D, Calibration standard concentration worksheet
18.0 R e f e r e n c e s ____________________________________________________________________________ 18.1 The validation reports associated with this method are FACT-M-1.1 and 2.1-V-l.
19.0 A f f e c t e d D o c u m e n t s _______________________________________________________________________
19.1 FACT-M-2.1, "Analysis of Liver Extracts for Fluorochemicals using HPLC-Electrospray Mass Spectrometry"
3M Environmental Laboratory
ExtractioFnAoCf TPF-MO-S1.f1rom Liver
Page 9 of 15
Page 137
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03Q laboratory Request Number-U2279
2 0 .0 R e v is io n s _____________________________________________________________________
NRuevmisbieorn.
1
Reason For Revision 7Validation o f method to include flu o rochemicals, new A P I/M S (M S )
ReDvaistieon 08/01/98
systems, monkey liver cross validation, improvements to ion pairing
extraction, M D L study, updates in record keeping and storing policies,
etc.
3M Environmental Laboratory
ExtractioFnAoCf PTF-OMS-l.flrom Liver
Page 10 of 15
Page 138
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Study#
Surrogate Std.
Matrix
approx, ppm
Box# actual ppm
#W
Analyst/Date
H.O BBllaannkk -
FC Mix Std approx. 0.5 ppm actual ppm #W
FC Mix Std aapctpuraolx. 5 ppppmm #W
FC Mix Std Comments approx. 50 ppm a#cWtual ppm
1
Blank_______________ Std #____________________amount =____________________________________________________________
Extraction Mcthod/Revision:_____________________________________________________________________ Date & Initials_____
Add Surrogate, Vortex IS sec.
___________________________________________________________________________
Pipette Sample_______________________________________Volume________________ ml____________________________________
Pipette 1ml of 0.5 M TBA, pH 10. PH =
Std. #
Pipette 2 ml of 0.25 Na2COyQ.25M NaHCOi buffer__________ Std. tt
_________________________________
Pipette S ml of ethyl acetate______________________________ TN-A-
__________________________________
Shake 20 min._________________________________________ Shaker Speed________________________________________________
Centrifuge 20-25 min.___________________________________Centrifuge speed:_____________________________________________
Remove a 4 ml aliquot of organic layer________________________________________________________________________________
Put on Nitrogen Evaporator to dryness___________________ Temperature:__________________________________________________
Add methanol_____________ Volume
ml__________ TN-A-
_____________________________
Vortex 30 sec.
____ __________________________________________________________________________________
Filter usiMngSa/M3cScDB/-_D__syCroinngte. Cwihthecaks0:.2SppmikSeRdI_f_il_te_r__inutoLao1f.5am__l_a_u_t_ospapmmplestvdia(l_______________________________)_f_o_r_a__f_in_a_l__co__n_c_e_n_tr_a_t_i_o_n__o_f___ _________ppm. MS/MSD used sample________________ . Cont. Checks used same matrix as for std curve.
Attachment A: Extraction worksheet ExtractioFnAoCfTP-FMO-S1.f1rom Liver
Page 11 o f 15
3M Environmental Laboratory
Page 139
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
M DL/LOQ values for Rabbit Liver:
Compound MDL LOQ Linear Calibration Range (LCR)
(ppb) (PPb) Approximate Concentrations to be used for preparing the Standard Calibration Curve
PFOS
1 1 .8 3 7 .4 3 8 p p b - 1 0 0 0 p p b
PFOSA
6 .0 6 1 9 .3 2 0 p p b - 1 2 0 0 p p b
PFOSAA
5 5 .7 177 18 0 p pb - 1 0 0 0 ppb
EtFOSE-OH 5 8 .7
187 190 ppb - 1800 ppb
POAA
2 3 .7 7 5 .5 7 6 p p b - 1 8 0 0 p p b
PFOSEA Monoester
1 6 .2 5 1 .7 6 2 p p b - 1 2 0 0 p p b
n/v n/v M o n o e s te r w as n o t d e te c ta b le /q u a n tifia b le at th e s p ik e d c o n cen tra tio n s.
M DL/LOQ values for Rat Liver:
Compound MDL LOQ Linear Calibration Range (LCR)
(ppb) (PPb) Approximate Concentrations to be used for preparing the
Standard Calibration Curve
PFOS
2 4 .7 7 8 .7 j 6 2 p p b - 1 2 0 0 ppb
PFOSA PFOSAA EtFOSE-OH POAA PFOSEA Monoester
2 0 .7
n/v n/v n/v n/v n/v
6 5 .8 2 0 ppb - 1 2 0 0 ppb
n/v 6 2 p p b - 1 2 0 0 p p b n/v 1 2 0 p p b - 1 2 0 0 p p b n/v 6 2 p p b - 1 2 0 0 p p b n/v 1 2 0 p p b - 1 2 0 0 p p b n/v M o n o e s te r w as n o t d e te c ta b le /q u a n tifia b le at th e s p ik e d c o n c e n tra tio n s .
M DL/LOQ values for M onkey Liver:
Compound MDL LOQ Linear Calibration Range (LCR)
(ppb) (PPb) Approximate Concentrations to be used for preparing the
Standard Calibration Curve
PFOS
n/v n/v 5 9 p p b - 1 2 0 0 p p b
PFOSA PFOSAA
2 7 .4 87 .1 2 8 p p b - 1 2 0 0 p p b
n/v n/v 1 2 0 p p b - 1 2 0 0 p p b
EtFOSE-OH n/v
POAA
n/v
n/v 5 8 p p b - 1 2 0 0 p p b n/v 1 2 0 p p b - 1 2 0 0 p p b
PFOSEA
n/v n/v 1 2 0 p p b - 1 2 0 0 p p b
Monoester
n/v n/v M o n o e s te r w as n o t d e te c ta b le /q u a n tifia b le at the sp ike d c o n cen tra tio n s.
n /v = N o t v a lid . U p o n a n a ly zin g the data, valu e d id n o t pass th e c rite ria set fo r th is c h a ra c te riza tio n . U n til fu rth e r a n a ly s is is c o m p le te d , use th e L C R to d e te rm in e th e ra n g e o f sta n d ard co n cen tratio n s fo r c a lib ra tio n cu rve p rep aratio n .
A ttachm ent B: M D L /L O Q Values
3M Environmental Laboratory
F A C T - M - 1.1 E xtraction o f PFO S from L iver
Page 12 of 15
Page 140
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Compound PFOS
Matrix Rabbit Bovine
MDL LOQ 11.8 ppb 37.4 ppb ' n/d = not determined2
Approximate Linear Range1
StaLnodward !jHigh Standard
38 ppb
1000 ppb
60 ppb
1200 ppb
Rat Monkey
24.7 ppb 78.7 ppb n/v = not valid3
62 ppb 59 ppb
1200 ppb 1200 ppb
PFOSA
Rabbit 6.06 ppb 19.3 ppb 20 ppb 1200 ppb
Bovine
n/d
n/d
30 ppb
1200 ppb
Rat
20.7 ppb 65.8 ppb
6 ppb
1200 ppb
Monkey
27.4 ppb 87.1 ppb
6 ppb
1200 ppb
PFOSAA
Rabbit 55.7 ppb 177 ppb 180 ppb 1900 ppb
Bovine
n/d
n/d 120 ppb 1200 ppb
Rat
n/v
n/v
62 ppb
1200 ppb
Monkey
n/v
n/v 120 ppb 1200 ppb
EtFOSE-OH Rabbit
58.7 ppb 187 ppb 190 ppb 1800 ppb
Bovine
n/d
n/d 120 ppb 1200 ppb
Rat n/v n/v 120 ppb 1200 ppb
Monkey
n/v
n/v 58 ppb 1200 ppb
POAA Rabbit 23.7 ppb 75.5 ppb 76 ppb 1800 ppb
Bovine
n/d
n/d 120 ppb 1200 ppb
Rat n/v n/v 62 ppb 1200 ppb
Monkey
n/v
n/v 120 ppb 1200 ppb
PFOSEA
Rabbit 16.2 ppb 51.7 ppb 62 ppb 1200 ppb
Bovine
n/d
n/d
30 ppb
1200 ppb
Rat n/v n/v 120 ppb 1200 ppb
Monkey
n/v
n/v 120 ppb 1200 ppb
Monoester
Rabbit
n/d
n/d
n/'a
n/'a
Bovine
n/d
n/d
n/a
n/a
Rat n/d n/d n/'a n/'a
Monkey
n/d
n/d
n/a
n/a
e1x-cUespspiveerlyLiwmeiitgchhtotsheenswtahnedraerdthceuvravleuoerwaaffsewctitRhienpetahteabLiilniteyar&CRaleibprraotdiouncibRialintygev(aLluCeRs.) but did not
2 - Not determined refers to no sample was analyzed for this data. 3de-teNromtinvaatliiodnr.efers to data from the analysis failed to meet specific criteria for a valid MDL/'LOQ
jC om pound L iv er M atrix
R ab b it B o v in e Rat M onkey
Prepared Range of Standards
(p p b )(n g /g ) 5.95 - 1790 6.00 - 1200
6.22 - 1240 5.93 - 1190
PFOS
Range of Average Curve
(p p b )(n g /g ) 5.95 -1790 6.00 - 1200
L-__X__e_R__lf_r_o____ 1 R a n g e of
LC R frani' Range of 1
1ffe!
Low Std. Curve
. Loti Std.:;7= H igh Std. Curve
pH sim ilim
(p p b )(n g /g ) 5.95 - 298
n/a
3 ;..(-pirp.69X;-d2j9?8/^ j n/a/*,
(p p b )(n g /g ) 119-1790
n/a
TSx 9?
___65_.._92_32__--_1_12_14_9_00___ii
622.r .1240 5913-9 :
n/a n/a
j . _. _n/a ! n/a
n/a
j n/a
.. .n/a- : j : n/a
Attachment C: LOQ summary
3M Environmental Laboratory
FACT-M-1.1
Extraction o f P F O S from L iv er
Page 13 o f 15
Page 141
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Com pound
PFOSA
;
1
L iv er M atrix
R abbit B o v in e
Prepared Range of Standards (p p b )(n g /g ) 6.04 - 1810 5.95 - I 190
Range of Average Curve (p p b )(n g /g ) 6.0 4 - 1210 5 .9 5 -1 1 9 0
.L C R f r--o m-.z o m sm
R ange of i L C R from y Range of I LGR/frptn L ow S td. L o\^ S td /V ( High Std. j.'H p iS td :
Curve i --v. C u ry e iS i Curve (p p b )(n g/g) (pp^KPE/E^y: (P Pb)(ng/g) j[ppB}(ffge> 6 .0 4 - 302 ,r,A 2 i\^ Z 0 te i: 121 1 2 1 0 1m m m i
n/a n/a
Rat 6 .1 7 - 1240- 6.17 - 1240
n/a
n/a
M onkey
Com pound L iv er M atrix
5.88 - 1180
Prepared Range of Standards (PPb)(ng/g)
5.38 - 1180 i
PFO SA A
(p p b )(n g /g )
j
n/a ... .- -ttn / j S fi n/a
i----------------------
1
Range of ;bpC R Jj$m & Low Std.
Curve
m
(p p b )(n g /g )
(P p b )(n g /g )
R abbit B o v in e
6.33 - 1900 5.99 - 1200
127 - 1900 120-1200 fflaaM B O M
^ '& m S S U n/a
n/a n/a
Rat M onkey
6.21 - 1240 5.92 - 1 180
62.1-1240 l l i p p i 59.2 - 1180 g P ]|jjg jg j
i . n/a
S H U fi ';i
n/a n/a
Com pound
: E tFO SE -O H ;
ii j|
L iv er M atrix
Prepared Range of Standards (P P b )(n g /g )
Range of
^ ange t5 L C K ^ ^ ^ ^ Range of
Average Curve
H igh Std. Curve
|p
|
(ppb)(ng/g) ffiM flia llf (ppb)(ng/g) r r 'fp p B ^ ^ ^ i (PPb)(ng/g)
R a b b it B o v in e Rat M onkey
5.96 - 1790
119-1790
aM
i
5 .8 7 - 1 170 58.7 - 1 170
! 6.09 -1220
122-1220
I S n
1
5.80-1160 [ 29 4 -1160 |
^
n /a
n/a
F
l& f S S ffig g
n/a n/a
n/a V4
Compound]________
Liver Prepared
M atrix
Range of
Standards
(p p b )(n g /g )
; POAA
Range of Average Curve (p p b )(n g /g )
Range of
pi n soei t o J
Low Std. Curve
(p p b )(n g /g )
S lgt .LRfroraaR Range of
li.a ip w jstd ^ w High Std. Curve
! 'r (pp bM nJ'g)J (p p b )(n g /g )
R abbit B o v in e
6.06 - 1820 30.3 - 1820 sffiPSifaggg 30.3 - 606 -q a ie g r ^ t 303 - 1820
5.93 - 1190 59.3 - 1190
n/a i- i - i'ttv 'ify ^ r ' n/a
Rat M onkey
| 6.15-1230 5.86-1170
61i1-57--1i12730 m m s a
n/a n/a
j
n/avt5ii^r;
n/a n/a
jk.v*-^s^APtvf Le :'
C om pound 1
Liver Prepared
M atrix
Range of
Standards
(PPb)(ng/g)
jH IPFOSEA
(p p b )(n g /g )
ji ;
R a n g e o f [.- L Q R frm l^ - R an ge o f [-.L C R irom -
Low Std. Curve
(p p b )(n g /g )
iE m ^ fe
|' (ppb)C ng/gjS
H|C?uhrSvted-
(P P b )(n g /g )
np!(lfsiQpfp*iXi^p*&p&'Ei)r
R ab b it B o v in e Rat
6.20 - 1860 5.92- 1180 6.14 - 1230
020 - 1240 r i g & g l 219236 --11213800 . ^ F 2 3 g r
n/a
n/a n/a
n /a,:r * 2 g
.-R t :F5 /a a r t y
| ---n/a; -* -
n/a | A'-^n/ahn/a l-.i.tjt/a y -. n/a j 1"-n /a -, -1
M onk ey 5.85 - 1170 58 5 -1170 -U ^ 1170t. n/a j n/a
n/a ! n/a
Monoester was not detcctablc/quamiliable in liver matrix for the concentration range of 4 94 - i450 ppb
Attachment C: LOQ summary
3M Environmental Laboratory
FACT-M-1.1 Extraction of PFOS from Liver
Page 14 o f 15
Page 142
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Prep D atefs): j 11/2/98
A naiyst(s):
IRWW-IAS
Sam p le M atrix: [Monkey Liver
M eth o d /R e v isio n FA CT-M -1.0
Target
FC-Mix
A nalyte(s):
1
Ion Pair Standard Curves--Tissues
Study Number:
[Cross Validation
i
Equipm ent Num ber:
;
[F in a l S o lv e n t <& T N N u m b er: ;MeOH TN-A-2076 i
Blank T issue/Identifier.
Liver
!
j
FC M ix Std A pprox. 0.500 ppm: IW398-1004 FC M ix Std A p prox. 5.00 ppm:' [W398-1003 F C M ix S td A p p r o x . 50.0 ppm: !W 398-I002 S u r r o g a te S td A p p r o x . 16.5 ppm:
) j W398-989
Actual Concentrations o f Standards in the FC Mix
PFOS
PFOSA
PFOSAA 1 EtFOSE
Std Cone. ; Std Cone. Std Cone. Std Cone.
ug/mL 1 ug/mL - ug/mL
ug/mL
0.501 0.497 0.500 0.490
0.501 0.497 0.500 0.490
0.501 0.497 0.500 0.490
0.501 0.497 0.500 0.490
0.501
0.497 j 0.500
0.490
5.01
4.97 [ 5.00
4.90
5.01 4.97 5.00 4.90
5.01
4.97 : 5.00
4.90
50.1
49.7 ! 50.0
49.0
, i ! 1
POAA Std Cone. ug/mL
0.495 0.495 0.495 0.495 0.495 j 4.95 1 4.95 1 4.95 I 49.5
|
I PFOSEA
| Std Cone.
. ug/mL
0.494
i 0.494
i
0.494 0.494
0.494
4.94
4.94
4.94
49.4
;
C alcu lated C on cen tration s o f S tan dards in the Sam ple M atrix.
PFOS i PFOSA
PFOSAA 1 EtFOSE
Final Cone. "g/g 5.93
[ Final Cone. 1
ng/g 5.88
Final Cone. ng/g
1!1
Final Cone. ng/g
5.92 5.80
11.9 11.8 11.8 11.6 29.6 29.4 29.6 29.0
59.3 58.8 59.2 58.0
119 118 ! 18 116
296 294 296 290
593 588 592 580
889 882 888 870
1186 1176 1183 1160
POAA
PFOSEA
Final Cone. Final Cone.
ng/g ng/g 5.86 5.85 i i.7 11.7 29.3 29.2 58.6 58.5 117 117 2 9 3 292 586 85 879 877 1 172 1169
! t 1 1
ii
; ah
Ain't
1 Spiked
i mL
; 0.002
0.004
0.010
i
0.020 0.040
0.010
0.020
0.030
[ 0.004
i ; ! !i
ir
A ll
Liver cone. g/ml [ 0.169 0.169 I 0.169 [ , 0.169 i 0.169 0.169 1 0.169 1 0.169 j 0.169 !
1
i
S u r r o g a te 1 Std Cone, i Am't
; Spiked ug/mL mL 16.50 ! 0.005
Surrogate1
Final Cone. ng/g 488.2
11 1
V alidated R anees -- ADDroxim ate C oncentrations
L iv er
PFOS
PFOSA
PFOSAA
R a b b it
40 - 1000 ppb 20 - 1200 ppb 180- 1900 ppb
B o v in e
60 - 1200 ppb 30 - 1200 ppb 120- 1200 ppb
R at 60 - 1200 ppb 7 0 - 1200 ppb 60 - 1200 ppb
M onkey
60 - 1200 ppb 9 - 1200 ppb 120- 1200 ppb
E tF O S E -O H
POAA
190 - 1800 ppb 80 - 1800 ppb
120- 1200 ppb 80 - 1200 ppb
120 - 1200 ppb 60 - 1200 ppb
60 - 1200 ppb 120 - 1200 ppb
PFOSEA
60 - 1200 ppb
30 - 1200 ppb
120 120
-1200 -1200
ppb ppb
i 1
Attachm ent D:
Calibration standard concentration worksheet
F A C T -M -l.l
Extraction of PFOS from Liver
3M Environmental Laboratory
P age 15 o f 15
Page 143
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
3M Environmental Laboratory
M ethod
A n a ly sis o f F luo ro ch em icals in L iv er E xtracts U sing H P L C -E lectro spray/M ass S pec tr o m etry
Method Number: FACT-M-2.1
Author: Lisa Clemen Approved By: Laboratory Manager
/'v 7 ^ 7 Group Leader
hT(echnical R___e_v_i_e__w__e__r______________________________________________
Adoption Date: 05/26/98
Revision Date:
/ ?/ T ?
Date 6 / j },') Date
Uni
Date
1.0 Sc o p e a n d A p p l ic a t io n _________________________________________________________________
1.1
Scope: This method is for the analysis of surfactants using HPLC-electrospray/mass
extracts of liver spectrometry.
or
other
tissues
for
fluorochemical
1.2 Applicable Compounds: Potassium perfluorooctanesulfonate, anionic fluorochemical surfactants, or other ionizable compounds.
1.3 Matrices: Rabbit, rat, bovine, and monkey livers or other livers as designated in the validation report.
Word 7.0.1/95
Analysis of LFivAeCrTE-xMtr-a2c.t1Using ES/MS
3M Environmental Laboratory
Page 1 of 9
Page 144
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
2 .0 _Su m m a r y o f M e t h o d ______________________________________________________________
2.1
This method describes the analysis of fluorochemical surfactants extracted from liver using HioPnLcCha-erlaecctterroisstpicraoyf/ma apsasrtsipcueclatrrofmlueotrroyc. hTehmeicaanla, lsyuscishiassptehrefopromtaedssibuymmonitoring a single
vpeerrifflyuocroomocptoaunnedsuildfoennatitfeic(aPtiFoOn.S) anion, M/Z= 499. Samples may also be screened to
3 .0 __D e f in it io n s _________________________________________________________________________ 3.1 A tm ospheric Pressure Ionization (API): The Micromass platform systems allow for
various methods of ionization by utilizing various sources, probes, and interfaces. These Iinocnliuzdateiobnut(AarPecnI)o,tJlhimerimtedostpor:aEyl,eecttcr.osTphraeyioIonniziazatitoionnp(rEoSceIs),s AintmthoesspehteercihcnPiqreusessuroecccuhresmaitcal atmospheric pressure (i.e. not under a vacuum).
3.2 E lectrospray Ionization (ES, ESI): a method of ionization performed at atmospheric pressure, whereby ionization occurs through the production of tiny charged droplets in a strong electrical field.
3.3 MThaessAPSIpepclatrtfoomrmetsryar, eMeqaussipSppedecwtritohmqeuteardr(uMpoSl)e, TmaanssdseemlecMtiavsesdSepteeccttorros.m Ieotenrs (aMreS/M S): selectively discriminated by mass to charge ratio (m/z) and subsequently detected. A single MinfSormmaaytibone.employed for ion detection or a series (MS/MS) for more specific fragmentation
3.4 C onventional vs. Z-spray probe interface: The latest models of Micromass platform osyrtshteomgosn(aplotsot t1h9e9c8o)nuetialipzeertaur"eZ.-sIpnrtahye"ccoonnvfoenrmtioantiaolnc. oTnfhoermspartaioynemitiitsteadimfreodmdairpecrtolbyeatisthe cone aperture, after passing through a tortuous pathway in the counter electrode. Though the configuration is different, the methods of operation, cleaning, and maintenance are the same. However, Z-spray components and conventional components are not compatible with one sapnroatyhesry,sbteumt osn, leytcw.)ith similar systems (i.e. Z-spray components are compatible with other Z-
3.5 MsaIIyresoatrssesimQmLusil.yaatnrtCr.xuoSFrIrooIefrMntwmtlayaosrrsMeeL:adysneSstxLyaisoyltrsnexmMseheasasotsshfLtWewymaninrxaednNoudwTaelssUisg9pSn5eEecadRinfdif'coSrWtGothiUntehdIesDopwiEencs)s.NtifriTucmo3e.p1netrva(eMtriosiincornoosfm. tahAseslslePvplealrtasftoiforonmrsm
4.0 W a r n in g s a n d C a u t io n s
_________________________________________________________
4.1 Health and Safety W arnings:
4.1.1 Uapspercoaxuimtioantewlyit5h00th0eVvoollttsa.ge cables for the probe. The probe employs a voltage of
4.1.2 aWndhecnlohthanindgl.ing samples or solvents wear appropriate protective gloves, eyewear,
Word 7.0.1/95
Analysis of LFivAeCr TE-xMtr-a2c.t1Using ES/MS
3M Environmental Laboratory
Page 2 of 9
Page 145
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
4.2 Cautions: 4.2.1 Dovoerno4t00rubnasro, ltvheenHt Ppu1m10p0s wabilolvienictiaaptaecaituytoomf a4t0ic0 sbhaurt(d5o8w0n0. psi). If pressure goes 4.2.2 Do not run solvent pumps to dryness.
5.0 I n t e r f e r e n c e ________________________________________________________________________ 5.1 sThooumldinnimotizbeeiunsteerdfefroernscaems pwlheesntoarnagaelyozrinagnsyapmaprtleosffionrstpreurmfleunotraotoiocntatnhoaat tceo(mPOesAiAn),cotenftlaocnt
with the sample or extract.
6.0 E q u ip m e n t _____________________________________________________________________________ 6.1 Equipment listed below may be modified in order to optimize the system.
6.1.1 Micromass Electrospray Mass Spectrometer 6.1.2 HP1100 low pulse solvent pumping system and autosampler.
7.0 Su p p l ie s a n d M a t e r ia l s _____________________________________________________ ;_________ 7.1 Supplies
7.1.1 High purity grade nitrogen gas regulated to approximately 100 psi 7.1.2 HPLC column, specifics to be determined by the analyst. 7.1.3 Capped autovials or capped 15 mL centrifuge tubes.
8.0 R e a g e n t s a n d St a n d a r d s _____________________________________________________________ 8.1 Reagents
8.1.1 Methanol, HPLC grade or equivalent. 8.1.2 MASilTliM-Q,TMTywpaetIerwaantedrm, Mayillbi-eQpTMrovwidaetedr,bayllawMatilelri-uQseTdOinCtPhlius smseytshtoemd .should be 8.1.3 Ammonium acetate, reagent grade or equivalent. 8.2 Standards 8.2.1 Typically one method blank, one matrix blank, and ten matrix standards are
prepared during the extraction procedure. See FACT-M -1.1.
9 .0 Sa m p l e H a n d l in g _____________________________________________________________________ 9.1 Farreesshtomreadtriinx csatapnpdeadrdasutaorveiaplrsepoarrceadpwpeitdh1e5acmhLanceanlytsriisf.ugEextturbaecsteudnsttial nadnaarldyssisa.nd samples 9.2 If analysis will be delayed, extracted standards and samples may be stored at room
temperature or refrigerated at 4 C until analysis can be performed.
FACT-M-2.1 Analysis of Liver Extract Using ES/MS
3M Environmental Laboratory
Page 3 of 9
Page 146
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03G laboratory Request Number-U2279
10.0 Q u a l it y C o n t r o l ___________________________________________________________ ___________ 10.1 M atrix Blanks and M ethod Blanks
10.1.1 Analyze a method blank and matrix blank prior to each calibration curve.
10.2 M atrix Spikes 10.2.1 Analyze a matrix spike and matrix spike duplicate with each analysis. With a minimum o f 2 spikes per batch. 10.2.2 Expected concentrations will fall in the mid-range of the initial calibration curve. Additional spike concentrations may fall in the low-range of the initial calibration curve. 10.2.3 See section 13 to calculate percent recovery.
10.3 Continuing Calibration Checks 10.3.1 Achnaanlgyeze(a 3m0i%d-)rainngpeeackaliabrreaatioocncustrasn, drealradtiavfetetroetvheeriynitteinatlhstsaanmdparled. cIufravesi,gsntiofpicathnet run. Only those samples analyzed before the last acceptable calibration standard will be used. The remaining samples must be reanalyzed. 10.3.2 See section 13 to calculate percent difference.
11.0 C a l i b r a t i o n a n d S t a n d a r d iz a t io n ___________________________________________________
11.1 Analyze the extracted matrix standards prior to and following each set of extracts. The
average o f two standard curves will be plotted by linear regression (y = my + b), not forced
through zero, using MassLynx or other suitable software.
'
11.2 sItfatnhdeacrudrcvuerdvoee(sifnnoetcmeseseatryre)qaunidrermeaenntasl,ypzee.rform routine maintenance or reextract the
11.3
For purposes o f accuracy when quantitating low levels of analyte, it may be necessary to use the low end o f the calibration curve rather than the full range of the standard curve. Example: when attempting to quantitate approximately 10 ppb of analyte, generate a rrcaaegnlirgbeersaostiifoontnhewcuceurigvrhevtecino(5gnspoipsftbhinitggoho1cf0o0tnh0ceepsnpttabrn)a.dtiaTorndhsisstfarwnoidmllarr5despd.pubcetoina10cc0uprpabcyraatthtreirbuthteadn ttohelinfuelalr
12.0 Pr o c e d u r e s _____________________________________________________________________________ 12.1 Acquisition Set up
12.1.1 Click on start button in the Acquisition Control Panel. Set up a sample list. Assign afofrilaecnqaumireinugs,inagndMtyOp-eDiAnYsa-lmasptledidgeistcorifpyteioanrs-s.ample number, assign a method (MS)
12.1.2 To create a method click on scan button in the Acquisition control panel and select SIR (Single Ion Recording) or MRM. Set Ionization Mode as appropriate and mass to 499 or other appropriate masses. A full scan is usually collected along with the SIRs. Save acquisition method. If MS/MS instruments are employed, additional product ion fragmentation information may be collected. See Micromass
F A C T -M -2.1 Analysis of Liver Extract Using ES/MS
Page 4 of 9
3M Environmental Laboratory
Page 147
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
MassLynx GUIDE TO DATA ACQUISITION for additional information and MRM (Multiple Reaction Monitoring).
12.1.3 Typically the sample list begins with the first set of liver standards and ends with the second set of standards.
12.1.4 Samples are analyzed with a continuing calibration check injected after every tenth sample. Solvent blanks should be analyzed periodically to monitor possible analyte carryover and are not considered samples but may be included as such.
12.2 Using the Autosam pler
12.2.1 Set up sample tray according to the sample list prepared in section 12.1.1.
12.2.2 Set-up the HP1100/autosampler at the following conditions or at conditions the analyst considers appropriate for optimal response. Record actual conditions in the instrument logbook:
12.2.2.1 Sample size = 10 pL injection with a sample wash
12.2.2.2 Inject/sample = 1
12.2.2.3 Cycle time =13.5 minutes 12.2.2.4 Solvent ramp =
Time 0 . 0 0 min. 8 . 0 min. 1 1 . 0 min. 1 2 . 0 min.
MeOH 40% . 90% 90% 40%
2.0 mM Ammonium acetate
60% 10% 10% 60%
12.2.2.5 Press the "Start" button.
12.3 Instrum ent Sep-up 12.3.1 Refer to ETS-9-24.0 for more details . 12.3.2 Check the solvent level in reservoirs and refill if necessary. 12.3.3 Check the stainless steel capillary at the end of the probe. Use an eye piece to check the tip. The tip should be flat with no jagged edges. If the tip is found to be unsatisfactory, disassemble the probe and replace the stainless steel capillary. 12.3.4 Set HPLC pump to "On". Set the flow to 10 - 500 uL/min or as appropriate. Observe droplets coming out o f the tip of the probe. Allow to equilibrate for approximately 10 minutes. 12.3.5 Turn on the nitrogen. A fine mist should be expelled with no nitrogen leaking around the tip of the probe. Readjust the tip of the probe if no mist is observed.
12.3.6 The instrument uses these parameters at the following settings. These settings may change in order to optimize the response:
FACT-M-2.1 Analysis of Liver Extract Using ES/MS
Page 5 of 9
3M Environmental Laboratory
Page 148
kOo
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03 laboratory Request Number-U227
12.3.6.1 Drying gas 250-400 liters/hour 12.3.6.2 ESI nebulizing gas 10-15 liters/hour 12.3.6.3 LC constant flow mode flow rate 10 - 500 uL/min 12.3.6.4 Pressure <400 bar (This parameter is not set, it is a guide to ensure the
instrument is operating correctly.) 12.3.7 Carefully guide the probe into the opening. Insert probe until it will not go any
further. Connect the voltage cables to the probe. 12.3.8 Print the tune page, with its parameters, and store it in the study binder with a copy
taped into the instrument log. 12.3.9 Using the cross-flow counter electrode in the ES/MS source is recommended for
the analysis of biological matrices. 12.3.10toCploicfksaomn pstlaertlisbtu. ttEonnsiunrethsetaArtcaqnudiseitniodnsaCmonptlreonl uPmanbeelr. inPcrleusds etshealsltasratmbpultetsontoatbe
analyzed.
13.0 D a t a A n a l y s is a n d C a l c u l a t i o n s __________________________________ 13.1 Calculations:
13.1.1 Calculate matrix spike percent recoveries using the following equation:
% Recovery = Observed Result - Background Result x 100 Expected Result
13.1.2 Calculate percent difference using the following equation:
% Difference = Expected CoEnxep.e-ctCedalcCuolantee.d Cone, x 100
f13.1.3 Calculate actual concentration o f PFOS anion in total liver (mg): ug PFOS anion calc, from std curve^
V g of liver used for analysis 1000 ug / 1mg
x Total mass of liver (g)
14.0 M e t h o d P e r f o r m a n c e
______________________________________________ .
---------
14.1 MmaettrhioxdspDeectiefcict.ionPlLeaimseitse(Me EDTLS) -a8n-d1.1L,imAitttaocfhQmueannttitBa,tifoonr (aLlOisQtin) garoefmcuerthreondt, vaanliadlyattee,dand
MDL and LOQ values.
14.1 14.2 Solvent Blanks, Method Blanks, and M atrix Blanks
14.1.1 Solvent blanks, method blanks, and matrix blanks values are must be below the lowest standard in the calibration curve.
14.2 Calibration Curves 14.2.1 The r value for the calibration curve must be 0.980 or better.
FACT-M-2.1 Analysis of Liver Extract Using ES/MS
Page 6 of 9
3M Environmental Laboratory
Page 149
CD O')
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03 laboratory Request Number-U227
14.3 Matrix Spikes
14.3.1 Mcoantcreinxtrspatikioenp. ercent recoveries are must be within 30% of the spiked
14.4 Continuing Calibration Verifications
14.4.1
Continuing calibration verification percent recoveries must be 30% of the spiked concentration.
14.5 If criteria listed in this method performance section isn't met, maintenance may be performed on the system and samples reanalyzed or other actions as determined by the analyst. Document all actions in the appropriate logbook.
14.6 If data are to be reported when performance criteria have not been met, the data must be footnoted on tables and discussed in the text of the report.
15.0 P o l l u t i o n P r e v e n t io n a n d W a s t e M a n a g e m e n t ___________________________________ 15.1 Sample waste is disposed in biohazard containers, flammable solvent waste is disposed in
high BTU containers, and glass pipette waste'is disposed in broken glass containers. All containers are located in the laboratory.
16 .0 R e c o r d s _______________________________________________________________________________ 16.1 hEeaacdhepraogrehgaennderwartietdtenfoorna tshtuedpyagme:uststhuadvyeotrhperfoojlelcotwninumg binefro,ramcqautiiosnitiionnclmudeethdoedi,ther in the
integration method, sample name, extraction date, dilution factor (if applicable), and analyst.
16.2
Print the tune page, sample list, and acquisition method from MassLynx to include in the appropriate study folder. Copy these pages and tape into the instrument runlog.
16.3 sPtloortethine tchaelibstruadtiyonfoclduerrv.e by linear regression, weighted 1/x, then print these graphs and
16.4 Panridntstdoarteaiinnttehgersattuiodny sfuomldmera. ry, integration method, and chromatograms, from MassLynx,
16.5 Summarize data using suitable software (Excel 5.0) and store in the study folder, see A ttachm ent A for an example of a summary spreadsheet.
16.6 Back up electronic data to appropriate medium. Record in study notebook the file name and location o f backup electronic data.
17.0 T a b l e s . D ia g r a m s . F l o w c h a r t s , a n d V a l i d a t i o n D a t a ____________________________ 17.1 Attachment A: FACT-M-2.1 Data reporting spreadsheet
FACT-M-2.1 Analysis of Liver Extract Using ES/MS
3M Environmental Laboratory
Page 7 of 9
Page 150
3m Medical Department Study: T-6295.7
Report No. FACT T0X-C3G laboratory Request Number-U227S
18.0 R e f e r e n c e s _____________________________________________________________ 18.1 FACT-M -l.l, "Extraction of Potassium Perfluorooctanesulfonate or Other Fluorochemical
compounds from Serum for Analysis Using HPLC-E!ectrospray/Mass Spectrometry 18.2 IEoTnSiz-a9t-i2o4n./0M, a"OsspSepraetcitornomanedterMQaiunattetnroanIcIetroipfltehequMadicrruopmolaessSyAsttmemossp"heric Pressure 18.3 The validationTeport associated with this method is FA CT-M -l.l-V & 2.1-V-l.
19.0 A f f e c t e d D o c u m e n t s ________________________________________________________________ 19.1 UFAsinCgTH-MPL-lC.l-,E"lEecxttrroascptiroany/oMf aPsostaSspseiuctmroPmeertfrluy"orooctanesulfonate from Liver for Analysis
20.0 R ev isio n s_______________________________________________________________________________
RNuevmisbieorn. 1
Reason For Revision
Section Section
611.1.1.2
Clarification o Average of two
f HP 1100 system components. curves, not standard values, are
used
for
plotting linear regression.
Section 12.2.2.4 Clarification of solvent ramp.
Section 17.1 Changed from attachment B to A.
ReDvaistieon 05/04/99
FACT-M-2.1 Analysis of Liver Extract Using ES/MS
3M Environmental Laboratory
Page 8 of 9
Page 151
3m Medical Department Study: T-6295.7
Report N o . FACT TOX-030 laboratory Request Number-U2279
Laboratory Study #
Study: Test Material: Matrix/Final Solvent: Method/Revision: " Analytical Equipment System Number: Instrument Software/Version: Filename: R-Squared Value: Slope: Y Intercept: Date of Extraction/Analyst Date of Analysis/Analyst:
Group Sample# Concentration Dose ug/mL
Initial Voi. mL '
Dilution Factor
Final Cone. ug/mL
Slope: Taken from linear regression equation. Group/Dose: Taken from the study folder. Sample#: Taken from the study folder. Concentration (ug/mL): Taken from the MassLynx integration summary. Initial Volume (mL): Taken from the study folder. Dilution Factor: Taken from the study folder. Final Cone. (ug/mL): Calculated by dividing the initial volume from the concentration
Attachment A: Data Sheet
FACT-M-2.0
Analysis of Liver Extract Using ES/MS
3M Environmental Laboratory
Page 9 of 9
Page 152
3ra Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
3M Environmental Laboratory
M ethod
E x t r a c t io n o f P o tassium Perfluo ro o ctanesulfo nate o r O th er F l u o r o c h em ic a l co m po unds fro m Serum o r O th e r Fluid fo r A nalysis
U sing H P L C -E lectro spray/M ass S pectro m etry
M ethod Num ber: FACT-M-3.1 Author: Lisa Clemen, Glenn Langenburg
Adoption Date: 04/22/98
hiRevision Date: 10 ( ^ ?
Group Leader
(it
Technical
A ihRevieweri'ri.K
*7h - ^ i f
Date Date
1.0 Sc o p e a n d A p p l ic a t io n _______________________________________________________________
1.1
oSrcoopthee:r
This method is fluorochemical
for the extraction compounds from
of potassium perfluorooctanesulfonate serum or other fluid.
(PFOS
)
1.2 A pplicable com pounds: Fluorochemical surfactants or other fluorinated compounds.
1.3 M atrices: Rabbit, rat, bovine, and monkey serum, rat whole blood, and rat milk curd.
Word 6/95
Extraction of PFOSFAfrCoTm-MSe-3ru.1m and Other Fluids
3M Environmental Laboratory
Page 1of 17
Page 153
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
2.0 Su m m a r y o f M e t h o d _________________________________________________________________
2.1 This method describes the procedure for extracting potassium perfluorooctanesulfonate
(PFOS) or other fluorochemicals from serum, blood, or milk curd using an ion pairing
reagent and 5.0 ml o f ethyl acetate. In this method, seven fluorochemicals were
extracted: PFOS, PFOSA, PFOSAA, EtFOSE-OH, POAA, PFOSEA, and FC-807
monoester analyte ion
(pseaeir3is.0pDaretfiitnioitnioednsin).toAenthiyolnapceatiartine.g
reagent is Four ml o
added to the sample and the f extract are removed and put
onto a nitrogen evaporator until dry. Each extract is reconstituted in 1.0 ml o f methanol,
then filtered through a 3 cc plastic syringe attached to a 0.2 pm nylon filter into glass
autovials.
3.0 D e f in it io n s ____________________________________________________________________________ 3.1 PFOS: perfluorooctanesulfonate (anion o f potassium salt) C8F17S 0 3' 3.2 PFOSA: perfluorooctane sulfonylamide C8F17S 0 2NH2 3.3 PFOSAA: perfluorooctane sulfonylamido (ethyl)acetate C8FI7S0,N(CH2CH3)CH2C 02'
3.4 EtFOSE-OH: 2(N-ethylperfluorooctane sulfonamido)-ethyl alcohol C8F,7S 0 2N(CH2CH3)CH2CH20H
3.5 POAA: perfluorooctanoate (anion of ammonium salt) C7FlsCOO` 3.6 PFOSEA: perfluorooctane sulfonyl ethylamide C8F17S 0 2N(CH2CH3)H 3.7 FC-807 monoester C8F,7S0,N(CH2CH3)CH2CH20 -P 0 3H) 3.8 Surrogate standard: 1H-1H-2H-2H perfluorooctane sulfonic acid
4 .0 W a r n in g s a n d C a u t io n s ______________________________________________________________ 4.1 H ealth and safety warnings
4.1.1 Uhasnedulinnigvearnsaiml palretcisasuuteio, nwsh, iecshpemcaiayllcyonlatbaoinraptoarthyocgoeantss., goggles, and gloves when
5.0 I n t e r f e r e n c e s ________________________________________________________________________ 5.1 There are no known interferences at this time.
6.0 E q u ip m e n t _____________________________________________________________________________ 6.1 The following equipment is used while performing this method. Equivalent equipment is
acceptable. 6.1.1 Vortex mixer, VWR, Vortex Genie 2 6.1.2 Centrifuge, Mistral 1000 or IEC 6.1.3 Shaker, Eberbach or VWR 6.1.4 Nitrogen evaporator, Organomation 6.1.5 Balance ( 0.100 g)
FACT-M-3.1 Extraction of PFOS from Serum or Other Fluid
3M Environmental Laboratory
Page 2 of 17
Page 154
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
7.0 S u p p l ie s a n d M a t e r ia l s _______________________________________________________________
7.1 Gloves
7.2 Eppendorf or disposable pipettes
7.3 Electronic pipettor, Eppendorf orequivalent
7.4 Graduated pipettes
7.5 Nalgene bottles, capable o f holding 250 mL and 1 L
7.6 Volumetric flasks, glass, type A
.
7.7 Volumetric pipets, glass, type A
7.8 I-CHEM vials^glass, 40 mL glass
7.9 Crimp cap autovials
7.10 Centrifuge tubes, polypropylene, 15 mL
7.11 Labels
7.12 Syringes, capable o f measuring 5 pL to 50 pL
7.13 Syringes, disposable plastic, 3 cc
7.14 Syringe filters, nylon, 0.2 pm, 25 mm
7.15 Timer
Note: Prior to using glassware and bottles, rinse 3 times with methanol and 3 times with Msepilalir-aQteTMviwalast.er. Rinse syringes a minimum of 9 times with methanol, 3 rinses from 3
8.0 R e a g e n t s a n d St a n d a r d s _____________________________________________________________
8.1 TbeypMeiIllir-eQagTMenwt agtreardeanwdamtera,yMbeillpi-rQovTMideodr beqyuaivMalielnlit-;QalTl OwCatePrluussTMed sinystthemis method should 8.2 Sodium hydroxide (NaOH), J.T Baker or equivalent 8.3 Tetrabutylammonium hydrogen sulfate(TBA), Kodak or equivalent 8.4 Sodium carbonate (N&,C03), J.T. Baker or equivalent 8.5 Sodium bicarbonate (NaHC03), J.T. Baker or equivalent 8 .6 Ethyl acetate, Omnisolv, glass distilled or HPLC grade 8.7 Methanol, Omnisolv, glass distilled or HPLC grade 8 . 8 Serum or blood, frozen from supplier 8.9 Control matrix or blank matrix for purpose o f standards, QC checks, blanks, etc.
8.10 F luorocbem ical standards
8.10.1 PFOS (3M Specialty Chemical Division), molecular weight = 538 8.10.2 PFOSA (3M Specialty Chemical Division), molecular weight = 499
FACT-M-3.1 Extraction of PFOS from Serum or Other Fluid
Page 3 of 17
3M Environmental Laboratory
Page 155
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U227S
8.10.3 PFOSAA (3M Specialty Chemical Division), molecular weight = 585
8.10.4 EtFOSE-OH (3M Specialty Chemical Division), molecular weight = 571
8.10.5 POAA (3M Specialty Chemical Division), molecular weight = 431
8.10.6 PFOSEA (3M Specialty Chemical Division), molecular weight = 527
8.10.7
FC-807 monoester (3M Specialty Chemical Division). FC-807 is a mixture of tmrioelsetceur,ladriewsteeirg,hatn=d 6m5o0noester fluorochemical components. The monoester
8.10.8
Surrogate standard: 4-H, perfluorooctane sulfonic acid (1-H,1-H, 2-H, 2-H C8F13S 0 3H) molecular weight = 428
8.10.9 Other fluorochemicals, as appropriate
8.11 Reagent preparation
8.11.1
10 N sodium hydroxide (NaOH): Weigh approximately 200 g NaOH. Pour into a 1000 mL beaker containing 500 mL Milli-QTM water, mix until all solids are
dissolved. Store in a 1 L Nalgene bottle.
8.11.2 I N sodium hydroxide (NaOH): Dilute 10 N NaOH 1:10. Measure 10 mL of 10 N NaOH solution into a 100 mL volumetric flask and dilute to volume using Milli-QTM water. Store in a 125 mL Nalgene bottle.
8.11.3
0.5 M tetrabutylammonium hydrogen sulfate (TBA): Weigh approximately 169 g o10f TuBsiAnginatpoprao1xiLmvaotelulym4e4trtioc 5co4nmtaLinoinfg1050N0 NmaLOMHilalni-dQdTMiluwteatteor.voAldujmusetwtoitphH
Milli-QTM water. While adding the last mL of NaOH, add slowly because the pH
changes abruptly. Store in a 1 L Nalgene bottle.
8.11.3.1 nTeBedAedreuqusiinregs1aNchNecakOpHrisoorlutotioenac.h use to ensure pH = 10. Adjust as
8.11.4 0.25 M sodium carbonate/sodium bicarbonate buffer (NaXOj/NaHCOj): Weigh approximately 26.5 g of sodium carbonate (Na^COj) and 21.0 g of sodium bQiTMcarwbaotneart.e S(NtoareHiCn0a3)1inLtoNaalg1eLnevobloutmtlee.tric flask and bring to volume with Milli-
8.12 Standards preparation
8.12.1 Prepare PFOS standards for the standard curve.
8.12.2 Prepare other fluorochemical standards, as appropriate. Multicomponent fluorochemical standards are acceptable (for example, one working standard s1o.1lu0tipopnmcoEnttFaOinSinEg-O1H.0.0) ppm PFOS, 1.02 ppm PFOSA, 0.987 ppm PFOSAA, and
8.12.3 tWheeiagchtuaaplpwreoixgihmt.ately 100 mg o f PFOS into a 100 ml volumetric flask and record
8.12.4 B(prgin/mg lt)o. volume with methanol for a stock standard of approximately 1000 ppm
8.12.5 Dilute the stock solution with methanol for a working standard 1 solution of approximately 50 ppm.
Extraction of PFOFSACfrTo-mMS-3e.r1um or Other Fluid
3M Environmental Laboratory
Page 4 of 17
Page 156
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
8.12.6 Dilute the stock solution with methanol for a working standard 2 solution of approx. 5.0 ppm.
8.12.7 Dapilpurtoex.th0e.5s0topcpkmso. lution with methanol for a working standard 3 solution of
8.13 Surrogate stock standard preparation 8.13.1 Weigh approximately 50-60 mg of surrogate standard 1-H,1-H, 2-H, 2-H, C ,FnS03H into a 50 ml volumetric flask and record the actual weight. 8.13.2 Bring to volume with methanol for a surrogate stock o f approximately 1 0 0 0 - 1 2 0 0 ppm. 8.13.3 Psurrerpoagraetea ssutorcrkogtaotea w50ormkilnvgolsutamnedtarridc. flTasrkanasnfedrbarpinpgrotxoimvoaltuemlye0w.5itmh lmoefthanol for a working standard of 10-20 ppm. Record the actual volume transferred.
9.0 Sa m p l e H a n d l in g ______________________________________________________________________ 9.1 All samples are received frozen and must be kept frozen until the extraction is performed.
10.0 Q u a l i t y C o n t r o l _____________________________________________________________________
10.1 M atrix blanks and method blanks
10.1.1 Esaxmtrpalcetstwdiolu1te.0d m1:L1 waliitqhuoMtsiloli-fQthTMe awpaptreorp)rfiaotlelomwaintrgixth(siserpurmoceodrubrleooadn,dwuisteh abslood matrix blanks. See 11.1.4.
10.1.2 Emxettrhaocdt tbwlaonk1s.0. ml aliquots of Milli-QTM water following this procedure and use as
10.2 M atrix spikes
10.2.1 Pthreepaacrceuraancdyaonfatlhyezeexmtraatrcitxiosnp.ike and matrix spike duplicate samples to determine
10.2.2 Prepare each spike using a sample chosen by the analyst, usually the control matrix received with each sample set.
10.2.3 Expected concentrations will fall in the mid-range o f the initial calibration curve. Acadlidbirtiaotnioanl cspurikvees. may be included and may fall in the low-range of the initial
10.2.4
Prepare one matrix spike and matrix spike duplicate per 40 samples, with a minimum of 2 matrix spikes per batch.
10.3 Continuing calibration checks
10.3.1 Prepare and analyze continuing calibration check samples to ensure the accuracy of the initial calibration curve. If the percent difference between the initial curve alansdt athcececpotnatbinleucinhgecckh.eck differ by >30%, re-analyze samples analyzed after the
10.3.2 Prepare one check per group o f ten samples. For example, if a sample set = 34, prepare and extract four checks.
Extraction of PFOFSACfrTo-mMS-3e.r1um or Other Fluid
3M Environmental Laboratory
Page 5 of 17
Page 157
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
10.3.3 Pthreepinairteiaelaccuhrvcoe.ntinuing calibration check from the same matrix used to prepare 10.3.4 Tcuhrevee.xpAedctdeidtiocnonacl esnptirkaetsiomnawyibllefainllclwuidtehdinththaet fmalildi-nratnhgeeloowf -trhaenigneitioafl tchaelibinriatitaiol n
5cloapwlipbberna-dtio1on0f0tc0huerpvpceab.l)i.bTrhaitsioins ncuecrevsesa(froyriefxtahme panlea,ly5spt pmbu-st1q0u0apnptibta,treauthseinrgthoannly the
11.0 C a l i b r a t i o n a n d St a n d a r d iz a t io n ________________________________________ ________ _
11.1 Prepare m atrix calibration standards
Note: Blood coagulates in air; therefore, minimize air contact until dilution. At this opofitnhte, dadildutTedBAmaatnrdixbsuafmfeprletotoeaecahchcetnutbrei.fuge tube as in step 12.9, then add 1.0 mL
11.1.1 Transfer 1 mL o f serum or 1 mL o f blood (blood is diluted 1:1 with Milli-QTM
water) to a 15 mL centrifuge tube. The blood is similar in composition to milk
curd and can be used in place o f milk curd for standard curves when extracting
that matrix.
.
11.1.2 vIRfoemlcuoomrsdtessthaeemquspaalmle tvpooletlhuvemosleausmmapereleolnevsotshluethmeaxentsr.1a.c0DtiomonnLo,stheeexextrtt.raaccttsbtaenldoawrd0s.5w0itmhLmoatfrmixatrix.
11.1.3 bWethwileeepnraepliaqruinotgs.a total of twenty aliquots in 15 ml centrifuge tubes, mix or shake
11.1.4 TTatywtphoiec1aelmnlydLuoasfletiqhtuhisoetssset,catonirdoanort,hdteocrosanppcikpeenr,otrpinartidaiotunepsvlioaclnaudtmes,ept,wiksoeinrsgvtaeanmadsaomrudnattcsruirxlivsbetelsad,nfkionsr.Taatbotleal1o, f eighteen standards and two matrix blanks.
11.1.5 Refer to validation reports FACT-M-3.1-V-1 and FACT-M-4.1-V-1, which list cthuervweos.rking ranges and the Linear Calibration Range (LCR) for calibration
11.1.6 Use Attachment D as an aid in calculating the concentrations of the working cstaalnibdraartdios.n sSteaendSaercdtsio. n 13.0 to calculate actual concentrations of PFOS in
11.2 Tstoanedaacrhdsftoarndthaerdc,obnlcaennktr, aotrioQnCtochfaelclkw, iatdhdinatphpercoaplriibartaetaiomnocuunrtvoefrsaunrgreog5aptepbwo-1r0k0in0gppb.
11.3 tEoxetrsatactblsipshikeedacmh aintriitxiasltcaunrdvaerdosnftohlelomwainssg s1p2e.c6t-r1o2m.1e6tero.f this method. Use these standards
Extraction of PFOFSACfrTo-mMS-3e.r1um or Other Fluid
3M Environmental Laboratory
Page 6 of 17
Page 158
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Table 1
Approxim ate spiking amounts for standards and spikes
using 1.0 ml of matrix
Working standard (approx, cone.)
*-
pL
Approx, final cone, of analyte in matrix
- Blank
0.500 ppm 0.500 ppm 5.00 ppm 5.00 ppm 5.00 ppm 50.0 ppm 50.0 ppm 50.0 ppm 50.0 ppm
10 0.005 ppm
2 0 0 . 0 1 0 ppm
5 0.025 ppm
1 0 0.050 ppm
2 0 0 . 1 0 0 ppm
5 0.250 ppm
10 0.500 ppm
15 0.750 ppm
20 .
1 . 0 0 ppm
Table 2
Approximate spiking amounts for standards and spikes
using 0.5 ml o f m atrix__________________
Working standard (approx, cone.)
pL
Approx, final cone, of analyte in matrix
- ...
0.500 ppm
5
Blank 0.005 ppm
0.500 ppm 1 0 0 . 0 1 0 ppm
5.00 ppm
2.5 0.025 ppm
5.00 ppm
5 0.050 ppm
5.00 ppm 50.0 ppm 50.0 ppm
10
2.5
0 . 1 0 0 ppm 0.250 ppm
5 0.500 ppm
50.0 ppm
7.5 0.750 ppm
50.0 ppm 1 0 1 . 0 0 ppm
12.0 P r o c e d u r e ______________________________________________ ___________________________ 12.1 Obtain frozen samples and allow to thaw. 12.2 pVoolrytperxompyixlenfoerc1e5ntsreicfuognedst,ubthee. nFtorranbslfoeord1.s0ammpLleosr, ortehmerovaepp0r.5opmriLateanvdolduimluetetotoa11.05 mmLL
with Milli-QTM water. As soon after diluting as possible, pipet diluted blood into TBAbuffer mixture shown in step 12.9 and mix well. 12.3 Return samples to freezer after extraction amount has been removed.
FACT-M-3.1 Extraction of PFOS from Serum or Other Fluid
3M Environmental Laboratory
Page 7 of 17
Page 159
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03G laboratory Request Number-U2279
12.4 Record the volume on the extraction worksheet. The final methanol volume equals the volume transferred from the sample. For example, if 0.5 mL is removed for a blood sample, the final methanol volume will equal 0.5 mL.
12.5 wLaobrkelshtheeettufobredwoictuhmtheentsitnugdythneurmembeari,nsinagmsptleepIsD. , date and analyst initials. See attached 12.6 Spike each matrix with the appropriate amount of standard as described in 11.1 or Table
1 or 2 in that section for the calibration curve standards. Also prepare matrix spikes and continuing calibration standards. 12.7 Spike all samples, including blanks and standards, ready for extraction with surrogate standard as described in 11.2. 12.8 sVaomrtpelxesmfoixr t1h5essetcaonnddarsd. curve samples, matrix spike samples, and continuing calibration 12.9 Tbiocaerabcohnsaatembpuleff,eard. d 1 mL 0.5 M TBA and 2 mL of 0.25 M sodium carbonate/sodium 12.10 Using a volumetric pipette, add 5 mL ethyl acetate. 12.11 Cap each sample and put on the shaker for 20 minutes.
12.12 sCeepnatrraitfeudg.e for 20 to 25 minutes at approximately 3500 rpm, until layers are well
12.13 Tcernatnrsiffeurge4 tmubLe.oLf oarbgeal nthicislafyreesrh, utusibnegwait5hmthLe gsraamdeuaintefdorgmlaastsiopnipaesttien, 1to2.5a.clean 15 mL 12.14 Put each sample on the analytical nitrogen evaporator until dry, approximately 2 to 3
hours. 12.15 Add 1.0 mL or other appropriate volume o f methanol to each centrifuge tube using a
tghreadeuxatrteadctipoinp.ette. Methanol volume to add equals the initial volume of sample used for 12.16 Vortex mix for 30 seconds. 12.17 Attach a 0.2 pm nylon mesh filter to a 3 cc syringe and transfer the sample to this
syringe. Filter into a 1.5 mL glass autovial or low-volume autovial when necessary. 12.18 mLaabtreilxt,hfeinaaultsoovlivaelnwt,itehxttrhaecsttioundydantuem, abnedr,aannailmysatl(sn)upmebrfeorramnidnggetnhdeeerx, tsraamctpiolne.timepoint, 12.19 Cap and store extracts at approximately 4 C until analysis. 12.20 Cnootmebpoleotke otrheinecxlturdaectiinonstwudorykbsihnedeetr,,aatstaacphperdotporitahties. document, and tape in the study
Extraction of PFOFSACfrTo-mMS-3e.r1um or Other Fluid
3M Environmental Laboratory
Page 8 of 17
Page 160
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
13.0 _D a t a A n a l y s is a n d C a l c u l a t io n s _______________________________________________ 13.1 Calculations
13.1.1 cCaalilbcuralattioenacsttaunadl acrodnsceunstinragtitohnesfoofllPowFOinSg, eoqruoatthioenr:applicable fluorochemical, in mmLLo fosftastnadnadradrd+ xmcLonocfesnutrrraotgioanteosftastnadnadradrd+ liungiti/aml Lm)a_t_r_ix__v_o_l_u_m__e__(m__L_)___=
Final Concentration (pg/mL) of PFOS in matrix
14.0 M e t h o d P e r f o r m a n c e ________________________________________________________________ 14.1 TfohrespmeectihfiocdMdeDteLctainond lliimmiitt o(Mf qDuLan) tiistaatnioanly(tLeOanQd) mvaalturiexs s(pseeeciAfictt.acRhemfeerntotsMBDaLndreCpo).rt 14.2 The following quality control samples are extracted with each batch of samples to ensure
the quality o f the extraction and analysis. 14.2.1 Method blanks and matrix blanks 14.2.2 Matrix spike and matrix spike duplicate samples to determine accuracy and
precision of the extraction 14.2.3 Continuing calibration check samples to determine the continued accuracy o f the
initial calibration curve
15.0 P o l l u t io n Pr e v e n t io n a n d W a s t e M a n a g e m e n t ___________________________ 15.1 Sample waste is disposed in biohazard containers, flammable solvent waste is disposed in
high BTU containers, and used glass pipette waste is disposed in broken glass containers located in the laboratory.
16.0 R e c o r d s ___________________________________________________________________________ 16.1 Complete the extraction worksheet attached to this method, and tape in the study
notebook or include in study 3-ring binder, as appropriate.
17.0 A t t a c h m e n t s _________________________________________________________________________ 17.1 Attachment A, Extraction worksheet 17.2 Attachment B, MDL/LOQ values 17.3 Attachment C, LOQ Summary 17.4 Attachment D, Calibration standard concentration worksheet
18.0 R e f e r e n c e s ___________________________________________________________________ ________ 18.1 The validation reports associated with this method are FACT-M-3.1 & 4.1-V -l.
FACT-M-3.1 Extraction of PFOS from Serum or Other Fluid
3M Environmental Laboratory
Page 9 of 17
Page 161
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
19.0 a f f e c t e d D o c u m e n t s _____________________________________________________________ 19.1 FHAPCLCT--EMle-4ct.1ro, sp"AranyaMlysaisssoSfpSeecrturommoertrOy"ther Fluid Extracts for Fluorochemicals using
20.0 R e v is io n s _________________________________________________________________
RNeuvmi1sbioern
Validatio` n o f method to inRcleuadseon7 FflouroRroecvhiseimonicals, an additional matrix, nimewprAovPeIm/MenSt(sMtoS)iosnysptaeimrisn,gmexotnrkaecytiosner,uMmDcLrosstsudvayl,iduaptdioante,s in record keeping and storing policies, etc.
ReDvaistieon 07/01/98
FACT-M-3.1 Extraction of PFOS from Serum or Other Fluid
3M Environmental Laboratory
Page 10 of 17
Page 162
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Study ft
-
-
1-
S am p le Number set ft H ,0 Blank
Blank -
FC-M ix approx. 0.5 ppm actual ppm #W
-
FC-M ix approx. 5 ppm actual ppm #W
-
-
FC-M ix approx. 50 ppm actual ppm #W
-
Date and Initials for
Std. or C om m ents
--
*
--
- '-
---
- --
--
*- -
- --
- --- -- -
- --
- --
-- -- - - '* " -- -
-
-
' Study number where the original wortsheet is located. Blank std n Serum Extraction Method
Vortex 15 sec
Pipette Matnx
Volume
Pipette 1ml of 0.5 M TBA, pH 10.
Std. #
-
amount =
ml
-
mL Date & Initials
Pipette 2 m l o f 0.25 N a?C O yO -25M N aH C O t buffer Std. #
P ipette S ml o f ethyl acetate________________________________ T N -A -
___________________________________
Shake 20 min.
C entrifu ge 2 0 -2 5 m in._______________________________ C entrifuge speed:_________________________________________________________________
R em o v e a 4 m l aliq uot o f organic layer_______________________________________________________________________________________________
Put on N itro g en E vaporator to d ryness E vaporator #:__________________________Tem perature:______________________________________
A d d m e th a n o l___________________ V o lu m e
m l______________ T N -A -
V ortex 3 0 sec.____________________________________________________________________________________________________________________________
FM__ilS_te/_rM_u_Ss_iDn_g/p_ap_m3_cC.c oMBn-StD./MCsyhSreiDncgkuess:weSditphsiaakme0 d.p2_ul_em____S__R_Iu_Lf_il_toe_fr_ai_n__to____a __1__.5.
pmplma ustotds a(m__p l_e_v_i_al__________________)__f_o_r__a_f_i_n_a_l__c_o__n_c_e_n__tr_a_t_i_o_n__o__f Cont. Checks used same matrix as for std curve.
Surrogate Standard: Spiked_____uL of a _____ ppm std (______________ ) to all samples, standards, and blanks
Attachment A: Extraction worksheet
FACT-M-3.1
Extraction of PFOS from Serum or Other Fluid
3M Environmental Laboratory
Page 11 of 17
Page 163
3m Medical Department Study: T-62 95.7
Report No. FACT TOX-030 laboratory Request Number-U2279
M DL/LOQ values for Rabbit Serum:
Com pound MDL LOQ Linear Calibration Range (LCR)
(ppb) (PPb) Approximate concentrations to be used for preparing the
Standard Calibration Curve
PFOS 1.38 4.39 5 ppb - 1000 ppb
PFOSA 2.23 7.09 10 ppb - 1000 ppb
PFOSAA 2.84 - 9.04 10 ppb - 1000 ppb
EtFOSE-OH 3.90
12.4 15 ppb - 1000 ppb
POAA
4.31 13.7 15 ppb - 750 ppb
PFOSEA 1.09 3.48 25 ppb - 1000 ppb
Monoester 149
248
MDL and LOQ are estimates only. No valid MDL was determinable from MDL study. Any quantitation performed for monoester will be an
estimate only. Please refer to FACT-M-3.1 & 4.1-V-l for specifics.
M DL/LOQ values for Rat Serum:
Compound M DL LOQ Linear Calibration Range (LCR)
(PPb) (PPb) Approximate concentrations to be used for preparing the
Standard Calibration Curve
PFOS 1.27 4.04 10 ppb - 1000 ppb
PFOSA
2.14 6.81 25 ppb - 1000 ppb
PFOSAA 2.32 7.38 10 ppb - 1000 ppb
EtFOSE-OH 3.25
10.3 50 ppb - 1000 ppb
POAA
1.20 3.81 5 ppb - 1000 ppb
PFOSEA 1.84 5.86 ... 10 ppb - 1000 ppb
Monoester | 149
248
MDL and LOQ are estimates only. No valid MDL was determinable from MDL study. Any quantitation performed for monoester will be an
estimate only. Please refer to FACT-M-3.1 & 4.1-V-l for specifics.
M DL/LOQ values for Bovine Serum:
Compound MDL LOQ Linear Calibration Range (LCR)
(PPb) (PPb) Approximate concentrations to be used for preparing the
Standard Calibration Curve
PFOS 2.11 6.70 25 ppb - 1000 ppb
PFOSA 5.04 16.0 25 ppb - 1000 ppb
PFOSAA 2.34 7.45 260 ppb - 1000 ppb
EtFOSE-OH 11.3 35.8 50 ppb - 1000 ppb
POAA
4.64 14.8 15 ppb - 1000 ppb
PFOSEA 3.71
11.8 15 ppb - 1000 ppb
Monoester 149
248
MDL and LOQ are estimates only. No valid MDL was determinable from MDL study. Any quantitation performed for monoester will be an
estimate only. Please refer to FACT-M-3.1 & 4.1-V-l for specifics.
No data is available for MDL or LOQ in Monkey Serum. Use validated Linear Calibration Range instead. Please see Attachment C (LOQ Summary) and MDL study in FACT-M-3.1 & 4.1-V-l for specifics.
Attachment A: Extraction worksheEetxtraction of PFOFSACfrTo-mMS-3e.r1um or Other Fluid
3M Environmental Laboratory
Page 12 of 17
Page 164
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
M DL/LOQ values for M onkey Serum:
Com pound M DL LOQ Linear Calibration Range (LCR)
(PPb) (PPb) Approximate concentrations to be used for preparing the
Standard Calibration Curve
PFOS
1.38 4.39 MDL and LOQ are estimates only. No valid MDL was determinable from
MDL study. Any quantitation performed for PFOS will be an estimate
only. Please refer to FACT-M-3.1 & 4.1-V-l for specifics.
PFOSA
2.23 ` 7.09 MDL and LOQ are estimates only. No valid MDL was determinable from
MDL study. Any quantitation performed for PFOSA will be an estimate
PFOSAA 2.84
9.04
only. Please refer to FACT-M-3.1 & 4.1-V-l for specifics. MDL and LOQ are estimates only. No valid MDL was determinable from
MDL study. Any quantitation performed for PFOSAA will be an estimate
EtFOSE-OH 3.90
12.4
only. Please refer to FACT-M-3.1 & 4.1-V-l for specifics. MDL and LOQ are estimates only. No valid MDL was determinable from
MDL study. Any quantitation performed for EtFOSE-OH will be an
estimate only. Please refer to FACT-M-3.1 & 4.1-V-l for specifics.
POAA
4.31 13.7 MDL and LOQ are estimates only. No valid MDL was determinable from
MDL study. Any quantitation performed for POAA will be an estimate
only. Please refer to FACT-M-3.1 & 4.1-V-l for specifics.
PFOSEA 1.09
3.48
MDL and LOQ are estimates only. No valid MDL was determinable from MDL study. Any quantitation performed for PFOSEA-OH will be an
estimate only. Please refer to FACT-M-3.1 & 4.1-V-l for specifics.
M onoester 149
248 MDL and LOQ are estimates only. No valid MDL was determinable from
MDL study. Any quantitation performed for EtFOSE-OH will be an
estimate only. Please refer to FACT-M-3.1 & 4.1-V-l for specifics.
M DL/LOQ values for Rat W hole Blood:
Compound MDL LOQ Linear Calibration Range (LCR)
(PPb) (PPb) Approximate Concentrations to be used for preparing the
Standard Calibration Curve
PFOS 1.25 3.96 5 ppb - 1000 ppb
PFOSA
1.77 5.65 10 ppb - 1 0 0 0 ppb
PFOSAA 17.3 55.0 55 ppb - 1 0 0 0 ppb
EtFOSE-OH 7.89
25.1 MDL and LOQ are estimates only. No valid MDL was determinable from
eMstDimLastteuodnyl.y.AnPyleqasueanrteifteartitoonFpAerCfTor-mMe-d3.1for&E4tF.1O-VSE-l-OfoHr
will be an specifics.
POAA
4.73 15.1 15 ppb - 1 0 0 0 ppb
PFOSEA 24.2 77.1 80 ppb --1 0 0 0 ppb
Monoester 58.0
185 MDL and LOQ are estimates only. No valid MDL was determinable from
MDL study. Any quantitation performed for monoester will be an
estimate only. Please refer to FACT-M-3.1 & 4.1-V-l for specifics.
Please see Attachment C (LOQ Summary) and MDL study in FACT-M-3.1 & 4.1-V -l for specifics.
Attachment A: Extraction worksheEetxtraction of PFOFAS CfrTo-mMS-3e.r1um or Other Fluid
3M Environmental Laboratory
Page 13 of 17
Page 165
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Ion Pairing Extraction o f Fluorochemicals from Serum and Analysis by API/MS(MS) Summary Table: Limits o f Quantitation
Compound
Matrix
MDL
LOQ
LAopwp rsotdx im a te
2linear range High std
PFOS
Rabbit
1.38 ppb
4.39 ppb
5 ppb
1000 ppb
Bovine
2.11 ppb
6.70 ppb
25 ppb
1000 ppb
- Rat
1.27 ppb
4.04 ppb
10 ppb
1000 ppb
Monkey
n/d
n/d 25 ppb 1000 ppb
PFOSA
Rabbit
2.23 ppb
7.09 ppb
10 ppb
1000 ppb
Bovine
5.04 ppb
16.0 ppb
25 ppb
1000 ppb
Rat
2.14 ppb
6.81 ppb
25 ppb
1000 ppb
Monkey
n/d
n/d 25 ppb 1000 ppb
PFOSAA
Rabbit
2.84 ppb
9.04 ppb
10 ppb
1000 ppb
Bovine
2.34 ppb
7.45 ppb
263 ppb
1000 ppb
Rat
2.32 ppb
7.38 ppb
10 ppb
1000 ppb
Monkey
n/d
n/d 25 ppb 1000 ppb
EtFOSE-OH
Rabbit
3.90 ppb
12.4 ppb
15 ppb 1000 ppb
Bovine
11.3 ppb
35.8 ppb
50 ppb
1000 ppb
Rat 3.25 ppb ' 10.3 ppb 50 ppb 1000 ppb
Monkey
n/d
n/d 10 ppb 1000 ppb
POAA
Rabbit
4.31 ppb
113.7 ppb
15 ppb
750 ppb
Bovine
4.64 ppb
14.8 ppb
5 ppb
1000 ppb
Rat
1.20 ppb
3.81 ppb
5 ppb
1000 ppb
Monkey
n/d
n/d 5 ppb 1000 ppb
PFOSEA
Rabbit
1.03 ppb
3.48 ppb
25 ppb
1000 ppb
Bovine
3.71 ppb
11.8 ppb
5 ppb
1000 ppb
Rat
1.84 ppb
5.86 ppb
10 ppb
1000 ppb
Monkey
n/d
n/d 5 ppb 1000 ppb
Monoester1
Rabbit
149 ppb
474.0 ppb
250 ppb
1000 ppb
Bovine
149 ppb
474.0 ppb
250 ppb
1000 ppb
Rat
149 ppb
474.0 ppb
250 ppb
1000 ppb
Monkey
n/d
n/d
100 ppb
1000 ppb
1. Values for monoester are estimates only.
2. Highest standard (approx. 1500 ppb) was excluded from final LCR and upper LOQ values due to poor R & R
values and excessive weighting of the calibration curve.
Compound: PFOS
Smearturmix
(psPrptarabenn)(pgdnaegar/remoddfLs)
(pRpaabcv)nue(ngrrvage/gemoeLf)
LCR from ave curve (ppbXng/mL)
(pRplaobc)nwu(gnrvges/etmdoLf)
(LppClboc)Ruw(nrgfvsr/etmodml_)
(pRhpbacig)nu(hgnrvges/emtodLf)
LCR from (phpbcig)u(hnrvgs/emtdL)
Rabbit
-4 .9 3 1 4 5 0 4 .9 3 - 1 4 5 0 4 9 .3 - 1 0 0 0 4 9 . 3 - 9 7 . 6
4.93 -9 7 .6 9 7.6 - 1450 9 7 .6 - 1000
Bovine
4 .93 - 1450 4 .9 3 - 1450 9 7 .6 - 1000 4.93 - 248 24.8 - 248 97.6 - 1450 9 7 .6 - 1000
Rat
4.9 3 - 1450 4.93 - 9 76
24.8 - 9 76
4.93 -248
9.76 - 248 97.6 - 1450 2 48 - 1000
Monkey 4 .9 3 - 1 4 5 0 4 .9 3 - 1 4 5 0 2 4 .8 - 1 0 0 0 2 4 .8 -4 9 3
24.8 - 493 97.6 - 1450
97.6 1000
Attachment C: LOQ Summary
FACT-M-3.1
Extraction of PFOS from Serum or Other Fluid
3M Environmental Laboratory
Page 14 of 17
Page 166
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
Compound: PFOSA
Serum Prepared matrix range of
(psptabnXdnag/rmdLs) Rabbit 5.00- 1470
Range of average (ppbcXurnvg/emL) 5.00- 1470
Bovine 5.00- 1470- 5.00 - 1470
Rat 5.00- 1470 5.00- 1470
Monkey 5.00- 1470 5.00 - 1470
LCR from ave curve (ppbXng/mL) 9.89 - 1000
2 5 .1 - 1000
50.0 - 1000
98.9 - 1000
Range of low std (ppbcu)(rnvg/emL) 5.00-251
5.00-98.9 9.89-500
25.1 - 500
LCR from low std (ppbc)u(nrgv/emL)
n/a
n/a 25.1 -500
25.1 - 500
Range of high std (ppbc)u(nrvg/emL) 9 8 .9 - 1470
9 8 .9 - 1470 98.9 - 1470
9 8 .9 - 1470
LCR from high std (ppbcu)(rnvg/emL) 9 8 .9 - 1000
9 8 .9 - 1000
9 8 .9 - 1000
n/a
Compound: PFOSAA
Serum Prepared Range of matrix range of average
(psptabn)(dnag/rmdLs) (ppbcXunrgv/emL) Rabbit 5 .2 0 - 1540 5.20 - 1540
Bovine 5 .2 0 - 1540 5 .2 0 - 1540
Rat 5 .2 0 - 1540 5.20 - 1540 Monkey 5 .2 0 - 1540 5 .2 0 - 1540
LCR from ave curve (ppbXng/mL) 104- 1000
263 - 1000
104- 1000
52.4- 1000
Range of low std (ppbcXurnvg/emL) 5.20-263
10.4-521
5.20-263 5.20-263
LCR from low std (ppbc)u(nrgv/emL) 10.4-263
n/a (1)
10.4-263
26.3 - 263
Range of high std (ppbcXurnvg/emL) 104- 1540 104- 1540
104 - 1540 104- 1540
LCR from high std (ppbc)u(nrgv/emL) 263 - 1000
263 - 1000
263 - 1000 263 - 1000
Compound: EtFOSE-OH
Smearturmix
sPrtaraennpgdaearreoddfs
Raavcnuegrrvaegeoef
(ppbXng/mL) (ppbXng/mL)
Rabbit
4 .9 4 - 1450 4.9 4 - 1450
Bovine
4 .9 4 - 1450 4.9 4 - 1450
Rat 4 .9 4 - 1 4 5 0 4 .9 4 - 1 4 5 0
Monkey 4 .9 4 - 1 4 5 0 4 .9 4 - 1 4 5 0
LavCeRcfurrovme
(ppbXng/mL) 49.4 - 1000
97.8 - 1000
4 9 4 - 1000 9 7 .8 - 1000
Rlaocnwugrvesetdof
(ppbXng/mL)
4 .94 - 248
4 .9 4 -2 4 8 4 .94 - 248 4 .94 - 2 4 8
LClocRwurvfsretodm
(ppbXng/mL)
9 .7 8 -2 4 8
4 .9 4 -2 4 8
n/a
9 .78 - 248
Rhaicgnuhgrvesetodf
(ppbXng/mL)
97.8 - 1450
97.8 - 1450 97.8 - 1450 97.8 - 1450
LhCcigRuhrfvrseotdm
(ppbXng/mL)
n/a
248 - 1000 97.8 1000
n/a
Attachment C: LOQ Summary
FACT-M-3.1
Extraction of PFOS from Serum or Other Fluid
3M Environmental Laboratory
Page 15 of 17
Page 167
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Compound: POAA
Serum Prepared matrix range of
(psptabnXdnagr/mdLs ) Rabbit 5.01 - 1480
Range of average curve
(ppb)(ng/m L)
5.13 - 1510
Bovine 5.01 - 1480- 5 .13-1510
Rat 5.01 - 1480 5.13-1510
Monkey 5.01 - 1480 5.13-1510
LCR from ave curve (ppb)(ng/mL) 25.8 - 1000
102-1000
51.3-1000
102 - 1000
Range of low std (ppbc)u(nrgv/emL) 5.13-258 5.13-258 5.13-102
5.13-102
LCR from low std (ppbcXunrgv/emL)
n/a 5.13-258 5.13 - 102
5.13 - 102
Range of high std (ppbc)u(nrgv/emL) 102 - 1510 102- 1510 102-1510
1 0 2- 1510
LCR from high std curve
(P P b )(n g/'m L )
n/a
258 - 1000
1 0 2 - 1000
258 - 1000
Compound: PFOSEA Serum Prepared Range of matrix range of average
(psptabn)(dnga/rmdLs) (ppbc)u(nrgv/emL) Rabbit 5.13- 1510 5.13 - 1510
Bovine 5.13 - 1510 5.13 - 1510
Rat 5.13 - 1510 5.13 - 1510 Monkey 5.13 - 1510 5.13 - 1510
LCR from ave curve (ppbXng/mL) 25.8- 1000
102 - 1000
51.3-1000
102 - 1000
Range of low std (ppbcXunrgv/emL) 5.'l3 -258
5.13 -258
5.13 - 102 5.13 - 102
LCR from low std (ppbcXunrgv/emL)
n/a
5.13 -2 5 8
5.13 -1 0 2 5.13 - 102
Range of high std (ppbcXurnvg/emL) 102 - 1510
102 - 1510
102 - 1510 102 - 1510
LCR from high std (ppbcXurnvg/emL)
n/a
258 - 1000
102 - 1000 258 - 1000
Compound: Monoester
Serum Prepared Range of matrix range of average
(psptabn)(dnag/rmdLs) (ppbc)u(nrgv/emL) Rabbit 4.94- 1450 9.78 - 978
LCR from ave curve
(ppbXng/mL) n/a
Bovine 4.94- 1450 97.8 - 1450 n/a
Rat 4.94 - 1450 2 4 8 - 1450 2 4 8 - 1000
Monkey 4.94 - 1450 49.4 -1450 97.8 - 1000 In general, the chromatography for the monoester was very poor (broad peaks, high baseline). Curves for monoester in rabbit and bovine were unacceptable. Any quantitation performed with the monoester is only an estimate and should not be used for reliable, accurate data reporting.
Attachment C: LOQ Summary Extraction of PFOFSACfrTo-mMS-3e.r1um or Other Fluid
3M Environmental Laboratory
Page 16 of 17
Page 168
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Ion Pair Standard Curves - Fluids
PASranemaplpydlteae(tmse)(a:st):rix:
SEFBtiqlanaunanidlkpasmforlldeuvniendtnu/nitmduaebmnnedtbrief:TireN:r::
TMFFFSCCuCaerrtgrmmmhoeoiiigtxxxdaa/ssstrnttetedddavslitysdtaieaaopa(ppnspppp):rp:rrorooxoxx.x...055.5.0100.7000.7pp1ppppmmpmp:::m:
W398-641 W398-640 W398-639 W398-605
Actual concentrations of standards in the
PFOS PFOSA PFOSAA EtFOOHSESutdg/cmoLne Sutdg/cmoLne Sutdg/cmoLne Sutdg/cmoLne
FCPOmAixA
Sutdg/cmoLne
PFOSEA Sutdg/cmoLne
Monor este Sutdg/cmoLne
0.500 0.507 0.532
0.500 0.507 0.532
5.00 5.07
5.32
5.00 5.07
5.32
5.00 5.07
5.32
50.0 50.1
53.2
50.0 50.1
53.2
50.0 50.1
53.2
Ca50lc.0ulated 5c0o.1ncentrat5i3o.2ns
of
0.501 0.501 5.01 5.01 5.01 50.1 50.1 50.1 50.1
standards
0.509 0.509 5.09 5.09 5.09 50.9 50.9 50.9 .50.9
in the
' 0.521 0.521 5.21 5.21 5.21 52.1 52.1 52.1 52.1
sample matrix
0.501 0.501 5.01 5.01 5.01 50.1 50.1 50.1 50.1
PFOS Final cone
PFOSA Final cone
ng/m L
PFOSAA Final cone
ng/m L
E tFO SE Final cone
ng/m L
POAA Final cone
ng/m L
PFOSEA Final cone
ng/m L
M onoester Std cone ng/m L
ng/m L 4.93 9 .7 6 24.8
49.3 97.6 248
493
735 976
5 .0 0 9 .8 9 25.1 5 0 .0 98.9 251 500
746 989
5.24 4.94 5.01 5.13 4~94 10.4 9.78 9.93 10.2 9.78 26.3 24.8 25.2 25.8 24.8 52.4 49.4 50.1 51.3 49.4 104 97.8 99.3 102 97.8 263 248 252 258 248 524 494 501 513 494 782 737 749 766 737 1038 978 993 1017 978
All spiAkemd'tmL
0.010 0.020 0.005 0.010 0.020 0.005 0.010 0.015 0.020
All VFomilnuLaml e 1.015 1.025 1.010 1.015 1.025 1.010 1.015 1.020 1.025
S urrogate Std cone ng/m L
2.64
S urrogate Final cone
ng/m L 81.0
A ll A m 't spiked
(m L) 0 .0 0 5
Validated ranges - approximate concentrations
S era
PFOS
PFOSA
PFOSAA
R abbit B ovine
R at M onkey
5-1000 ppb 25-1000 ppb 10-1000 ppb E stim ates only.
10-1000 ppb
25-1000 ppb 25-1000 ppb Use values for
10-1000 ppb 263-1000 ppb 10-1000 ppb
R abbit
E tF O SE -O H
10-1000 ppb 5-1000 ppb 50-500 ppb
POAA
10-750 ppb 5-1000 ppb 5-1000 ppb
PFOSEA
25-1000 ppb 5-1000 ppb 5-1000 ppb
Attachment D: Ion Pair Standard CEuxrvtreasction of PFOFSACfrTo-mMS-3e.r1um or Other Fluid
3M Environmental Laboratory
P ag e 17 o f 17
Page 169
3m Medical Department Study: T-6295.7
VReport N o . FACT TOX,-030
laboratory Request
*F
3M Environmental Laboratory
M ethod
A na ly sis of P o tassium Perfluoro octanesulfonate o r O th er F lu o r o c h em ic a ls in Serum o r O th er Fluid E xtracts U sing H P L C -E lectrospray/M ass Spectrom etry
M ethod Number: FACT-M-4.1
Author: Lisa Clemen, Glenn Langenburg Approved By:
Adoption Date: 4/22/98 Revision Date: lo -i-ij-
Laboratory Manager
| y/v.
Group Leader
---------- '
Technicaflt RevLilexw/rweri.
Date
Mw Date Date
1.0 S c o p e a n d A p p l ic a t io n ____________________________________________________________________
1.1 Scope: This method is for the analysis of extracts from serum or blood for fluorochemical surfactants using HPLC-electrospray/mass spectrometry.
1.2 Applicable Compounds: Fluorochemical surfactants or other fluorinated compounds, or other ionizable compounds.
1.3 Matrices: Rabbit, rat, bovine, or monkey serum and rat whole blood or milk curd.
Word 6.0.1/95
FACT-M-4.1 Analysis of Serum or Fluid Extract Using ES/MS
3M Environmental Laboratory
Page 1 of 9
Page 170
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
2.0 S u m m a r y of M ethod_________________________________________________________________ __ 2.1 wTashhaiosplepmrbeotlpohrooidadt,edo.ersTmchriielbkeascnuatrhlydesuaissniianslgypsHeirsPfooLrfCmfl-euedolerbcoytcrhomseopmnriaictyoa/rlmisnaugsrsfaascsptienacngttlrseoemioxentrtarcycht,aeordracfsrtieomrmiislatsirecrsouymfsta,em
particular fluorochemical, such as the potassium perfluorooctanesulfonate (PFOS) anion, M/Z= 499. Samples may also be analyzed using an API/MS/MS system to further verify compound identification.
3.0 Definitions__________________________________________________________
3.1
vAatrmioousspmh eerthi codPsr eosfsiuorneizIaotnioinz abt iyounti(lAizPinIg):
The Micromass various sources,
platform systems allow probes, and interfaces.
for These
iIanotmcnliuozdsapteihobenurti(cAaprPercenIs)os,utTrlhieme(riim.tee.odsntpoort:auEynl,edecettrcr.oasTvparhcaeuyiuoImonni)z.iazatitoionnp(rEoSceIs),s AintmthoesspehteercihcnPiqreusessuroecccuhresmaitcal
3.2 E lectrospray Ionization (ES, ESI): a method of ionization performed at atmospheric pressure, whereby ionization occurs through th production o f tiny charged droplets in a strong electrical field.
3.3
TMhaesAs PSIpepclatrtfoomrmetsryar,eMeqaussipSppedecwtriothmqeuteardr(uMpSol)e,
Tmaanssd seemlecMtiavses dSepteeccttorros.m Ieotne rs
(MS/MS): are
selectively discriminated by mass to charge ratio (m/z) and subsequently detected. A single
MS may be employed for ion detection or a series (MS/MS) for more specific fragmentation
information.
3.4 soCcyorostnhtneeovmageponsent(raiptoluontrsoaet,lt1hav9fest9.ec8r2o)1pnu-aestpsiaslripiazneyegrtaputhrr"roeZo.b-useIgpnihrntahtayee"trocfcraootcnunevof:oeunrsTmtpihoaaenttihaloawlnteca.soytTnimfhnoeorthmdspeearlctsaioyoounfenmMtiteiriitscteeraldoeimcmftrareoosdmsddepai.lrapeTtcrfohtolrobymueagtihsththee cHoonwfiegvuerra,tiZo-nspisradyifcfoermenpto,ntehnetsmaenthdocdosnovfenotpieornaatliocno,mcpleoanneinntgs, aarnednmotaicnotmenpaantcibelearwe itthheosnaeme. sapnroatyhesry,sbteumt osn, leytcw.)ith similar systems (i.e. Z-spray components are compatible with other Z-
3.5
MsysatsesmLs.y
nCxuSrroefntwtlyarMe:asSsLysytnexmhsaosftWwainredodwessig9n5eadndforWthinedsopwecsNifiTc
operation of 3.1 versions.
these platform All versions
are similar. For more details see the manual specific to the instrument (Micromass Platform
II or Quattro II MassLynx or MassLynx NT USER'S GUIDE).
4.0 W a r n in g s and C au tio n s_________________________________________________________________ 4.1 H ealth and Safety W arnings:
4.1.1 Uapspercoaxuimtioantewlyit5h00th0eVvoollttsa.ge cables for the probe. The probe employs a voltage of
4.1.2 Wanhdecnlohtahnindgli.ng samples or solvents wear appropriate protective gloves, eyewear,
Word 6.0.1/95
Analysis of SerumFoArCFTlu-Mid-E4.x1tract Using ES/MS
Page 2 of 9
3M Environmental Laboratory
Page 171
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
4.2 Cautions: 4.2.1 DIfothneobt aocpkerparteesssuorlveeenxtcpeuedmsp4s0a0bboavre, ctahpeaHciPty11o0f04w00illbainri(t5ia8t0e0auptsoi)mbaatcicksphruetsdsouwren.. 4.2.2 Do not run solvent pumps to dryness.
5.0 I n t e r f e r e n c e s ______________________________________________________________________ 5.1 To minimize interferences when analyzing samples for perfluorooctanoate(POAA), teflon
wshiothultdhenosat mbeplueseodr efoxrtrsaacmt. ple storage or any part o f instrumentation that comes in contact
6.0 E q u ip m e n t ' _____________ _____ ___________________________________________________________ 6.1 Equipment listed below may be modified in order to optimize the system.
6.1.1 Micromass Electrospray Mass Spectrometer 6.1.2 HP 1100 low pulse solvent pumping system and autosampler
7.0 S u p p l ie s a n d M a t e r ia l s _____________________________________________________________________ 7.1 Supplies
7.1.1 High purity grade nitrogen gas regulated to approximately 100 psi 7.1.2 HPLC analytical column, specifics to be determined by the analyst 7.1.3 Capped autovials or capped 15 ml centrifuge tubes
8.0 R e a g e n t s a n d St a n d a r d s_______________________________________ _ __________________________ 8.1 Reagents
8.1.1 Methanol, HPLC grade or equivalent 8.1.2 Milli-QTM water, all water used in this method should be Milli-QTM water and may
be provided by a Milli-Q TOC Plus system 8.1.3 Ammonium acetate, reagent grade or equivalent 8.2 Standards 8.2.1 Typically one method blank, one matrix blank, and ten matrix standards are
prepared during the extraction procedure. See FACT-M-3.1.
9.0 S a m p l e H a n d l in g ____________________________________________________________________________ 9.1 Farreesshtomreadtriinx csatapnpdeadrdasutaorveiaplrsepoarrceadpwpeitdh1e5acmhl acneanltyrsifisu.geEtxutbraecstuedntsiltaanndaalrydssis.and samples 9.2 If analysis will be delayed, extracted standards and samples can be refrigerated at
approximately 4 C until analysis can be performed.
FACT-M-4.1 Analysis of Serum or Fluid Extract Using ES/MS
3M Environmental Laboratory
Page 3 of 9
Page 172
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
10.0 Q u a l it y C o n tro l______________________________________________________________________ 10.1 M ethod Blanks and M atrix Blanks
10.1.1 Analyze a method blank and a matrix blank prior to each calibration curve.
10.2 M atrix Spikes 10.2.1 Analyze a matrix spike and matrix spike duplicate per forty samples. With a minimum o f 2 spikes per batch. 10.2.2 Expected spike concentrations will fall in the mid-range of the initial calibration curve. Additional spike concentrations may fall in the low-range of the initial calibration curve. 10.2.3 See Section 13 to calculate percent recovery.
10.3 Continuing Calibration Checks 10.3.1 crAuhnnaa.nlOgyezne(lyat3mh0oi%ds-e)rsaiannmgpepealcekasliaabrnreaaatlyoiozcnecdusrtbasne, fdroearlraedttiahvfeetetlraosettvhaeecrciyneitpteitnaatlbhsletsaacnmadlapibrlerd.actIiufornavsesi,tgasnntoidfpaicratdhnet will be used. The remaining samples must be reanalyzed. 10.3.2 See Section 13 to calculate percent difference.
11.0 C a l ib r a t io n and S t a n d a r d iz a t io n _____________________________________________ 11.1 Analyze the extracted matrix standards prior to and following each set of extracts. The
mreegarnesosifotnw(or^stfaonrdtahredcvaalilbureast,ioant ecaucrhvestuasnidnagrdMcaosnscLeynntrxaotiroont,hwerillsubietapblloettseodftbwyarlien.ear 11.2 Tdihsecrre2tvioanluoefftohretahneadlyastat ashnodudldocbuem0e.n9t8e0doarpgprreoavtaelr.ofLtohwe ePrrovjaelcuteLs emada.y be acceptable at the 11.3 If the curve does not meet requirements, perform routine maintenance or reextract the
standard curve (if necessary) and reanalyze. 11.4 uFsoer tphuerploowsesenodf oacfctuhreaccayliwbrhaetnioqnucaunrtviteatriantghelrowthalnevtehles foufllanraanlygtee,oifttmheaystbanednaercdescsuarrvye.to
rcEaaxnlaigbmerapotliefo:tnhwecuhcruevnrevaecto(t5enmspippsttbiinntggo to1of0q0thu0eapnspttaibtna).dteaTradhpsipsfrwrooximlilmr5aetpdepulybcet1oi0n1ap0cpc0bupropafbcaynraaattlhtyretierb,utghteeadnnettrohaetlienfuaelalr regression weighting of high concentration standards.
12.0 P r o c ed u res_____________________________________________________________________________ 12.1 A cquisition Set up
12.1.1 Click on start button in the Acquisition Control Panel. Set up a sample list. Assign a filename using letter-MO-DAY-last digit of year-sample number, assign a method (MS) for acquiring, and type in sample descriptions.
Analysis of SerumFoArCFTlu-Mid-E4.x1tract Using ES/MS
Page 4 of 9
3M Environmental Laboratory
Page 173
3m Medical Department Study: T-6295.7
Report No. FACT TOX-C30 laboratory Request Number-U2279
12.1.2 To create a method click on scan button in the Acquisition control panel and select SIR (Single Ion Recording). Set Ionization Mode as appropriate and mass to 499 or oStahveer aacpqpuroispitriioantemmeathssoeds.. IAf MfuSll/MscaSninissturusumaellnytscoalrleecetmedplaolyoendg, waditdhittihoenaSlIpRrso.duct ion fragmentation information may be collected. See Micromass MassLynx GUIDE TO DATA ACQUISITION for additional information and MRM (Multiple Reaction Monitoring).
12.1.3 Tstyanpdicaarldlys athned aennadlsytwiciathl baastecthorfunexsterqacuteendcme batergixinsstawnidtharadss.et of extracted matrix
12.1.4 cSsaaamrmrpypolleve.serSaraoenlvdaennaartleybnzlaeodnt kcwsoinsthhsiodaueclrdoendbtesinaaumnianplglyezsceabdliubptremartiaiooydnbicceahlielnycckltuoidnmejedocntaeistdosruafcpthoe.rsseivbeleryanteanltyhte
12.2 Using the Autosampler 12.2.1 Set up sample tray according to the sample list prepared in Section 12.1.1. 12.2.2 Saneta-luypsttchoenHsiPd1er1s00a/papurtoopsraimatpelfeorraotptthiemfaolllroewspionngsce.onRdeictoiorndsaocrtuaatlccoonnddititioionnssthine the instrument logbook: 12.2.2.1 Sample size = 10 pL injection with a sample wash
12.2.2.2 Inject/sample = 1 12.2.2.3 Cycle time = 15 minutes 12.2.2.4 Solvent ramp =
Time MeOH
0 . 0 0 min. 7.5 min. 1 1 . 0 min. 11.5 min.
45% 90% 90% 45%
2.0 mM Ammonium acetate
55% 10% 10% 55%
Note: In this instrument configuration, the run must be set up on the electrospray software wHiPthWao"rWksataittiinogn.for inlet start" message before the "Start" button is pressed on the 12.2.2.5 Press the "Start" button.
12.3 Instrument Set-up 12.3.1 Refer to FACT-EP-3.0 for more details. 12.3.2 Check the solvent level in reservoirs and refill if necessary. 12.3.3 Check the stainless steel capillary at the end of the probe. Use an eyepiece to check tuhnesatitpis.faTchtoeryti,pdsihsaosusledmbbeleflatht ewpitrhobneo ajangdgreedpleadcgeetsh.e Isftathineletisps isstefeolucnadptiollabrey.
Analysis of SerumFoArCFTlu-Mid-E4.x1tract Using ES/MS
3M Environmental Laboratory
Page 5 of 9
Page 174
to o
3m Medical Department Study: T-6295.7
Report No. FACT TOXlaboratorv Request Number-U2
12.3.4 Set HPLC pump to "On". Set the flow to 10 - 500 uL/min or as appropriate. Observe droplets coming out of the tip of the probe. Allow to equilibrate for approximately 1 0 minutes.
12.3.5 Turn on the nitrogen. A fine mist should be expelled with no nitrogen leaking around the tip o f the probe.
12.3.6 The instrument uses these parameters at the following settings. These settings may changein order to optimize the response: 12.3.6.1 Drying gas 250-400 liters/hour 12.3.6.2 ESI nebulizing gas 10-15 liters/hour 12.3.6.3 HPLC constant flow mode flow rate 10 - 500 p.L/min 12.3.6.4 Pressure <400 bar (This parameter is not set, it is a guide to ensure the HPLC is operating correctly.)
12.3.7 Carefully guide the probe into the opening. Insert probe until it will not go any further. Connect the voltage cables to the probe.
12.3.8 Record tune parameters in the instrument log. 12.3.9 Using the cross-flow counter electrode in the ES/MS source is recommended for
the analysis o f biological matrices. 12.3.10CMbulaitctsoksnLoyanntsxttoavpretorbsfuiostantomsn,psileneetlihasept.pArEconqpsruuiiasrtieetisMotnaarCtssaoLnnydtnreoxnl dUPaSsnaEmeRlp('ltSehiGnsuUmmIaDbyeErv)a.inryPclrauemdsseostnhagellstart
samples to be analyzed.
13.0 D a t a A n a l y sis and C a lc u la tio n s 13.1 Calculations:
__________________________________________
13.1.4 Calculate matrix spike percent recoveries using the following equation:
% Recovery = Observed Result - Background Result x 100 Expected Result
13.1.5 Calculate percent difference using the following equation:
% Difference = Expected Cone. - Calculated Cone, x 100 Expected Cone.
13.1.6 Calculate actual concentration of PFOS, or other fluorochemical, in matrix (jug/ml):
(rig o f PFOS calc, from std. Curve x Dilution Factor) x 1 ug (Initial Volume of matrix (ml) + ml of Surrogate Standard) 1000 ng
Final Volume (mL)
14.0 M e t h o d P er fo r m a n c e_______________________________________________________ __________ 14.1 Method Detection Limit (MDL) and Limit of Quantitation (LOQ) are method, analyte, and
matrix specific. Please see FACT-M-3.1, Attachment A for a listing of current validated MDL and LOQ values.
Analysis of SerumFoArCFTlu-iMd -E4x.1tract Using ES/MS
Page 6 of 9
3M Environmental Laboratory
Page 175
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
14.2 M ethod Blanks and M atrix Blanks 14.2.1 Mpstoaesntsdhibaorldedbcilnoanntthkaesmcaiannldaibtmiroaanttirooinrxccbaulrarrvnyeko.svewri.llVbaeluaensalayrzeedexwpeitchteedactoh fsaalml bpeleloswettfhoerlowest
14.3 M atrix Spikes. 14.3.1 Matrix spikes are analyzed with each sample set and the percent recoveries are expected to fall within 30% o f the spiked concentration.
14.4 Continuing Calibration Checks 14.4.1 wCoitnhtienaucihngsacmalpiblerasteito.nTchheecpkesrcaernetarneacloyvzeerdieast aarme einxipmecutmedotfoaffatellrwevitehriyn 103s0a%mpolfes the spiked concentration.
14.5 Ipferafnoyrmcreidteroina tlhisetesdysitnemtheamndetshaomdppleesrfroeramnaanlyczeedseocrtioonthiesrna'tctmioents, masadinetteenrmanicneedmbayy tbhee analyst. All actions will be documented in tKe instrument runlog, the maintenance log, or on the summary sheet with the sample results.
1 5 .0 P o l l u t io n P r e v e n t io n and W a s t e M a n a g e m e n t _______________________________________
15.1 Sample extract waste and flammable solvent is disposed in high BTU containers, and glass pipette waste is disposed in broken glass containers located in the laboratory.
16.0 R e c o r d s________________________________________________________________________________________ 16.1 Sfotollroewcihnrgominafotormgraatmiosninintchluedsetuddeyitohrerprinojtehcet hfoeladdeerr. oErahcahncdhwrormittaetnogornamthemcuhsrtohmaavteogthraem:
study or project number, acquisition method, integration method, sample name, extraction date, dilution factor (if applicable), and analyst. 16.2 Plot calibration curve by linear regression and store in the study folder. 16.3 Print sample list from MassLynx and tape into the instrument runlog. 16.4 Print data integration summary from MassLynx and tape into the instrument runlog. 16.5 Copy instrument runlog pages, including instrument parameters and sample results, and store in appropriate study folder. 16.6 Summarize data using suitable software and store in the study folder. 16.7 Back up electronic data to appropriate medium. Record in study notebook the file name and location o f backup electronic data.
17.0 T a b l e s . D ia g r a m s . F l o w c h a r t s , a n d V a l id a t io n D a ta ________________________________
17.1 Attachment A: FACT-M-4.1 Data reporting spreadsheet
17.2 The validation report associated with this method is FACT-M-3.1 & 4.1-V-l.
Analysis of SerumFoArCFTlu-Mid-E4.x1tract Using ES/MS
Page 7 of 9
3M Environmental Laboratory
Page 176
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
18.0 R e f e r e n c e s _____________________________________________________________________________ 18.1 FACT-EP-3.0, "Operation and Maintenance of the Micromass Atmospheric Pressure
Ionization/Mass Spectrometer Platform Systems"
19.0 A ff e c t e d D o c u m en ts__________________________________________________________________ 19.1 FACT-M-3.1, `'Extraction of Potassium Perfluorooctanesulfonate or Other Fluorochemical
Compounds from Serum or Fluid for Analysis Using HPLC-Electrospray/Mass Spectrometry"
20.0 R e v is io n s________________________________________________________________________________
Revision Number.
*
Reason For Revision
Revision Date
1 Validation o f method to include 7flu o rochemicals addition o f whole 0 7 / 0 1 / 9 8
blood matrix, surrogate standard, new A P I/M S (M S ) systems, monkey
sera cross validation, M D L study, updates in record keeping and storing
policies, etc.
FACT-M-4.1 Analysis of Serum or Fluid Extract Using ES/MS
3M Environmental Laboratory
Page 8 of 9
Page 177
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030
laboratory Request Number-U2279
Attachment A
Laboratory Study #
Study: Test Material: Matrix/Final Solvent: Method/Revision: Analytical Equipment System Number: Instrument Software/Version: Filename: R-Squared Value: Slope: Y Intercept: Date of Extraction/Analyst: Date of Analysis/Analyst:
Group Sample# Concentration Dose ug/mL
Initial Vol. mL
Dilution Factor
Final Cone. ug/mL
Slope: Taken from linear regression equation. Group/Dose: Taken from the study folder. Sample#: Taken from the study folder. Concentration (ug/mL): Taken from the MassLynx integration summary. Initial Volume (mL): Taken from the study folder. DFiinluatlioCnoFnea.c(tuogr:/mTLa)k:enCfarlocmulattheedsbtuyddyivfiodlidnegr.the initial volume from the concentration
FACT-M-4.0 Analysis of Serum or Fluid Extract Using ES/MS
3M Environmental Laboratory
Page 9 of 9
Page 178
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Attachment D Data Summary Tables
R e p o r t N o . FACT TOX-030
la b o r a to r y R e q u e st N um be r-U 2 27 9
Report No. FACT TOX-030 Laboratory Request Number-U2279
3M Environmental Laboratory
3M Environmental Laboratory
Page D-1
Page 179
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
Table D-1a. Sample Intervals and Types by individual Animal from Study 6329-223
Amm a l ID Group 1 (Contrai)
105508M 105517M 105519M 105520M 105526M 105527M 105529F 105530F 105531F 105535F 105544F 105549F G rou p II (Low Dose)
Serum Samples Collected (Qty-- W eek)
Liv e r S a m p le s C o llected (Da te )
151 Samples
8 Samples
12-- 0, 1 .2 , 4. 6, 8 ,1 2 ,1 6 , 20. 24. 26, 27i
11-- 0, 1 ,2 ,4 , 6, 8 ,1 2 ,1 6 , 20, 24, 26
12-- 0 ,1 , 2 , 4 , 6 ,8 ,1 2 ,1 6 , 20, 24, 26, 27i
14-- 0 ,1 ,2 .4 , 6, 8,12,16, 20, 24, 26, 27, 27i, 27ii
14-- 0, 1 ,2 ,4 , 6, 8, 12, 16, 20, 24, 25, 27. 27i, 27ii
12-- 0, 1 ,2 .4 , 6, 8 .1 2, 16, 20, 24, 26, 27I
14--0, 1, 2 ,4 , 6, 8, 12,16, 20, 24, 26, 2 7 ,27i, 27ii
12-- 0 ,1 ,2 ,4 , 6 ,8 ,1 2 ,1 6 , 20, 24, 26, 27i
12-- 0, 1 ,2 ,4 , 6, 8, 12, 16. 20, 24, 26, 27II
12-- 0, 1 ,2 .4 , 6, 8 .1 2, 16, 20. 24, 26. 27ii
12--0, 1, 2, 4, 6, 8,12. 16, 20. 24. 26. 27i
14-- 0 ,1 ,2 ,4 , 6, 8 ,1 2 ,1 6 , 20, 24. 26. 27, 27I, 27il
99 Samples
2/25/99 2/25/99 2/25/99 Relumed to ooiony 3/07/00 Returned to colony 3/07/00 2/25/99 Returned to colony 3/07/00 2/25/99 2/26/99 2/26/99 2/25/99 Returned to ooiony 3/07/00 8 Samples
Recovery Subgroup Serum Samples Co llected (Qty-- W eek)
72 Samples
- : '-r '` l'f
.v
tl
' " 7" /':; ,r;
18-- 27iii, 28, 29. 30, 31, 35, 3 9 .4 3 , 47, 5 1 ,5 3 ,5 7 ,6 1 ,6 5 ,6 9 , 73,77, 79
18-- 27iil. 28, 29, 30, 31, 35, 3 9 ,4 3 , 47, 51,53,57,61,65, 69, 73,77.79
' ' , , - 1', . -
18--27iii, 28, 29, 30, 31,35. 39, 43, 47, 51,53,57,61,65, 69,73, 77,79
,
*'1 'y ' -
"* ' ' '
18--27iii, 28, 29, 30, 31, 35, 3 9 ,4 3 , 47, 5 1 ,5 3 ,5 7 ,6 1 ,6 5 , 69 ,73, 77, 79
--
''W 8 S
105514M
105515M
105516M
105521M
A O SSB ^k
1-- 0
12-- 0, 1,2, 4. 6, 8 ,1 2 ,1 5 , 20, 24, 26. 27i
12-- 0, 1, 2 ,4 , 6, 8. 12, 16, 20, 24, 26, 27li
12--0, 1 ,2 .4 , 6 ,8 , 12. 16, 20, 24, 26. 27li
12-- 0, 1 ,2 ,4 , 6 ,8 , 12, 16. 20. 24, 26, 27li
1-- 0
Baseline
assigned
2/2699
2/26/99
2/26/99
2/2699 BaseOri|ibi)IV^Not assigned
Returned to colony
' ' 1 t - .V
' : A y /iy A Returned to colony
105537F 105541F
11-- 0, 1,2 , 4, 6, 8,1 2, 16. 20, 24, 26
12-- 0, 1,2, 4,6, 8,12.16, 20, 24, 26, 27ii
1-- 0
2/25/99 2/2699
BasdiiflBflBSte assigned
'V r 1 I 'Returned to colony
105547F 105550F
1-- 0
12-- 0, 1. 2 ,4 ,6 , 8, 12, 16. 20, 24, 26, 27
12-- 0, 1 .2 , 4, 6 ,8 ,1 2 , 16, 20. 24. 26, 27
Bas&lfti(P$ft& assigned
2/2699 2/26/99
Returned to colony - , .y - "
27 Day 183 (2/23/99) 27i Day 184(2/25/99) ** Two samples 2/20/99 79 Sample on 2/23/00
27ii Day 185 (2/26/99) 79i Sample on 2/25/00
27iii Day 187 (2/28/99) 79il Sample on 2*25/00
N ote: Samples for Week 25 and Week 27 (Recovery Group) taken on same day (Day 183, 2/23/99)
3M Environmental Laboratory
3M Environmental Laboratory
Page D-2
Page 180
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
Table D-1b. Sample Intervals andTypes by Individual Animal from Study 6329-223
A n im a l ID
Serum samples Collected (Qty-- W eek)
LIVER SAMPLES COLLECTED (Da te)
recovery Subgroup Serum Samples Collected (Qty-- W eek)
Group III (Mid Dose)
105505M 105510M 105518M 105523M 105524M 10552BM 105532F 105538F 105539F 105545F 105548F 105552F Group IV (High Dosa) 105506M 105507M 105509M 105511M 10S512M 105522M 105533F 10S534F 105536F 105540F 105542F 105551F
152 Samples
14-- 0, 1,2 , 4, 6, 8 ,1 2 ,1 6 , 20, 24, 26, , 27, 27i, 27
12-- 0, 1, 2 ,4 , 6, 8, 1 2 ,1 6 , 20, 24, 26, 27
12-- 0, 1 ,2 ,4 , 6, 8, 12, 16, 2 0, 2 4, 26, 27
14-- 0, 1 ,2 , 4. 6, 8 ,1 2 ,1 6 , 2 0 ,2 4 , 2 6 ,2 7 ,2 7 1 , 27
12-- 0 ,1 ,2 .4 ,6 , 8 ,1 2 ,1 6 , 20, 24, 26, 27
12-- 0 ,1 ,2 ,4 , 6, 8 ,1 2 ,1 6 , 20. 24, 26,27
12--0 ,1 , 2 ,4 , 6, 8, 12,16, 20, 24, 26, 27i
12-- 0 ,1 , Z 4, 6 ,8 ,1 2 ,1 6 , 20, 24, 26, 27I
14-- 0, 1 .2 , 4, 6, 8, 12, 16. 20, 2 4, 2 6, 27,271, 27
12-- 0, 1,2 , 4, 6, 8 ,1 2 ,1 6 , 20, 24, 26, 27i
12-- 0, 1 ,2 ,4 , 6, 8, 12, 16, 20. 24, 26. 27i
14--0 ,1 ,2 , 4, 6, 8 ,1 2 ,1 6 , 20, 2 4, 2 6 , 27, 27i, 27ii
148 Samples
11--0 ,1 ,2 , 4 ,6 ,8 ,1 2 ,1 6 , 20. 24, "
12--0 , 1,2, 4 ,6 , 8 ,1 2 ,1 6 , 20. 24, 2 6 ,27i
9-- 0, 1 ,2 ,4 , 6 ,8 , 1 2 ,1 6 ,2 0 14-- 0 , 1, 2, 4, 6. 8, 1 2 ,1 6 , 20, 24, 26, 27, 27I, 27 12-- 0 , 1 , 2 , 4 , 6 , 8, 12, 16, 2 0 ,2 4 , 26, 27I 14--0 , 1 , 2 . 4 , 6, 8, 12, 16, 20, 24, 2 6 ,2 7 . 27i, 27 14--0 ,1 ,2 ,4 ,6 , 8 ,1 2,16, 20. 24, 26. 27, 2Ti, 27il 12--0 , 1 ,2 ,4 , 6, 8 ,1 2 , 16, 20, 24, 26.27 12--0 ,1 ,2 , 4, 6, 8, 12,16, 20.24, 2 6 ,27i 12-- 0, 1 ,2 ,4 , 6, 8, 12, 16, 20. 24. 26. 27 14--0 ,1 ,2 .4 , 6, 8 ,1 2 ,1 6 , 20. 24, 26. 27, 271,27 12-- 0, 1 ,2 ,4 , 6, 8, 12, 16, 20,24, 26,27
12 Samples
3/01/00 Biopsy
2/26/99
2/26/99
3/01/00 Biopsy
2/26/99
2/26/99
2125m 2125m
3/01/00 Biopsy
2/25/99
2/25/99
3/01/00 Biopsy
14 Samples
none
2/25/99 none
9/22/99 Biopsy, 2/25/00 2 /2 5 /9 9
9/22/99 Biopsy. 2/25/00
9/22/99 Biopsy, 2/25/00 2/26/99
2125m 2125m 9/222/91925B/0io0psy.
2/26/99
72 Sam ples
18-- 271, 28, 29, 30, 31, 35, 39, 4 3, 47. 51,53, 5 7 ,6 1 .6 5 .6 9 ,7 3 .7 7 ,7 9
18-- 271, 28, 29, 30, 3 1 .3 5 , 39, 43, 4 7, 5 1 ,5 3 ,5 7 ,6 1 ,6 5 ,6 9 , 73. 7 7,79
.
;
` ' .
18-- 27iii, 28. 29. 30, 31, 35, 39, 43, 47, 5 1,5 3 ,5 7 , 6 1 ,6 5 ,6 9 , 73, 77, 79
18-- 27ill, 28, 29, 30, 31, 35, 39, 43, 47, 51,53,57, 6 1,6 5,69 , 73, 7 7,79
80 Sam ples
' ` ' 'T
,
20-- 27III, 28. 29, 30. 31, 35. 39, 4 3. 47, 5 1 ,5 3 , 57. 61, 65, 69, 73, 77, 79, 79i, 79
20-- 27ill, 28, 29, 30, 3 1 .3 5 , 39. 43, 47, 51. 53. 57, 6 1 ,6 5 , 69. 73, 77, 79. 79i, 79
20--27iil, 2 8. 29, 30, 3 1 ,3 5 . 39. 43, 4 7, 51. 53. 57, 61. 65, 69, 73. 77, 79, 79i, 79
t -; '
-...... -
20-- 27iii, 28. 29. 30, 31.35, 39. 43, 47, 51,53. 57, 61, 65. 69. 73, 77. 79. 79i, 79
27 Day 183 (2/23/99) 27i Day 184 (2/25/99) '* Two samples 2/20/99 79 Sample on 2/23/00
27 Day 185 (2/26/99) 79i Sample on 2/25/00
27iii Day 187 (2/28/99) 79ii Sample on 2/25/00
Note: Samples for Week 26 and W eek 27 (Recovery Group) taken on same day (Day 183.2/23/99)
3M Environmental Laboratory
3M Environmental Laboratory
Page D-3
Page 181
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-03Q laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
Table D-2. Average PFOS Concentrations in Serum by Dosage Group and Week from Study FACT Tox-030 (Baseline- Day 185)
Time Point LOQfcig/mU
All PFOS values tig /m L
G roup 1M
GOrAomugpfeg1/dF
Group
O.O2VdMnofeQf
Group
OJUm2gFAtg/d
Group
Q.153mM0l(gfe!
Group
O.ISr3rvFfcefcJ
Group
0.794fnMoAc^d
Group
O.754mF0%gftt
Baseline
LOQ 0.025
Average PFOS Std Deviation
<LOQ NA
Week 1
LOQ 0.025
Average PFOS Std Deviation
<LOQ NA
Week 2
LOQ 0.025
Week 4
LOQ 0.0152
Average PFOS Std Deviation Average PFOS Std Deviation
<LOQ NA
<LOQ - 1 Anomaly NA
Week 6
LOQ 0.0152
Average PFOS Std Deviation
<LOQ NA
W eeks
LOQ 0.0152
Average PFOS Std Deviation
<LOQ -1 Anomaly NA
W eek 12
LOQ 0.0152
Average PFOS Std Deviation
0.0383 -1 Anomaly 0.00811
W eek 16
LOQ 0.0152
Week 20
LOQ 0.0152
Week 24
LOQ 0.01S2
Average PFOS Std Deviation Average PFOS Std Deviation Average PFOS Std Deviation
0.0407 0.0110 0.0400 0.0120 0.0440 0.0101
W eek 26
LOQ 0.0152
Week 27
Average PFOS Std Deviation Average PFOS
0.0459 0.0143 0.0529
LOQ 0.024a
Std Deviation
0.0145
Day 183
LOQ 0.0152
Average PFOS Std Deviation
0.117 0.0764
Day 184
LOQ 0.0152
Average PFOS Std Deviation
0.0233- 1 Anomaly NA
Day 185
Average PFOS
0.0432
LOQ 0.0152
Std Deviation
0.00928
<LOQ: Less than Ihe lower Limit of (iiantitation
<LOQ NA
<LOQ NA
<LOQ NA
<LOQ NA
<LOQ NA
0.0226 -2 Anomalies 0.00189
0.0263 -2 Anomalies 0.00362
0.0432 -2 Anomalies 0.00851 0.0504 0.0127
0.0426-1 Anomaly 0.00784 0.0506 0.0164 0.0416 0.0148 0.0533 0.0315 0.0352 0.00911 0.0546 0.0306
<LOQ NA
0.869 0.147 1.10 0.0835 3.20 0.577 3.61 0.430 4.73 0.432 6.69 0.578 11.2 2.44 12.3 1.40 14.5 3.06 15.8 1.41 15.9 5.54
-- -- -- -- -- --
<LOQ NA
0.947 0.110 1.10 0.0963 3.40 0.291 3.71 0.417 4.76 0.577 6.31 0.717 10.5 1.90 19.5 14.5 13.0 0.675 13.2 1.42 11.1 1.52
-- -- -- -- -- --
<LOQ NA 4.60
0.782 5.81 0.933 17.8 1.68 20.4 1.65 26.0 3.30 35.2 5.39 56.2 5.84 63.7 6.71 65.9 6.88 82.6 25.2 68.1 5.75 85.0 14.9 69.7 4.68 77.9 10.7
<LOQ NA 3.71
0.455 5.39 0.930 16.5 1.87 18.8 2.15 24.0 3.06 27.8 3.98 42.1 4.04 58.1 14.7 60.4 7.24 66.8 10.8 58.5 4.67 81.7 35.1 78.0 1Z0 84.3 23.3
<LOQ NA 21.0 1.57 26.9 3.54 95.3 70.4 94.5 8.07 109 18.3 122 23.9 189 15.9 144 10.9 215 24.9 173 36.5 194 8.93 249 46.8 259 110 294 22.0
<LOQ NA 20.4 2.71 22.0 3.25 92.7 39.6 90.1 7.11 107 11.8 117 11.7 162 19.3 156 21.8 174 20.9 171 22.2 160 23.9 230 40.3 245 29.2 321 170
3M Environmental Laboratory
3M Environmental Laboratory
Page D-4
Page 182
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
Tabla D-3. Average PFOS Concentrations in Serum by Dosage Group and Week from Study FACT TOX-030 (Recovery Group)
Time Point LOQ (pg/mL)
Day 187 LOQ 0.0152
Week 28 LOQ 0.0152
Week 29 LOQ0j0152
Week 30 LOQ 0.0152
Week 31 LOQ 0.0152
Week 35 LOQ 0.00655
Week 39 LOQ 0.00555
Week 43 LOQ 0.00555
Week 47 LOQ 0.00655
Week 51 LOQ 0.00555
Week 53 LOQ 0.00555
Week 57 LOQ 0.00655
Week 61 LOQ 0.00555
Week 65 LOQ 0.00555
Week 69 LOQ 0.00565
Week 73 LOQ 0.00556
Week 77 LOQ 0.00556
Week 79 LOQ 0.00555
AJI PFOS values ng/mL
Average PFOS (mw -) Std Deviation Average PFOS (mow .) Std Dviation Average PFOS (paw.) Std Deviation Average PFOS (mow .) Std Deviation Average PFOS (mow .) Std Deviation
Average PFOS (mow.) Std Deviation Average PFOS (mow.) Std Deviation Average PFOS (mow. i Std Deviation Average PFOS (mow.) Std Deviation Average PFOS (mow.) Std Deviation Average PFOS (mow.) Std Deviation
Average PFOS (mow .) Std Deviation Average PFOS (mow.) Std Deviation Average PFOS (mow .) Std Deviation Average PFOS (mow .) Std Deviation Average PFOS (mow.) Std Deviation Average PFOS (mow .) Std Deviation
Average PFOS (mow .) Std Deviation
Group 1M
Group 1F
0.0mg/kg/day
0.0300 -1 Anomaly NA
0.0371 0.0124
0.0457 0.0118 0.0430 0.00821
0.0665 0.00362
0.0742 0.000664
0.0313 0.000165
0.0303 0.000485
0.0358 0.000567
0.0368 0.0121
0.0459 0.00303
0.0723 0.00352
0.0391 0.0106
0.0509 0.000779
0.0319 0.00440
0.0368 0.0000923
0.0355 0.00221 0.0237 0.00333 0.0331 0.0086
0.0459 0.00323 0.0341 0.000403 0.0397 0.00311
0.0327 0.00526
0.0445 0.00385
0.0351 0.00449
0.0448 0.00210
0.0210 0.00365
0.0360 0.000522
0.0406 0.00313
0.0400 0.00301
0.0350 0.0115
0.0365 0.00284
0.0296 0.00535
0.0305 0.00167
0.0215 0.00296
0.0243 0.00355
Group 3M Group 3F
0.15m g/kg/day
79.1 4.67
39.5 41.4
84.6 1.51
86.1 3.59
75.8 2.18
69.9 11.4
65.2 4.60
62.0 10.6
56.6 4.77
79.6 43.8
84.5 12.0
74.4 9.53
60.1 3.16
51.7 7.29
45.7 1.12
58.1 0.249
48.3 3.69
42.6 6.70
37.9 2.62
35.1 13.2
46.2 3.30
36.7 6.24
30.2 2.36
32.3 1.34
31.6 5.98
38.2 0.283
32.9 0.0269
37.6 2.32
26.4 2.59
34.5 3.46
27.3 4.66
25.8 2.91
22.5 0.632
23.0 6.37
19.1 0.805
21.4 2.01
Group 4M Group 4F 0.75mg/kg/day
267 42.0 249 21.7
258 15.2 236 18.3
223 66.9
194 19.0
143 38.0
162 7.87
161 185 46.1 21.9
181 19.5
171 10.1
146 161 16.1 11.1
78.8 16.8
159 28.4
124 25.9 94.7 38.4
98.3 8.32 91.4 6.07
80.8 36.8
98.2 0.490
78.0 16.3
106 3.84
100 50.3
109 0.697
91.5 55.2
82.8 9.68
84.0 52.4
75.0 5.25
54.4 27.3
147 131
60.0 38.3
57.0 19.1
41.1 25.9
41.4 1.15
3M Environmental Laboratory
3M Environmental Laboratory
Page D-5
Page 183
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 Laboratory Request Number-U2279
Table D-4a. PFOS Amounts Reported in Serum by Individual Animal (Baseline-Week 26)
PFOS Re p o r te d
WEEK0 (pO*ti)
W eek 1 (petti)
W eek 2 (uflimL)
Week 4 Inoriti)
Weeks Ui0frnL)
W eek 8 (ligAnL)
W eek 12 (moAiL)
W eek 16 (p e ri)
Group 1(Conta*>
105508M
<LOQ
105517M
<O Q
105619M
<O Q
105520M
<LOQ
105528M
<LOQ
105S27M
*<LOQ
105S29F
<LOQ
105530F
<LOQ
105531F
*<LOQ
<OQ <LOQ <LOQ <LOQ <00 <OQ <LOQ <-OQ <_OQ
<LOQ <LOQ <O Q <O Q <LOQ < 0 0 <O Q <O Q <LOQ
105535F 105544F 105549F
<LOQ <LOQ <-OQ
<OQ <O Q <LOQ
<OQ <LOQ K lC
Group 1 (Low Do m )
105513M 105514M 105515M 105516M 105521M
<O Q <O Q <O Q <LOQ <LOQ
0.783 0.767 0.632
109
1.02 1.03 1.19 1.13
105525M 105537F 105541F 105543F 105546F 105547F 10S550F
<LOQ <LOQ <LOQ <LOQ <LOQ <O Q <O Q
1.10 0929
0931 0.832
1.19 1.16
1 06 0.980
Group M fM klD oM )
105505M 105510M 105518M 105623M 105524M 105528M 105532F 105536F 105539F 105545F 105546F 105552F
<LOQ <L0Q <LOQ <LOQ <LOQ <O Q <LOQ <LOQ <OQ <O Q <LOQ <t_OQ
4.60 4.19 5.46 354 425 5.52 4.31 4.12 3.31 *3.60 3.72 3.12
6.07 4.82 7 01 456 624 6.15 461 6.67 4 65 5 28 6.42 4.73
Group (V (High Do m )
105506M 105507M 105509M 105511M 105512M 105522M 105533F 105534F 105536F 105540F 105542F
^LOQ <LOQ <OQ <OQ <LOQ <LOQ <LOQ *<O Q *<O Q <O Q <LOQ
21 3 220 18.8 19.3 22.8 21.6 226 18.1 21.0 16.8 24 0
299 25.1 23.9 22.6 31.3 288 249 26.0 *23.5 19.5 199
105551F
<OQ
20.1
18.2
indicates a sam ple w ith an extraction volume of <0 5 m l Shaded ceUs=moribund
<OQ <LOQ <O Q <LOQ <LOQ <O Q < 0Q < 0Q <LOQ <LOQ <LOQ <O Q
2.87 2.75 3.13 4.03
3.73 3.07
3.55 3.27
17.0 17.2 20.2 176 15.4 19.2 16.6 18.7 14.3 18.7 15.7 14.9
236 72.6 54.8 48.4 77.4 822 141 145 64.1 67.2 78.4 60.2
<O Q < .0 0 <O Q <OQ <LOQ <O Q *<O Q *<O Q <tOQ <O Q <O Q <O Q
3.67 3.31 3.26 4.19
4.28 3.66
3.85 3.27
21.0 22.5 20.1 18.6 21.8 18.5 18.4 18.9 1B.4 22.7 18.4 16.1
91.0 828 923 93.7 105 102 90.0 83.3 89.8 90.8 102 820
<OQ <OQ <OQ <LOQ <LOQ 0.0385 0.0214 0.0244 0.0206 <OQ <OQ 0.0240
4.61 4.17 5.05 5.10
5.28 4.85
4.98 3.94
27.9 221 25.1 24.5 31.6 246 27.6 24.3 26.5 245 22.3 19.1
125 86.1 103 923 118 131 110 121 102 105 116 87.3
0.0381 0.0430 0.0438 <LOQ 0.0244 0.0423 <LOQ 0.0243 0.0254 <OQ 0.0238 0.0316
620 648 6.55 7 52
6.81 5.57
7.03 5.83
40.1 392 337 35.3 37.8 25.4 258 32.8 278 32.2 23.2 24.8
116 106 123 994 167 121 126 114 98.0 112 131 117
00344 0.0408 00423 00332 0.0320 0,0615 0.0438 0.0515 0.0314 <O Q <100 0.0462
10.4 9.47 10.1 14.8
11.1 .123
107 7.85
59.4 529 60.7 522 63.4 48 4 40.4 37 3 46.3 43.1 47 0 38.7
182 172 197 179 216 185 164 157 184 173 168 127
W eek 20 (petti)
0.0348 0.0419 0.0336 0 0300 0.0369 0.0631 0.0617 0 0579 0.0493 0.0263 0.0505 0.0570
12.5 10 7 11.9 14.1
11.0 11.5
14.3 41.1
` 62 3 633 63.1 75.2 64.0 542 09.2 47.4 78.2 45.7 65.3 427
158 138 152 126 143 145 169 143 148 193 151 132
W eek 24 (petti)
0.0449 0 0486 0.0414 0.0283 0.0397 0 0613 0.0498 0 0497 0.0364 LOQ 0.0325 00446
14.7 10.9 14.1 184
13.4 13.7
127 122
77.4 65.2 58.8 597 69 6 648 63.1 486 69.9 63.5 56.1 61.7
198 186 -- 207 247 233 190 200 169 151 181 150
W eek 26 (pO/mL)
0 0496 0.0539 0.0417 0.0254 0.0376 0.0669 0.0613 0.0736 00431 00266 0.0433 00556
16.2 165 138 169
13.5 .148
130 11.4
92.9 129 69 5 72.1 69.5 624 634 590 72 2 85 7 645 556
-- 182
-- 142 148 221 203 187 155 177 165 142
3M Environmental Laboratory
3M Environmental Laboratory
Page D-6
Page 184
3m Medical Department c - u d y : T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
Table D-4b. PFOS Amounts Reported in Serum by Individual Animal (Days 183-Day 185 and Week 27)
PFOS Repo r ted
Da y 1S3 (ngiA)
Day 184 (ppM.)
Day 185 (kigftnL)
WEEK 27
bi&mL)
Group UCofrtroO
105506M
--
@
--
105517M
--
--
--
105519M 105520M 105528M 105527M 10S529F 105530F 105531F 105535F 105544F 105549F
-- 0.171 -0.0626
-- 0.0756
-- -- -- -- 0.0310
&
<LOQ 0.0233
@ 0.0416
@ -- -- @ 0.0287
-- 0.0366 0.0498
-- 0.0763
--
@
@ -- 0.0330
Group 1 (Low Do m )
105514M
--
--
105515M
--
--
@
105516M
--
_
@
105521M
--
--
@
105537F
--
--
--
105541F
--
--
@
105547F
--
--
@
105550F
--
--
@
Group III (Mid OoM)
105505M
74,4
66.4
70.3
105510M
--
--
105518M
--
--
@
105523M
95.5
73.0
854
105524M 105528M 105532F 105538F 105539F 105545F 10S548F 105552F
-- -- -- -- 107 -- -- 56.9
-- -- @ @ 865
@
@
69.5
@ @ -- -- 101 -- -- 678
Group IV (High Do m )
10550eM
--
--
--
105507M
--
--
10S509M
--
--
--
105511M
216
181
309
105512M 105522M 105533F
-- 282 258
@-- 336 278 265 441
105534F
--
--
105536F
--
@
--
105540F
--
--
105542F
201
224 201
105551F
@
Sample colection date for Week 27 data * Sample colectad on 2/20/99 incicates a sample with an traction volume of <0.5 mL
0.0461 --
0.0430 -- -
00695 --
0.0635 00374 0.0318 0.0338
-
23.9 13.0 114 15.5 -- 126 953 11.2
-- 68.5 68.7 -- 60.6 74.7 54.3 565
58.0 65.1 -
196' 184 -- -- 202 --
182 169 164 126
3M Environmental Laboratory
Page D-7
3M Environmental Laboratory
Page 185
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
Table D-5a. PFOS Amounts Reported In Serum by Recovery Group Animal (Day 187- Week 47)
PFOS
Re p o r t e d
D(a1y0/m18D7
Week 28
tup'll*.)
Week 29
(pO/mL)
W(EusEAKnL3)0
W(nefel4knL3|1
W eek 35 WEEK 39
MOW.
(pptmL)
WEEK 43
(uplrt.)
Week 47
Group l(C o n tno*)
105520M
<LOQ
105528M
0.0300
0.0284 -0 0459
0.0890 0.0639
105529F 105549F
0.0373 0.0541
0 0488 0.0372
0.0738 0.0747
Group I I (MM Po m )
105505M
824
105523M
75.8
105539F
10.2
105552F
88.8
Group IV (HIglIi Do m )
85.7 83.5 88.7 83.6
773 *742 77.9 61.9
105511M 105522M 105533F 105542F
237 297 269 248
233 264 249 223
175 270 207 180
Indica tes a sam ple w ith an extraction volum e o f <0.5 mL
0.0314 0.0312 0.0299 0.0306
68.4 61.9 69.9 54.5
116 170 156 167
00362 0.0354 0.0282 0.0453
60.0 53.2 111 48.6
129 194 201 170
0.0437 0.0480 0.0746 0.0698
93.0 76.1 81.2 67.7
167 195 164 178
0.0316 0.0466 0.0503 0.0514
62.4 57.9 56.8 46.5
135 158 169 154
0.0287 0.0350 0.0368 0.0367
465 449 58.3 58.0
669 90.7 179 139
0.0339 0.0370 0.0481 0.0436
50.9 45.7 47.4 37.9
105 142 104
92
Table D-5b. PFOS Amounts Reported in Serum by Recovery Group Animal (Week 5 1 - Week 79)
PFOS Re p o r t e d
WEEK 51
(jifl/mL)
WEEK 53
(UP*"*-)
WEEK 57
(ligAnD
WEEK 61
luptmL)
WEEK 65
{jiftnL)
WEEK 69
tupmL)
WEEK 73
(UPTnL)
WEEK 77
(uptruL)
WEEK 79
(upmL)
G roup 1(ContrOl)
105520M
0.0213
105526M 105529F
0.0261 0.0344
105549F
0.0338
G roup III (Mid Do m )
105505M
39.8
105523M
36.0
10553SF
44.5
105552F
25.8
G roup IV (Hlgl Do m )
0 0269 0.0392 0.0375 0.0419
43.9 485 41.1 32.3
0.0289 0.0364 0.0472 0.0418
28.5 31.8 33.3 31.4
00319 0.0382 0.0433 0.046
27.4 35.9 38.0 38.4
0.0184 0.0236 0.0364 0.0357
32.9 329 39.3 36.0
0.0428 0.0383 0.0421 0.0379
0.0431 0.0269 0.0386 0.0345
24.6 28.3 36.9 32.0
240 30 6 27 9 23.7
0.0334 0.0259 0.0317 0.0294
22.1 23.0 27 5 18.5
0.0194 0.0236 00268 0.0218
197 185 228 19.9
105511M 105522M 105533F 105542F
67.5 122 87.1 95.7
548 107 986 97 9
66.5 B9.5 103 109
84.7 136 106 109
52.5 131 89.7 76.0
47.0 121 787 71 3
35.1 73.8 54.5 240
329 87.0 70.5 434
228 564 406 422
In d ica te s a sam ple w ith an extraction volum e of <0.5 m L
Table D-6. LOQ Values Used In Analyses by Method and Usage Dates
Methoo
Effective Date
LOQ
Usage Dates
Sera
FACT-M-4.1 ETS-8-5.0 ETS-6-5.1
Liver
FACT-M-2.0 FACT-M-Z1
ETS-8-7.0
10/10/98 3/01/99 4/26/99
5/26/S8 6/03/99 7/22/99
ng/m L
4.39 15.2 5.55
ng/g
30.0 37.4 26.9
1/25/9910 2/22/99 3/05/99(0 4/17/99 5/17/99 through the end of study
1/25/99 to 5/22/99 6/03/99 to 6/14/99 7/29/99 through the end of study
3M Environmental Laboratory
Page D-8
3M Environmental Laboratory
Page 186
3m Medical Department. Study: T-6295.7
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-112279
Tabla D-7. PFOS Concentration* In Uver by Dosage Group
DOSAGE Group
COLLECTION Da t e
PFOS C a l c u l a t e d Co n c e n t r a t io n (now
Amount or PFOS a*)
Group 1(Control)
105508M
2/25/99
2 Anomalies
105517M
2/25/99
143-1 Anomaly
105519M
2/25/99
91
10552OM
--
105S26M 105527M 105529F 10S530F 105531F 105535F 105544F 105549F
N d fS tir -
2/25/99
222N11122o2566mmmmfer 2125m
.y-:- .
' Nones.. : , ilniMawilirrj.g..y .
129 --
128
112 87
97 _
Group II (Low Dose)
105514M 105515M 105516M 105521M 10S537F 105541F 105547F 105550F
222111222666mmm 22222111112222265666mmmmm
18237 22709 11417 16734 22818 24847 20102 20735
2 Anomalies 0.143 0.091 ----- 0.129 -- 0.128 0.112 0.087 0.097
--* .
18.2 22.7 11.4 16.7 22.8 24.8 20.1 20.7
Group III (Mid Dose)
105505M 105510M 105518M 105523M 105524M 105528M 105532F 105538F 105539F 105545F 105548F 105552F
3/01/00 Biopsy 2/26/99 2/26/99
3/012/01026Bmiopsy 22112265mm
2/25/99
3/0122/01102255Bmmiopsy
3/01/00 Biopsy
8252 42169 86173 10203 58673 48203 80421 49590 24728 66532 81376 17690
8.25 42.2 86 ' ' 10.2 58.7 48.2 80.4 49.6 24.7 66.5 81.4 17.7
Group IV (High Dose)
105506M 105507M
M2M12f5llmilWft; "at t;;--.;
--
412474
105509M
r 5N 5S p r--7
105511M 105512M
9/22/99 Biopsy
2125m 2125m
142465 23480 378723
105522M
9/222/91925Bmiopsy
137561 70781
105533F
9/222/91925Bmiopsy
175283 42668
105534F 105536F
22/12265/9m9
280575 256669
105540F
2/26/99
267328
105542F 105551F
9/222/91295Bmiopsy 2125m
421647 57895 287223
--
412
--
142
23.5 379 138 70.8 175 42.7 281 257 267 422 57.9 287
<LOQ: Less Sian the Lower Limit of Quantitation (26.9-37.4 ng/g)
3M Environmental Laboratory
3M Environmental laboratory
Page D-9
Page 187
3m Medical Department Study: T - 6 2 9 5 . 7
3M Medical Department Study: T-6295.7
Attachment E Data S preadsheets
Report No. FACT TOX-030 laboratory Request Number-U227S
Report No. FACT TOX-030 Laboratory Request Number-U2279
3M Environmental Laboratory
3M Environmental Laboratory
Page E-1
Page 188
3m Medical Department study: T-62 3& c ?TOX-30
Report No. FACT TOX-03 0
Covance#6329-223 laboratory Request Number-U2279
Study 26 Week Capsule Toxicity Study with PFOS in Cynomolgus Monkeys
Product Number(Tet Substance):
T-6295 (PFOS)
Matrix Monkey Sera
Method/Revnion:
FACT-M-3,1 & FACT-M-4.1
Analytical Equipment System Number
Soup 020199
Instrument Software/Vernon:
MassLynx 3 1
Filename:
See Attachments
R-Squarad Value
See Attachments
Slope See Attachments
Y-Irrtercept
See Attachments
Date of Extraction/Analyst
02/09/99 RWW
Date of Analysis/Analyst
02/13/99 MEE
DSaatme opfleDaDtaaRtaeduction/Analyst
02/16/99 KJH
BASELINE MONKEY SERA
Group Doee
Sauapls #
PFOS Cone
Coaeaa(ration of PFOS
Meaa PFOS
RSD Std. Dev.
ag/osL ng/mL or % Ree ug/mL MS/MSDRPD
Method Blk
RBS02099-H20 Blk-1 RBS02099-H20 BIk-2
000 000
<LOQ <LOQ
<LOQ
NA
Matrix Blk
RBS02099-Sera Blk-1
0.00
<LOQ
RBS02099-Sera Blk-2
0.00
<LOQ <LOQ NA
QC *250 ppb
MMKKSS0022009999-M-MSSD
299 285
121 % 115%
118%
5%
Group 1
I05508M+
1.28
<LOQ
Control
105517M+
1.32
<L0Q
0.0 mg/kg/day
105519M+
3 16
<LOQ
I05520M+ l 46 <LOQ
I05526M+ KJ5527M+ I05529F+
1.62 1 48 2.28
<LOQ <<LLOOQQ <!.OQ NA
I05530F+ 113 <LOQ
10553IF - 1.73 <LOQ
I05535F- 1 46 <LOQ
I05544F l 60 <LOQ
I05549F 5.42 <LOQ <LOQ NA
Group 2
105513M+
2.63
<LOQ
Low-Dose
1055MM 1.59 <LOQ
0.03 mg/kg/day
110055551156MM+
0.540 265
<<LLOOQQ
105521M+ 1.72 <L0Q
105525M* 1.90 <LOQ <LOQ <LOQ
I05537F+ 1.33 <LOQ
105541F- 2.23 <LOQ
I05543F+ 2.53 cLOQ
I05546F-*- 2 50 <LOQ
05547F+ 1 69 <LOQ
I05550F- 1.50 <LOQ <LOQ <LOQ
Groap 3
I05505M 3 13 <LOQ
Mid-Dose
105510M+
1.04
<LOQ
0.15 mg/Vg/day
105518M+
1.51
<LOQ
I05523M+
0.930
<LOQ
I05524M+ II0055552382MF++
1 82 2.69 3 13
<<LLOOQQ cLOQ
<LOQ <L00
I05538F 2 25 <LOQ
I05539F 2 15 <LOQ
I05545F+ 3 27 cLOQ
I05548F 360 <LOQ
I05552F+ 2.02 cLOQ <LOQ <LOQ
Groap 4
I05506M+ 2.19 <LOQ
High-Dose
I05507M 2.79 <LOQ
0 75 mg/kg/day I05509M 2.06 <LOQ
I05511M 269 <LOQ
I05512M+
264
<LOQ
105522M+
2.73
<LOQ <LOQ <LOQ
I05533F+ 2.02 <LOQ
I05534F+ 2.54 <LOQ
I05536F+ 2.85 <L0Q
I05540F+ I05S42F+
3 45 1.94
<<LLOCQQ
I05551F 3.52 <LOQ <LOQ <LOQ
Limit of Quantitation (LOQ); 4.39 ng/mL
Date Enterad/By 02/17/99 LAC
Date Verified/ By: 03/23/99 OML, 06/07/00 PW
Date punty corrected/verified 09/12/00 rrvnh, 09/12/00 LAC
NA - Not applicable
+ Serum initial volume less than 0.50 mL, concentration* should be considered tentative 04/28/00 LAC
PFOS " Pcrfluorooctaneaulfonate
Extraction Volume Ratio * Initial Volume-Final Volume
FACT-M-4 l Excel 97
3M Environmental Laboratory
tox-030-sera223- l C
9/ 12/00
Page 189
3m Medical Department Study: T -6 2 % ^ c Y T O X - 0 3 0
Report No. FACT TOX-030
Covance#6329-223 laboratory Request Number-U2279
Study; 26 Week Capsule ToxicityStudy with PFC-S in Cynomolgus Monkeyi
Product Number(7est Substance)
T-6295 (PFOS)
Matrix Monkey Sera
MAneathlyotdic/R!eEvuqiuoinp:ment System Number
FMAaCdTe-liMne-30411S0l9F8A&CTA-mMe-l4ia 1062498
Instrument Software/Venion:
MaisLynx 3 1
Filename
See Attachments
R-Squared Value.
See Attachments
Slope: See Attachments
Y-Intercept:
See Attachments
Date ofExtraction/Analyst:
02/05/99 SAH
Date of AnaJysia/AnaJyst: Date of Data ReducUon/Analyst:
02/08/9, 02/10/99, 02/12/99, 02'1 */99 HOJ/DRB 02/10/99, 02/16/99. 02/2d'99 HOJ/DRB
Sample Data
WEEK 1 MONKEY SERA
Groep
Sample #
PFOS
Coflceutratioa
Meas
RSD
Dose
Cose
of PFOS
PFOS Std. Dev.
af/naL ug/mL or % Ree
MS/MSD RPD
Method Blk
RBS02059-H20 Blk-l RBS02059-H20 Blk-2
0.00 0.00
<LOQ <LOQ <LOQ NA
Matnx Blk
RBS02059-Sera Blk-l RBS02059-Sera Blk-2
0.00 000
<<L1OOQQ <LOQ NA
QC - 250 ppb
MMXKSS0022005599-M-MSSD
305 304
112233%% 123Y oy.
Groep 1
I05508M
0.00
<LOQ
Control 0.0 mg/kg/day
105517M+ 105519M I05520M
000 0.00 . 0.00
<<LLOOQQ <LOQ
I05526M
0.00
<LOQ
I05527M
000
^LOQ <LOQ NA
I05529F
ooo
<LOQ
I05530F
0.00
<LOQ
I05531F
0.00
<l o q
I05535F
o.oo
<LOQ
I05544FI05549F
00..0000
'[.OQ <LOO
<LOQ NA
Group 2
105514M
495
0 ~93
Low-Doae
105515M+
383
0 ~6`
0 03 mg/kg/day
105516M 105521M
519 677
0 832 16.9 1 09 0 869 0 147
105537F
684
10
105541F+
464
C929
I05547F
581
093!
1] 6
I05550F
519
0 832 0 947 0.110
Group 3
I05505M
287
4 60
Mid-Dose 0 15 mg/kg'day
I05510M* 105518M
209 342
-5A4189
105523M
221
3.5-1
IC5524M
318
1 25
17 0
105528 M I05532F*
413 161
5 4
35l:
4 60 0 782
I05538F
257
4 !:
I05539F
248
3 3!
I05545F+
184
3 69
II0055554582FF
213952
33 712: 3 71 0124.535
Group 4
I05506M
665
2l 3
High*Dose
I05507M*
411
21.0
0 75 mg/kg/day
105509M*
351
18 8
105511M*
482
19 3
10551 2M
711
22 8
7 49
I05522M*
539
21 6 21 0 I 57
I05533F+
564
22 6
I05534F*
451
18 1
I05536F*
393
21 0
I05540F-
419
6.8
I05542F
749
24 0
133
10555 IF*
377
20 ! 20 4 2 71
Limit of Quantitation (LOQ): 4 39 ng/mL
Dete Entered/By 02/10/99, 03/02;99 LAC
Date VenBed/ By 03/23/99 GML.
Date punty correcled/vurified: 09/12/00 mmh. 09' 12/00 LAC
NA " Not applicable
* Serum ffutial volume lets than 0 50 ml., concentrations should be considered tentative 0
PFCS " PerCuorooctanerulfemale
Extraction Volume Ratio = Initial Yolume/Finai Volume
FACT-M-4 1 Excel 9 '
3M Environmental Laboratory
tox-030-seru223-l C
9/1 2/00
Page 190
3m Medical Deartment Study T-62^cf TOX-030
Report No. FACT TOX-030
Cov.nce#6329-223 laboratory Request Number-U2279
Study 26 Week Capsule Toxicity Study with PFOS ui CMtomolgus Monkey
Product Number(Teit Subitanee):
T-6295 (PFOS)
Matrix Monkey Sera
AMIFninlseeattrnhluyaomtmdic/eeaRnlteEvSuqoiufoitpnwm.aeren/tVSeyrantoenm' Number'
MMSFeAaaedCsiAeTLlti-ytnManecx-h03m4311e10nA9ts8FAACATm-Meb-4a.1062498
R-Squared Value
See Attachments
Slope See Attachments
DYa-ltneteorfcEepxtt.racbon/Analyst
0S2e/e0A9/t9ta9chJmCePnts
Date of Analyau/Analyst:
02/15/99. 02/22/99 HOJ
Dare of Data Reduction/Analyw.
02/19/99, 02/25/99 HOJ
Sample Data
WEEK 2 MONKEY SERA
Graap
Sample
PFOS
Cancantradan
M taa
RSD
Dow
Cone.
af PFOS
PFOS Std. Dev.
ng/mL
g/nsL ar % Ree
ug/eaL
MS/MSD RPD
Method BQc Matnx BQc QC - 250 ppb
RRRBSBBSS000222000999999---SHHe22r00a BBBfUllkcc---121 RBM30K2039092-0S9e9r-aMBSlk-2
M1CS02099-MSD
00..0000 000000 293 300
<LOQ <<LLOOQQ <1L18OVQ. 121%
<LOQ NA <LOQ NA 120% 2V.
Graap 1
105508M
4 09
<LOQ
Control
J05517M
3 07
<LOQ
0 0 mgkg/day
I05519M* II00555S2206MM*
4 53 2 08 2.02
<LOQ <LOQ <LOQ
105527M*
1.89
<LOQ <LOO NA
I05529F-*
0.520
<LOQ
I100555533CIFF** I05535F 105344F* I05549F*
311..190202 0 380 0810
<<LLOOQQ
<LOQ
<LOQ <LOQ
<LOQ NA
LGowro-uDpos2e
105514M* 105515M*
557153
102 103
0.03 mg/kg/day
I05516M-
492
1.19
7 63
05521M*
425
1 13 I 10 0 0835
105537F+ 105541F 105547F* I05350F+
472426 527 550
1 19
1.16 01.90860
8 79 I 10 0.0963
Grasp 3
I05505M-
227
6.07
0 1M5 midg-D/kogs/eday
I10055551180MM*
301 350
47 0812
I05523M
285
4 56
I05524M-
195
6 24
16 1
I05528M
384
6 15 5 81 0 933
[05532F*
173
4 61
105538F
416
6 67
I05539F*
232
4 65
I05545F
329
5.28
II0055554582FF*
322950
64.7432 5 39 0197.320
Graup 4
I05506M*
747
29 9
High-Dose
1O5507M*
626
25.1
0 25 mg/Vg/day
105509M
746
23.9
1055UM
706
22.6
105512M
976
31.3
13 1
05522M
899
28.8 26 9 3 54
105533F
778
24.9
I03534F*
650
26.0
105536F*
588
23.5
105540F* 105542F* 10555 IF
546 372 568
19 5 199 14 8 18.2 22 0 3.25
Limit of Quanbtabon (LOQ): 4.39 ng/mL
Date Enlered/By 02/22/99. 03/02/99 LAC
Date Verified/ By 03/23/99 GML
Date purity correeted/venfied 09/12/00 mmh, 09//12/00 LAC
NA Not applicable
* Serum uutial volume leu than 0 50 mL. concentrations should be considered tentative 04/28/00 LAC
PFCS * Perfluorooctanasulfonate
Extraction Volume Ratio " Irubal Volwne/Final Volume
FACT-M-4 1 Excel 97
3M Environmental Laboratory
tox-030-KTa223-lC
9/ 12/00
Page 191
3m Medical Department Study T - 6 2
TOX-030
Report N o . FACT TOX-030
Covance# 6329-223 laboratory Request Number-U2279
SPtruoddyuct NumbcrfTest Subitanee) AMIFMRnin-lsaeSeatttnrrlhqiuyaoxutmmdiacie/eaeR:nldetEvVSqiosauiflaiutpwnem:areen/tVSerysrioonn Number
SDWYDDSlaaa-aoItttEpmneeeetEeoo:oprfffKlceADEepxanD4ttt.arataayMcRtntaeisoOd/nAuN/cAntiaKnolaynEl/iyAtY:stn:aSlyEstR: A
26 Week Capsule Towaty Study with PFOS tn Cynomolgus Monkeys TMEMSSMeeT-ao6eae5dns2A-Aeik98Lltet5-itytn4ya(anePcc0SxhhF0eammO43nn1eeSd0lnn)9aEtt8ssnT,dSA-3m82-e5li0a 062498, A Soup 020199 0"0SS333ee//ee/000A82AV//tt999tt9aa99cc,,S0hh03Amm1//H2ee06nn/8R/tt/9ss9W99.W0KVJH25/D/9R9BHOJ/MEE/DRB
CDrawtrep
Staplea
PFOS aCa/mneL
aCg/amamLfaPwaFrnO%aSfloRaac
Mtu PKFlOmSL
M39/MtAR9SDDOevR.PD
Method Blk Matrix B0t Matnx Blk QC - 250 ppb
Groop1
0 0Cmogn/Vtr^o/lday
20.0L3Comwng-aD/pkogs/deay
MCirda-aDpos3e 0 15 mg'kg'day
407H3Cigmnhg*a/Dpkgos/deay
RBS03029-H20 Blk-1 MMRRR8BBKKSSSSS0000033333000002222299999-*---HSSSSee2eenn0nn BBQBBlIOllkkkkc-----12122 MMKKSS0033002299--SSeerna BBlIkk--43 MMMMJKCK)SCS1II1SI110II00S10100000000035500505535535530555553055555550251521220342302239497097259908694-MMMI-M9FFFFMMMMF-F-****M****MSSSDDS----2112
I055MM* 11I1I1I00000005555535555555552431140117567FMFFMMF++** I1IIIIIQ00I0000055555555555555552110322388053428MMMMMMFF+*-** 1I1100005555555544355892FFFF**** I1III1III000000Q0555355555555555251OI00333212793466MMMMMMFFF***+***** 1IIQ0055555354420IFFF***
00..0000
ox
o7721x17 762326 253 250 242 235 657463 791 667131 619683 611 98.1179
989746
108 111109871662 153 212613 63 7 646 101 no 9965.37 41 4 347185617873 55 9 118 222324970782023 335632 24 0 289384 150
<LOQ <<LLOOQQ <<<<LLLLOOOOOQQQ <119L00821O%%%0 <<<<<<<9LLLLLLL5OOOOOOO%QQQQQQQ
8
V
<LOQ NA <LOQ NA
<LOQ NA
101% !%
96% 3%
NA
<<<<LLLLOOOoQQQq <LOQ
<LOQ NA
2 87
2343..07173335 3 20 0I.S571?
3.07
33.5257 3.40 0825931
1177..20
211057..624 9 47 19 2 1 7 168
16.6
187
111485377 14.9
165 111874
475228436486
774 738
861M244..1S12 95.3 70 4
6778.42 60.2
42 7 927 39 6
Land ofQuantuaoon (LOQ): PFOS 13 2 ng/mL Date punty DcDoaratreteecVtEeendrti/efvireeenddf//iBeBdyy*: 000393///]20128///099099,m0GVmM2hU6,/0999/1L2A/0C0 LAC
NA - Not applicable
* Scrum initial volume less than 0.50 mL, concentrations should be considered tentative 04>?8/00 LAC
PFCS = Perfluorooctanesulfonate
Extraction Volume Ratio - Initial Vohime/Final Volume
EExTcSe-l89-5" 0
3M Environmer tal Laboratory
tox-030-ser223-lC
9/ 12/00
Page 192
3m Medical Department Study T -62 TOX-030
Report No. FACT TOX-C30
Covance#6329-223 laboratory Request Number-U2279
Study. 26 Week Capsule Toxicity Study with PFOS in Cynomolgus Monkeys
Product NumberfTen Subtlance):
T-6295 (PFOS)
Matnx: MAInnseattrhluyomtdic/eRanletEvSmqoufoitnpwmareen/tVSeyrssitoemn Number: FRi-lSenqaumaree:d Value: SYl-oIpnetercept Date of Extraction/Analyst-
DDSaaattmee oopffleADDnataaatyRtuaead/Aucntaiolyns/tA. nalyst:
Monkey Sera AEMTmuSes-lL8ia-y40n6xO23a4n91d8aEAnT.dSS3-o8u2-p3.Q020199 See Attachments See Attachments See Attachments See Attachment 03/10/99 SAH 03/12/99, 03/21/99 MEE/DRB 03/ItW , 03/24/99 LAC/DRB
WEEK 6 MONKEY SERA
Grwup
Daaa
Samplea
PFOS Mean RSD
Cane.
CfnL
fPFOS ug/aLer%Ree
PFOS Std.Dev. uf/nL MS/MSDRPD
Method Blk Matnx BQc Matnx BQc
QC - 250 ppb
RRBBSS0033110099--HH2200 BBQOcc--12 RRBBSS0033110099--SSeerraa BBDDcc--12 MMKKSS0033110099--SSeerraa BBQQcc--12 MKS03109-Sera 31-3 MKS03109-Sera Blk-4 MMKJSS0031301099-M-MSSD-1-1 MMKKSS0033110099-M-MSSD-2-2
070704 000 4.19 2.56 21 9535 0.500 264 222544339
<LOQ <<LLOOQQ
-LOQ NA
<LOO <LOQ NA
<LOQ
<LOQ
<LOQ
4<1L06O%O
101%
<\,OQ
NA
103% %
97% 100%
987'. 2%
Graup 1 Control 00 mg/kgf'day
I05508M* 105517M* 111000555555122906MMM*
I05527M +
I05529F+ I10035533301FF+ 105335F* I05544F* I05549F*
000 000 0016601000 949 1.56 34 3184 0 00 03.0504
<LOQ
<LOQ
<<<LLLOOOQQQ
<<LLOOQO <LOQ NA
<LOQ
<LOQ
<LOQ
<LOQ <LOQ
<LOQ NA
Craup 2 Low-Doae 0 03 mg/kg/day
I[0055551145MM-** I05516M* I05521M* 105537F+ 1I0055554471FF* 105550F+
3336 61 4312.58 42.7 4356-7r32 7
33.3617 3.26 4.19
:: 9
3 61 0 430
4.28
3 66 33.6257
3 71 0n4P:
Craop 3 0 1M5 midg-D'kogs/eday
Croup4
High-Doae 0.75 mg/kg/day
I05505M 10551OM I03518M* I03523M+ III00103505555325233482BMMFF++* I05539F+ 1IID00555555445852FFF+ I05506M* I10055530079MM* 105511M 110035551222MM-V* I05533F I05534F+ I05336F* 1I000555555445201FFF*
87 4 6566 91 6712..79 6696911144 62455 6617 03 182 165 223340 211 203 213626 212779 220053
21.0
22.5
20.1
18.6
21.8 1188 54
:o a
8 1
5259
18 9
18 4
422.7
18 4 16 1
18 8 2!115
91.0
82 8
92 3
93.7
105 102
94 5 88057*
93 0
83 3
89 8
90 8 102
7 90
82.0 90 l 7 13
Limit of Quantitation (LOQ); PFOS* 15.2ng/mL
Date Entered/By 03/19/99, 03/24A>9 LAC
Data punty DcoartreecVteendf/iveetVnfiBedy 0049//1172//9090 mSmAHh,,0095//1129//0000LPAICO-PW
PFCS " Perfluorooctaneaulfonate
* Serum initial volume less than 0 30 mL, concentrations should be considered tentative 04/28/00 LAC
NA Not applicable
Extraction Volume Ratio " Initial Volume/Final Volume
EETxcSe-l89-57 0
3M Environmental Laboratory
tox-030-serm223-lC
9/ 12/00
Page 193
3m Medical Department Study: T -6 2 t o x -030
Report No.
C ov*n ce#6329-223 laboratory Request
Study 26 Week Capsule Toxicity Study with PFOS mCynomolgus Monkeys
AMFMPInirnlseioeatttdnnrlhyuuaxotmmc:ditce/eaRN:nletuEvmSquobuifoeitpnwrfm:Tareeens/ttVSSeuyisbsitaoetnmmcNe)u:mber SRl-oSpqeu:ared Value:
YDDDS-aaaaIttlmneeetoooeprffflcADeEepxnaDtattanlayeRtstaiiesod/nAu/cnAtainolyansi/tyA.sntalyst:
1SSS00MESSM*3VeeeeoT6oeee/etuSO0s2npAAsAA-39k58L/50tttteW-9tttty24yaaaa9(n0cPccc,0S1xhhhhF0Re9ammmmVO3rW9na.e0eeeSd)Wnnnn9)aEttt/t9ssssn/TJ9dCS,-3P08.32-/5100/99, 03/25/99 DRB 03/0&99.03/1V99, 03/24/99,0V26/99 DRB
WEEK 8 MONKEY SERA
GDroeunp
Sample#
PCFoOucS ng/mL
Comutrsttou
ug/moLf PoFrO%S Rac
PMFeOaSu StdR.SDDer. ag/mL MS/MSD RPD
Method Blk Matrix Blk Matrix Blk QC - 250 ppb
MMRRRRMJBKBBKM3SKSSSSSKO0000S0S333333C0O0000033333333099999093-*--3--S9HSSHS9e-O-ee22MrMnan00SSBBBEBBD*fif2lllk1l-kktkc-1-----121221
00030211.0000971210004030
<<LLOOQQ <<<<6LLLL9OOOO%QQOQ 76V.
<LOC> NA <LOQ NA <LOQ NA 72% 9%
MMMMKKKKSSSS000033330003339399-9-MM--MMSSSSDD--2-3-23
221100881553
88772132%%%%
77V, 10% 76% 11%
0 0GCmrogon/utkrpgo/l1day
III[I000000555555553555120122778906MMMMMM I11I000055S355552333930IFFFF J10055554494FF
9 43 2791n8620.o8083 16.0 911118458403605
<<LLOOQQ
0<0<<.LLL00O2OO318QQQ45
<LOQ 1Anomaly
NA
0 0244
00<<..LL00OO2240QQ06
0.0226 - 2 Anomalies
0 08031689
Group 2 0 0L3omwg-/Dkogs/deay
I05514M I1II1Ir000000055555555555555112345465I770IMMMFFFF
4343333311646744..13453821
44.6117 554435.998021845580
4^3 094I3d2 4 76 01.52717
0 1M5Gmirdog-uD/kpogs3/eday
I1I1I100000003555335553555521202I38804532MMMMMMF
891242291 891M1601$76
279 222322254147.....116665
26.0 312307
305538F
106
243
I1100055555J344985FFF I05552F
685192922364
22214269.535i
24 0
12 7 306
0.7H5Cimgrhog-u/Dkpog4a/deay
JI1I1IIW000000055335355555555330001213J96722134MMMMMMFF
8891111193821120275778a1
816251 911111220311113301
109 1168 37
1I100005553555544530!26FFFF
100 102 9m92
811170012563
107 111118
Limit of Quantitation CLOQ): PFOS 15 2 ng/tnL
DDaateteVEenniereedd//BByy 0Q3B/M08//9999,0S3A/2HV, 9095,/01V1/2060/9P9IOL,AOCV2VOOA 05/24/00 PW
Date punty corrected/'venfied 09/12/00 mmh, 09/12/00 LAC
NPFAC=S N" oPt earpflpuloicraobolcetanesulfonaic
Extraction Volume Raoo " Iretial Volume/Final Volume
FACT TOX-030 Number-U22 79
EETxcSe-l89-57 0
3M Environmenta Laboratory
tox-030-scTa223-lC
9; 12/oq
Page 194
3m Medical Department S udy: T-62 9 F A C ? TOX-030
Report No. FACT TOX-030
C o v a n ce# 6329-223 laboratory Request
Study: 26 Week Capsule Toxicity Study with PFOS in Cynomolgus Monkeys
MMPraeotidrhiuxoc;dt/NReuvnutbieoTnf:Tesi Substance):
AIFRSYDnlin--aolsSIetatpnenrqletuyaueotmmraifccreeEeaenpldxtlEt:VnSqcoautlfuiitpowemn:a/erAenn/tVaSleyynssittoenm Number: DDSWaaattEmeeEoopffKlAeDanD1taa2layRUsMeisd/uAOcntNiaolKny/sAEt'nYalySstE: RA
T-6295 (PFOS) 00S0MEMSSSS331oeeeeT//o/eeeue0uQS0n&sp5A-AAA3kL8///0te9ttt9-9ytttt42y999aaaan.0.,cccc0SRx1hhhh03e9ammWVmm33r9n/a0ee1eed2Wnn9nn5/ttE/tt/99ssssJT99CS.,P-00833-//512400//9999,, 0033//2265//9999 DDRRBB
GDroocu*p
Sample*
PFOS nCgo/mucL.
Ceu4tePuFtOtaSdeu ag/mL ar % Ree
iPMigF/eOmanSL
StdR.SDDev. MS/M3D RPD
Method Blk Matrix Blk Matrix Blk QC 250 ppb
0 0GCmrogon/uktrpgo/ld1ay
0 0L3Comrwog-uD/kpogs2/deay
MCirdo-uDpos3e 0 15 mg/kg/day
MMRRRRMMBBBBKKMMSSKSSRSSJK0000SCS00333S30330S00000033003333333039990990393---3--39-9HSHSS99S--eee--2MM2errMMn00naaSSBSS5BBBDED--J1Ol1J2k-kk-t-2t-1----2112l2 MMKKSS0033003399-M-MS5D-3-3
11111I[I000000005555555555555555222021I3977S0690FMMMMMMF* I1I1100000555555555U34349154MFFFF 1III11000000555555555555241143176517MFMMFF** 1II000555555105050MMF I10053552138MM*
00300..0200030000 221111.809871113540 3322120620.39987 23110116..1443 19.0 294411384453381
47 4
4557 81 3364.89 488 143 135 133 88.0
<tOQ <<<<LLLLOOOOQOQQ
<LOQ NA <1.00 NA
<67877L96232O%%%%%Q 81%
<LOQ NA 72% 9%
10% 76% 11%
0.0381
00.00443380
<0.L0O24Q4 0<0L4O2Q3
0 0383 - 1Anomaly
0 02108111
00..00324534
<LOQ
00..00233186
0.0263 -2 Anomalies
0 01033862
6.20
66765.8455518725 669 0856738
57.8033 631 0171147
433903.271
35.3
11I10000535553553223884F2MMF-*
87169(829 94 2
322755..848 328
35 2 31.5393
111100005555555534459582FFFF
Group 4
1556M
0 7H5igmhg-D/kogs/deay Limit ofQuantitation (LOQ):
PFOS-
1511I.I([I1II20I0000000000355535533n55S55555555g554230101345/302672m913214FFMMMMMFFFF-L+*-
771179001694 232247232828 8811136014.94369 911119206)63674
818090 681300006 128 114 Dale Entered/By
91118212.1460 111131217 0V08/99, 0^24/99, 0V26/99 LAC
27 8 122 I!4
314983
213969
:oo
117
Date Venfied/By: 08/18/99 SAH. 05/24/00 PW
PFOS Perfluorooctanesuifonate
Date punty c*orrSeecrtuedm/vienritiifaieldvolu0m9e/1l2e/a0s0thtraonnh0,5009m/1L2/,0c0onLcAeCntrations should be considered tentative 04/28/00 LAC
NA Not applicable
Extraction Volume Rato " [rubai Vohsne/Final Volume
Number-U22 79
EETxcSe-l8-57 0
3M Environmental Laboratory
tox-030-seii223-1C
9/12/00
Page 195
3m Medical Department Study: T- 6 29pj\cT TOX-030
Report No FACT TOX-030
Covince# 6329-223 laboratory Reques Number-U22 79
FQenimc:MMAISPntrnasueoattdtdrrhlyiyuuxo:tmc.dict/eRNn]eutEvmSiqaobuifeoitxpnwfm:Tueeens/ttVSSeuyrbsntaoelmaancNe)u:mber
RSYDDDSl.a*aaaoStttlpmeeenqetuo:oopeafrfflrcAEeDeexdpanDtttrVaaaalacRtyltauiesoedtnuA/cAntainolaynls/yAts:tn:alyst.
26 Week Capsule Toxicity Study with PFOS in Cynomclgus Monkeys TMES-oT6ouS2np-9k850e-24y(0P0S1F9eaO9nnSd)ETS-8-5 0 MtstLyrutl 2 See Attachments oSSy0Seeyye1ceeii26yAAA/9/99ttt9ttt99aaa,c,ccSohhh0Aymmm3Hi/eee29/nnn4R/ttt/9sss9W99WdDrRBb/hoj
WEEK 16 MONKEY SERA
Group Sample* Doe*
Method Blk Matrix Blk Matrix Blk QC- 250 ppb 0 0GCmrogon/utkrpgo/l1day
LGorwa-uDpos2e 0.03 mg/kg/day
0 1M5Gmirdag-Du/kopgs3/eday
0 7H5Gigmrhag-uD/kpogs4/deay
MMRRRRMMBBBBKKMMSSSKKSS$KK00000SS0333SS3300311I010133l222332221I9991192992---22-9--H9HSSS99S--eeM22--eMerMMrOOnanaSSBSSBBDBBBD--QIOtDI2I-k-kkc2cIc------12122l I10055551078MM*105519M+ III11CI0000005555555555555533222235060791FFMMMFF** II0055554449FF*I055I4M I11I0I00005555555555I24I53161M7MMFF*+ I10055555407FF 1I111IQI1100000000555355555555555553012221333503848289MMMMMMFFF* 111000555555454825FFF 1II111000000555535355553000112796212MMMMMM 1I11II00000055355355555533443563204FFFFFF*
PCFKeOn/meS.L 0000212211171...0035899000659990000054 21.) 321089497 3255.57 2927II187.3...59776 88471367.374I 665639 289 233237209 343223762754522697 323 324213 227537 222259694686 222111349398115864
Cancaotratea ug/mo00L<<<<<<f9.777PLLLLLL00e0266FOO4OOOO3r****04OQOQQQO%84S Rac
0.0423 0000000<<.....0LL00000054O3643O31621313QQ5205842 91.0447 1104.91 675511I.92200U8...753749 654428304424 344736..133 4378.70 211111111117897865872627954743
116287
Memo PFOS og/naL <LOC LOO <LOQ 74% 83%
00407
0.0432 -2 Anomalies 11 2 105
56 2
42 1
189
162
StdR.SDDev. MS/MSD RPD
NA NA NA 5% 16%
02071110
197 0 00851 221449 118901
510844
940549
815429
1! 9 193
Unit ofQuanmaoon (LOQ): PFCS - 15 2 ng/mL
DDaateteVEenntefireedd//BByy:: 0038//0188//9999,0SAy H17,/9O9S,/0l&3'/O2O4,/9095/2L4A/0C0 PW
PFOS - Perfluorooctanoulfonate
Date punty corrStcetreudm/viennitfiiaeldv'.olu0m9e/1l1e/s0s0thnaunnh0,5009m/1L2/,0c0oLncAeCntrations should be considered tentative. 04/28/00 LAC
NA " Not applicable
Extraction Volume Ratio * Initial Votume/Final Volume
EETxcSe-l89-5? 0
3M Environmental Laboratory
tox-030-era223-1C
9/12/00
Page 196
3m Medical Departrr.ent Study T -629fcTOX-030
Report N o . FACT TOX-030
Covince# 6329-223 laboratory Request Number-U2279
Study: 26 Week Capsule Toxicity Study with PFOS in CynotnoJgus Monkeys
MMASYPIFRDDnlir--naaolaseolSettapttntdeenrrhqletiuuyaeouxoo.mmtcidaiffetc//eeAeEeRaN:npdlxnettutEav:VrmSliaqysoacbuislftoeuiiitapnoiwef/m:nATv/eAenensa/nVttlaySSelsyuynt:sbsitots:etnam:ncNeu) mber Date ofData Reduction/Analyst
TMESSM-eoT6ioeuaS2npsA-9k8L50et-ty42ya(n.P0c0Sxh)F9eamO39nneSdIn)EtsTS-8-5 0 See Attachments S0S13e'e'1ee/51AA/69/tt99ttaa9ccJ,h0Chm3mP//e2eSnn4Att/ss9H9 DRB 0V17/99,0V25/99 DRB
WSaEmEpKle 2D0aUMONKEY SERA
Grasp Sampte * Data
pros CaocmrtraOaa
nCgo/mmeL. ag/maLf PaFrO%S Rar
Mean PFOS
StdR.SDDev.
ug/aaL MS/M3D RPD
Method BUc Matrix Blk Matrix Blk QC - 250 ppb 0.0CCmrogon/utkrpgo/l1day
LGorwa-uDpos2e 0.03 mg/kg/day
0 1M5Gmirdog-uD/kpoga3/eday
0 7H5Gimgrhag-s/Dkpog4s/deay
MRRMRRBBRRBBKKRRSBSSBSSSBB000S0S003SS3330303111Q01331153355113559919933I99-*55--99-H-SHS99S-S-eMc2-M-2eeMrMjOr0aanSSaSSBDBBDBBB--Q*0l2-Il-lkkk2kIcc------1I222l I111(I0000005535533555321220I797068MMMMMM*11WI000555555553323I590FFFF* 1Q055554449FF* 111000355555111456MMM 111I00003555555S2344177IMFFF III[1000005555S5355510125S3030MMMMF 1III1111000000005553S55335553555522933445B4F2SS82M-MFFFFF*111111II1000000000555355355535355550523001317326962t3M4MFMMMMFF*+ III000555555445201FFF+
0000030323312222....11.03090522100000......6369050000404203 253211989836634 838896.671 977931803650..129632 22245383? 3222222110251127051!3509044 332381851252 330029 323079343 441 333002
<<<<<<1989LLLLLL0180OOO3OOO%%%%QQOQQQ
00000000.......0000000653433633741610319899706 0000....0000554207963033 1102.57 114191 411U4M1..503 666323.331 677654464859572445...220372472 111111111355464442882359366
111593132
<LOQ NA <LOQ NA <LOQ NA 97% 13% 89% 2%
0 0400 02091.290
0 0504 02051227
12.3 12.3 19 5
7111l1144.447.560944
63 7 61075|
58 1 2154 47
144 710692
156
140 21 8
Limit of Quanatabcsi (LOQ) PFOS - 13 2 ng/mL Date punty DcDoaratreteecVEteemdri/efvireeednd/f/iBBeyyd::: 000938///110280//T99O99,0rSm1A/n1Hh7.,/90099V/11L72A//O0C00LPAWC
NPFAO*S N" oPtearnflauloyrsoeodc, tnaontesauplpfloincaabtele
a*CSaelrcuumlatienditiwalitvhooluutmseamlepalsethI0a3n503.05F0 mL, concentrations should be considered tentative 04/28/00 LAC
Extraction Volume Ratio Initial Vohsne/Final Volume
EETxcSe-l89-570
3M Environmental Laboratory
tox*030-so*223-1C
9/12/00
Page 197
3m Medical Department Study T -629&C? TOX-030
Report N o . FACT TOX-030
Covance# 6329-223 laboratory Request Number-U2279
SPrruoddyu:ct NumbeifTest Substance) AMMnaeamthlyxot:dic/aRleEviqauiopnm: ent System Number Instrument Softwire/Vcraon: Filename: SRYl--oISpnqetue:racreepdt:Value: DDaattee ooffAExntarlaycstiios/nA/Ananlaylystst:
WDSaatEmeEopfKlDea2Dt4aaRtaMeduOcNtioKn/EAYnalSysEt RA
C m p Sample 0 Dew
26 Week Capsule Toxicity Study with PFOS in Cyr.omolgus Monkeys TEAM-Tm6oS2ne-9lk8i5ea-4y(0P60SF2eaO4nn9Sd8)EAT.SS-o8u-p5 0020)99 MSSS00S3V3/eeee1eea/ee162uA7AA/3AL9//ttt9t99ytttt9aaaa9nRcc,cc.x0hhhhWO3mmmm3V/W2eeee2l4nnnn0//Stttt/9ssss9A99H., 0043//022V/9999 DDRRBB/MEE
PFOS PClo/wocl.
g/m(Lprro%s Ree
uPMgF/omObSL
M3S/MtdR.SSDDDevR.PD
Method Blk MatnxBlk QC - 250 ppb 0 0GCmrogon/utkrpgo/lIday
0 0L3Comwng-uD/pkogs2/eday 0.1M5Cmirdeg-u/Dkpogs/3deay
0 7H5Cigmhmg-D/*kOg4M/day
RRBBSS00331I6699--HH22OO BBllkk--12 RRRJRRBRRRBBBSSBBB0S0SSSSS3030010031336331613I9II6696166-9-969S9S9--9--eMM-eM-MMrrMaaSSSSSSDDDBB---ll2-I3--kk23I--12
105508M III1110111(00I00050000055555555555555255555533714212432M7054690991MMFMFFMFFF+---1I111010II000005055355555555315I542513457416TMFM0IMMFF-F*** 1I1000555555011580MMM I11000555555222834MMMI1I1011000C0555555555S55533344229S58FFFFFF+*II11I111001I00000050505555333355555555325530001I432467269IF30FMMMMMM-FF-*** 1I0055553412FF*
000000 002220033116008 222122340 36 4 303 32222416445059..8447892 831.363264 815134 111433124 811430388 211159861164 2222132222111111221M03558032459380463141548532697935810780
<<<LLLOOOQQQ <89989L85360O%%%%%O 89%
<LOQ <LOQ 92% B9% 90%
NA NA 8% 8% 2%
00.00448469
0000000....0000000334464261919984347873 0 0440 001170?1
0<0..L1004O34.247Q56
0.0426 1Anomaly
0.01087484
1111140338...14497 12.7 122
14 5 231060 13.0 0561785
656736646665345799138689......186864726751
65 9 610884 60 4 712240
22221111M0043989670883079 2M 214196
1115851]0 174 2102 90
Lamt ofQuantitation (LOQ>. PFOS - 15.2ng/mL
DDaateteVEenriifeireedd//BByy 0038//2148//9999 LSAACH, 05/24/00 PW
Date punty corrected/venfied: 09/12/00mmh, 09/12/00 LAC
PFOS PerUuorooctanesulfonate
* Serum initial volume less than 0.50 mL. concentrations should be considered tentative 04/28/00 LAC
MNA*-MNoontbaupnpdlicable
Extraction Volume Rado " Snidai Volume/Final Volume
ETS-S-5 0 Excit 97
3M Environmental Laboratory
tox-030-iCTi223-lC
9/12/00
Page 198
3m Medical Department Study T -62^ * c f TOX-030
Report N o . FACT TOX-C30
Covnce# 6329-223 laboratory Request Number-U2279
Study: 26 Week Capsule Toxicity Study with PFOS in Cynomolgus Monkeys
Product Number(Test Substance)
T-6295 (PFOS)
Matrix MAInnesattrhluyomtdic/eRanletEvSuqooufoitpnwm.meinWt Seryssitoenm: Number:
MEAMTmaoSsne-skb8Lae-yy40n6S0x2e3i4rn.a91d8.ESToSu-pS-052.00199
FUenante-
See Attachments
R*Squared Value:
See Attachments
SYl-oIpnetercept:
See Attachments See Attachments
DDaattee ooff EAxntaralycstiao/nA/Ananlyaslyt:st:
033/1/61/79^99,0R3W/2W1//9S9AHDRB/MEE
DSaatme opfiDeaDtaaRtaeduction/Analyst
03/23/99. 03/22/99 DRB/MEE
WEEK 26 MONKEY SERA
Creep Dee*
Sample *
CPFeOaeS. tfmL
Ceaceutratlen ef PFOS
uf/oiL er H Ree
Meiu nPgF/rOaSL
RSD Std. Dev. MS/MSD RPD
Method BDc Matra BDc QC - 250 ppb
RBS03169-H2O Bik-1 RBS03169-H2O Blk-2 RS03169-Sera BIk-1 RBS03169-Scra Btk-2
RBS03169-MS-! RBS03169-MSD-1
000..000000 000 210 232
<LOQ
<LOO <1.00
NA
<LOQ <8i5o%o 94%
<1.00 89%
VA 10%
RRBBS3003316196-9M-MSSD--22
229 193
9728%% 85% 17%
RRBBSS03316196-9M-MSSD--33
211 213
8856%% 86% 1%
Greup 1 0 0Cmogn/tkrgo/lday
105508M I05517MI05519M 05520M
30.9 2371..10 16.8
000.0419369 0.0417 0.0254
E05526M 105527M
4261.77
0.0376 0.0669
0 0459 00311.433
I05529F I05530F
4589.27
0.0613 0.0736
10553IF 30 1 00431
I05335F 166 0 0266
110055554449FF*
234167
00..00453336 0 0506 03021654
Greup 2 Low*Dose 0 03 mg/kg/day
105514M 1I005551165MM 110055533271FM-**105541F* I05547F
114513 131 n10:1 113 140
16.2
16.3 13.B 111634...389
15 8
8.91 1 41
13.0 108
I05550F+
85 3
11.4 13 2 142
Greup 3 Mid-Dose 0 15 mglcg/day
105505M 05510M* I05518M* 105523M* 1I0I0055555252438M2MF*II0055553398FF 1I0055554485FF+ 105552F
215459 142 176 211105656900 221669 114452
92.9
6192.95
72.1 66652939.4504
82.6
30.4 25 2
72.2
85 7 6345.65
66 8
116038
HGigrhe-uDpos4e
105506M 105507M-
2M13
1M82
0 75 mg/kg/day
105509M
1ro05s5si12iMM
2M48 285
1M42 148
21 0
[05522M
298
221
173 36 5
110055553334FF
330480
210837
1I0055553460FF* I05542F 105551F*
221705856 163
115757
114623
171
13 0 22.2
Ltfnit of Quanmaon (LOQ) PPOS 13.2 n^mL
DDaateteVEenrtiefrieedd//BByy:: 0038//2139//9999 LSAACH. 05/24/00 PW
M * Moribund
Date puitfy corrteted/venfied 09/12/00 mmh, 09/12/00 LAC
PFOS 3 Perfluorocctaneauifonate
* Serum initial volume leu than 0.50 mL. concentrations should be considered tentative 04.7&'00 LAC
NA * Not applicable
Extraction Volume Ratio " Initial Vohimc/Fmal Volume
EExTcSe-l89-57 0
3M Environmental Laboratory
tox-030-seTB223-IC
9/12/00
Page 199
3m Medical Departmen
Study
T -629fe \c ? t o x -030 Covance# 6329-223
Report No. FACT TOX-030 laboratory Request Number-U22 79
SPAMM(rtrnuuaoeatdttdrrlhyiuyaxoctn:idtce/aNnRltoeESmvqawbufcatifwpnfmTv*eu*n/1Vt SSeuyravbotictnamneNeu) mber
T2MDME6-Taa6oSvWen2re-k9y8Le5e0-eyy47k(nP0SxICF7ea3a9Ornap93Sde)uElcTST-c8u-Scif1y Study with PFOS in Cynomoigua Monkeyi
SYDFRli--aolSIetpnenqetau.eomvrfcweEe:dpxttV:raacluaoea/Anatyvt
0SSSS6eeee/eeea0AAAA1/tttt0ttttaaaa0cccchhhhSmmmmAeeeeLnnnn/tttKu!!JK
DDSWaaattEmee EoopffKlADe aj2Dut7atayRtnMaet/dAOucnNtaiolKyni/EtAYnalSyiEt RA
0066//0067//0000,,0066//1145//0000,,00&6/1169//0000 [IAASS'M/MMMHH
GDreoauep Method Blk Matnx Blk QC - 230 ppb Grasp 1 OQCmogn/ktrgo/lday
Sample 9 RRBB0016S16S0000030316316300100191--1H9HM00W-2-2S-SM0-0eMcBrSnBaSlDlkBB-k5--ll3-6kk5--56
1I1111I00000005S335335533353O21343J789043IMMMFFFF
pCraaocs. 0005033C3000033300000/lnL 334847609338...911561
CouccatraUoa g'oaLf prro%s Ree
<LOQ
<<LLOOQQ <11L22O123HC4 0.0461 000000......000000633463913337388034
Mean upfr/mosL
<LOQ <LOQ
122H
0 0529
00416
MSS/MidR.S5DDD*vR.PD NA NA 194 02071443
0.3031458
0 0L3Goxwrno-guD/pkoge1/day
Groap J 0 1M3imd-gD/kog/day
0.7H3Gigmrhog-uD/kpoge4/d*ay
II1II01I1111111II00000O030000000055535535555553S333555O35533535552I2113124443U5C464858621838701MMMMMMMMFFMFFFFr* [III10000005353535335550I433J27O64IMMFFFF
21m1112386813737 i332233226064611^3i70409660: 433444687213494970 291
29111113123133...5062394 6688 37
13.9 11 !
354384 n1.527
665373360844...133067
68 1 85.7445 58.5 476979
211111088669242946
194 846913 14 9
126 160 23 9
Limit ofQuanQtatKn (LOQ): PFOS NPFAOSN" oPtmapHpuloicraobolcetaneeulfonate
5.55
n|mL Dai
punry
cDDoaratrateecVEteendnt/fevireeednd1f/iBBeydy: Extraction Volume
0R00669a//t/Q0i1o&27=///0000Q0Im,m0Po6mJiW/lh1V,9/0o09l0u/1jn2Le/A-0T0CmELxaAltrVCacotliuomneVolume
Ratio
-
ImbaJ
Volum/FinaJ
Volume
cn-j-j o
Excel 97
3M Environmental Laboratory
tux-C36-im213-lC
9/12/00
Page 200
3m Medical Department Study T-62 9i^ c ?TOX-030
Report No. FACT TOX-030
Covmce# 6329-223 laboratory Request Number-U2279
Study:
PMADDIDMFRSYSnilraa-naalo-saoeSettliatmtptdeeennrqnhleuuyatuxoooo:pmemct.adffifetlcr/eeAEeDeeaNR:ndplxnaetuDtEttavmVrSaliaqayosabRcutislfetaouietiixpwsnoedf/m.:nuATa/creeAnetnsia/ntotVlanSSyle/usyyAntbssinttsoeatnaml:ynscNte:)umber
T2MAMSE6e-Tmo6aeWSsn2eAs-kl98Leiet5a-etyy4(ak0nPc60SxCFh2eamOa43nnp.9Se2ds8n)u.EtlsSeToSTu-o8px-05ta20r0y19S9tu, dAyMwiatdhePhnFeO0S4i1n09C8ynomolgus Monkeys 000SSS444eee//ee/e000A796AA///t9tt99ttt99a9aac,,cchhh00Rmmm44W//eee11Wnnn52ttt//sss9999,.0044//2170//9999., 0035//1147//9999.,0033//1178//9999 HHOOJJ//DDRRBB//MKJEHE/KJH
DAY183 MONKEY SERA
GDroewm? Method Blk Matrix Blk QC - 230 ppb
S an|bl RBS04069-H20 BIk-1 RRBBSS0044006699--SHe2r0a BBl&k--12 RBMSX0S4006490*69S-eMrtSB-&1 -2 MMKKSS0044006699-M-MSSD--21
PFOS d0Cr.0m/b0eL. 01.4020 1225.47 224667
ag/tnrLfPeFrOHS Ree <LOQ <<LLOOOQ <1L02O*O4 19098%%
uPgF/mOSL
StdR.SDDrr. MS/MSD RPD
NA NA
NA NA
101% 3%
0.0CCmrogen/etkrpgo/l1day
MICS04069-MSD-2 11I0I0005335555522246099MMFF+
228 219287 626130
09127%1 000.000637213606
100% 0 IP 0 0533
000165096357.%163254
0.1M5Gmirdag-Dn/kotgs3/eday
11I0I0005355355502353392MMFF+-
343797781197
74,4 931630.793
83 0 81.7
411374.690 35 1
Groap 4 High-Dose 0.75 mg/kg/day
1I00555512I2MM I0055551432FF
97.1 194 214756
216 222058182
249 416888 230 417035
Lsmt ofQuantitation (LOQ):
PFOS -
13
2
ng/ir.L Date
punty
DcDoarelreteecVtEcendrt/ievfticeerddi/f/BiBeydy::
000489///111992///990990.r0Sn3mA/1Hh0,,/09b99e/,f1o02r5/e0/20006L/-90A98C/0L0ACTXR
PFOS - Perfluorooctanesulfonate
- Senim initial volume leu than 0.30 mL, concentrations should be considered tentabve 04/28/00 LAC
NA * Not applicable
Extraction Volume Ratio =Initial Volume/Final Volume
EETxcSe-l89-57 0
3M Environmental Laboratory
tox-030-era221-lC
9/12/00
Page 201
3m Medical Department Study: T - 6 2 t o x -030
Report N o . FACT TOX-030
Covinee# 6329-223 laboratory Request Number-U22 79
SPtruoddyu:ct Number(Test Subitanee) AMMInnsaeatttrnlhuyxotm.idce'alnlletEvSquouifoitpnwm:ireen/tVSeyrnstoenm Number
FRSDDDYSil-aal-aoueSIttmpneneeqetaueooopmrafffclreAeEDee:pdxnaDtta:tVralaayaRctslatueiisedo/:unAc/Antiaonlnayl/syAtsntalyst:
26 Week Capsule Toxiaty Study with PFOS tn Cynoroolgus Monkeys
TMA00MSSESS-44eeeeTm6oa//eeecS002nseAAA-6A79akl8i//5Letttat9-9tttt4yyaa9(a9e0.Pccnc,06Sh0hFhhxR2me4ammOm34Wnn/9e1Seeed28n2nWnn).Et/ttus9!!ST9oS,u-O8p-W053P00/19999,
. A Madeline 0 4 1 09 05/14/99,05/17/99
8
HOJ/DRB/MEE/KJM
04/09/99, 04/15-99, 04/20/99, 05/17/99, 05/18/99 HOJ/DR3/KJH
Group Sample* Dm
Method Blk
RRBBSS0044006699--HH22O0 BB0lkc--12
Matrix Blk QC - 250 ppb
RRMMfBMMiSKKSJK00SCS4S400S0004406460049096066-9-69SS9-9-MeMe--MMnnSSSSBDBD--UO1-2-1c2M-2
O.QGCmroegna/tkrpgo/l1day
11110000555355522420699MMFF
0 1M5Gmirdog-uD/kpogs}/eday Group 4
0.7H5imghg-/Dkogs/deay Limn DfOiunnunonO-OQ)
1II000555555203339MMF I10055555121FM* PFOS- 15 JIII0n00S5j55'55m243223LMFF
PFOS n0011222g.0244560/n.0624707aL 228 24213238.2063 866321991200 222164192420
ug/mfLPoFrO%S Ree
<<<<1199LLLL0092OOOO28%%%%QOQO 000<...L00042O2138Q637 664 687196381550 322362654
aPgF/nOsSL NA NA 101% 100%
0.0233 ! Anomaly 0 0352 69 7 780 259 245
DDuueeVEenritfeireedd//BByy 00SVaIV9/9999,0S5A-1H0,-b9e9f,o0rVe2a0V/O99&OLOACTKR
MSS/MtdR.SSDDDeRv.PD NA NA 3% 16% 002N059A911 671 411265.840 42112191.2095
PFOS-Pertluorooctinesulfonite
Date punry c*onStcetmedi/tiveinnifbieiidv:ota0n9e/1l2e/00tmhimnh0,.3009/m12L/,0c0oLnAceCntricons should be coniideied muove 04/2&'00 LAC
NA * Not applicable
Extraction Volume Ratio Initial Volume/Finai Volume
EETxcSe-l89-51 0
3M Environmental Laboratory
tox-030-sen223-1C
9.'11'00
Page 202
C) 01
3m Medical Department Study: T -629jE*c?TOX-030
Report N o . FACT T0X-C3
Covance# 6329-223 laboratory Request Number-U227
MMAFSPIRnitrn-luaseoSeattdtdnnrqlhyuuyaxuo:tmcm:aditcre/eaeRN:nldetuEvVmSqtoasbuilfueoitpweinfm:Tareeens/ttVSSeuynbsitsoetnam.ncNe)u:mber
SYDDDSlaa-aaoltttpmneeeetoeoo:prfffclDAeEepxanDttta:arlaayRctsateiisdo/unAc/nAdaonlnya/lsAytsntalyst:
T26-6W29e5e(kPCFaOpSs)ule Toxicity Studywith PFOS inCynomolgus Monkeys EASSS000MMS444eeeeTmo/e//eeeu0S00nesAAAA7694klL//i/-tttet9a99ytttt4yaaa99a90n.ccc,c0.6Sx0hhhh0R2e4ammmm434Wnn//.91eeee12d85Wnnnn2,/tEttt/9ssss9ST99oS.,u-008p44-5//071.20070//1999999,, ,0055A//.11M74//a99d99e,.l00in55e//1107*4/91909998HHOOJJ/.'DDRRBB//KMJEHE/KJK
DAY195 MONKEY SERA
CDraatotp
Staple*
PFOS l/aL
aCg/umarLfsaPatFrrOs%BSiwRei e
uPMgF/emOanLS MSS/tMdR.SSDDDe*R.PD
Limit of PFOS
Method BOc Matnx Blk QC - 250 ppb
0 0GCmrogwn/tksrpgo/l1day 0.1M5Cmirdeg-eD/kpogs3/eday 0.7H5Gimgrhog-u/Dkpog4/sdeay Quantitation (LOQ): PFOS
Perfiuocoocunesulfonau
RHS04069-H2O Bflc-l RRBBSS0044006699--SHe2ra0 BBAlkM-2 RBMSJ0C4S006490-S69e-rMa SB-Q1c-2 MMMKKKSSS000444000666999--MM-MSSSOD--2-12
105520M 1II000555S5J224699MFF 105505M II0055552339MF I05552F* 15 211In1000g055555/55n52342t13L2M1FFM-+**
Date pw.ty
104010 1022220654774604 228
<LOQ <<LLOOOQ <1L02O5O4 99%
NA NA 10! %
108% 92%
100%
310 3637..13 23.0
0 0366 0.0498
00432
0.0763 0.0330
0 0546
575738 7805.34 77 9
867 322
6170.18 84 3
221112211603
324240071198
294 321
Dc+DoaratreSteeecVrEtueendmrit/feviireentdndit/f/iBiaBelydyv:::olu000m849e///211l529e///s909s909t,hm0Sa3Amn/1Wh00.,,5/09b099em/f1oLL2rA/e,0Cc00o6Ln/0Ac8eC/n0t0rioToXnRs should
be
NA NA 3% !6% 002019528 56 1 0 0306 137 10 7 27 6 233 7 49 2522.08 170
considered tentative
04/28/00
LAC
EETxcSe-lg9-5T0
3M Environmental aboratory
tox-030-sera223-1C
9/12/OC
Page 203
3m Medical Department Study: T -62 3 = aC T T O X -030
Report No. FACT TOX-G3G
Covance# 6329-223 laboratory Request Number-112279
Study: 26 Week Capsule Toxicity Study with PFOS in Cynomolgus Monkeys
Product N'umbertTcst Substance):
T*6295 (PFOS)
MMaettrhioxd: /Revision: Analytical Equipment System Numbci Instrument Software/Version: Filename: R-Squaxed Value:
Monkey Sera EATmSe-l8ia-40.602a4n9d8.ESToSu-8p-052.00199, &. Madeline 041098 SMeaesAsLttyancxhm3.e2nts See Attachments
Slope: Y-Inrcrcept: Date of Extraetion/Analyst: Date of Analysis/Analyst:
DSaatme opfleDaDtaaRtaeduction/Analyst:
See Attachments See Attachments 04/06/99 RWW 04-07/99. 04/11-99. 04/17/99, 05/14/99. 0517.99 HOJ DRB.MEE Kill 04/09/99. 04/15/99. 04/20/99. 05/17/99. 05 18:99 HOJ DRFVKJH
DAYI87 MONKEY SERA
Croup Dose
Sample *
PFOS Concentration
Mean
RSD
Cone of PFOS ng/mL ug/mL or % Ree
PFOS ug/mL
Std. Dev. MS/MSD RPD
Method Blk
RBS04069-H20 Blk-1 RBS04069-H20 B2k-2
0.00 14.2
<LOQ <LOQ
NA
NA
Matrix Blk
RBS04069-Sera Blk-1 RBS04069-Sera Blk-2
0.00 12.7
<LOQ <LOQ
NA
NA
QC - 250 ppb
MKS04069-MS-1 MKS04069-MSD-1
254 246
102% 99%
101% 3%
MMKKSS0044006699-M-MSSD-2-2
267 228
108% 92%
100% 16%
Croup 1 Control 0 0 mg/kg/day Group 3 Mid-Dose 0.15 mg/kg/day
I05520M 105526M I05529F I05549F+ 1I0055552035MM I05539F I05552F
13.6 22.1 39.1 31.7 699 662 63.7 498
0<.L03O0Q0 00..00534713
0.0300 - l Anomaly 0.0457
NA 25.9 00118
82.4 75.8
5 91 79.1 4 67
10.2 105
68.8 3-).5 41.4
Group 4 High-Dose 0.75 mg/kg/day
10551IM 105522M I05533F I05542F
225 185 289 253
237 297 269 248
15.7 267 42.0
5.90 258 15.2
Limit of Quantitation (LOQ): PFOS 15.2 ng'mL
Date Entered/By: 04/19/99. 05/10/99. 05'`20 99 LAC
Date Verified7By: 08/25/99 SAH. before 06/08-00 TKR
Date purity corrected/verjfied: 09-12/00 nunh. 09/12 00 LAC
PFOS - Perfluorooctanesulfonate
- Semin initial volume less than 0.50 mL. concentrations should be considered tentative. 04 28 00 LAC
EETxcSe-l8-957 0
3M Environmental Laboratory
TOX-030-sera223-lC
0*M.V2000
Page 204
3m Medical
Department
Study:
T -62C9 orvvincce#TO63X2-90-32023
Report N o . FACT TOX-C30 laboratory Request Number-U2279
PMSrtuoaddnyuxct NumberfTest Substance):
TM26-6oW2n9ke5eeyk(PSCFeaOnpSs)ule Towcicy Study with PFOS in Cynomolgus Monkeys
MAInnseattrlhuyomtidce/aRnlteEvSqmoutiotpwnmireen/Vt eSryssiotermv Number Filename
EAMSTematSseAs-l8iLatUtya0nc06xh2am43n9ed28n.EtsSToSu-p8.50200199. & Madeline 041098
R-Squaxed Value:
See Attachments
DWSDYDSlaaaa-oltttEmpmeeeeEoooepifffKclADEeepxna2Dttta:8ralaayRctstMaetisod/nOAu/cnANtainolKyansl/EyeAsYnt alSysEt RA
0SS4ee/ee0AA8/tt9tt9aacchhRmmWeeWnnttss 0044//1161//9999..0044//1270//9999,,005V/1147//9999 DHROBJ//DMREBE//KKJJHH
Crasf Dm *
Sample
PFOS ag/mL
aCg/--aoiLfc--PeFrtOr%aSflReuec
Meta PFOS
StAR.3DDev.
or/boL MS/M3D RFD
Method Blk Matnx Blk QC - 250 ppb
Cretip l 0.0Cmogn/tkrgo/lday
Creep 3 0.1MSmid*gD/kogs/eday
HCifihw-Dpoe4e 0.75 mg/kg/day
RRRRBBBBSSSS00004444000018889999----SHHSee22rna00 BBBBQlIlkkkc----1122 MMMMKKKKSSSS00004444000088889999--MM--MMSSSSDD---2-I12
I1I100005555555524226990MPFM*-* 1I100035J355023339MMF*-* 105532F* I10100355555I23I2M3MF* I05542F
007722226.0066468810794000 222145066881...1.10844 635253389568 366 423
<<<<LLLLOOOOQCOQ 00001111..800000000534845162.7758%%%8742894
<LOQ NA
<1.00 NA
106% 3%
103% 6%
0 0371 0 0430
000.311003918*72251841
8883.57 836 222634439
84 6 151
86 1 249
43.3196 827..177176
223 236 18.3
Limit ofQuanbtaoon (LOQ): PFOSPFOS * Perfluorooctanesulfonate
15
2
ng/mL Date
punry
cDDo*aratrSeteeecVrEtueendrnti/uefvirneeeidndb/f/aiBBelydyv:::olu000m498e///121l59e2//s/990s990t,hm0Sa5mnA/1Hh00,,5/09b099em/f1oLL2rA/e,0cC00o6Ln/0cA1eC/n0t0ratTioKnRs
should
be
considered
tenuave
04'2&/00 LAC
EETxcSe-l89-57.0
3M Environmental Laboratory
tox-03O.en223-IC
9/12/00
Page 205
3m Medical Departmen Study: T-62 9&cfTOX-O30
Report N o . FACT TOX-030
Covjnce# 6329-223 laboratory Request Number-U2279
MMAIPFSnitrnlsaueoeattdtdnrnhlyuyuaxo:mmtc:ditcee/aNR:nlteuEvSmqmobwfoetpwnr(m.vTereens/ttVSSeyunsbutsmetma:ncNeu)'mber: RSl-oSpqeu: arad Value: DDDYaaa-ItttneeeioooerfffcAEDepnxatatt:ralayRcnteaiod/Anu/cnAtiaonlnayl/iyAtsntalyst.
A2TMEM6-Tm6oSWM2en-l9k8iLe5ae-ey4y(k0nP06SxCF2eaOa43nnp9tS2ds8)u.ElSeToSTu-o8px-50i2a0t0y19S9t.uAdyMwaitdhelPinFeO0S41in09C8ynomolgus Monkeys SSeeee AAttttaacchhmmeennttss 0SS4ee/ee08AA/tt9tt9aacchhRmmWeeWnnttss 0044//1116//9999., 0044/7107//9999,.0055//1147//9999 DHROBJ//DMREBE//KKJJHH
Sample Data
WEEK 29 MONKEY SERA
CDreotuep
Sample
pros CO(/UmCL.
Cm cmtrance vg/m*Lp rero%s Rcc
uPM|F/moObLS
StdR.SDDev. MS/MSD RPD
Method BOc Matrix Blk QC 250 ppb
RRRBBBSSS000444C0088S999---SHHe2r3Oa0 BBBDD&cc---2ll RMBMSKK0S4S0004840908-98S-9cM-rUaSSDB-01-c1*2
7.80 701 0.00 0226668070
<<LLOOQQ <LOQ <LOQ 110058%%
<LOO NA <LOO NA 106% 3%
MKS040S9-US-2
249
101%
MKS04089-MSD-2
264
106% 103% 6%
0.0CCmorgnm/tkrgpo/llday
iI10I0050555555252240969MFMF**
43648482...2771
0000....0000767643397980
0 0665 0 0742
5 45 00000080093664624
0.1M5Gmirdog-u/DkpagtJ/eday
I10I10050555555250533529MMFF*
664511637 432
7747J2 761799
75 8 69 9
228188 116124
Gmg 4 0.7H5igmhg*/Dkgo/sdeay
1II00Q555555213213MMF 105542F
635548461490
221707075 180
223 194
300 696B93 19.0
Limit of Quantitation (LOQ): PFOS- 15.2 ng/mL
Date Entered/0y 04/19/99,05/10/99 LAC
Date Verified/ By 08/25/99 SAH, before 06/08/00 TXR
Date punty coiTected/venfied: 09/l2/00mmh,09/12/00LAC
PFOS Perfluofooctanesidfonate
* Serum irutul volume less than 050 mL, concentrations should be considered tentative. 0478/00 LAC
EExTcSe-l89-57 3
3M Environmental Laboratory
tox-03O-scra223- l C
9*12/00
Page 206
3m Medical Department Study: T -62 9 p & c TOX-030
Report N o . FACT TOX-030
Covanct# 6329-223 laboratory Request Number-U2279
Study: 2dWeak Capsule Toxiaty Study with PFOS inCynomolgus Monkeys
Product NumberfTest Substance). AMMInnseiatttnrhluyxomt:dic/eaRnletEvSqiosuifoitpwnm:aeren/tVSeyrnstoenm Number
TAMEM-Tm6aoSs2ne-a9hk8L5ae-y4y(0nP06SxF2eaO34nn9S2d8).ESToSu-p8-05200199. k Madeline 041098
FDename:
See Attachments
RSYl-o-Slpnqetu.earreeedptValue: DDaattee ooffAExntraalcytsiotAn/nAanlyiisytit
DSaatme opfleDaDtaaRtaeduction/AnaJyit:
0SSS044eeeeee//01AAA81//ttt99tttaa9a9ccc.hhh0Rmmm4W/eee1Wnnn7ttt/sss99.0V14/99 DRB/MEE/KJH 04/16/99,04/20/99,05/17/99 HOJ/DRB/KJH
WEEK 30 MONKEY SERA
GDraawi*p Method Blk
Sample RRBBSS004400B899--HKI2O0 BBilkk--12
PFOS nC77jg.08w/10aacL
ttC|/oaoafc<LepLeOrtrroQaSstSReaar
<LOQ
uPMP/emOanSL
StdR.SDDev. MS/MSD RPD
<LOQ NA
Matnx Blk QC 250 ppb
RBS04089-Sera BQc-1 RMBMKSK0SS40004480098B-99S--MeMnSSBD-1l-kI-2 MMKJSC0S4480989-M-MSSD-2-2
0022.6.66080700 226449
<LOQ <11110100058160%%%%0
<LOQ NA 106% 3% 103% 6%
0 0CCmrogen/Votrfgo/l1day
111I0000535555522426099MMFF
33221290.4551
0000..0000233391019264
00313 0 0303
00..00100.0061406855
0.1M5Gimrda*guD/kpogs3/eday Grwp 4 High-Do
0.75 mg/kg/day
I05505W 11I10000055555555552321529312MFMMF* J10055553432FF
418 43524450* 346437161056
666198469 511114617576065
7.06
65 2 417.6.10
62 0 2160 65
143 162
347888607
Limit of Quantitation (LOQ): PFOS - 15.2 ng/mL
DDaateteVEenrtiefireedd//BByy:
Date punty conected'vmfied:
000894///211529///909909,m0S5mA/1Hh0.,/09b99e/f1oL2rA/e0CQ06L/OAVCOQ TKR
PFOS " Perfluorooctanesulfonate
* Serum initial volume less than 0 50 mL. concentrations should be considered tentative. 04>'2&'OO LAC
EETxcSe-l8-951 0
3M Envi ronmental Laboratory
tox-030-seim223-lC
9/12/00
Page 207
3m Medical Department Study T-62 9 & ,c ?TO X -030
Report No. FACT TOX-030
Covance# 6329-223 laboratory Request Number-U2279
ASMIPMntrnuseaoattdtdrrlhyiuyuox:tmc:ditc/eaRNnluteEmvSqiosbuifcoitrpnw^m:TaeerensI/tVSSeuynbsitsoetmarncNeu) mber
26 Week Capsule Toxicity Study with PFOS in Cynomoljtui Monkeys TAME-Tm6oS2ne-9lk8i5ae-4y(0.P06SF2eaOr4na9Sd8).ESToSu-8p-50200199. & Madeline 041098 MuiLynx 3.2
FRSDSYDDil-aaaa-loSeltttmpneeenqetauoooepmrafffclreeDEAee.pdrnaDtttar:VaalaycaRtsolauieosedt/:VAucAntainolaynlsy/tA:stn: alyst
000SSSS444eeee/ee/ee/01tA6AAA81///tttt999ttttaaa9a99cccc,,0h0hhhR4m4mmmW//1eee2eWn7nnn0tt/tt/ss9ss999.,0055//1174//9999 HDORJB/D/MREBEO/CKJJHH
WEEK 31 MONKEY SERA
GDraaeup Sample#
nPCgFa/OmseSL
Ceocaatrade* (/mefLPeFrOSS Rac
PtgF/OasSl.
M5S/MtdR.SSDDOrvR.PD
Method BIk Matrix Blk QC - 250 ppb
OOCCmrogan/aktrpgo/l1day 0.1M5Gmirdag-sD/kpogs3/eday 0 7H5Cimgrahgw-/Dkpog4s/deay
RRRRMBBBBMSSKSSJO00S0C44440S000400S880t4999980----9HHSS-9M22ec-OOnnMSDBBSBBIDl--lkkk11c----1212 MMKKSS0044008899-M-MSSD-2-2
W1II0005555555542229609FMMF* 1I0055552035MM 1I0055555329FF*11I000055555555422312F13-MMF*-
770810 0022606680070 224694 2376..17 2254.35 325599981180 363599961888
<LOQ <<LLOOQO <11100580%%0
<LOQ <LOQ 106%
NA NA 3%
110016%% 00.00335642 00.00425832 64510831...1062
103% 0 0358 0 0368 566 79.6
6% 000301021052598)67
84 4737 4535 80
211109721409
28 6
161 >85
42I1I6 981
Dale Entered/By 04/19/99 LAC
PFOS - PerOuorooctanesulibmte
Due punty Dc*oartrSeeecVrtueemdri/6vienednit/fiaiBeldyv::olu00m98e//12l25e//a09s09thmSamnAH0h,,50b09em/f1oL2r/,e0c00c6mL0Ac8eC0n0traTnKorRs should be considered tentative 04/28/00 LAC
NA Not applicable
Extraction Volume Ratio " Initial Volume/Final Volume
EExTcSc-j89-750
3M Environmental Laboratory
tox-030^oi223*lC
9/12/00 Page 208
3m Medical Department Study T - 6 2 3 & C ? TOX-O30
Report N o . FACT TOX-C30
Covanee# 6329-223 laboratory Request Number-U22 7S
Study- 26 Week Capsule Toxicity Study with PFOS m Cynomolgus Monkeys
Product NumbertTest Subitanee).
T-6295 (PFOS)
MMAnaeattrhliyxot:dic/aRleEvquuioipnment System Number: Instrument Softwere/Veroon.
AMETmoSne-lk8iae-y406SI2e4aran9Bd ETS-8-3.1 MauLynx 3 3
Filename: R-Squared Value
See Attachments See Attachments
Slope: Y-Intercept DDaattee ooff EAxntariayc*ti*o/nA/Ananlaylsytst: Date of Data Reduction/Analyst
0SS8ee/ee2A5A/tt9ttaa9cchhRmmWeennWttss 09/28/99, 10/05/99, 06/14/00 MEE/MMH 09/29/99. 10/0^99. 06/15/00 MEE/IAS'MMH
Sample Data
WEEK 35 MONKEY SERA
Creep Dose
Sanpla 0
PFOS
Caacentration
Mean
RSD
Ceec.
fPFOS
PFOS SU. Dev.
(/nL
oc/aiLer H Ree
mg/mL MS/MSD RPD
Method Blk
H20 Blk-1 H20 BOc-2
0.00 000
<LOQ <LOO
<LOQ NA
Matrix Blk QC - 250 ppb
MRRaaKbb3bb0iitt8SS25ee9nn-MBBDISkc---12l MKS05289-MSD-1
00.0000 227 254
<LOQ <9L1O%O 102%
<LOO NA 97% 11%
MMKKSS00J8228599-M-MSSD-2-2
223596
19063%% 100% 7%
Creep 1 Control 0.0 tr^A^/day
105520M I05526M 1I00555S4299FF
27 3 35 9 74.7 61.0
0.0437 660
0.0480 0 0459 0 00303
00..00764988
486 0 0723 0 00352
Creep J Mid-Dcee 0 15 mg/kg/diy
I05505M* I05523M I05539F* I05552F-
118960 122 135
93 0 76 l 81 2
84 5 1U2 01 12 8
67 7 74 4 9 53
HCigrhe-eDpo4se 0.75 mg/kg/dey
105511M 1I0055552323MF 105542F
41? 486 444048
167 195 116748
181 171
511139394851
Lrrut of Quantitation (LOQ) PFOS - 5 33 n^mL
Date Eniered/By: 1005/99, KV07/99, 06/19/00 LAC
Date Verified/ By before 06/08/00 TKR
PFOS Perflucrooctanesulfonate
Date purity c*orrSeecrtuedm/viennitfiaieldvolum09e/1le2s/s00thmanm0h,3009m/1L2./0c0onLcAeCntrations should be considered tentadve 04/2800 LAC
NA " Not analyzed, not applicable
Extraction Volume Ratio Initial Volume/Final Volume
EETxcSe-l89-57 1
3M Environmental Laboratory
tox-030*erm223-1C
9/12/00
Page 209
3m Medical Department Study T -62SfccfT O X -030
Report No FACT TOX-C30
C ovance#6329-223 laboratory Reques Number-U2273
Study 26 Week Capsule Toweity Study with PFOS in Cynomolgus Monkey
Product NumberiTest Substance)
T-6295 (PFOS)
Matrix: Monkey Sera
MAInnseattrhluyomddc/eaRnletEvSuqoiuofitnpw.maeren/tVSeynsitoenm: Number
AEMTmaSue-lL8ia-y40n6x123a4n93d8 ETS-8-5.1
Filename:
See Attachments
R.Squared Value
See Attachments
SYl-olpnetercept.
SSeeee AAttttaacchhmmeennttss
'
Date of Extraction/Analyst: Date of Analyst*/Analyst: Date of Data Reduction/Analyse
08/25/99 RWW 09/28/99, KV05/99. 06/14/00 MEE/MMH 09/29/99. lQ/06/99. 06/15/00 MEE/IAS/MMH
Sample Data
WEEK 39 MONKEY SERA
Craap Date
Sample*
PFOS C a|/bieL.
Concentration Of/aarLPeFrOHS Rc
Mean RSD uPgF/OmSL MSS/tMd.SDDevR.PD
Method Blk
H 20B a-l H20 BOt-2
0.00 0.00
<LOQ
<LOQ
<LOQ
NA
Matrix Blk
RRaabbbbiitt SSeerraa BBfllkc--12
0.00 0.00
<<LLOOQQ <1.0Q NA
QC - 250 ppb
MKS08259-MS-1 MKS05289-MSD-1
227 254
91% 102%
97% 11%
MMKKSS0058228599-M-MSSD-2-2
223596
19063%% 100*4 7%
Croup 1 Control 0 0 mgfcg/day
1I00555522C6MM I10055534299FF*
23 7 29 l 3215 47
00..00341666 0.0503 0.0514
27
00391
00106 1 53
0 0509 0 000779
MGirdo-uDpoeJe 0.15 mg/kg'day
1I0055552035MM++ 105539FI05552F-
321117 114742
62.4 5 26
579 568
60 1 314161
46.5 5) 7 7 29
0 7H5Gigmrhog-a/DVpoga4/eday
1I0055551221MM** II0055534323FF--
227306 233380
113558 115649
11 0 1-16 616861 161 1! 1
Limit of Quantitation (LOQ) PROS - 5 55 ng'mL
Dale Entered/By: 10/05/99. 10/07/99, 06/19/00 LAC
Dale Verified/ By: before 06/08AW TKR
Dale punty corrected^verified: 09/12/00 mmh. 09/12/00 LAC
PFOS * Perfluorooctanesuifonate
* Scrum mmal volume less than 0.30 mL, concentrations should be considered tentative. 04/28/00 LAC
NA " Not analyzed, not applicable
Extraction Volume Ratio * Initial Volumc'Final V olum e
.
ETS-8-5 1 Excel 97
3M Environmental Laboratory
tox-030-sera223-lC
9/12/00
Page 210
3m Medical Department Study T -62
TOX-030
Report No. FACT TOX-C30
Covance# 6329-223 laboratory Request Number-U2279
StudyProduct Number{Te>t Substance) AMMnaeattnlhyxot:idc/aRleEvquuioinp.ment System umber Instrument Sofrware/Venion:
26 Week Capsule Toxicity Study with PFOS ui Cynomolgvu Monkeyi T-6295 (PFOS) MEAMTmoa5nue-lkL8iae-yy40n6xSi2e3a4ran93d8 ETS-8-5 l
Filename RSDYl-a-oSItpneqelu.oearfcrEeedpxtt:VraaclOuoet:VAnalyst: Date of Anatywii/Analyst Date of Data Reduction/Analyst:
See Attachments See Attachment See Attachments See Attachments 0089//2285//9999, R10W/0W5/99.06/14/00 MEE/MMH 09/29/99, 10/06/99, 0^15/00 MEE/1AS/MMH
Sample Data
WEEK 43 MONKEY SERA
Groap Sample n Deea
PFOS Cese. rtg/mL
Concentration or PFOS
ugtoL ar H Rec
Mpreoans
RSD Std. Dev.
hr/qiL MS/MSD RPD
Method Blk Matrix Blk QC - 250 ppb
GCroonutrpol1 0.0 mg/kg/day
MCirde-Depo#3 0.15 mgfcg/day
HH2200 BBDfltt--12 Rabbit Sera Blk-1 Rabbit Sen BIk-2 MMKKSS0058228599-M-MSSD--1I MKS08259-MS-2 MKS05289-MSD-2
110055552260XM4 1I0055554299FF 10055552035MM I05539F I05552F*
0 00 000000 020270 254 256 239 21.5 2312..82 22.9 162 111426 116
<LOQ <<LLOOQQ <19L012O%VQ.
<LOQ NA <LOQ NA 97% 11%
103% 96%
100% 7%
0.0287 00330 00..00336678
0 0319 . 0001203548140 0 0368 0 0000923
4446 95 5588.30
2.44
45 7 58 1
0012.4142299
HGigrho-eDpo4se 0 75 mg/kg/day
105511M 110055552323MF I05542F
167 226 447 347
9606.97 117399
214 78 8 1167.88 159 28 4
Limit of Quantitation (LOQ) PFOS * 5.55 ng/mL
Date Entered/By 10/05/99, 10/07/99, 06/19/00 LAC
Date Verified' By: before 06/08/00 TKR
PFOS Perfluorooctanesulfonate
Date purity c4orrSeecrtuemd/wuuntfiiaeldv:olum09e/1l2e/u00thtarnm0h.,5009m/1L2,/0c0onLcAenCtration* should be considered tentative 04/2&/00 LAC
NA = Sot analyzed, not applicable
Extracoon Volume Ratio Initial Volume/Fmal Volume
ETS-B-S I Excel 97
3M Environmental Laboratory
tox-030-era223-lC
9/lZ'00
Page 211
3m Medical Department Study: T -62 TOX-030
Report N o . FACT TOX-030
Covance# 6329-223 laboratory Request Number-U22 79
SPtruoddyu:ct Nuinber(Teit Substance)
26 Week Capsule Toxicity Study with PFOS in Cynomolgus Monkeys T-6295 (PFOS)
AMMlnnaaeatttrrlhiuyxomt.idce'alnllctEvSquoutfoitnpw.mareen/tVSeynsttoenm: Number Filename:
METoSn-k8e-y4 Slearnad ETS-8-5 1 AMmasesliLay0n6x234.938 See Attachments
R.Squired Value: SYDDl-aaolttpneaeteoorffcEAepxnttraalcytsitoAn/nAanlyaslyt:st:
Sec Attachments SSeeee AAttttaacchhmmeenntts! 0089/7258//9999, R10W/0W5/99, 06/14/00 MEE/MMH
DSWaatEmeEpofKleDDa4t7aa
Reduction/Analyst;
taMONKEY SERA
09/29/99, 10/06/99,06/15/00 MEE/IAS/MMH
C risp
Dm
Sample a
PFOS Csac. ag/mL
Concentration of PFOS
of/mLor % Rcc
Mesa USD PFOS Std. Dev. ug/mL MS/MSD RPD
Method Blk
H20 B3c-1 H20 Bfc-2
OX OX
<LOQ <1.00
<LOQ NA
Matnx Blk
Rabat Sera 30c-1 Rabbit Sen Bflc-2
ox ox
<LOQ <LOO
<LOO NA
QC - 250 ppb
MKS082S9-MS-1 MJCS05289-MSD-1
222574
19012%V. 97% 11%
MXS0S259-MS-2 MKS05289-MSD-2
256 239
103% 96%
100*/. 7%
Crisp 1 0.0Cmogn/tlcrogl/day
[05520M I05526M 105529F I05549P
2275..74 36.0 32.6
0.0339 0 0370 0.0481 0.0436
6 23 0 0355 0.X7 02421 0.0459 0X323
C riap J 0 1M5 imdg-DAocgse/day
I05505M 105523M 1I0055555329FF
111542 111148
445570.974 37 9
7 65
48 3 426
631.567907
Crap 4 Htgh-Dcac 0.75 mg/kg/day
105511M I05522M+ II0055553432FF
263 212 321727
105 21 0
110442 92
124 259 98 3 88 4372
Limit of Quanbtafion (LOQ) PFCS - 5 55 ntfmL
Date Entered/By 10*05/99, 10/07/99. 06/19-00 LAC
Date Verified/ By: before 06/08/00 TKR
PFOS =*Perfluorooctaneiulfonate
Date punty c*orrSeecrtuemd/winnitiaeldw: him09*/1le2u/Xthmanm0h,5009m/1L2,;XconLcAenCtrations hould be considered tentative. 04,7^00 LAC
\ `A " Not analyzed, not applicable
Extraction Volume Ratio * Initial Volume/Final Volume
EExTcSe-l89-57 1
3M Environmental Laboratory
tox-O30-tera223- 1C
9 /12/00
Page 212
3m Medical Department Study: T -623 & C ? TOX-030
Report N o . FACT TOX-C30
Covance# 6329-223 laboratory Request Number-U22 79
Study. Product Number{Test Subatance): AMMInnsaeatttrrlhuiyxomt.dice/aRnlteEvSuqoiufoitnpw.mareen/tVSeymstoenm: Number Filename R-Squared Value Slope: YD-ellneteorfceEpxtm: caon^Analyst: Date of Analysis/Analyst: Date of Data Reduction/Analyst
26 Week Capsule Toxicity Study with PFOS m Cynomolgui Monkeys TEM-T6oSn2-k98e5-y4(PS1FerOanSd)ETS-S-5 I AMmuesbLayn0x6234938 See Attachments See Attachments See Attachment! See Attachment! 0098//2285//9999, R10W/0W5/99, 06/14/00 MEE/MMH 09/29/99, 10/06/99, 06/15/00 MEE/1AS/MMH
Sample Data
WEEK 51 MONKEY SERA
Grasp D*u
Sample
PFOS Cane. ng/mL
Ceaceatretlen of PFOS
ag/m LorH Rec
Mean PFOS og/aL
MSS/iMdR.3SDDDevR.PD
Method BUc Matrix Blk QC - 230 ppb
HH2200 BBllkk--21 Rabbit Sere Blk-1 MRaKbSb0d8S2e3r9e-MBlSk--12 MKS05239-MSCM
00.0000 0.00 02.2070 254
<LOQ <<LLOOQO <9L1O%O 102%
<LOQ NA <LOQ NA 97% 11%
MMKKS30058228599-M-MSSD-2-2
225369
19063%% 100% 7%
Grasp I 0 0Cmogn/tkrgo/lday
I05520M 105526M 1I0055554299FF
1193 53 324936
0.0213 00261 00..00334348
14 0 0 0237 0.00333 00341 0.010.014803
Croup 3 Mid*Doe* 0 15 mg/kg/day Gr*p 4 High*Doae 0 75 mg/Vg/day
I03505M 103523M 1I0055535329FF* 10351 105522M II0055333432FF
119 108 15121 135 365 226817
39 8 36 0 4254.38
6.92 37 9 327.626 35 1 13.2
67 5 122
94 7 4308 64
87.1 95.7
9! 4 66 0657
Limit of Quantuaoon (LOQ): PFCS - 5.33 ngr'mL
DDaateteVEenrtiefireedd//BByy:; b1e0f/o0r5e/9096,/0180//0070/9T9K, .0R6/19/00 LAC
Date punty correcled/vtnfied: 09/12/00 mmh. 09/12/00 LAC
PFOS " Perfluorooctanesulfonate
* Serum initial toKune leu than 0 50 mL, concentration! should be considered tentative 04/28/00 LAC
NA Not analyzed, not applicable
Extraction Volume Ratio " Initial Vohune/Final Volume
EETxcSe-l89-57 1
3M Environmental Laboratory
tox-030-iera223-1C
9/12/00
Page 213
3m Medical Department Study: T -62Sfoc?t o x -030
Report N o . FACT TOX-030
Covance# 6329-223 laboratory Request Number-U2279
Study: 26 Week Capsule Toiaafy Study with PFOS ui C^nomolgui Monkeys
Product Number(Test Substance) AMMInnaseatttrrhliuyxomt:dic/eaRnletEvSquouifeitpnwm.areen/tVSeyrnstoenm: Number
TMESMo-Tao6uSan2pa-k908Le52-yy40n(1PSxl9Fe39aOnn3Sd)ETS-8-5 1
FRi-lSenqaumaree:d Value DDSYlaa-oIttpneeet:ooerffcAEepxntta:riaycmtio/An/nAanlyaslyt.st
DSWaatmEeEopflKeDDaSt3aatRaMedOucNtioKn/EAYnalSysEt RA
See Attachments SSSeeeeee AAAttttttaaaccchhhmmmeeennntttss] 111111///000348///999999., S1MA1''L1ll2//9999,, 1111//1282//9999 MIAMSH/1AS
CDramup
Sample *
PFOS Caaceatratian nCge/nuciL. agriaaLf PaFrOHS Rec
JO B a fc i
StdRSDDev MS/MSD RPD
Method Blk
K20 Blk-5 H20 BQc-5
0180370
<LOQ <LOC
<LOQ NA
Matrix Blk QC - 250 ppb
Rabbit Sera Blk-5 MRaKbbSi1t1S0e3r9a-MBlSk--56
MMMfKCK3S.S1l1111000333999--M-MMSSSDD-*5-5i
2.20 222339.978540054
<LOQ 0<.L02O3O7 0 0236
<LOO 0 0236
0 000N01A092453
111142%% 113% 2%
0.0GCmrogan/atkrpgo/l1day
(I0055552206MM I100555S2499FF
33.6 446898 52.3
00.00329629 00.00431759
0 0331 02060.186 0 0397 007083211
MGirda*aDpos3e 0.15 mg/kg/day
I05505M 3II000555555523239FMF+
112019 18013
43 9 7.15
48 5 3421.13
46 2 36 7
6317.23400
Craup 4 High*Dose 0.75 mg/kg/day
110055552121MM* II0055553432FF
216377 224446
514078 997869
45 5
80 8 9R2
003644.99809
Limit of Quantitation
(LOQ)
PFOS *
5
55
ng/mL Date
purity
DcDoaratreteecVEteendrit/fevireeedrdi/f/BiBeyyd:
0b19e1/f1/o12r5/e0/90096m,/10m18/h/20,400/99T9/1K2LR/0A0CI.AC
PNFAO"S N"oPtearpflpuloiccaobolcetanesulfonate
* SAerluthmouingihtialalbveolleudmue lMeuS/tMhaSnD0-.65,0thmeLse, cwoenrceennotrtatsipoinksedshaonudldwbilel bceonussiedderuedbtleanntkatsiveLA0C4/2118//1050/9L9AC
Extraction Volume Ratio * Initial Volume/Kwal Volume
EETxcSe-l89-57 1
3M Environmental Laboratory
tox-030-en223-lC
9/12/00
Page 214
IQ O
3ra Medical Department Study T -62SJVCf TOX-030
Report No. FACT T0X-G3
Covince# 6329-223 laboratory Request Nuraber-U2 27
Srudy" 26 Week Capsule Toxicity Study with PFOS in Cynomolpus Monkeys
MPraotdriuxc:t Number(Teil Substance) AMInnseattrlhuyomtdice/aRnlteEvSquouifoitpnwmaeren/tVSeymstcetmv Number
T-6295 (PFOS) MESMoTaouSsnps-k80Le-2yy40n1Sx19ea39rna5d ETS-8-5 1
Filename:
See Attachments
R-Squared Value: SYl-oIpnetercept
See Attachments See Attachments See Attachments
Date of Extraction/Analyst DDaattee ooff ADnataalyRsee/dAocn&aloyrsVt:Analyst.
111111///000348///999999,, S11A11//L1112//9999,, 1111//1282//9999 IMAMS H/1AS
SWaEmEplKe D57ataMONKEY SERA
GDreseuep
Sample *
PFOS nCge/mneL
Concentration g/aeifLPnFrOHS Rec
Mean oP(F/OmSU
StdR.SDDev. MS/MSD RPD
Method Bik Matrix Bik
QC - 230 ppb
H20 Bik-5 RabHbi2t 0SeBraikB-5lk-5 Rabbit Sera Bik-5 MMMM1KCKK-SS.SS11H11101CC30339399-9-M--MMMSSSSDD--56--65
021.8203070 2223399.875.40504
<<<LLLOOOQQQ 0<0L2O3Q7 011.101422%%36
<LOQ NA <l,OQ NA 0 0236 0 00001094253 113% 2%
0.0GCmroegnuAtrpgo/l1day
I05520M [11000355555224699MFF
36.1 453258.194
0.0289 000...000344671428
16 1 0 0327 0 00526 0 0445 0 80063385
Cmup J Mid-Dose 0 15 mg/kg/day
II0055550253MM I05539F I05552F
7719.14 83 1 78 4
2318.85 3313..43
30 : 72 8336 4 13
32.3 134
HGigrh*-uDpo4se 0 75 mg/kg/day
I10I00555555213213MMF* I05542F*
166 222725138
6869.55 110039
78 0 106
2106 83 33 6834
Limit of Quantitation (LOQ): PFOS ' NPFAO"S N=oPtearptJpuloicraobolcetanesuJibnate
5
55
ng'tr.L Date
punty
Dc+DoaratrSeteeAecVrEltuteehnmdroti/e5uvirengetdinhdt/if/alBiBalebydyveolleudm0b1a9e1esf//1o1lMe25reu//S9009/0tM^h,m0aS1n8m1D/0/0h2-.6,054,/009t97h9m/Ke1Ls2LRe,'tAXcwCo)enLrceAennCtortatsipoinksedshaonudldwbilel
bceonussiedderaesdbtelanntaktsiveLA0C4/7181//1050/9L9AC
Extraction Volume Rato Initial Volumc'Final Volume
EETxcSe-l89-57 1
3M Environmental Laboratory
tox-030*era223-lC
9/12/00
Page 215
3m Medical Department Study T - 6 2 % ^ c ?TOX-030
Report N o . FACT TOX-030
Covince# 6329-223 laboratory Request Number-U22 79
SPtruodduyct Number<Te*l Substance) MMAnaeattrlhiyxot:idc/aRleEvqwuoipnment System Number: Instrument Software/Venion RFi-lSenqaumaree:d Value: SYl-oIpnet.ercept
DDDSaaaatttmeee ooopfffleAEDxnDatatralaayctRxatWieodnAu/cAntainolyanls/ytA.stn:alyst:
26 Week Capsule Toxicity Study with PFOS in Cynomolgus Monkeys ESTMMSoeT-oa6euSsn2pAi-k9L085et:y-ty0a4n(1cP.Sx1h9Fem93arOane3Sdn)tEsTS-S-5 1 SSSeeeeee AAAttttttaaaccchhhmmmeeennntttsss \11111///000843///999999,, SU1A1//1L112//9999,, 11W1/2128//9999 LMAMSH/IAS
WEEK 61 MONKEY SERA
GDroamsp
Sample U
aPCgFa/OanseSL.
CoaceatraUe* mffmaLf PaFrOHS Rec
uMPgFe/OaanSL MSS/UMRS3DDDevR.PD
Method Blk Matrix Blk
QC - 250 ppb Group 1
00 mg/kg/day
H20 Blk-5
RabHbi2t 0SeBrIak-B5lk-3
Rabbit Sera Blk-5 MMKKSSl U1003399--MMSSD-6-6
MMKSSl111003399-M-MSSD-5-5
II0055552206MM-
I10055552499FF
0 830 21.2070 22239.975.4504 380 4379.87 5347.07
<<LoOoQ NA
A
8
<LOQ 00<..L002O233O76
<LOQ 0 0236
NA 0 000.10902453
111124%% 00..00338129 00..0044363
113%
2% 12.8
00351 0.40064849
0 0448 0.00210
MGirda-Dspos3e 0 15 mg/kg/day
II0035550253MM II0055553592FF*
689845 9943 88
27 4 3358.09 38 4
31 6 051.7894982 38 2 0.283
0.7H5Gigmrhag-aD/pkoga4/eday
110053552U2MM 110055554323FF
322173761392
64 7 111030869
100 109
5500..23 00 669470
Limit of Quan&taQon (LOQ) PFOS - 5 55 ng/mL
DDaateteVEenrtifeireedd//BByy:: b1e1f/o15re/9(9W, 0181//2040/9T9KLRAC
Date punfy corrected/vcnfied 09/12/00 tnmh, 09/12/00 I.AC
PNFAO-S S- oPtearpOpuliocraobolcetaneaulfonate
- SAerluthmouingihtialalbveolleudmaeslMeaSs/tMhaSnD0-.63,0thmeLse. cwoenrceenntortatipotnksedshaonudldwbilel bceonusaiedderaesdbtleanntaktsiveLA0C4/1218//1050/9L9AC
Extraction Volume Ratio " Initial Vohime/FinaJ Volume
EEx7cSe-l89-57 1
3M Environmental Laboratory
tox-030-sar223- 1C
9/ 12/00
Page 216
3m Medical Departme: Study T -6 29Pa c t t o x -030
Report N o . FACT TOX-030
Covance# 6329-223 laboratory Request Number-U22 79
Study 16Wsek CapsuleToxicityStudysnth PFOS in Cynomolgus Monkey*
Product Numbr(Tcft Sobetance) AMMIFninlsaceatttnrrlhuiyaxomtmdicee/aR:nlttEvSiqoitufoitnpw.minen/Vt Stnywutmrm. Nu-nMt SRDYl-eo-SLlpeqnu:to*affrcaEdJptaVtraaeJuDao: /Analyst
WDOSuaotEtmeEoopfKflDAean6Dta5alayRtiMatefd/AOacnNtaiolKyni/tEA. nYalySeEt RA
SCSSSTRMMEmmmMe-Tuo6eubS/2n7eAAyAA-49kL8/5nttte-10yttt4yaaaa00n(.cccc0P1Sxhhhh4FSmmmm9a3rOAv9neeee3SLdnnnn)/ttttFKasssTJKS-8-5 1 0044//2275//0000,,0034//0217/A00.,0034//0218//0000,, 0055//0043//0000 IlAASS/MMH'ADV
GDrouwmp Method BUt Matnx 01k
QC - 250 ppb
O.OGCmroagns/tkrpog/l1day
Sample MRRBB0K04SS4S20020444446O222-44-H400H0--22SS-OS0eeerrBaaantlkkBBB--lll34kkk---433 MMMMMKKKKKSSSSS000004444422222444440000O>---SS-SSSeeaaearsnan-s--U-MMBMSJSSDSk---04-3434
IK1Q0333S3535522420699MMFF .
000tpC28g.3936or/7039m43os000eLs. U3332023166600 32111442....1577
Cla/aaocLfapourrtroHastioRuee 00<<<<.11109.LL0LL2212007O2900%709%%%QQ5Q050 0000....0000231336856447
aMpgr/esostaLs MSS/iMdR.SSDDDevR.TD
<LOO MA
cLOQ 0.00852
NA 001061.944
t07% 27%
123% 167%4
00210 0 0360
000.0010043356232
0.1M3Gimdra-gD/skepge3/edey 0.7H3Gigmrhag*s/Dkpoge4/dsay Lumi ofQuantitation (LOQ) PFCS
PNFAO"S M" oPtearpflpulcicraobolcetaneeullbnate
*
5.351rIeIIIOI0010g00C503-55f33m55355i253l420Ll235323M5M92FFMMFF**** Date
punty
232164091438
33336292.0399
32 9 37 6
245363823474
85719263.1075
91 5 82 8
cDDe*aratretSeaceVtrEauendmrit/faviireansdnidt/fi/iaBBa]dyyv:.ota000m569e///001l322e///s000t000t,hm0Ta3nmK/0hR09,3/00090m/1L2I^/,0Ac0CoLn'CcASeCHntnooni
Extraction Volume Rat " Initial Volume/Tinai Vohim
006269..51000..5113826..3782826209 ihouJd be considered tentative.
04/28/00
LAC
EExTcSe-l89-57 1
3M Environmental Laboratory
tox-030-Mft223-lC
9/12/00
Page 217
3m Medical Department Study T - 6 2 9 Tox-030
Report N o . FACT TOX-030
Covmncc# 329-223 laboratory Request Number-U2279
MMAFPISnirtnmlceuoeattddntrhlyyuuauo:tmmcdi-ct/eeaRNn:letuEvSmqiaouboficptnwrm:tTvetne/tsVSScyumwboormnunNceu)mber
12*64W29e5ek(PCFeOpScu)le Tonaty Study mth PFOS mCynomalguc Monkeys METoSn-kBe-4y SIennd ETS-B-5 1 RMSeucuby*A.t1yta0rc0wh6m9J93ent!
DDDRSYSWl--uuaoulSpEeermsuqeoooE*:upfrffuKltDE*AeepdanD6trua.aV9lCcayafDtUtulrruMaaootdefntuuAe/OcpAnUNaMolycdKv*y/EAYjulySE. RA
Sample *
0<0SSS4W4cee//ec22734AAA7/A'0t0ttttt00aaa..ccchhh0OSmm4mAS/^ee2eLtnnn7./'tKttO/*s0!JO0K., 0O4S/^3lA/0X0).. OOVSOWi/OOOO IlAASS'MMH'ADV opCfor/toeacsL. uCt/ouoLfcepourrtroHesttoRde< ipMmreoeLns MSS/tMdR.SSDDDevR.PD
Method Bli MMru 31k
QC . 250 ppb
0 0CCmroo^nuktrpfo/ld1ey 0.)M5Cmirdoj.yuDYpofSec*'day 0 7K3Cifmrho-guD/pko^e4deay
MMMMMMRRKXBfKKKX00SiSSSS4SS4S002OO&04034044242044O40242422-2.OH4Q04H4400-00-0-.22SS.S.S--OSS0ScSeecUcrrrmnBvBnvan1.lMZ.MMkMBBBBk*S-llS3llS4SkkkkDD------434-433.43 1IIII101III10000000003003555555355535SS553S5523J220232345124035439992IM2MMMMMFFFFFF++
000212333..133.913021709.36444050000 2U324443333549202544672.S9.1449113452
000000<<<<0111..942333770.LLL0101021200721140422432OOO.93?37..%.9140902797036%%3Q3QO03410904
<LOO NA
<ioo 0.00852
0.01N06A1944
107% 27%
123% 00406 00400 264 34 5
St 0 75 0
00073670792551602.0.02420755%B334063014290103]
Lima ofQuuttaMion aOQ): PFOS - 3.52 n*mL
DDuueeVEenrilfeireedd//BByy: 0054//0032/-0000, 0T5X/0R9/00 LAOCS1I
PFOS * PerflocroocUneruifontfe
Dae puncyco*mSceurdum/vemnmfiaeldv:olu0m9/e12le/00tmhamh0, 5090/1m2L/0.0coLnAcCeniruon* should be considered tentative 04-2400 (.AC
ETS-e-i l
Eatel 97
3M Environmental Laboratory
Ioi-430-em223-1C
9-1100
Page 218
3m Medical Department Study T - 6 2 9 :j>A(3r t o x -oo
Report No. FACT TOX-030
Covante &329-22J laboratory Request Number-U2279
MYPUFRSDDDAlSSWilirut-nioaaa-luotlattoaSr*p**aEkdrdnuuluyoqyupooovxE:ztcdurnffinflttc/Kanc*EeDAKaN:npdlxnialtuD7vEt:a*VrSm3uqtaayRatoucbtointiaaciMlipnuadohrm:/:fonAmTOca/UAMnwN/kwnVySaKSVaynyuAE*aboneaYnamwi.yeSN*Eu):mRbAer
CDrmoup
Saapk >
MahodBlk Manx Blk
QC 230 ppt>
0.0CCmroo^nuktrpfo/dl1uy
MMMMMMRRKXKBKBXKOSO3SSS3SS40040200040O42U44W3444M4!3JO212MO30CD344OC-44iJ-35H5O00OK002--25S--SS2---24S-32SSS0S99*M*Mrc*reFFmrr*BvrBn+na-Ml--MtkBBMMtBB--SlSl34llkkSSkDkD-----34-4-33443
02TMERMSS5S46t-Tu*a/*o*2bWS2an4AAyAASt-kL/l30fCBar-1iyty40aak0xa(rcrP0cruSthCIiShFaum3AzanOn*nnpua3caLSenafntTti)tiueuaElOaT*TSo-x-ic5it1y Study wih PFOS in Cynomolgua Monktyi 0044//22M7/J0.. 0O4iO/2l7.'O/0O0,. WOV/2OSl//O0O0,. 0OVVOOV*OO0 IlAASS'NiMH'ADY
000uCp22221331132.3.92427702413o13r93..../0054v17o0a0eLs.
vC/N*o00LCf<<0000<<1I19...0LLLLp2000M21t2073OOa23OO279rr9H453%%HloQOQO5%Sn94I04sURteie
upMtr/emoansL MSS/MtdR.SSDDDrR,PD
<LOQ NA
<LOO 0 0052
0 N116A944
107% 27%
113% 6%
0 0350 0.0345
00.3700021721*54
0. lM5CmxrIoj-ADupo/m3d*y 0.7H5Cimtrhoj-u/Dkpso/4wdy Lun* of Qumitaion (LOQ) PFOS -
NPFAO*SNoPt*arpfpluliocraobolectai**uifonac
3
55
1I10000355S3555250332S9MFMF*+ (IrOI0o355s5S5s243i223iMFMF*np/mL
Da*
punty
cDoDararSa*ccVtEretud4332nrml1!1t/072235tfvS47m103iieandnda/f/iiBBaaidyyv-otu000m4*9/0/*01322l/a//000a00a0,tm0hTaSmK23223752n07343W344Rh..0015.0791.W0590/1mL2LA/0.C0cCoLn5AcHCemne225li4?5c"'43rui
ihould
be
4211.1796.1163
5219073132l considered
tentaive.
EJdnctcn Votum* Rato (rubai S'olume/Final Votum*
04/21/00
LAC
3M Environmental Laboratory
loa-430.*n223-IC
9/12/00
Page 219
3m Medical Department Study T - 6 2 9 Ac t TOX-030
Report N o . FACT TOX-030
Covane# 6329-223 laboratory Request Number-U22 79
SPtruoddyua Numbct<TMSubMance) MFMRA(ni-aMalSanxnqtayntxumot.aiodcrcalea.UldtEvVSiqaoauoifintfpwcim::wean/tVSeyrMnocnm: Number YDSl-otlupnUomf Erjpelracuon/AnMyM:
DDSMmu*noopffiDAcunDalayRnteaad/AucntaiolynM/A:nniyM:
T1EM000MRSSSS4446eeee-Tu6o///*aeee27b3'S2nnV574yAAAA-9kL//l/t3t00tte0-t!ttttyt400y00aaaka(n...ccc0cP1ShihhCh600SFmmmme9345aAO9n//ieeee2031tdSnnnno171tttt)K//i*E00eJ00TK..TSO0w-4Vlo-/O32eSla/l/Oy0O0S..tuO0d5Vy/00wM4/0*W0h
PF05 in Cynomolgui IIAAS&MMH'ADV
Monkeyi
WEEK 77 MONKEY SERA GDrootup
Sample
pC|/roaoseLs.
CocBefcLPreePtrOrHaSttReeee
uMPiFteOahnSL MSS/iMdR.SSDDDevR.PD
Method BU ManxBlk
QC - 250 ppb
0 0CCroenetrpol1 0 1M5C*mrde-pDe'kopj*/)eday 0 2H5Cimtrbof-u/Dkpef/4adtay
MMMMMMRRKXBKBKKXS00SSSSS045S404O0020020424444444244202320422O-44*4-044HH0-000-00S--2S--2--SS4SSOSeS0Teer*cOrBerrrBrae*--tltM--kMkBBBBMM--llS3lSU4kkSSkDD------433443--43 I11I11JI100I0I00000000055S5555SS555555SS3S553S542052M432132220539923I9FFMMMMFMFMFF--+**+***
00012n3323.93307213(o309660645000 724411143111105661201102.131401093?92
000000<<<.1114.317.,920022LILLL0000112302710173t32O023OOO972.%.7139009594551%%5%O5QOQ4459?0
'LOO KA
<LOQ OOOS52
SA
0 01061.944
10*% 2?%
123% 00296 0 0303
22 5 1)0 60 0 57 0
000065220I60S.064*7%313O360?763273 6331319)6831
Unul of OueiiUMxm(LOQ): PFOS = 555 np*mL PFOS * PcrfluoroocunevuifonMe
Dmpunty cDoDMmmeScetVerEuedrmr/tiVfaiireentnddift//iiaBBcldyyv:olu000mV96/0e*1322l/e0**Oa00.tmhT05amK/t0RhW0. 005Q90/m1LAl,.0C0c'oCLnAScHCenttMion ihould be considered teniMive.
04/21/00
LAC
\A - Not applicable
Extraction Volume Rjkio" Inaiai VolumeTmal Volume
ELTxSr-l#V-5T 1
3M Environmental Laboratory
tox*03O-n223-1C
9*'12*00
Page 220
3m Medical Department Study T -6 2 9AcfrTox-3o
Report No FACT TOX-030
cawi#6329-223 laboratory Reques Number-U2279
MSPMtruoaxdndhyxuoc:dt'KNruvmubuenr:tTrtt SubfUncc). RFAIni-nlaSeacnqlryauumtmaicremae:ld*EVSqoanlfurtpwenwrac/iVScymaeemn Number Slope DYDD-aaaIeaentoooafrffcEDAeapnantaactytRitoetadn/a/AAcatiaaoalnyl/yaA:an: aiya:
26 Week C^auit Toacity Study with PFOS u\ Cynomolju Monkey*
RMTME-uTao6bSnn2yL9k-tSey-1y40n(0.PxS16Fe93KO9n.3iSd)ETS-J-5 i
SSeeee AAttttaacchhmmeenntt*s
SSeeee AAtttuadchamnceantti!
000444/-.717743///000000..
O034AS/'OL77I0//CO0OJ0K,. 0045//2091//0000..
OVOVOO IA5/MMH-ADV 0VO4AX) IAS
SWaEmEpKle D79ataMONKEY CDrmaa#p
Method Blk Manx Blk
QC 250 ppb
0.0CCmroan^at^rpodl1ey 0. IMSCimtdc-^De^opde)eary 0.7H5Ci^mrhof-a/Dkpoj/e4deay Limit of Quanuuoca (LOQ)
SPFEORSAMM-MMMMRRKX5KBKKK0SS03S3S4SSS40050O3010O0244144II404nS442430J1eOMH01IIC22333*00S4aC940i5503445e-4-4350m/3eS055355H33Kt00203503-04-5L3S3U)J--2p22S2-SL0-2224-25S3S3SSS-40-Ol3S0ee3992-91e-ee1eeeMMM1mMrFFIeFFrMrBMrrvrBDFFsaana*a-Ml--lM-BkaBMkBBM-eSI-l3Sll4kSpkSkDkD-Ou---O4-443nO4tycoDrDraaaeceiVeEd0e00pC1221133112322t23/111ri9c.21a.1v6337252916i303n54r6o7/3.f.mS093.e34102422o43b560s95i000reesidLd.f/i/BeBdyy:
Cto/moofclepoarrtorHasttoRaee
00<<<<1I1900LLLL12200OOO9O72H97MHH3OQO3Q40
uMPKFe'ObanSL
'oq i.oo 000032 107% 123%
0000..2..111000091291222.909136754060
0 0215 0 0243 19 1 21 4
000369///001122///000000.m0T3m44K23/90230Rh9620.4/0090/1L2A/0C0-LCASHC
41 1 41 4
MSS/MUR.SSDDDevR.PD
KA 001N061A944 27%
6% 0000046922211U00.43.59.3274230S00296099311565
PFOS Perflnorooctaiefulfonae
- Serum inkial volume leea than Q.50mL. concimmiona ihould be coftfidmd tentajv* 04/79/00 LAC
N A -N ct applicable
Extraction Volume Rao " (nkial Volume.Fuul Volume
CExTcSe-l1T-3 1
3M Environmental Laboratory
iox-030-eera223- 1C
9-1: w
Page 221
3m Medical Department Study: T - 62 9F5A .C7T -T O X -0 3 0
Report N o . FACT TOX-030 laboratory Request Number-U2279
Covance# 6329-223
SPtnuxdJyu.ct Numbcr(Tesl Substance): M atru: MAneathlyotdic/RalevEiqsjuoinp:ment System Number: Instrument Software/Venion: Date of Exiractinn/Anaiyst: Date of AnaJysis/Anaiyst:
Dale SofaDmaptaleReDduacttaion/Analy *t
MONKEY LIVER Week 27
Group Sample # Dose
Method Blk
RBL05189-H2O 81k-3
RBL0S189-H2O Blk-4
Method Blk
RBL06119-H20 Blk-11 RBL06119-H20 Blk-12
Method Blk
05230-H20 Blk-5
0523O-H2O BUc-6
Matrix Blk
RRBBLL0055I18899-L-LV\Tt
Blk-3 BUt-4
Matrix Blk
RBL061 19-Lvt Blk-11
RBL61 19-Lvr Blk-12
Matrix Blk
RBLD5230-Lvr Blk-5
RBL05230-Lvr BUt-6
Matrix Blk
MKL05230-Lvr Blk-5 MkL05230-Lvr Blk-6
QC - 250 ppb
I05508M-MS
05/18/99 QC - 250 ppb
I05508M-MSD 155I7M-MS
06/11/99
105517M-MSD
QC - 250 ppb
MKL0523O-MS-5
05/23/00
MKL05230-MSD-
Group 1
10S5O8M 6/11/99
Control
I05517M 6/11/99
0.0 mg/kg/day
Q5508M 5/18/99
1055I7M 5/18/99
IC5519M 5/18/99
105527M 5/18/99
I05530F
10553 IF
II0055553454FF
Group 2
1055 UM
Low.Dose 0.03 mg/kg/day
IQ5515M 105516M
I05521M
I05537F
I05541F
105547F
ext 5/23AJO
105547F
I05550F
Group 3
I05510M
Mid-Dose
[Q5518M
0 15 rag/kg/day
105524M I05528M
I05532F
10538F
IQ5545F
I05548F
Group 4 High-Dose
I05507M 105512M
0.75 mg/kg/day
105534F
I05536F
I0555545G1FF
Limit of Quantitation (LOQ): PFOS * 30.0 ng/g
NA Not analyzed. not applicable PFOS Perfluorooctanesulfonate
26 Week Capsule Toxicity Study with PFOS in Cyrnroolgos Monkey
T-6295 <PFOS)
Monkey Liver
Filename
See Attachment*
FAAmCeTb-aM06-I24.O98k.
FACT-M-2.0. 2.1. Madeline (Ml098.
FTS-8- R-Squared DaseyOSlope
Value:
See Attachments See Attachments
MassLynx 3.2 3.3
Y-tniervepi
See Attachment*
05/l8<99. 06/11/99. 05/23/00 SAH/SRP/SKH/SAI.
05/19/99. 05/22/99, 06/09/99. 06/14/99, 07/2999. 06/U/99. 05/25/00 KJH/HOJ/MHH/SAH/lAS
05/20W. 05/25/99. 06/10/99. (W22/99, 08/04/99. 10/1299. 50-2MX) KJH/NOJ/Mh'Pl/MMH/lAS
p r o s C m rn tn m Mean RSD
Calc. Cone. 0.t0/0t
m frt<orLrrOo%QaRee.______
PFOS "8/8
MSS/Mtd.SDDeKv.PD
0.454 <LOQ
<LOQ NA
0.00 <LOQ
NA NA
<1.00 NA
0.00 <LOQ
1.64 <LOQ
<1.00 NA
0.00 <LOQ
3.43 <LOO
<1.00 NA
0.00 <LOQ
NA 01.3.2951
<LNOAQ <LOO <LOQ . <t.oo
NA NA
15.2 <LOQ
97 482 305
<1L74O%O 110%
<LOO 142%
NA 45%
300 101%
305 103%
102% 2%
239322 m98%%
104% 13%
564 0.564 ++
143 0.143
477 0.477
119 0.119 R 91 0.091
22.2
129 0.129
0.121 0 0269
128 0.128
112 0.112
87 97
00..008977
0.106 001167H8
18237 182
22709 227
11417 16734
1161..74
27 0 17 3 4 66
22818 22.8
24847 24 8
282623
283
20102 20.1
9 73
20735 20.7
22.1 2.15
42169 42.2
86173 86
58673 58.7
33 1
48203 48.2
58.8 19 5
80421 80.4
49590 496
6861533726
66.5 81 4
21 4 69.5 149
412474 378723
412 379
396 62.3039
280575
281
256669
257
267328
267
5.00
287223
287
273 13 6
Date Exilerexi/By: 05/25W. O^IOW, 06/22/99. 10I2/V9 IAC
Dale Verified/ By: 06/02/00 PJW. 06/05/00 TKR
Date Punty correctedVerified/ By9/12/00 mmh. 09/12/00 I.AC
Sample determined an outlier and waa not included in any calculation*
Sample used for MS/MSD appear* to be spiked accounting for low recoveries. Sample 105507M will be used for the MS/MSD and 105518M cone. Vcnfied.
Sample
105507
St
IS will be rextractcd.
R = Sample reextracted along with MS/MSD. This value *a* mi used in any calculation*
* Sample determined an outlier and was not included in any calculations. Was extracted 05/25/00
FFAxcCeTl -9M7 -2.1
3M Environmental Laboratory
tox-030-liver2231B.xls
9/12/00 5:59 PM
Page 222
3m Medical Department Study: T-6295.7
3M Environmental Laboratory
DDPMMAIDSntraaanusacotllatdtleeedrrhlyuuiytooox:mxctff:fitlc/eDAERaNnlxnaetutlEavSmraliaqoysRhcuifstoeleiiiwpsrnodf/m:nuAaT/rceeAnelnsia/nolVtlaynSSels/uyryAts:bssinttso:eatnaml:nycsNte:)u:mber:
Sample Data
FACT-TOX-030 Covance# 6329-223 ETS2MM1116o00-0To6au///SW111sn2p-s584k98le0///e5.99-9ey2y699k9n(0.P,,,Lx01CF11i19&v3aO0009pe.///2,Sr222sEAu)015&Tl///me99S93999Te.,,83loi-S11ax700Ei00c//E226it/252yR//499W9S999t,,Wu1d10y0//22w67i//t99h99P..F11O00//S2297i/n/999C9yIMnAoMSm/HMo/l1gMAuHsSMonFSRYkli--eolSIeypnnqsetaue:mracreee:pdt:Value:
SSSSeeeeceec AAAAttttttttaaaacccchhhhmmmmeeeennnnttttssss
M O NKGDErooYsuepL IV E R Day 393SaBmioplpes#y
MMMMaa1111eett0000rrtt//ihi/h/21x1x2oo5445ddBB////9999llBB9999aanllnkkkk
25QppC1m-02/A2550/59p09p0mppb 0 7H5Gigmrhog-uD/pkog4s/deay
RRRRRRMMRRBBBMBBBBBKMKLLLILLLKLL0ILIILIK10II500011L010I5052LII0001I011I512I444052202I00244045992509552555552999-5-F2-99555959F--HH-H25---9LL13H4---MLL29LL22M-3I22vv2MMM-vvOOFFOvvSrrMOSrrrrDSBB-BBBBBSBB1BD-lllll-llkIkllklkk2kk-kkk---2------1I1-1212112I212
Ca411111lP29c40473n038245NNNNFN18.7525g....029005416OAAA5AC9A42/18058802g64768So117453ne,
uCro/ron<<<<<fco7588LLe4LLLNNNPNN111r97382n437OOOOOFAAAAA%%%%2%285tOQQQQQraSRtioeen.
PMUFegOa/gnS MSS/MidR.SSDDDeRv.PD
<LOQ NA
<LOQ NA
<LO0 NA
<1.00 NA
<LOQ NA
68% 30%-
85% 140 298
32551..8%744.4784
LimnofQuantitation(LOQ): PFOS=26.9ng/g
DaleEnlered/By: 10/22/99. 10/25/99. 10/29/99LAC. 11/05/99GML
DaleVerified/By:06rt)5/00TKR
DalePurilycorrecledVcrified/By:09/12/00mmh.09/12/00LAC
NA=Nol analyzed, nolapplicable
MS/MSDsamplescxlracledan10/14/99werenai wiihinrecoverycriteria,andsampleswerereexiraeledan10/25/99
PFOS=Pcrfluoroocianesulfonair
atahigherconcentration. TheearlierMS/MSDsampleswerenolspikedatahighenoughlevel inrelationtotheendogenousPFOSlevels
ReexiraeledMS/MSDswerewithincriteria. LAC12/14/99
Tocalculatetheextracteddensity:(initial liverweighi/(initial liverweight+Milli QWateradded) TocalculatethePFOSCalc.Cone.: (PFOScone,ng/gXdensityofcurveliverhomogenateg/ml.)/extracteddensityg/mL)*PFOScorrectionfactordilutionfactor
Report No. FACT TOX-030 laboratory Request Number-U2279
Page 223
FTS-8-7.0 Excel 97
lnx-030-liver223-IB.xls
9/12/00 4:00PM
3m Medical Department Study: T-6295.7
3M Environmental Laboratory
FACT-TOX-030
Study: Product Num bcr( l est Substance): M atrix: M cthod/Revision: A nalytical Equipm ent System Num ber: Instrum ent Software/Version: Date o f Extraction/A nalyst: Date o f A nalysis/A nalysl: Date o f D ata R eduction/A nalyst:
Sample Data
26 W eek C apsule Toxicity Study wilb PFOS in C ynotnolgus M onkeys T-6295 (PFOS)
M onkey Liver ETS-8-6.0 & ETS-8-7.0
Davcy 070799 M assLynx 3 2 & 3.3
3/22/00 SAL 03/24/00, 03/27/00,03/28/00, 5/5/00 M M H , IAS 03/27/00, 03/28/00, 03/29/00, 5/8/00 M M H , IAS
Monkey L ive r Wks 79 & 80 G roup Dose
Sam ple #
M cthod Blk M atrix Blk
RBL03220-H 20-Blk-5 R BL03220-H 20-Blk-6 R B L 0 3 2 2 0 -liv erB lk -5 R B L 0 32 2 0-liv crB lk -6 M ICL03220-liverBlk-5
QC 250 ppb
M KL03220-liverBlk-6 M KL03220-M S-250ppb-5-1 M KL03220-M SD-250ppb-5-2 M ICL03220-M S-250ppb-6-l
M KL03220-M SD-250ppb-6-2 l05505-M S-50ppm -5-l l05505-M SD -50ppm -5-2
G roup 4 H igh-Dose 0.75 m g/kg/day
10551 1/M /W k79 105522/M /W k79 I05533/F/W k79 105542/F/W k79
G roup 3 M id-Dose 0.15 m g/kg/day
I05505/M /W k80 I05523/M /W k80 I05539/F/W k80 I05552/F/W k80
Limit o f Q uantitation Limit (LO Q ): PFOS = 26.9 ng/g
PFOS Calc. C one.
ng/g 0.00 0.00 0.00 0.00 0.00 0.00 216 186 266 232 54408 47351
23480 70781 42668 57895
8252 10203 24728 17690
PFOS = Perfluorooctanesulfonate NA = N ot applicable Date Entered/A nalyst:
Date V erified/A nalyst. Date Purity corrected V erified/ By:
04/05/00, 04/06/00, 5/10/00 M M H , CSH
06/05/00 TKR 09/12/00 mmh, 09/12/00 LAC
C oncentration of PFOS
u g /g o r */ R ee <LO Q (30.6 ng/g) <LO Q (30.6 ng/g) <LO Q (30.6 ng/g) <LO Q (30.6 ng/g) <LO Q (30.6 ng/g) <LO Q (30.6 ng/g)
72% 62% 89% 77% 95% 81%
23.5 70.8 42.7 57.9
8.25 10.2 24.7 17.7
M ean PFOS " g/g <LOQ <LOQ <LOQ
67% 83% 88%
47.1
50.3
9.23 21.2
RSD Std. Dev. M S/M SD RPD
NA NA NA NA NA NA
15%
14%
17% 71.0 33.4 21.4 10.8 14.9 1.38 23.5 4.98
Report No. FACT TOX-C30 laboratory Request Number-U2279
Page 224
E T S -8 -7 .0 Excel 97
TO X -030-liver223-lB.xls
9/12/00 4 16 PM
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
3M Medical Department Study: T-6295.7
Report No. FACT TOX-030 Laboratory Request Number-U2279
Attachment F Example Calculations
Formula Used for Sera Analyses in Study FACT TOX-030 AR (ng/mL) x DF x SC x FV (mL) x 1.0 pg = pg/mL x PC = Reported Cone (pg/mL)
EV (mL) 1000 ng
Calculation Used for Group 3, Week 1, Animal ID 105505M
287 ng/mL x 10 x 0.9275 x 1 mL x 1.0 pg = 5.32 pg/mL x 0.864 = 4.60 pg/mL
0.5 mL 1000 ng
AR-- Analytical result from MassLynx summary DF-- Dilution factor SC-- PFOS salt correction constant (0.9275) FV-- Final extract volume (1.0 mL unless otherwise noted) EV-- Volume of sera extracted PC-- PFOS purity correction factor (86.4%)
Formula Used for Liver Analyses In Study FACT TOX-030
AR (ng/g) x 8 curve ( 0 x SC x DF x 1.0 pg = pg/g x PC = [PFOS] sample (pg/g)
d sample
1000 ng
(l)
d curve is assumed to be:
1 g liver 5 mL H2O
Calculation Used for Group 3, Week 27, Animal tD 105510M
524 ng/g x 1 g/ 5 mL x 0.9275 x 100 x 1.0 pg = 48.8 pg/g x 0.864 = 42.2 pg/g
0.9963 g/ 5mL
1000 ng
AR-- Analytical result from MassLynx summary d curve-- Density of the liver standard curve, assumed to be 1g liver/ 5 ml water d sample-- Density of the liver sample (1 g sample/ 5 mL H,0) SC-- PFOS salt correction constant (0.9275) DF-- Dilution factor PC-- PFOS purity correction factor (86.4%)
3 M Environm ental Laboratory
3M Environmental Laboratory
P a g e F-1
Page 225
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Attachment G Intrim Certificate of Analyses
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-112279
3M Environmental Laboratory 3M Environmental Laboratory
Page G-1
Page 226
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
INTERIM CERTIFICATE OF ANALYSIS
Test N_Ca_me_ne_t_r_e_A__n_a_ly_t_i_ca_3l_M_L_aRP_brRe_oofePredvaaruiterscoiinttorS:cynipe:eeP#s1c8F:i(Cf96iOc/OS.a97SDt%/Ai,0o-0Ln0R)s1oe8tfe2r1e7nce #: 023-018A Purity1
Result 86.9%
AIdpepnetaifricaNantcMieoRn Met2a1l..s (MCICaaPlgc/niMuemsSi)um Tota45367l.....%NIMPSIrmooioacdtnpnakiuusgesarmliinutyems(e2NMR) TRTP((GLOooeCltCtAaaa//tllMAMe%%dSSC))IImmomppuuprroiiuttyynds RPuersiidtyubalySDoSlvCents (TGA) Inor23g1...aniBCFclrhuAoloomnrriiiiodddneees (IC) Orga45671n..... icNNPTSAuhiFittcolrArfisadiaptttseehe34at(IeC)
243... NHPFFFPPBAAA Elem4231e.... ntNHCSaulaiytlrAdrfbuornoograngelenynsis6:
5. Fluorine
White Crystalline Powder 24351..... TTTTThhhhheeeeeooooorrrrreeeeetttttiiiiicccccaaaaalllll VVVVVaaaaallllluuuuueeeee ===== 05061%%0.79%.58%%
Conforms Positive 2435671.......81..4900<06<113....00.00084ww..0004030tt1559009..//11wwwwwwwwwttttttt......V%%////ttwwwwV.w/wtttwtt....%%%%%tt..%% None Detected
NN0o.o3tn3AepwDpte.l/tiwceact.tb%elde1 4235671....... <<<<<0000008.......5000700916040059067wwwwwwwtt../tt/tttww...../////wwwwwtt..%ttt%tt.....%%%%% 4231.... <<00..0021..8011wwwwtttt../.7//wwwwtttt....%%%% 24351..... 0581I4...2287..1444484wwwtwwtt.../tt//w..ww//wwttt...%tt%%..%%
COA023-018A
3M Environmental Laboratory
Exact Copy of Original
InLiAtiIa--i OatscaIizjc.
Page 1 o f3
Page 227
3m Medical Department Study: T-6295.7
Report No. FACT TOX-G30 laboratory Request Number-112279
INTERIM CERTIFICATE OFANALYSIS
Centre Analytical Laboratories COA Reference #: 023-018A Date of Last Analysis: 08/31/00 Expiration Date: 08/31/01 Storage Conditions: Frozen <-10C Re-assessment Date: 08/31/01
F0'P.l3uu3or%ritiyd)e=,
01.0509%%-+(NsuMmRoimf mpeutraitliiems,p1u.r9i3t%ies+, o1r.g45a%nic+aLcCid/MimSpuimriptiuers,it0ie.3s,88%.4+1P%O+AInAo,rganic ToPtaulriitmyp=ur1it0y0%fro-m1a3l.l09te%sts==861.39.%09%
2Potassium is expected in this salt form and is therefore not considered an impurity.
o3PbuserirtvyebdyfoDrStChisissagmenpelrea. lly not applicable to materials of low purity. No endotherm was
4inSourlfgiairniicn athneiosnammpetlehoadppceoanrdsittioonbse.coTnhveeratneidontoreSsOul4taangdreheesnwceeldl ewteitchtetdheussiunlfgutrhe determination in the elemental analysis, lending confidence to this interpretation. Based on the results, the SO4 is not considered an impurity.
5THFFABA NFPA PFPA
THreipfltuaoflruooarcoebtiuctyarciicdacid Nonofluoropentanoic acid Pentafluoropropanoic acid
6Theoretical value calculations based on the empirical formula, CgFi7S03'K+(MW=538)
This work was conducted under EPA Good Laboratory Practice Standards (40 CFR 160).
COA023-018A
3M Environmental Laboratory
Page 2 o f3
Page 228
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
INTERIM CERTIFICATE OF ANALYSIS
Centre Analytical Laboratories COA Reference #: 023-018A LC/MS Purity Profile:
ImpCa4rity C5 TCCot76al
wtV411w...732t232. % 1.14 8.41
Note: The C4 and C6 values were calculated using the C4 and C6 standard calibration cafruvoermrvaetgsh,eerreCessp4peoacnntidsveeCflay6c. sttoTarnhsdefarCrod5mcvutahrleuveeCsw.6 aaLsnikdcaeClwc8uislseat,atenthddeaurCsdi7ncgvuarthlvueeesa.wvearsacgaelcrueslaptoendseusfiancgtotrhse
Prepared By: _D_a_v_i_d_S__. _B_e_l_l_________________
_D_a_t_e
Scientist, Centre Analytical Laboratories
Reviewed B y:_J_o_h_n_F_l_a_h_e_r_t_y_____._____________
_D_a_t_e
Laboratory Manager, Centre Analytical Laboratories
COA023-018A
3M Environmental Laboratory
Page 3 of 3
Page 229
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
INTERIM CERTIFICATE OF ANALYSIS
Revision 1(9/7/00)
Centre Analytical Laboratories COA Reference #: 023-018B 3M Product: PFOS, Lot 171
Test Name Purity1
RefPeurreintSycpe:e#c8:if6icS.a4Dt%io-n0s09
Result 86.4%
AIdpepnetaifricaNantMcieoRn TTTR(M(GLoooeeCtttClaataa423567/a/1llltMM.....e.l.%%%sdSS(NMPIMCSC)I)IIIrCmmmooiooaaacdtPnmlpppnagkci/uuuusngiepMusrrramleoimiiinsuStuttiyyyem)unsmd(e2NsM--R) PRPuOersAiitdyAubalySDoSlvCents (TGA) IOnrogra4232673511gn..........ainciTNNPHPFSBCcAuFlhFirihFuAttcoolPArlrBoifomnsadiaArptrAtitsieiioehedddn54aeees(tIe(CIC) )
4. NFPA Elem2431e.... ntNHCaSluaiytAlrdrfbuornorogangelneynsis4:
5. Fluorine
White Crystalline Powder 4231.... TTTThhhheeeeoooorrrreeeettttiiiiccccaaaallll VVVVaaaalllluuuueeee ==== 0051%%.79.58%% 5. Theoretical Value = 60%
Conforms Positive 45672311.......10.0.60<0600100...0...005003w.w0050501t3402577t./.1/wwwwwwwwtwttttttt.V.VV..%.///t%www.www/wtttttt......%t%%%%%.% None Detected
NN0o.o3tn0AewpDpte.l/tiwceact.tb%elde1 4235671....... <<<<<0800000.......2800000721040059076wwwwwwwtt..//tttttww...../////wwwwwtt..%%ttttt.....%%%%% 231... <<<000...111 wwwttt...///wwwttt...%%% 4. <0.25 wt/wt.%
231... 011..276.19084wwwt.tt/.w.//wwt.t%t..%% 4. 10.1 wt./wt.% 5. 50.4 wt./wt.%
COA023-018B
3M Environmental Laboratory
Exart Copy of Original
Initial
Data
Page 1 o f3
Page 230
3m Medical Department Study: T-6295.7
Report No. FACT TOX-03Q laboratory Request Number-U2279
INTERIM CERTIFICATE OFANALYSIS
Centre Analytical Laboratories COA Reference #: 023-018B Date of Last Analysis: 08/31/00 Expiration Date: 08/31/01 Storage Conditions: Frozen <-10C Re-assessment Date: 08/31/01
'1P0u.6r0it%y +=In10o0r%gan-ic(sFumluoorfidme,et0a.l27im%p+uNriMtieRs, i1m.3p9u%rit+ieLsC, 1/M.00S%im+pPuOriAtiAes,, 0.30%) Total impurity from all tests = 13.56% Purity = 100% - 13.56% = 86.4%
2Potassium is expected in this salt form and is therefore not considered an impurity.
3Purity by DSC is generally not applicable to materials of low purity. No endotherm was observed for this sample.
4inSourlfguarniicn athneiosnammpetlheoadppceoanrdsittioobnse.coTnhveeartneidontoreSsOul4taangdreheesnwceeldl ewteitchtetdheussuinlfgutrhe determination in the elemental analysis, lending confidence to this interpretation. Based on the results, the SO4 is not considered an impurity.
5TNHFFFAPBAA PFPA
HTNroeipnfltouafoflluruoooarrocoepbteuincttyaarcniicdoiacciadcid Pentafluoropropanoic acid
6Theoretical value calculations based on the empirical formula, CsFnSOsTC (MW=538)
This work was conducted under EPA Good Laboratory Practice Standards (40 CFR 160).
COA023-018B
3M Environmental Laboratory
Page 2 of 3
Page 231
3m Medical Department Study: T-6295.7
Report No. FACT TOX-030 laboratory Request Number-U2279
INTERIM CERTIFICATE OFANALYSIS
Centre Analytical Laboratories COA Reference #: 023-018B LC/MS Purity Profile:
ImpCCCCu5764rity Total
w t6/11w...305386t % 1.63 10.60
Note: The C4 and C6 values were calculated using the C4 and C6 standard calibration cfruormvesth, ereCsp4eacntidveCly6.stTanhdeaCrd5 cvuarluveesw. aLsikcaelwcuislea,tethdeuCsi7ngvathlueeawvearsacgaelcrueslaptoendsuesfiancgtotrhse average response factors from the C6 and C8 standard curves.
Prepared By: _DS_ca_ive_in_dt_iSs_t_.,_BC_ee_ln_lt_r_e_A__n._a_l_y_ti_c_a_l_L_a_b_o_r_a_tories
_D_a_t_e
Reviewed B y:_J_o_h_n_F_l_a_h_e_r_ty____________________
_D_a_t_e
Laboratory Manager, Centre Analytical Laboratories
COA023-018B
3M Environmental Laboratory
Page 3 of 3
Page 23.2
3m Medical Department Study: T-6295.7
3M Medical Department Study: T-6295.7
Attachment H Report Signature Page
Report No. FACT TOX-030 laboratory Request Number-U2279
Report No. FACT TOX-030 Laboratory Request Number-U2279
") TOO
Andrew M. Seacat, P h tf., Study Director
John L. Butenhoff, Ph.D., Sponsor Representative
Date'
/ ' &
/^ Date
z*< 9 ? >
3M Environmental Laboratory 3M Environmental Laboratory
Page H-1
Page 233