Document ZRyoM0X1bXzvoNgzzLVNYbRY

] ARR26 -- 1517 1 i AMMONIUM - PERFLUOROOCTANOATE ] GROUN(CD-8W)ATER INVESTIGATION STEERING . TEAM REPORT - AUGUST 2003 2 El - CONSENT ORDER No. GW- 2001-019 i - CONTAIN NC CRI - 006005 Final C-8 GIST Report page 2 TABLE OF CONTENTS: Executive Summary . 3 - Introduction . Lo 1 West Virginia Private Water Supply Sources 1 Ohio Private Water Supply Sources Le - West Virginia Public Water Supply Sources Ohio Public Water Supply Sources . .......... 22 S25 OhioRiver Sampling .......... L..28 = Surface Water and Groundwater Monitoring Groundwater Modeling... ... i! L380 . 45 References tein La = Appendixes A: Site maps and Groundwater-Top maps B: Groundwater Data = C: Consent Order No. GW-2001-019 - ConacT: _ Groundwater Program Division of Water and Waste Management 414 Summers Street Charleston, West Virginia 25301 304-556-2108 MEMBERS OF THE GROUNDWATER INVESTIGATION STEERING TEAM: = DGaornthCrCiossn,neGre,olEognivsitr,onGmreonutnadlwaEntgeirnePerro,grEanmf,orWceesmtenVtirDgiivniisaioDnE, PRegion lil, United States EPA George R. Dasher, Geologist, GroundwaterProgram, West Virginia DEP - Andrew Hartten, Principal Project Leader, DuPont Engineering Jack C. Hwang, Hydrogeologist, Region lil, United States EPA Bill Toomey, Program Manager, Source Water Protection, Bureau for Public - Health, West Virginia Health and Human Resources Roger Reinhart, Environmental Engineer, Water Division, Region lil, United - Dee States EPA Ann Staats, Ph.D., Science Advisor, West Virginia DEP Dave Watkins, Program Manager, Reguiatory Programs Section, West Virginia DEP NON-VOTING GIST TEAM MEMBERS: Sarah Wallace, Environmental Engineer, Division of Drinking and Ground 5 Waters, Southeast District Office, Ohio EPA Steve Williams, Hydrogeologist, Division of Drinking and Ground Waters, Southeast District Office, Ohio EPA Division of Water and Waste Management - 000006 Final C-8 GIST Report page AMMONIUM PERFLUOROOCTANOATE - (C -8) GROUNDWATER INVESTIGATION STEERING TEAM REPORT EXECUTIVE SUMMARY A multi-media Consent Order (GWR-2001-019) was entered into between the = WDeepsatrVtimregnintiaofDHeepaalrtthmaenndt oHfuEmnavniroRnemseonutraclesP-roBtuercetaiuonfo(rWPVuDbElPic),HetahlethWe(sWtVVDiHrgHiRni-a BPH) and DuPont on November 14%, 2001. The Consent Order identified a series of requirements to be performed by the Parties (WVDEP, WVDHHR-BPH, and DuPont) inorder to determine whether there has = been any impact on human health and the ammonium perfluorooctancate (C-8), CAS environment as a result of Number 3815-26-1, to the releases of environment from DuPont operations at the Washington Works main plant and three associated landfills - (Local, Dry Run, and Letart). manufacturing process at its C-8 is a material used by DuPont in Washington Works Facility's located its in fluoroproducts Washington, Wood _ Choauznatryd,ouWseswatsVtier,ginoira.othCe-r8wihsaesspneoctifbiecealnlyidreengtuilfaietdedasunadehrazWaersdtouVsirsguibnisataonrcfee,deral statute or regulation. In accordance with AttachmenAt of the Consent Order, three tasks were to be performed by DuPont and evaluated by the Groundwater Investigation Steering Team - (GIST). The GIST used a phased approach towards meeting these requirements. - Task A: Task A required Dupont to conduct a distance-phased public water supply - service survey along the Ohio River on both the West Virginia and Ohio sides of the tfihvreer.e-mSiulbe)serqaduieanltditsottahneceTaofskthAe Wreaqsuhiirnegmetnotn,Waoornkes-mFiaclieli(taynadnpdostshiebLloycaalt,woLe-taarntd, and Dry Run Landfills. The phased approach to the water and groundwater well use survey and sampling was intended to allow the GIST to focus efforts along potential C-8 impact transport pathways and eventually cease activities in directions where impacts were not = present or where there were low concentrations. - Division of Water and Waste Management 000007 Final C-8 GIST Report paged WEST VIRGINIA PRIVATE WATER SUPPLY SOURCES: = Conclusions: + Initial sampling within a one-mile radius of the Washington Works Faclity and - weaatcehrosfotuhrecetshree landfills resulted in varying levels of C-8 being found in private sources sampling beyond the two-mile radius is necessary based on the lower - + Private water sources within a one- to two-mile radius were sampled around the Washington Works Facility and the Local Landfill based on C-8 concentrations _ detected greater than 1.0 ug/l in the one-mile radius. No further private water concentrations detected in the one- to two-mile radius sampling area. - + No private water sources in West Virginia were found to exceed the C-8 drinking water screening level of 150 g/l. The highest concentration detected - was 10.4 ug/l. Recommendations: - W+ aCsohnitninguteodn qWuoarrtkesrlFyascaiimtpylianngd oLfocsaelleacnteddDprryivRautenwLaatnedrfisllosurfocresonaeroyuenadr tishe - recommended by the Letart Landil is also GIST. Annual recommended. sSaumbpsleiqnugenoftltyh,e tphreivfarteeqwuaetnecrysoofutrhcees at the sampling should then be re-evaluated. OHIO PRIVATE WATER SUPPLY SOURCES: - Conclusions: Initial sampling within a one-mile radiusof the Washington Works Facility - sreosuurlctiensg sianmvpalryeidng levels of C-8 being found in approximately 94% of the water - Private water sources within a one- to two-mile radius from the Washington Works Facility were sampled based on the levels of C-8 detected at the outer limits of the one-mile radius. No private water sources in Ohio were found to exceed the C-8 drinking water screening level of 150 ug/l. The highest concentration detected was 23.6 ugh. Recommendations: - W+ aCsohnitninguteodn qWuoarrtkesrlFyascaiimtpylifonrgoonfeseyleeacrteisd rweacteormmseounrdceeds bayrotuhnedOthhieo EPA. a Subsequently, the frequency of the sampling should then be re-evaluated. - Division of Water and Waste Manaogfement 000008 Final C-8 GIST Report page 5 WEST VIRGINIA PUBLIC WATER SUPPLY SYSTEMS: Conclusions: - downstTreenampufbrloicm wtahteeWrassuhpipnlgytsoynsWteomrsksalFoancgilitthyeaOnhdioLeRtiavrterLaantdvfialrliowuesreposinatmspluepdafnodr C8. No public water supply production wells in West Virginia were found to exceed the drinking water screening level of 150 ug/l. The highest concentration detected was 1.87 g/l. _ + The widespread distribution and low concentrations of C-8 indicate that the pthreimWaarsyhmiinggrtatoinonWoprakthswFaaycsilittoytahnedpupbulmipciwnagt-eirndsuupcpeldieisnfialrterataiiornefmriosmsitohnesOfhrioom - River, which receives C-8 from the National Pollutant Discharge Elimination System (NPDES) outfalls at the Washington Works Facility and the Letart Landfill " Recommendations: - +DuCoPnotnitnuWeadshqiunargtteornlyWsoarmkpsliFnagcialttyt,heanLdubGeecnkerPaulblEilcecSterrivcipcueblDiicstwriactte(rPsSyDs)t,ems - fBolrentnweoryheaasrssetits rIselcanodm,mMeansdoend CboyutnhteyGPISSTD., aAnldsot,heanRnaucailnseamLpolciknagnodf Dthaem Public Water System for two years is advised. Subsequently, the frequency of the sampling should then be re-evaluated. OHIO PUBLIC WATER SUPPLY SYSTEMS: - Conclusions: Six public water supply production wells along the Ohio River at various points - up and downstream from the Washington Works Facility and the Letart Landfill were sampled for C-8. - + No public water supply production wells in Ohio were found to exceed the C-8 drinking water screening level of 150 ug/l. The highest concentration detected was 8.58 g/l. + The widespread distribution and the low concentrations of C-8 indicate that the primary migration pathways to the public water supplies are air emissions from = the Washington Works Facility and pumping-induced infiltration from the Ohio River, which receives C-8 from NPDES outfalls at the Washington Works Facility and Letart Landfill. -- Division of Water and Waste Management ULLULY Final C-8 GIST Report page6 Recommendations: - +WaCtoentriSnyusedteqmuafrotrertlwyosyaemaprlsinisgroefctohemmLeitntldeeHdocbkyinthgeWGaItSeTr. AsAslsooc,iaatninounaPlublic - stawmopyleianrgsoifs tahdeviTsuedp.persSuPblsaeiqnuse-nCthleys,tetrhWeaftreerquDeinstcryicotfPtuhbeliscamWpaltienrg Ssyhsotuledm tfhoern be re-evaluated. Task B: - would dTeatsekrmBinreeqtuhiereedxttehnetdaenvdelporpemseenntceanofdCi-m8plienmdernitnaktiinognwaotfear,mognriotuonrdiwnagteprl,anatnhdat - surface water in and around the Washington Works Facility and the three landfills, and thoydprroogveiodleoagiccomcphialraacttieornizoaftailolnavdaaitlaabfloer geraocuhndfwacaitletry/surface water monitoring and - OHIO RIVER SURFACE WATER SAMPLING: - Conclusions: + Twelve sampling locations in the Ohio River at points up to 28.6 miles upstream - of the Washington Works Facility and downstream to the Letart Landfill were sampled for C-8. - d+rNionkisnagmwpalteesrcsoclrleecetneidngfrloemvelthoefO1h5i0ogR/ilv.erTwheerehifgohuensdt ctoonecxecntereadtitohne dCe-t8ected was 1.04 pg. Recommendations: - + No additional river sampling is recommended. `SURFACE WATER AND GROUNDWATER MONITORING: This task included monitoring of the surface water and groundwater at the = WfoalslhoiwnegdtboynqWuoarrtkesrlyFascialmiptlyianngdtthehreeatfhtreere. landfills for four consecutive monthly events, ~ DRY RUN LANDFILL: Conclusions: - + C-8 is believed to be migrating, via groundwater and surface water, from the C- 8-containing waste that has been disposed of within the landfill Divisionof Water and Waste Management LoLLal Final C-8 GIST Report page? + Groundwater flow is toward the west and toward the Dry Run valley at this site. - + C-8 concentrations measured within the one-mile radius of the site show that some off-site migration of C-8 may have occurred. = + The Dry Run Landfill is located within eight miles of the Washington Works Facility. The transport of C-8 via air emissions from the plant could potentially be - trahdeisuosusracmepolfintghearveear.y low concentrations of C-8 detected within the one-mile There are no known complete exposure pathways for human receptors that = exceed the C-8 drinking water screening level of 150 ug/l. _ Recommendations: _ +grSouurnfdawcaetewratsearmpalnidnggrsohuonudlwdatcoenrtmionnuiettooribnegqsuhaortuelrdlyc,onwthiinlueethaet tohuitsfasliltes.amTphleing can be either monthly or quarterly, as required by the site's NPDES permit _ + The C-8 concentrations in wells DRMW-13A and DRMW-13A should be mpoorntiitoonreodf,thaes Ct-h8espeluwmeel)l.s appear to be the most vulnerable (down-gradient - + The C-8 concentrations at the Dry Run leachate discharge location should be monitored. - LETART LANDFILL: - Conclusions: + C-8 is believed to be migrating via surface water transport from the C-8 - containing waste that has been disposed of within the landfill. - +LaGnrdfoiulnldiws attoewrarfdlsowthinetOhheiAo RZiovneer,, aDn-dE iZsoanweas,y CfrZoomnteh,eapnrdivaFteZownateeartstuhpeplLieetsaritn this area. Groundwater flow in the F Zone (the deepest zone) is generally ~ bineltihiesveadretao;bheowteovwearr,dsthtehreeOmhaioy Rbieveargarnodunadwwaaytefrrofmlotwhdeipvriidveaoten wtahteeurpspueprplaineds northwestern side of the landfill - +loTwhecoanncennutarlatCi-o8nlionatdhiengrifvreormfrgormoutnhdewlaatndefrillt,o atnhed OthhiisoisRisvueprpoirndtiecdatbeystahevevreyry - lpooswsicbolnec,enhtorwaetvieorn,s othfaCt-t8hiisnltohaediOnhgiois Rciovnetrridboutwinnsgttroetahme opfrethseenlcanedfoifl.loIwtiCs-8 concentrations in some of the down river community water systems. = + Air emissions are not a viable migration pathway from the landfill because there _ Divisionof Water and Waste Management 000011 Final C-8 GIST Report page8 are no air emissions at the Letart Landfill - e+ xcTeheedrethaereCAtThTre-eesctoambplliestheedexCp-o8sudrrienkpiantghwwaatyesrfsocrrheuenmianng rleevceelptoofr1s5t0hautg/l - Tlehaecsheataered:isccohntaarcgtedwittohseuirtfhaecresuwraftaecreawtattheertrouenooffft(haet LtehtearCtaLpanRduinlo,ffanlodcatthieon), resulting wet-weather stream that discharges into the Ohio River. However, these exposure routes are limited because of the remote location of the landfill, - the very steep terrain, and the wet-weather nature of the stream. In addition, the fencing around the site limits trespasser access to the area, and the use of - eheqaulitphmaenndt saalfseotlyimpiltasnCs,-8steaxnpdoisnugroepefrorattihnegopnr-soicteeduworrekse,rsa.nd personal protective _ Recommendations: + Surface water and groundwater monitoring should continue at this site. The _ gcraonubnedweaitteherrsmaomnptlhilnygosrhqouualrdtecrolyn,tiansueretqoubireedqubarytetrhley,siwthei'sleNtPhDeEouStfpaellrmsiatm.pling LAMlWl -t8hr)eeshoofutlhde bZeonmoenAitgorroeudnfdowraCt-e8r cmoonncietnotrriantgiwoenlslsan(dLMgWro-u1n,dwLaMtWe-r7f,loawnd direction. - + Zone Fgroundwater wells LMW-2A and LMW-12 should be monitored for C-8 concentrations andgroundwater flow direction. - LOCAL LANDFILL: - Conclusions: + C-8 is believed to be migrating via surface water transport from the C-8 - containing waste that has been disposed of within the landfill + Groundwater flow from the Local Landfill is toward the northwest at this site and - toward the Ohio River valley. Flow is also towards the Washington Works Facility. - + C-8 detected within the one- and two-mile radius sampling areas near the `fWraosmhtihnegtpolnanWtovriaksairFaecmiilistsyiaonnsd. Local Landfill is likely to have been transported + There are no known complete exposure pathways for human receptors that - ewaxtceeredsctrheeenCi-n8gAlsesveelsosfm1e5n0t uogf/lT.oxicity Team (CATT)-established C-8 drinking Recommendations: = Division of Water and Waste Management 000012 Final C-8 GIST Report page 9 + Surface water and groundwater monitoring should continue at this site. The groundwater sampling should continue to be semi-annually, while the outfall - sampling can be either monthly or quarterly, as required by the site's NPDES permit. - + Three locations at the Local Landfill should be monitored: Outlet 101, Outiet LM, and well LLMW-4. = WASHINGTON WORKS FACILITY: ~ Conclusions: The on-site Solid Waste Management Units (SWMUs) are believed to be the . primary source of C-8 migration into the groundwater. Air deposition of C-8 onto the ground surface and its subsequent migration into ~ the groundwater may also have occurred. No off-site migration of the groundwater is occurring, as long as DuPont's ' Western Well Field continues pumping Some limited groundwater may migrate off-site in the northwest comer of the - DuPont facilty in response to the GE plant pumpingtheir wells #3 and #4. + Air emissions are believed to be the primary migration pathway of C-8 from the - Washington Works Facility to adjacent areas in Ohio. Air emissions of C-8 from the Washington Works Facility are believed to be the - source of C-8 detected in areas of West Virginia located adjacent to the facility and the Local Landfil - toAibreetmhiessmiiognrastoifonC-p8atahnwdaytsheodfiCs-c8hafrrgoemotfhCe-f8actilhirtyoutgohthteheOhouitofaRlilvsear,reabnedli--eved most likely--from the river to the public water supplies located downstream. Air emissions of C-8 from the plant are believed to be the source for C-8 along the Ohio River upstream of the plant. + There are no known complete exposure pathways for human receptors that exceed the CATT-established C-8 drinking water screening level of 150 ug/l at - the Washington Works Facilty. Recommendations: + Surface water and groundwater monitoring should continue at this site. The groundwater sampling should continue to be quarterly, while the outfall sampling - can be either monthly or quarterly, as required by the site's NPDES permit. ~ Division of Water and Waste Management 000013 Final C-8 GIST Report page 10 m+ oTnhietofroilnlgowaitngthgerWoausndhwiantgetronmoWnoirtokrsinFgacwileiltly:s aRnOd4-ouMtfWa0ll2s,rePqOu4ir-eMfWu-rt2h,erQ04- - MWO2, VOS5-PWO1, NO4-MW-01, and Outfall 005. It is important that DuPont further investigates the high concentrations of C-8 in = tRihveesre. weDlulsP,onwthihcahsasrteatleodca(tiendthaetirthFeebWrausahriyng2t0o0n3 WSourmkmsaFrayciRlietpyoardtj)atcheanttCt-o8tihsecOohnifoined toa perched aquifer and that the deeper aquifer contains no C-8. - Task C: Task C required the determination of the vertical and horizontal extent of any and - all C-8 impacted groundwater exceeding 1 ug/l. This task also included an assessment of C-8 impacted surface water and/or groundwater at the Letart Landfill and its impact on the Ohio River and nearby public water systems along the river. GROUNDWATER MODELING: - Groundwater modeling of the Washington Works Facilty and surrounding area was conducted to evaluate the groundwater flow pathways and determine the potential of C-8 migration to off-site receptors. Conclusions: = + The Ohio River creates a groundwater divide in the Pleistocene alluvium under the river. As a result of production-well pumping at the Dupont Washington - WfroormkstheFacWialsithyianngdtotnheWonerikgshbFoarciilnigtyGiEs nfoactilbietyi,ngthderCa-w8n-iimntpoaceittehdergtrhoeunLduwbaetcekr wPeSllDfmieulndiicnipOhailow.ellSofimeled ilnimWietesdtgVriorugnindiwaaotrerthmeaLyitmeigHroactkeionfgf-sWiateteinrtAhsesociation = northwest cornerof the DuPont facility in response to GE pumping wells #3 and . #A4s.socSioautriocne,saorfeCc-8o,mifnorgtfhreoLmutbheecOkhPioSDRiavenrd atnhde LdiitstpleerHsoicoknibnyg aWiarter Recommendation: - The URS Diamond model should be accepted as representing real-world conditions in determining groundwater flow and contaminant transport _ Diivviision of Water and Waste M:lanagemen it 000014 F~ inalC8GISTReport ~ pagelt INTRODUCTION C-8 has manufacturing been used processes. by DuPont Residues since the early containing C-8 1950's in its fluoropolymer from the fluoropolymer related - fmoantuhfeaacitr,urdiinsgchparrogceedstsoesthaet OthhieoWaRsivheirn,gdtiosnpoWsoerdkosf Faatcitlhietyfaacirleitoy,r ahnadveotbheeernwirseeleased shipped off-site for destruction and/or disposal. DuPont also captures for recycling a - portion of used C-8, - containNsopepceirfmiictlsimiistsautieodnstoonDutphoenatmaouutnhtoriozfiCn-g8rethlaetasmeaoyf bpoellruetlaenatssedt.o tShienecnevairsoenamrelynt as 1980, presence DuPont has and level of performed C-8 in and regular, around voluntary water sampling to its facilities in West Virginia, detect the and has reported - the results of these samplings to WVDEP. been detected in varying concentrations in As a result private and of DuPont's sampling, public water supplies. C-8 has DuPont, by and through its use of C-8 in the fluoropolymer manufacturing process, was - considered the likely source. - BPH deTtheermfiendeerdalthEatnvitiwroansmednetsairlaPbrloetteoctaisocnerAtgaeinnctyhe(sEoPuA)r,ceWoVfDCE-P8,inadnrdinWkiVngDHwaHtRer-for persons facilities. poTthenetiEaPllAy,eWxVpoDsEePd,toagnrdoWunVdDwHatHeRr-oBr PsuHrfraecqeuweastteedrsthian tthDeuPaorenatsoufbtmhiestea.ll = tihnfeosremfaatciiolntiaesn.d Tdhoecuamgeenntcsierselcaotinncgltuodetdhethdaetteict twioounldanbdeporfegsreenacteiomfpoCr-t8aninceantdo haarvoeund sufficient data upon which to determine the potential exposure risk of the presence of = C-8 in the environment - Therefore, established in the a C-8 Groundwater Investigation Steering Team (GIST) was Consent Order to oversee investigations and activities that would be conducted to assess and surface water at the and presence and extent of around the main plant, C-8 and in drinking the Local, water, groundwater, Dry Run, and Letart - Landfills. - WVDHHTRh-eBGPIHS,T EwPasA mReagdieonupllo,faandteDaumPoonft.scieInntMisatys a2s0s0e2mablMeedmforroamntdheumWVofDEP, _ OUnhdieorEsPtaAn.diTnhge(MMOOUU)ewsatsabsliigshneedd gbuyidWeVliDnEesP,forWOVhDiHoHERP-AP'sBHpa,rtaincidpaDtuioPnoinnttwhiethGItSheT due to the discovery of C-8 in Ohio public drinking water supplies. - DuPont, through an agreed-upon third party and under the supervision of the GIST, conducted the groundwater use and well survey identification and sampling of - mgirloeunrdadwiautserofwtelhlesWaansdhiontghteronwaWtoerrkssouFraccielsit(yi.ae.ndsptrhientghsraeendlancdifsitllesr.ns)Idweintthiifnictahteioonnaen-d scaomncpelnitnrgatoifopnrsivoaftCe-w8elflosuwnadsincwoanttienrgseonutrucepso,ntlhaenGdoIwSnTerthpreorumgihsstihoen.ConBsaesnetd Ourpdoenr was - empowered to possibly expand the radial survey distance to include wells within a two- ~ Division of Water and Waste Management 000015 Final C-8 GIST Report page 12 or three-mile radius of the Washington Works Facility and the three landfills. - Historical data and hydrogeologic information was evaluated in order to prioritize tihneveisntiitigaaltisocnoapcetiovfitwioesrk(e.fgo.r cmoonntiitnouriinngggwreollunidnswtaatlelartimoonnsi)troerqiunigreadndunadneyraTdadsitkioCnaPllume = Identification. - chargeUdpwointhcpornecplaursiinognaoffitnhael rTeapsokrts wsietthffoirntdhiinngsthaenCdocnosnecnltusOirodnesr,retghaerdGiInSgT was groundwater quality, and the extent of groundwater impacts. The final GIST report provides conclusions and makes recommendations regarding the need to conduct - faunrdthheruwmoarnk,heoarlttho. taTkheeacftoilolnoswinnegcreespsoartrysutommaasrsiurzeesprtohtoescetifoinndoifnggsr,ouconndcwlautseironqsu,alaitnyd ~ recommendationsof the GIST in fulfillment of the Consent Order. ) Division of Water and Waste Management 000016 Final C8GISTReport ~~ paged WEST VIRGINIA PRIVATE WATER SUPPLY SOURCES Pursuant to Attachment A of the Consent Order, the Groundwater Use and Well Survey involved evaluating C-8 in groundwater initially within a one-mile radius from the - Washington Works Facility sampling water from wells, and the Cisterns, three landfills and springs. (Local, Letart, The area was and Dry Run) by expanded to a two-mile radius at the Washington Works Facility and the Local Landfill based on the initial - results obtained from the one-mile radius survey and sampling. Between March 2002 and October 2002, DuPont's third-party contractor, Potesta - Associates, Inc., performed a door-to-door well survey and collected samples following protocols established by the multi-media consent order. Representatives from the WVDEP and the Wood County Health Department accompanied Potesta Associates, - Inc. personnel during the initial door-to-door survey. WASHINGTON WORKS FACILITY AND LOCAL LANDFILL: In April 2002, DuPont submitted a report to the GIST documenting the well survey and C-8 sample results within a one-mile radial distance around the DuPont - Washington Works Facility and the Local Landfill. Because of the proximity of the Local Landfil to the DuPont Washington Works Facility, groundwater wells located within the combined one-mile radius (of both sites) in West Virginia were sampled. A total of 44. - wsealmlsp,lessprwinegrse, caonldleccitsetderfnsr.om drinking water wells, non-drinking water wells, unused The C-8 concentration from drinking water wells ranged from 0.328 ug/l to 2.8 Wl. The highest concentration of C-8 from the category of non-drinking water wells _ and unused wells was 14.3 g/l. C-8 was detected in all wells, springs, and cisterns sampled within the one-mile radius. A total of two samples collected in the one-mile radius had concentrations of C-8 above10 g/l. Because of the levels found in the one- _ mile radius of the Washington Works Facility and the Local Landfill, the private water spuripvpaltye saonudrciendsussturrivaleywawtaesr esxuptpelnideesdubsyedthfeorGdIrSiTnktiongawtawtoe-rmiwleereradsiaums.pleIndaodndiatiomno,nthly - basis until the CATT drinking water screening concentration of 150 ug/l was developed. `The private water supply sources survey and C-8 sampling results within the ~ one- to two-mile radius of the DuPont Washington Works Facility and the local landill were submitted on August 2002 to the GIST. A total of 65 samples were collected and analyzed for C-8 including drinking water wells. The C-8 concentrations measured in drinking water wells ranged from non-detect (<0.010 g/l) to 0.889 ug/l. The highest concentration of C-8 from non-drinking water wells or unused wells was 1.57 ug/l. A spring sample, used for drinking water, had a concentration of 1.8 g/l. Due to - mdiesatsaunrceedfrcoomnctehnetrWaatsihoinnsgotfoCn-W8oirnktsheFatcwioli-tmyi,ltehreaGdiIuSsTinddeitceartminigneaddtehcarteaadsdiintgiotnraelnd in samples beyond the two-mile radius were not necessary. Division of Water and Waste Management 000017 Final C-8 GIST Report page 14 In summary, C-8 was detected in 100% and 79% of the private water supply - sCo-u8rwceerseslaomwpelredin itnhtehtewoon-emi-laenrdadtiwuos-mairleeaaarseacso,mrpeasrpeecdtitvoeltyh.e oTnhee-mciolnecernatdriuast.ionNsoof private water supply sources in the one- or two-mile radius area exceeded the CATT-established C-8 drinking water screening level of 150 ug/l. The widespread = distribution of C-8 groundwater flow in to private water this area from supply sources, the Washington combined with Works Facility the lack and the of Local Landfill facilities, indicates that air emissions may be the primary migration pathway of C-8 from = the facility to adjacent areas in West Virginia. RECOMMENDATIONS: Under the Consent Order, a significant number of private water supply samples have been collected that document the extent and current concentrations of C-8 in - gsraomupnldewdataterlewaistthionncteh.e oInt ei-s uannkdntowwon-mwihleetrhaedriatlhaerecaosn.cenMtorsattilooncsatdieotneschtaedveinbeen ~ groundwater are couple of years. the result of historic air deposition Therefore, the GIST recommends of result of air deposition in the that DuPont collect additional last scoanmcpelnetsraftrioomnsthine pfroilvlaotweinwgatseelrescotuirvceelso.catAidodnistitoonaelvaslaumapteletsheshcuorurledntbetrceonldleocftCed-8from the following sample locations, with the owner's permission: . + Drinking water wells with detected levels of C-8, + Drinking water springs with detected levels of C-8, - + + SNporni-ndrgisnaknindgcwiastteerrnwsewliltshwdietthedcetteedctleevdellsevoeflsC-o8f,Ca-8n,d + Wells or springs used for cattle above 5 ug/l (total 1). - The GIST recommends selecting ten of these locations, with at least one or mfroerqeuefnrcoym oefatchhe csaatmepgloirny,g fsohroquuladrttehrelny bseamrpel-ienvgalfuoarteodn.e year. Subsequently, the LETART LANDFILL: = surveyIannAdprCil-820s0a2m,plDiunPgornetsuslutbsmwiitttheind tahereopnoer-tmtiolteheraGdiIaSlTardeoacuamreonutndinLgettahretwLealnldfil - A total of 30 samples were unused wells, springs, and collected cisterns. from The drinking water wells, non-drinking water wells, C-8 concentration from drinking water wells. frraonmgetdhefrcoamtengoonr-ydeoftencotn-(d<r0i.n0k1inugg/wl)atteor0w.e1l3l9s uwg/al.s 0T.6h3e6hgi/glh,esftrocmonBcreinntkreartiRounn,ofwCh-i8ch = wmaasy nbaemtehde rfeosrusltamopflsiunrgfapcuerpwoasteesr"inRfoiluttraeti3on3fUrnomnathmeedLetSatrrteaLamn.d"filTlhiisntocoBnrciennkterratRiuno.n Due to the low C-8 concentrations found at the Letart Landi, and in the private water - supply sources the survey was not extended by the GIST to a two-mile radial area. Division of Water and Waste Management 000018 Final C-8 GIST Report page 15 In summary, C-8 was detected in 6% of the private water supply sources sampled in the one-mile radial area. No private water supply sources samples. = exceeded the CATT-established C-8 drinking water screening level of 150 ug/l. RECOMMENDATIONS: Under the Consent Order, a significant number of private water supply samples - wwaetreercsoulplpelciteesd twhiatthidnoacuonmee-nmtilteheraedxituesntofanthdecLuertraernttLcaonncdein.trations of C-8 in private Each location was sampled at least once. The C-8 concentrations measured in - all Letart Landfill one-mile radius samples were non detect or not quantifiable, except } f0o.r1o39neugs/almapnlde ocnoellescatmepdlferocomllaewcetleld ufsreomd afonr udrniunskeidngwwealltetrhatthahtahdaad caonccoenncternattriaotnioonf of 00..613399 pgg//ll. beThreesGaImpSlTedr.equTirheed rtehsaitdtehnet drreifnuksiendg twoathearvewetlhlewiwetlhltrheesCa-m8plceodn.centration of as to whEeatchherlotchaeticoonnhceansttrhautsiobneseonf sCa-m8pdleetdecatesdinignlegrtoiumen,dwaantderthaerree iinscnroeacslienagrotrrend - decreasing. Therefore, the GIST is recommending that DuPont collect yearly samples from the GERLACHIBA and the BRINKERA private water supply sources, contingent - uprpiovnatpeedrrmiinsksiingonwoaftetrhesuwpepllli-eosw.neTrhsi,stsoaemvpalliunagtefrtehqeuternecnydsohfoCu-ld8 tchoenncebnetrraet-ieovnasluianttehde. DRY RUN LANDFILL: surveyIannAdprCil-820s0a2m,plDiunPgonretsuslutbsmwiitttheidn tahereopnoert-mtiolteheraGdiIuSsTadroecauamreonutnidngDrtyheRwuenll Landfill. A total of 53 samples were collected from drinking water wells, non-drinking water wells, unused wells, springs, and cisterns. The C-8 concentrations from drinking - wcaotnceernwterlaltsiornanogfeCd-8frformomnotnh-edectaetcetgo(r<y0.o0f1noung/-ld)ritnok0i.n4g2w2aptge/lr. welTlhseahnidghuensutsed wells w`waaste0r.s8u3p9plpyg/ls.urvDeuyewtaosthneotloewxtleenvedlesdobfyC-th8efGouInSdT attotahetwDor-ymiRluenraLdainadlfialrl,eat.he private collecteInd sinumthmearoyn,e-Cm-il8ewaarsea.detNecoteprdiviant6e 0w%atoefrtshaempprlievsateinwtahteeronseu-pmpillye sraamdipulses = exceeded the CATT-established C-8 drinking water screening level of 150 ug/l. The wariedaesopfrDerayd RdiusntriLbauntdifoinloifnCd-ic8atiensprtihavtataeirwaetmeirsssiuopnpslymasuyppbleietshewiptrhiinmatrhye moinger-amtiiloen radial - pathway for C-8 from the Washington Works Facility. This assumption was made due to the lackof groundwater flow into these areas. RECOMMENDATIONS: N Under the Consent Order, a significant number of private water supply samples TT DiviivsisiioonnooffWaWtat erandWajsastte eMMaannageemmeenntt _CoLu|ld - Final C-8 GIST Report page 16 have been collected that document the extent and current concentrations of C-8 in - groundwater within a one-mile radius of the Dry Run Landfill. It is unknown whether the concentrations detected in the groundwater are the result of historic or recent air - eDmuiPsosnitoncoslalemcptlaedddiattioenaaclhsalomcpalteisonfsroonmlyseolneccet.iveThleorceaftioornes, ttoheevGaIlSuaTteretcheomtmreennddosf tCh-a8t concentrations. The criteria to select repeat sample locations, with the owners" permission, may include: + Drinking water wells with detectable levels of C-8, + Drinking water springs with detectable levels of C8, and = + Springs and cisterns with detectable levels of C-8. The WVDHHR-BPH and WVDEP recommend selecting ten, with at least one or = more from each category, of these locations for quarterly sampling for one year. The sample frequency for sampling private water supplies should then be re-evaluated. `Summary of C-8 Results in Private Water Supply Systems at the Washington Works Facility and Local Landfill ( 1 Mile Radius) sl ----|y IN EE EE | sgl rr] =o 1 Mr] 58.. alll1| a | Ll | Milam | Drinking Water Wells - 10 Non-drinking / Unused Wells - Springs and Cistems - 10 - 28 = DiDivviissiioon ooffWWaatteerr aanndd WWaasstteeMMaannaaggeemmeenntt 000020 - Final C-8 GIST Report page 17 = Summary of C-8 Results in Private Water Supply Systems at the Washington Works Facility and Local Landfill (2 Mile Radius) = 25 C - gI s o EE A 1I | Eo [ | ong 1 Ae | 50s IH ClTA - o | i | Drinking Water Wels - 17 Noninking / Unused Wells -35 Springs and Cisters- 13 = Summary of C-8 Results in Private Water Supply Systems at the Letart Landfill (1 Mile Radius) i 3 8 = Oriking Water Wels- 11 NodiikingUnusedWels - 19 Division of Water and Waste Management 000021 = Final C-8 GIST Report page 18 - Summary of C-8 Results in Private Water Supply Systems at the Dry Run Landfill (1 Mile Radius) - 1 reese ee : - 0 E Cl wr _ jl-- TT] dl | I | Drnkog WaterWels 16 Non-dring Unused Wels 25 SpranidnCsgtesms- 16 - Division of Water and Waste Management 000022 Final C-8 GIST Report page 19 OHIO PRIVATE WATER SUPPLY SOURCES As a result of C-8 being detected in the Little Hocking Public Water Supply in December 2001, Ohio EPA and DuPont, in addition to the work being performed under = the West Virginia Consent Order, agreed to expand the private water supply sources water use survey and C-8 sampling into Ohio within a one-mile radial distance from the Washington Works Facility. Between March and June of 2002, Potesta Associates, -- Inc. personnel performed a door-to-door well survey and collected samples from private water supply wells, springs, and cisterns. The samples were collected following the protocols established by the multi-media Consent Order between DuPont, the WVDEP, - and the WWDHHR-BPH. Representatives from the Washington County Health Department, Ohio Department of Health, or the Ohio EPA accompanied Potesta Associates, Inc.'s personnel during the initial door-to-door well survey. In August 2002, DuPont submitted a report to the GIST and Ohio EPA documenting the well survey and C-8 sample results within the one-mile radial area. A - total of 69 samples were collected from drinking water wells, non-drinkingwaterwells, unused wells, springs, and cisterns. The C-8 concentrations measured for drinking water wells ranged from non detect (<0.01 ug/l) to 8.59 g/l, while a single spring used - for drinking water was 1.29 ug/l. The highest concentration of C-8 from the category of non-drinking water wells and unused wells was 16.9 ug/l. C-8 was detected in all the springs and cisterns sampled within the one-mile radius, including a concentration of = 23.6 ug/l in a spring used for livestock. Overall, a total of nine samples collected in the one-mile radius had concentrations of C-8 above 10 ug/l. Because some of these higher concentrations of C-8 were detected at the outer limit of the one-mile radius, be DuPont agreed to expand the sampling effort in Ohio to two miles from the Washington Works Facilty. = The private water supply survey and C-8 sampling within the one- to two-mile radius of the facility were completed in Septemberof 2002. The results were documented in a report submitted by DuPont to the GIST and Ohio EPA in December - 2002. A total of 63 samples were collected and analyzed for C-8, including 50 drinking water wells. The C-8 concentrations measured in drinking water wells ranged from non ~ detect (<0.01 g/) to 6.5 g/l. No Gisterns and springs sampled in the two-mile radius were used for drinking water. The highest concentration of C-8 from non-drinking water wells or unused wells was 8.68 g/l. One spring sampled for C-8 had a concentration ~ of 3.02 gli. Overall, no concentrations of C-8 were detected above 10 g/l within the one- to two-mile radius. ~ In summary, C-8 was detected in approximately 94% and 77% of the private `water supply samples collected in the one- and two-mile areas, respectively. In general, the concentrations of C-8 are lower in the two-mile radius area as compared to - athdeeocnree-amsiilneg rtardeinuds.inBdeicstaaunscee mferoamsutrheedWacsohncienngttroantiWoonsrkinstFhaecitliwtoy-,mtihlee OrhadiiousEPinAdiacnatded DuPont determined that additional sampling beyond the two-mile radius was not - necessary. No private water supply samples in the one- or two-mile radius exceeded Division of Water and Waste Management 000023 - Final C-8 GIST Report page 20 - dtihsetrCiAbTutTi-oensotfabCl-i8shinedprCiv-a8tedrwiantkeirngswouartceerss,carleoennginwgitlhevtehleofla1ck50ofuga/l.groTuhnedwwaitdeerspread pathway, indicates that air emissions are the primary migration pathway of C-8 from the Washington Works Facility to adjacent areas in Ohio. RECOMMENDATIONS: = pcroinvcaetnetArwtaatttiheoernrsoeufqpupCel-sy8tsionafmgtprhloeuensOdhiwinaotOeEhriP,oA,stphDraitunPdgoso,nctuamnhedanscticsottlhelerencestx,etwdeintathisaningdtniwfcoiucrmarineltnetnsuomfbteherirof = Washington Works Facility. Each location has been sampled once, and itis currently unclear as to whether the concentrations detected in private water sources are reflective of historic air emissions or air emissions in the last couple of years. = TDhueProenfotreco,llteoctevaadlduiatitoentalhestarmepnldeosf wCi-t8h ctohnecoewnntreartsi'onpse,rmtihsesiOohniofrEoPmAthreefcoolmlomweinngds that _ categories of private water sources: _ ++ DDrriinnkkiinngg wwaatteerr sweplrlisngwiwtihthdedteetcetcatbalbelelelveevleslsofofC-C8-,8, -+ SNopnr-idnrgisnakinndgcwiastteerrnswewliltsh wdietthedcettaebcltealbelveellsevoeflsC-o8f.C-8, and - sampleTshferoOmhieoacEhPcAarteegcoormymfeorndqusarsteelrelcytisnagmpatlilnegasftorteonnleocyaeatri.onsSwuibtsheqouneentolfym,otrhee - frequency of sampling will be re-evaluated by the Ohio EPA and DuPont. _ 2 _ Fa S s I Ohio 1 Mile Radius I > `Drinking Water Wells -18 Non-drinking / Unused Wells- 30 `Springs and Cisterns - 21 - DDiiivsisiioonnooTfWWaatteerraannddWWaassttee MMaannaaggeemmeenntt 0000:24 = Final C-8 GIST Report - 2 Ohio 2 Mile Radius = 4% cada. Lull L - F w 3s `Drinking Water Wells- 50 Non-drinking/ Unused Wells - 9 page 21 `Springs and Cisterns- 4. - Division of Water and Waste Management 000025 Final C-8 GIST Report page 22 WEST VIRGINIA PUBLIC WATER SUPPLY SOURCES - Public Water Supply Sources (PWSSs) in West Virginia along the Ohio River - wWeorrekssaFmapcilletdy apturvsaurainoutstopotihnetsCounpssetnretaOmrdaenrd. dIonwitniasltsraemapmlionfgthoef DPuWPSoSnst Wwiatshhiinnagton - oBPnaWes-eSmdiloleoncuatpthseetdrCae-sa8mfcaoarnnacdesntsteernavmteiinloenmssildmeoeswaunspussrtterrdee,aamtmhooeffstthahemepffalaceicliialttryyebaaenwgdaasn54einxmipDlaeencsdedemodbwetnorsti2rn0ce0la1umd.e Sampling efforts between January 2002 to March 2003 resulted in the following findings: I B ar Wars ho - PubSlyicstWoamter | RivWWearoshMriilnkegsstofnrom| Sampling Dates - (810) Well Field Results SyDsitstermibRuetsiuonlts (C81) Parkersburg . Well #1:We0l.0#628:6N10D 0.0746 | Deparment WWeell##45:: NNDD l - BlesnlnaenPrdahraSkstasteett Jan 2002 Well#1: 0.165 | = aren Jan 2002 ANNMQOa170-0aP.W3Os13:5 - WoofraksstiFnga)city Mar 2003 yr 0.308 to 0.499 [ovomenre|e| ima| [From] - Tree | wars tsere 0.72110 1.42 | _ WWeelllAlB:: 006.8443311000096318 Jan2002 | WellC: 0.398 100592 - Libeok PED to Feb 2003 WWWeleelllDEllF: -000.32339827311t0o0011..0724518 0510088 i - BeEllelcetrHicydro 14 Jan 2002 Recreation = RMuanviecinpsalwWoaotder a WWeellll ##12::NNDD { Well #3: ND - Works WWeellll##54::NNDO Well #1: NG 2 MPaSsDo--nLeGat| uanrlty <] JanAprMa2r002and | Weeill4#2:3:0.00.601683 010 00..1008238 Not tested N Division of Water and Waste Management 000026 Final C-8 GIST Report page 23 [mos] [ow |==] wo |] Racine Locks Not tested 1 | NewwatHearven _ |L_eparimen_ Apr 20_ 02 Well #1:NQ * A negatpiovseilsvterenaummbmielre rveafleures roefaerlsoctoataiolnocdaotiwonnsuiprsetarefarmomfrtohmatfhceiWiay.shington Works Facilty. A - + ND ref"eTrhse tloi.staed"NcoonncDeenttercatt"iocnonccaenntvraartyibony itnnsttri umaetnotrabnedloiwmet;hehloawbeovraetro,ryt'hsemNionnimDeutmecdtetceocntcieonntriaittion _ "++ NQ rfeofrerCs-8tof"oNrotthiQsuapnetriifoidabolfe.t"meIits0s.a0c1onucegntration that i below the laboratory's minimum detection fmoitthiasndpesritohdoerfeftoirmeebiesl0o.w05thyegl.evel of quantification. The Not Quantiiable concentration for C-3 - Upon establishing acodmrpilnekitnigonwoaftetrhescCr-e8enAisnsgelsesvemlenoft of Toxicity 150 g/l for TCe-8a,ms(aCmpAlTiTn)gsetfufdoryts were discontinued for General Electric, Parkersburg Water Department, Blennerhassett = IMsalsanodnSCtoatuentPyarPkS,DB--eLllevtilalretH,ydRraociEnleecLtroicckRseacnredaDtiaomn,Palanndt,NReawveHnasvwenooWdatMeunricipal, = tDheepaDrutPmoennttWbaassheidngotnotnheWomrekassuFraceidliltyowancdoncLeunbtercatkioPnSs.D Sampling was continued on a quarterly basis to at continue to evaluate trends in C-8 concentrations. - CoNcLUSIONS: - part of The the Cc-o8mpGlIeStiTosntoufdythheagvreourensduwlatteedrinsttuhdeifeoslalonwdinsgamcponlcilnugseifofnosrtrsepgearrdfionrgmetdheas a source of C-8 in the West Virginia PWSSs: - t+ haPtatrhkeerCs-b8urlgevWelastearreDterpaanrstpmoretnetd afnrdomBltehnenDeruhPaosnstetWtaIsshlianngdtSotnatWeoPrakrsk:FaItcis iltbyevliiaevaierd - emissions. Please note that C-8 transported in air emissions and deposited on surfaces is likely to be mobilized by precipitation and migrate via water transport to surface and/or groundwater. + DuPont Washington PSD: Itis believed that the C-8 levels are transported via air - eSomliisdsiWoanss,teanMdanfarogmemgreonutndUnwiattseratmtihgeraWtaisonhifnrgotmoCn-8W-ocrokntsaiFanciinligtym.aterials in the on-site - + General Electric: Washington Works Itis believed that the C-8 levels are Facility via air emissions associated transported from the with the infiltration of DuPont precipitation or from production-well-induced recharge from the Ohio River impacted with wastewater discharges from the DuPont Washington Works Facility. +reLcuhabregcekoPfSsDu:rfatcieswabetleirefvredomthtahtetDhuePCo-n8tlWeaveslhsianrgetoanssWocoiraktsedFawciitlhitpy'usmwpaisntge-wiantdeurced = discharges to the Ohio River and possibly via air deposition. N Division of Water and Waste Management 000027 Final C-8 GISTReport page 24 + Mason County PSD--Letart: It is believed that the C-8 levels are derived from pumping-induced recharge of surface water from DuPont Washington Works Facility's - `wastewater discharges to the Ohio River. + Racine Locks and Dam: It is believed that the C-8 levels are derived by pumping- = induced recharge of surface water from the DuPont Washington Works Facility and/or the Letart Landfill leachate discharges to the Ohio River. = RECOMMENDATIONS: Considering this data, it is the GIST's recommendation that DuPont continue the - following for the PWSSs: _ + Lubeck PSD, DuPont Washington Works Facility, and General Electric: Quarterly `sampling of wells for two years to ensure that C-8 levels are being maintained or reduced. Conduct a limited field investigation to determine the extent and -- concentration of C-8 in soil at the Lubeck PSD in the vicinity of their production wells. `When the soil sample results are available and the data is evaluated, the GIST will determine what additional sampling activities are necessary to complete the -- tihnveesCt-i8gatrieosnu.itsDutoPothnet GwiIllSTsuwbhmietnathreeproerstuldtoscaurmeenfitnialnigzetd.he Asfatmeprltiwnog yienavress,titghateisoanmapnlding program will be re-evaluated. - + Blennerhassett Island State Park and Mason County PSD--Letart: Annual sampling for a two-year period to ensure C-8 levels are being maintained or reduced. After two - years, the sampling program will be re-evaluated. + Racine Lock and Dam: Annual sampling for a two-year period to evaluate levels of - aCr-e8 bdeuiengtomtahientuapisnterdeoarm rperdouxciemdi.ty Aofftterh etwLeotayretarLsa,ndftihlel,saamnpdlitongenpsruorgeratmha t C-8 levels will be re- evaluated. + Parkersburg Water Department, Bellville Hydro Electric Recreation Plant, Ravenswood Municipal Water Works, and New Haven Water Department: No further - action is deemed necessary at this time. 3 Divisionof Water and Waste 4 Management 000028 Final C-8 GIST Report 25 OHIO PUBLIC WATER SUPPLY SOURCES - sampliTngaosfk tAheofptubhleiGcIwSaTteTresaumpplOybjseocutricveess aalnodngEftfohretOshrieoquRiirveedr.DuAPsonatretsoulpte,rtfhoermwell - fiinelDdefcoermtbheerL,it2tl0e01H.ockTihneg sWaamtpelrinAgssroecsiualttsiownitPhuibnltihceWwaetllerfiSelydsatnedm swuabssesqaumepnlted for C-8 - msoynsitteomrsinfgivaelmliolwleesd utpheanGdIS5T7 tmoielexspadnodwnthtehaerreiaveorffmroonmittohreiWnagsthoiinngctloudneWpourblkisc wFaactieltry. Sampling efforts between December 2001 to February 2003 have resulted in the following findings: [PSuyistweamter | RWiavserhiMinegstofnrom| Sampling Dates | Wel[Fie=ld rResults SyDsitstormibRuotisounts | - I Works c8umn) | - upeotpeenntg Dec 2001 WWeell#l1:#1.262:1102043026765 JAaung,,Faenb,d OMcatr,2A0p0r2,|| WWeellll##35::054.269101006.95582 | coi - I . [oworsepe Feb 2003 | Well #1: 00995 160.13 Feb Mar and A9r | wenWsell0#122:1N0Q0141 | 008110012 WWeelll##540:10.013011100 00..111313 || - Toppers Fob, Mar, Apr Jul, | WWeellll ##12:.00428368100.00..471276 BR Crester 1415 and Oct 2062 NWaellla#3: NNDD tOo NNOG | 0240383 Yow Feb2003 Well #5:0.201100.297 ot Well #6: 0.t4o03.6439. { ~ Wel #1: ND wid - Vilageof -- Syracuse - L_PPoemegreey Well #3: ND. North Wel: 0.2-00.4891 Mar and Apr 2002 South Well: ND Well #1: ND _ Mar andApr 2002 WWeellll##42:0.N0D7t1ot000..00685 0.t0o06.0366 . A negatpiovseitsivterenaummbmeirerveafleures troefaerlsoc0ataiolnodcoatwonnsturpesaimrefarmomfrtohmattfhaecWial.shington Works Facilty. A ND ref"eTrhse tiotaed`NcoonncDeenttercatt"iocnonccaenntvraartyiboyn tihnasttrisumaetnotrabnedloiwmet;hehloawbeovraetro,ryt'hsemNionnimDeutmecdtetceocntcieonntrmaittion - ++ NQ rfeofrerCsftoo "NotthiQsupaenrtifoidaobflei"me1s is a 0c.0o1nycegn.tration tha is below the laboratory's minimum detection ~ ifomrithaisndpeirsitohdeorfeftoirmeebiesl0o.w05thpegl.evel of quaniiicatin. The Not Quantiiable concentration for C-8 _ Division of Water and Waste Management 000029 BN Final C-8 GIST Report page 26 150 ug/UlpfoornCc-o8mpwlaestieosntoafblitshheeCd,AsTaTmpsltiundgy einffwohrtischwearedrdiinskicnogntwiantueerd screening level for the City of of - Belpre and the Villages of Racine, Syracuse, and Pomeroy. However, quarterly sampling was continued for the Little Hocking Water Association and the Tuppers ~ Plains Water Systems in order to further evaluate C-8 concentration trends. CoNcLUSIONS: = part of Tthhee GcIomSpTlesttiuodny hofavtehergesruolutneddwianttehremfoodlellowiinngg acnodncslaumspiloinnsgbeefifnogrtdsrpaewrnformed as _ concerning the source of C-8 contamination in Ohio public water systems: - Little Hocking: Mainly air deposition from Washington Works Facility's stack discharges; however, pumping-induced recharge of surface water contamination from Washington Works Facility wastewater discharges to the Ohio River may have also contributed. - + Belpre: Air deposition from Washington Works Facility's stack discharges. - W+ asTuhpipnegrtsonPlWaionrs:ksPFuamcipliintyg-wiansdtuecweadterredcihsacrhgaerogfessutroftahcee water contamination Ohio River. from - Village of Racine: No discernible contamination. + Syracuse and Pomeroy: Pumping-induced recharge of surface water contamination - from the Washington Works Facility and/or the Letart Landfill leachate discharges to the Ohio River. - in the TCeosntsiWdeelrli4ngIntvheestpiugbaltiicowna(tseere system below), data, and the GIST the elevated levels recommends that of C-8 DuPont noted - cHoonctkiinnuge WqauatretrerAlsysoscaimaptliionng poufblbiocthwattheerpsryodsutcetmiofnorwtewlolsyaeanrds.entArlysop,oianntnufoarltshaemLpilttilneg cfoorntthienuTeudppreedrusctPiloaninosf WCa-t8eirs aSdyvsitseedm.(Aptrotdhuiscttiiomne,wenlolsfuarntdheernatcrtyiopnoiinst)dteoeemnesdure - necessary for the Villages of Belpre, Racine, Syracuse, or Pomeroy. After two years, the sampling frequency will be re-evaluated. LITTLE HOCKING WATER ASSOCIATION WELL FIELD INVESTIGATION: - DuPontInhaadsdipteiroinodtiocaslalmypslaimnpglLeidttlteenHotceksitnwgelWlast(ei.r..Asmsoonciitaotriionng'sweplrlosd)uwcittihoinn wtehlelsL,ittle Hocking most of Water Association well field. these test wells; however, a The concentration few wells exceeded of C-8 4 ug/l. is In less one than test 2 ug/l in well, TW-4, - sthaempcloinncgenotfraTtWi-on4oifndCi-c8atweassgemneearaslulryeddecatre3a7s.i1ngugc/lonicneJnatnrautairoynsofo2f0C0-28. atSu3b3s.3equuge/lnt . TT DivisionofWaterandWaste Managoement 000030 Final C-8 GIST Report page 27 (March 2002), 28.7 ug/l (April 2002), 12.3 g/l (August 2002), and 14.5 ug/l (October 2002). However, in February 2003, the concentration in well TW-4 rose to 22.5 gl, - indicating possible seasonal effects on this well At the request of the Ohio EPA, DuPont conducted a field investigation in the = Little Hocking WaterAssociation Well Field between August 19th and August 30, 2002. The purpose of this investigation was to determine the extent and concentration of C-8 in soil and groundwater in the vicinity of test well TW-4. Groundwater sample - results collected during this investigation ranged from non detect (<0.01 ug/l) to 78.0 gli of C-8. The highest C-8 concentration detected in soil from the well field is 170 pg/kg. A report documenting the results of the investigation was submitted by DuPont = to the Ohio EPA and GIST in April of 2003. Once an evaluationof this report is complete, the Ohio EPA and DuPont will determine what additional activities are ~ necessary to compete the investigation. _ Division of Water and Waste Management 000031 Final C-8 GIST Report page 28 OHIO RIVER SAMPLING - and extOehnitoofRiCv-e8r isnamtphleiOnhgiaoctRiivvietri.es wSearmeplceonsdwuecrteedcotloldecetteedrmfirnoem t1h2erciovnecretnrtarnasteicotnss. - and 19 locations, and multiple depths were sampled at many of the locations. - and 46TmhielemsodsotwdnissttarnetarmivferrosmamtphleiDnugPloonctatWioansshiwnegrteoanppWroorxkimsaFtaecliylt2y8tmoidleetserumpisnter.eam Pblaacnktgtrooudnetdelremvienles otfheC-c8o.nceSnatmrpalteisonwseorfeC-co8lliencttheed raidvejra.ceTnhtetofiannaldpbaretloowf tthhee rDiuvePront - sampling was adjacent to the Letart Landfill to determine if concentrations of C-8 were present there. - Atthe end of the Ohio River sampling, 49 water samples were taken, with the following results: - Transect| River| Numberof| Numberof| Average C-6 | Number | Mie ac`rsoasmsp-lreisver Samples collected Concentration wh) - [T[eoer +|eovpmeammeocmomwnn| |2 3 [ |wcooror|| - [2T[eeseo|| + Toannmomcooumcamoisuwomn||o0 5 ns| sorooooorr_|n| Ces[evow reoms e| [5 [wmoee]5TJeanmnssmomcsitm||m1oe 0n0 |moowoono n]| [eTooTT sommeetm | 5 | un | [eosmJasna|[ +| eopv omocoa wn| [n a2[| oosws | CE FoTTemme| T| T cpoamecoennw| 2|ors| [2 lows + | cpoimocoumn | 5 otorss | * includes a duplicate sample. _ Division of Water and Waste Management 000032 Final C-8 GIST Report page 20 `CONCLUSIONS: - level ofN1o50rivjeirg/sfaomrpalneyeoxfcteheedeOdhitoheRiCvAeTrTs-aemsptlaebsl.ishNeodaCd-di8tidornianlkirnigvewrastaemrpslcirnegenisintghus - trheequWiaresdhiansgatopnarWtoorfktsheFCacoinlsteynatndOrLdeetra;rthoLawnedvfeilrl, NsPamDpEliSnogutsfhaollulmdonciotnotriinnuge as part of ~ Division of Water and Waste Management 0033 Final C-8 GIST Report SURFACE WATER AND GROUNDWATER MONITORING page 30 It should be noted that site location maps, top-of-groundwater maps, and site - geological maps are located in Appendix A, and that a complete set of groundwater data (in both table and graph form) is located in Appendix B. These data included with this final GIST report ends with the March 2003 sampling. The hydrological information = is from the February 2003 Summary Report. - have beItesnhoguelnderaaltseodbeusniontgesdevtheartalthdeifdfaerteantdiasnpallyatyiecdalhemreeth(obdosth. hiPsrtioorrictaol1a9n9d1,reDcuePnot)nt performed the C-8 analysis at the DuPont Experimental Station in Wilmington, _ Delaware. In 1991, when the Resource Conservation and Recovery Act (RCRA) Verification Investigation was conducted at the Washington Works plant, the analysis _ wlaabsorcaotnotrrieasctuesdetdo athGeaCsH,CMhHriolmlatLoagbroarpahtyo-ryEliencMtornotngCoampetruyr,eADleatbeacmtae.d-bBaostehdoafntahlyetsiecal cmoentdhuocdtsedwitthhedeCt-e8ctainoanlylsiimsitsinftoortCh-e8fatllhaotfr1a9n9g8edwhfreonmt0h.e1 ltaobo1r.a0tpogr/yl.ceCaHs,eMdHiolpleration. " ALtantchaasttteirm,e,Petnhnesyalnvalayntiiac.al wDourPkonwtascotnrtainnsufeedrrteod utsoeLathnicsafsatceilritLyaubnotrilatOocrtioesb,erin2001, when development and testing was completed on a new analytical method utilized by - Exygen Research, Inc., located in State College, Pennsylvania. This method uses a Liquid Chromatography-Tandem Mass Spectrometry. DuPont adopted the regular use of this method in November of 2001 HISTORICAL WORK: ~ Before any assessment could be made of the groundwater and surface water at the four DuPont locations, a summary of the historical data was compiled. This was submitted by DuPont in January of 2002 in the document, Compilation of Historical C-8 - Data, DuPont Washington Works Facilty, Main Plant, and Landfils. This report included a brief historical, geological, and hydrogeological overview of the four sites. (Washington Works Facilty, Local Landfill, Dry Run Landil, and Letart Landfill), and - cidoennttiinfiueeddtrherefeindeamteantgaopfst:hetghreonueneddwaftoerradmdoidtieolnaalt gtrheoumnadiwnatpelranmt,onaintdortihneg nweelelds,to evaluate the Ohio River surface water. `This report also included location maps for the four sites, multiple geological cross-sections, four top-of-groundwater maps for each facility, and construction details - for the groundwater monitoring wells. Many of the locations were sampled only once; ohcocwaesvieorn,s.saTmhpeleisnfhoardmabteioenn scuoblmlietctteedd fornomthoetfhoeurrlsoictaetsi"ohnisstoonricaasl msaanmpyliansg1l7ocations - was as follows: Division of Water and Waste Management - 000034 Final C-8 GIST Report page 31 . For Sooets,|| novSesresesor,e||coCuOmRvEeTMo || ouosrtrsert [Wosmgorvors[2|=| @ || - wlan | 0| 2|4] oo | - Letart Landfill _ l Zone A: 3 I | Eezeene Zone D-E: 3 To satisfy Task B of the GIST requirements, regular surface water and groundwater monitoring for C-8 then began in Decemberof 2001. At first the . groundwater sampling was monthly; however, this interval was modified to quarterly once the initial four sampling events were conducted. The surface water was (and still is) sampled each month. To date, including the historical data, the four DuPont sites - have been sampled for C-8 for the following number of locations and occasions: - wasnongoonwons|[ __Tsc ewmeeo| |mfm26em 0ym [|||e1 Mm=or nmt|e | | Sample points| occasions _| [Coooommoammzimmmeesa| || er|z| o] n1 2e]r| - [omnia |e_Go_vmoowmeemzsonas|||o waz|ow umw|n|| [oon |Gomasvwaeerzoec[ |1 o|m 2 || Sommer| 5[nl Gonoveerznes | 0 | 0 | Gonmwaerzonec| 1[10] Division of Water and Waste Management 000035 Final C-8 GIST Report page 32 - [ _ Toome mmwzmee[0 T 12] -- To satisfy Task C of the GIST requirements, it was also recognized that all of the four DuPont locations required additional groundwater monitoring wells. The following wells were added in August of 2002: - [meeTeTames|os Grow |scmmrio] - rorTo[w wtovmmun e|zoo|] sore] - rou |saan:[sommes| sim | oer | zo0 | - or[|zoownn|[omamreoenn|| awvonn ||waieoe|| sooeur|| - [xToor [| Traorsomam |ze | mows] - [sx seorock |abouttzstest| arroy | 2inch| 2fo0t | - These new wells, first sampled in October 2002, fill in missing gaps in the groundwater well fields. They provide a complete encirclement of the four DuPont locations, and should identify any C-8 groundwater plumes migrating from any of the - four sites. = "RESULTS AND CONCLUSIONS: i. DRY RUN LANDFILL: The Dry Run Landfill is located westof the town of Lubeck, on the headwaters of - Dry Run in southwestern Wood County. The site is about eight miles southwestof the Washington Works Facility and the Local Landfill, at 38" 11' 07" North Latitude and 81" 41' 18" West Longitude. Dry Run begins at the toe of the landfill and flows to the - northwest. It is a tributary of the North Fork of Lee's Creek, which flows into the Ohio River. The landfill is situated on the dissected Appalachian Plateau, and is underlain by the sandstones and shalesof the Dunkard Group, which are of late Pennsylvanian or . Permian age. The Dry Run Landfill began operation in 1986, and the central portion is Division of Water and Waste Management 000036 Final C-8 GIST Report page 33 still active and operates under WV-NPDES Permit No. WV0076244. The upper - (cosvoeurt.heaTshteerlno)weporr(tnioonrtohfwetshteelrann)dfpiolrtiisocnloalsseod calnodsecdovaenrdediswciothvearesadilbyanadnveenggeitnaeteivreed- landfill cap. ~ wide The Dry and 1500 Run feet Landfil is long, with about 17 acres in size, and is an elevation rise of about 250 approximately 690 feet. tis oriented feet in a Southeast and northwest direction, and is constructed in an old, v-shaped valley above = Dry Run. Physically, the site is a long grassy slopeof fll material surrounded (and situated on) the small valley's native rock and soil. The site borders no highways, residential, or industrial areas. In the late 1980s, waste sludge materials from an - anaerobic digestion pond (from the main plant) was placed in the upper, southeastern side of the landfil shale, Geologically, silty clay, and the bedrock beneath the sandstone and sittstone. landfill is comprised of Within this sequence individual the three layers of dominant _ aquifers are nearly continuous sandstone and siltstone. These have been labeled by ZDouPnoenBt,--baengdiZnonniengC,wiwtihththZeoOncetCobbeeri2n0g0t2hegrdoeeupnedswta.teZromnoeniBtoirsicnognrseipdoerrted--atsheZomnaeinA, ~ gnreowulnydcwoantsetrruzcotneed,aannddhhaavseeolnelvyebneweenllssasmcprleeedneodntohnreouogchcaisti--ofni.ve ZofotnheeAsehwaeslltshraeree wells screened within it, and Zone C has only one well The Zone A groundwater flows to the west-northwest, and has a gradient of 0.055 vertical feet per horizontal foot. The zone varies in depth between zero (to the - northwest) and 200 feet deep (to the southeast). It is between 25 and 35 feet thick. The C-8 plume, based on three wells, appears to be moving to the west-northwest and down the axis of Dry Run. Ofthe three Zone A groundwater monitoring wells, one--located northeast of the. Dry Run Valley--has consistently contained concentrations below 1 ug/l. A second - well, located to the southwest of the valley, contains 5 g/l. The third well, DRMW-13, has contained the concentrations of between 0.2 highest concentrations of C-8, and ranging from 3.6 0 20.9 ug/l. This well is located in the middle of Zone A and the Dry - Run valley. The Zone B groundwater flow appears to be moving in an arc that varies - bweesttweerenn dairneoctritohnweinsttehrenldoiwreerctwieosntienrtnhepaurtppoefrthseoustithee. asTtheernzpoonretiiosn aobfotuhtetseintef,eaetndthiincka with a gradient between 0.006 and 0.023 vertical feet per horizontal foot. Zone B varies = in depth from between 220 feet deep under the southeastern portion of the site to just a few feet surface below stream the surface at the toe of northwest of the landfill the All landfil. of the It may be breached by the Dry wells surrounding ZoneB were Run - sampled in October 2002. Only six wells in the down-gradient western partof the landfill contained detectable concentrations of C-8. The well which consistently contains the highest concentrations of C-8 is well DRMW-13A, located directly in the - Dry Run Valley and is adjacent to well DRMW-13. The C-8 concentration in well Division of Water and Waste Management 000037 Final C-8 GIST Report page 34 DRMW-13A is less than in well DRMW-13; however, it does seem to indicate that Zone B's plume is also moving directly down the Dry Run valley. As stated previously, Zone C is the deepest of the three groundwater zones. This zone is only penetrated by one groundwater monitoring well, DRMW-21B. Zone C = is located approximately 120 feet below the Dry Run valley, and it has not been determined if it extends to the southeast and under the landfill. Zone C is at least 45 feet thick, and may be confined, as the groundwater surface in the well extended above = the well's screen and the top of the sandstone-siltstone layer in the October 2002 sampling. Without additional wells penetrating Zone C, it is impossible at this time to determine the zone's extent or the groundwater flow direction and gradient. Well = DRMW-21B contained no detectable concentrations of C-8 on the two occasions it was sampled, so it is presumed at this time that there is no C-8in Zone C. - Itis difficult to make any kind of conclusions regarding the surface water at the Dry Run Landfill because many of the sampling locations have been consistently dry ~ during muchof 2002. Itis also difficult to make statements regarding the concentrations of C-8 found to date because these concentrations vary so much from sample location to sample location. The highest concentration of C-8 found at the - surface sampling points is the Dry Run leachate location, where the concentrations of C-8 has ranged between 109 and 704 ug/l since December of 2001. The leachate is collected and hauled to the Washington Works Facility's treatment system, and does -- not discharge into Dry Run. A further breakdown of the Dry Run Landfill sampling data is as follows: Ee r en s Tua TyTa T] orn vr | oo 001 003 004 `Boundary #2 Leachate| Under Drain | - es | = [mmmmmcse|m7s[[omrr[[owro|[omJoowo[Twoo[|mwe|wws]| [averagecs|sesr|1730[703s| 113 | vor|aozo| 20550| sos| - Sriram STm m assy] oommmoes| v=or ||osmuew ||mou] mw || imnce|om |me| eo | N | _avosgecs | 008| 1216 | 374| _ Division of Water and Waste Management LOL03S Final C8 GIST Report age 35 Note: Forthe purpofoavseraegisng these values, a No Detet concentrationof<0.1was calolated a 2610 - [samp pom |orun:s |ormw-oa |ormw124|oraw-126|ormm134|orww-14] [umbororsampes | | 1s [wo | wn Tw |ow | - Chnmmes[or[ow| or[or | ow | or] | vesmmcs [| vo | vas [ over | sa | 16 | 20| - [pwoogece |os | oe | oo |oss|es|ox| Note: Fr the purposesof averaging these values, a No Detect cancentatoof <0.1 was calculated a 260 [ory Run Landfill Groundwater Zone B: (units are 197) ] - [ renree]ome [ormo |ori [oroTora [ors] omvorotsomgos | 2 |v[+[2[2| 2| = [wmmmes| wor |ows | wor | cor | 01 |ows| [woummce | wor |ows| or | 1[ wor |oz| - ZDoryneRuG:n (LuannsaairoGyrhou)ndwater - [rumooror|sam2pio|s [wnmm|co01s| - |omm|oors| LETART LANDFILL: Letart iTnhneorLtehtearrnt LMaansdfoinl Cisoulnotcya.teIdt iasb4o6utm0i.le6smdiloewsnnotrhtehOohfitoheRisvmearlflrcoommDmuuPnointty'sof - Washington Works Facilty, an is located at 38 54' 15 North Latitude and 81 55' 43" West Longitude. The site--like the Dry Run Landfill--is situated on the dissected - AnGoprroptuahp.l.acWhIeitsiastnsoPifltaettdheeainul.aandvfBaiellllder(yoatnchdkatacocisnrsodisisrstecstthloeyf hwtiehllesbtseaohfnidntsdhtetohOneheisloanadRniidivles)rh,iaswlthehisecohnfoitrsthhhe-eDfrlueonwfkilanogrwidng 2 NBor.inWkeVr0R0u7n6.06T6h,e aLnedtarwtasLanpdefrimlawneanstolpyecrlaotseedd abnydincsltoaslleidnguandneernWgiYn-eNerPeDdEmSulPie-ramyietr - Division of Water and Waste Management 000039 Final C-8 GIST Report page 36 gmeoonistyonrtihnegt,icsuarnfdacseoiwlactaepr minon2i0t0o1r.ingT,haenpdercmaipt mraeiqunitreensanqucaer.terly groundwater and tapPehryssiicnalwliyd,ththferoLemtaartmaLaxnidmfulmisofte8a5r0-sfheaepteadl.onIgt is approximately 1.400 ts northern edge to a feet long, narrow = bpooiunntdaatrtyhaenOdhitoheRilvoewre.stTehleevealteivoantipoonindtinffeearrentchee bOehtiwoeReinvetrh,eiswiadbeoru,thi1g4h0erfeneto.rthTehren - landfill itself is covered adjacent to the landfill, with grass. There are no highways, residents, however, U.S. Route 33 parallels Brinker Run, or businesses which is located `about 700 feet to the west. This is a rural part of West Virginia, and there are no residents and businesses along this section of the highway. shale, Geologically, silty clay, and the bedrock beneath the sandstone and siltstone. landfil There is comprised of are, depending individual layers of on how and where = tDhuePyoanrteacsouZnotneed,A,beZtowneeenB,foZuornaenCd,sZixonaqeuiDf,erZsonatetEhi,sasnitde,ZwohniechF.haZvoenebeAeinsltahbeeled by ~ ZshoanleloBwecsotnotfaitnhsesneo awqeulilfse,ras,ndanZdonisemConciotnotraeidnsbyontlhyreoenegrwoeluln.dwZaotnere mDo-nEitcoornitnaginwselflsi.ve `groundwater monitoring wells, and Zone F, the deepest and dominant aquifer at this - site, has nine wells screened through it - feet thiGckr.ouIntdiswacotnetriZnuoonuesAinisnaetxupreo,sebdutnaepaprartehnetsluyrfcaocnet,aiannsdivnatreirebsedbdeetdwediesnco2n5tiannuodus6.0 shale, sandstone, and siltstone lens. - There are only three wells screened in relatively close together and more-or-less in a Zone A. straight These wells are all located line along the northwestern edge - tofhethaepplaendafrilal.nceGiovfean ntohretsheglriomuitnadtwioantse,rthfeloOwcatnodbearp2l0u0m2egtrhoautncdewnatteerredsaomnplweilnlgLgMaWv-e1, the central-most of the three wells. - Of the three Zone A concentrations have varied wells, since LMW-1 has the highest concentrations. These April 1996 between 1,700 and 30,500 g/l. Well - bLeMtWw.e-e8nh2a8s0thaendne4x,t-0h2i0ghuge/sl.t cWoneclelntLrMaWti-o7ns,haasnddistphleasyeecdotnhceenlteraastticoonnscehnatvreatviaornisedof C- 8in these wells since October 1999 between 158 and 567 ug/l. - There are section produced no wells screened when the deeper through Zone B. wells were dried, However, this zone judging from the crossreaches its maximum thickness combined of more than with Zone C. 70 feet at the northern-most tip of Zone B pinches out (disappears) the landfill, completely where itis as one moves down the landfill toward the river. = feet thiZcoknuendCeraptpheeamrasintoabnedcsoonuttihneuronuspoarctrioosnss otfhethsietel.andfItilils,aapnpdrocxoimmbatienleys1w5itthoZ2o5ne aBsisnetshsemneonrtthoefran ppalrutmoefotrhegrsoitue.ndwOantleyrofnleowwealnldisdisrcercteieonnecdatnhrboeugmhadZeo.neThC,isswoelnlo, _ Division of Water and Waste Management 000040 Final C-8 GIST Report page 37 LMW-3, is locatednear the very toe of the landfill and in close proximity to the Ohio River. This well had a concentration of 2.270 ug/l C-8 in May 2002. Zone D-E is the most complex of the Letart water-bearing zones. These zones. - aarpepesaerpatroabteedcobmybainsheadleinltahyeersoinutthheernw,escteenrtrnala,nadnpdosnsoirbtlhyertnhepcoernttiroanls opfortthieonsoitfe.thTehey landfill. Itis also possible that Zone D may be completely missing in the northern and northeastern portions of the site. The thickness of this zone can range between 10 and - 4ve0rtfieceatl.feZeotnpeerD-hEo,riazsonmtaalpfpoeotdwbiythDauPgornoutnidnwOactteorbfelrow20d0ir2e,cthiaosn taogtrhaediseonuttho-fs0o.u0th2w6est. = of thesTehweerlelsaarreefilvoecagtreodunndewaarttehremsoonuitthoerrinngtoweelolfstshcerleaendnfieldl.tOhrfoutghhesZeonfieveD-wEe.lls,Motswto - whearsecoonnsliystreenctelnytlcyoinntsatialnleedd,thaendhilgohnegs-ttceornmcdeanttaraetxiiosntss foofrCt-8h.reeTohfetsheecwoenllcse.ntrLatMiWon-s4. have ranged from 172 0 2,840 ug/l. - 2002 All five indicate ohfigthheC-Z8onceonDc-enEtrgartoiuonndswuantdeerrmotnhietmoariinng wells sampled in October of part of the land, with a plume ~ flowing due south and through LMW-4. Two wells, located just east of LMW-4 contained much lower concentrations of C-8. - atthe As previously Letart Landfill. stated, groundwater Zone This zone is the deepest F of is believed to be the six aquifers. the dominate aquifer It is continuous ~ across the site ranging to the south-southeast. from 30 to This zone 70 feet thick. The has a gradient of groundwaterwithin the between 0.030 to 0.057 zone flows vertical feet per horizontal foot. - There positioned all are nine groundwater monitoring around the landfill. Six of these wells were screened through Zone F sampled prior to October 2002, and seven were sampled in October of 2002. These wells project a possible C-8 plume - moving south down the center of the landfill. The lowest concentrations are to the west of the landfill, where there is one concentration of 105 ug in well LMW-14B. The highest C-8 concentration is at the very toeof the landfil at well LMW-58, which has - cagoon.sisSteinntcleyJcuolnytoafin1e9d99h,igthhecsoencceonntcreanttiroantsiosnisncheaivt ewarsanignestdalbleetdwmeoerne5t9h2ananadd2e,c2a8d0e ugh. betweeZno2n4e2Fawnedll9L13MWg-/l2AsicnocnetaSienpstehimgbhercoonfce1n9t9r4a.tioInnsadodfitCi-o8n,ththaits have well varied is located on - tWheellexLtMrWe-m1e2n,ordtrihlelrend ejudsgtetoofthtehewelsantdfoilfl,LMaWw-ay2Af,rowmatshedrayntdiucriipnagtetdheplOucmtoebdeirre2ct0i0o2n. sampling event. These two wells should be monitored closely to determine - gshroouulnddwaaltseorbfelonwotdeidretchtaitontahenrdeifistaheprreiviastae pwlatuemresmoouvricneg(oGffERthLeAsCiHteItBoAt)henonrotrhth.of tIht e Letart Landfill where a small concentration of C-8 was found. ) Division of Water and Waste Management 000041 Final C-8 GIST Report page 38 It should be noted that, due to the installationof the synthetic cap, stormwater contribution to the groundwater flow has been lessened under the landfill. It is probable = that the contribution of C-8 to this flow has remained stable. Less groundwater volume `combined with a steady contribution of C-8 will equal a higher concentration of C-8 in the groundwater. This scenario appears to have occurred at the Letart Landfill. The = site should be monitored closely to ascertain trends in C-8 concentrations. The surface water at the Letart Landfill has been sampled for C-8 at six locations. The data for some of these points is very intermittent. While most of these concentrations are very low, C-8 has been found at the two Brinker Run sampling locations. The two highest concentrations were found at the southern toe of the landfill, at Outlet 002 (the Leachate Basin) and the Cap Runoff location, both of which indicate increasing concentrations of C-8. Outlet 002 and the Cap Runoff have had _ concentrations as high as 3,240 and 415.6 ug/l, respectively. A detailed breakdown of the surface and groundwater data is as follows: 2 pr oiutr | [Ssammere|| Fooneess 2Ps - [woorvmomrocmomp|e|as ||o0w||w+o||ow[|o2o||wor|| [waimmos| sa [ome| mo |sw |oar|aw| - (_Avesgecs |swoz2| 021 | | 15 |o1es| 2251s| - [Cetart Lanai Zone A Groundwater: nis ares) | - [ wroe||m m w5 o m || or wrc m ||ss wwe oo || - oun |osm | wr | wo| [CLeotaarnt Lanndfaitn zone Groundwater: | - Como|roo s| - [m Cim m| |mms zoren0s|| = Division of Water and Waste 9 Management 000042 Final C-8 GIST Report page 39 = CNaotlec:ulFatoerdt3he52pu6r1poses of averaging these values, a No Detect concentrationof *<0.1"was. [EsmCaendiD.EoZorneesGGrouondwarter: (unis as ro 15) en]| = | samp pont |woman [cues | commis |uwmw-1aa| wren | [mbororsampes| 10 | 2[0|2|2| - Fammnce[os[on | oo | wa | on | [ounce |wo| we | wz|so | ena | - o [[s ouSnmtiaonreomzmonJFco2rwe mate core| cey s| cimo | c|r| | c] Tne || ceoe || chame ~ [rmbororsmpes|22| 22 | vw | 0|'s[8[0[2[2] [wnmmcs | so |a0| os | 02 [ows[oss| [oo |704] " [Cveumumcs |ow[aso | 30|ost[ozs[arse| [ows | os| | egeceTne[vers[vrs |om Tow [oro] Tom] ~ LOCAL LANDFILL: ~ in nort"hTwheestLeorcnalceLnatnrdafillWl oisoldocCaotuendtyi.mmeItdicaotnesliystssooufthtorfeteheseWpaasrhaitengctloonseWdocrekllss,Faacnidlitisy _ tlshhoeacladetises.dseaTtcht3ee8d"tAh1rp5ep'ea5ll4aa"cndhNfioiarltnchePlLllaasttwieteauurd,eecoaopnnesdrias8tt1iendg39fo'rfo1Dm6u"1nW9ke6a4srdtinLGtoornotghuietpu1ds9ea.8n0dssI,ttioasnnsedistwuaeantrdeed on closed under WV-NPDES Permit No. WV0076538. They are now covered with approximately two feet of low permeability soil and vegetative cover. The site is in a and DuPont's Washington Works Facil. -- `somewhat rural area; however, there are a number of residential homes south of the landfill. State Highway 892 is just north of the landfill and located between the landfill - in size;Phhyoswiecvaelrly,, tthhee ltahnrdeiielLcoeclall aLraendfiirlrlegcuellalrs ianrseh6a0pebyan1d40t,h7e0ceblyls1a1r0e, a4c0tubayll6y0 feet - smaller than these dimensions indicate. These cells are sited along the tops and sides of three hills, which are located just south of the flat Ohio River flood plain. --- Geologically, the bedrock beneath the landfill is comprised of individual layers of Division of Water and Waste Management 000043 Final C-8 GIST Report page 40 shale, which silty clay, and sandstone are continuous under the and siltstone. There are four principal aquifers, all overall site, and are comprised of sandstone and of - siltstone. DuPont has named these report), from shallowest to deepest, (in their Zone A, October Zone B, 2002 Zone groundwater C, and Zone monitoring D. Zone Ais believed to be the dominant aquifer. to 110 Zone feet. A is usually between 10 This zone is continuous to 20 feet thick, across the site, and and varying in has been depth between eroded by an 60 - unonrnthawmeestd.sGtrroeuanmdtwhaattefrlofwlsoowutinoZfotnhee lAanisdfitlol atrheeanotortthh-enowretshtw,easntdwitthhean gfrlaodwisetnottohfe = 0s.c0r0e8enveerdtiicnaZl ofneeet Ap.erThwoorizoofntthalesfeooht.avTehceornesiasrteenftoluyr cgornotuanidnweadtCe-r8mcoonnictoernitnrgatwieolnlss that _ are ug/l. below The 1 gl. fourth A third well, LLMW-6, well, LLMW-4, contains has C-8 contained C-8 concentrations concentrations up to 79 ug/l. below This. 10 - supports the theory that the Zone A C-8 plume is moving north toward LLMW-4. _ Zone Bis generally 5 to 10 feet thick, incised by the unnamed surface stream, and and between 90 to 130 grades out to the east. feet deep. Itis There is only one _ well screened concentration in of this zone, and 0.0658 g/l in has only been sampled October 2002 and a No twice. Detect It contained a concentration C-8 in March of 2003. With only one well, no plume information or groundwater flow and gradient data can be generated on this groundwater zone. ZoneC the entire site. iDs u1e0t0o 2Z0onfeeetC'tshigcrke,aatnerdd9e0pttho,1i3t 0hafseentodtebeepe.nIitniscicsoendtbiynutohuessaucrrfoascse - stream. Groundwater flow per horizontal foot. Three is to wells the are northwest, screened and the gradient is 0.0153 in this zone. Each well has vertical been feet sampled twice, and the C-8 concentrations ranged from 0.317 to 6.61 kg/l. Zone D is more than 12 feet thick, and is 135 to 170 feet deep. Only one well has been screened in this zone, and has only been sampled twice, with No Detect - concentrations on groundwater flow both occasions. and gradient data With can only one well, be generated no for plume Zone D. information or - Landfill.SixAlslaomfptlhiensgellooccaattiioonnssahraevuesdeidstpolamyoenditcoornctehnetrsautrifoancse wofatCe-r8awtitthhethLeochailghest - concentrations from 38 g/l in occurring at Outlet 101 June 2002 to 72 ug in JaannduaOurtyle2t00L3M,1.andThdreospepceodnctoen4t5r.a4tigo/nls ranged in March 2003. Outlet LM1's concentrations are higher: They were 120 and 81.7 ug/l on the two occasions this location was sampled. The Local Landfill data can be further broken down as follows: Division of Water and Waste Management 000044 Final C-8 GIST Report page 41 [Ta] - samplePoint] utr004 | ew 004 | outa 005 | New005 | out 101| outerut| Tvumborarsampes | 16 | 6 | 5 |a |w | 2 | - [wnmmcs | 1st | em | es |ow | ww |er| - [[CWeommmocesT|o1r8 || teeo|[ssses|| woowess|| swns|| wowwws|| EE _ [coca ConanZoneAGroundwater risers) | [_sawmpoiorPosnte||co5mes||co6mes|| cu5ms||euamme|rol [wnmmocs | 1a |1:| cor|ows| _ [ WommemeoeeT | 1s96| weoe|tooww |otuw ]| on Zone 15 - [oTrsaomptsooProontrr_|s[u7mump] ne]er2s8} _ Vek: Fr prosof averaging esvats,0 DEL concentration vas - [Coca cans zane Groundwater misao) | [n|m 20s m |ewc |oe w| |weea mcs u ||maom ms ||m eeeerno ||ovws ess|| TT DivisionofWaterand Waste Management 000045 Final C-8 GIST Report BN GLroocaulndLwaandtfeirl:l Z(uonnietsDare 491) page 42 _ [umborors|om2so|s [hmmm or] [wemg[eccore| WASHINGTON WORKS FACILITY: The DuPont Washington Works Facilty is located just northof the small community of Washington and about seven miles west and downstream of - Parkersburg. The facilty is located at 39" 16 13" North Latitude and 81 40' 34" West Longitude, and is sited on the Ohio River flood plain. The flood plain here is comprised of Pleistocene glacial outwash and Holocene river sediments (alluvium) overlying the 7 bedrock of the Dunkard Group. These sediments are comprised of sand and gravel, silt aloncdatceldayj,ucstolslouuvtihumo,f and the fill. The site is plant property. in a somewhat rural area. The Ohio River is located State Route immediately 892 is to the o north of the property. There are more than 100 groundwater monitoring and production wells at the - Washington Works Facility. Of these wells, the following 19 wells were chosen by the GIST to be sampled under the Consent Order. - [Ferrans|coer mora |coves| some [var-poor |Exsamnor[isan|rocannos |noeanuos| [novapwor|wiopwor|posaviz|voswor |viewwor| Lexazowor |voeewor[eosmwor|vramwor|] Of these wells, five have consistently been less than 1 gl, and another seven - have been less than 20 ug/l. Three of the remaining wells have had C-8 concentrations bseatmwpeleend--2c0onatnadi6n0edig1/l2;0hgo/wle.veAr,foounrethowfeltlh,esNeO4we-lMlsWO(1P,O8h-asMWoOnl1y)b--ewehnensalmapstled once, = but this concentration was 689 g/l The remaining three wells all contain high concentrations of C-8. These are - wells PO4-MW-2, Q04-MW-02, and RO4-MW02, with reported concentrations as high has 46,600, 7,720, and 322,000 ug/l of C-8, respectively. - Atpresent, six outlets are used to monitor the discharges at the Washington } Division of Water and Waste Management 000046 Final C-8 GIST Report page 43 Works Facility. With a few exceptions (one of which was Outfall 005 in November 2001 with a concentration of 915 ug/l), all of these outlets have had consistently discharged = relatively low concentrations of C-8, ranging from ND to 54.9 pg. A further breakdownof the Washington Works Facility discharge water and - groundwater data is as follows: _ Washington Works [wos] wTcmmon[we Facility Surface Water: (units are 4 /1) [ oSwar--s[ ocwar[ wv | o ["Civaemmmmeess|[oaww[[evwe[[rovme|| wism[|eowr[|wooe]] [ aversgecs | ase |321| tse | eure| ta2 |1a | - Forman r er |epe | meer | aTooe| TE - aammmmcess||oanw [ | wr[o ew [[vov am[[aanve []eoaw|| = (_av | e 141r |os stg |oe ss c |10s 3| ome [2127] Ee - . Wee ng WoT rk FaJcoteG|romdaTvaearar|oraase27|97 | is [=ee [Smomrmecos||aww wom[|e+w[[o2r[ooonm [[a+[nwao]] ) [ aveagecs |ns| vsor| | 2013 [28ses|ss|0re0 o| i. Division of Water and Waste Management 000047 Final C-8 GIST Report page 44 oe Fey TT --] - ommaremes|v| 0| 0[2[2[2| - `Sample Point wRwOoz4_-| VwOo5r- | mYw1o4-r wNOo4-s| mYw1o4-z | |wnmumca |a0[oss [ass[ooee[ar2| oi] - [woummce|szao0| 12 [ree[ors [aaa[ 1] (Aversgecs |eor2e|262 |1376[one|raze| 01] RECOMMENDATIONS: - The first priority at each of the four sites is to continue the surface and groundwater monitoring programs. Sampling of the groundwater should continue to be _ quarterly, while the outfall sampling can be either monthly, quarterly, or semi-annually, as required by each site's individual NPDES permit. - The continuing source of C-8 at the Washington Works Facilty is believed to be originating from a previously reclaimed digestion pond and from the old River Bank Landfill. Currently, the facility is under a RCRA Facility Investigation, which is - addressing these C-8 sources. It is the recommendation of the GIST that any action relative to the investigation or remediation of the C-8 sources be deferred to the WSEPA-WVDEP RCRA Corrective Action Program (CAP). - Division of Water and Waste o Management 000048 F~ inalC8GISTReport ~ pageds GROUNDWATER MODELING Groundwater modeling of the Washington Works Facility's main location was - SctoamtpelsetGeedoliongdiecpaelnSduernvtleyy b(yUSDGuSP)o.nt'UsRUSRDSiaDmioanmdo'nsdmocodnetlriancgtowraasndcobmypltehteeUdniutseidng sGorfotuwanrdew.atBeortVhismtoadseslosftwwearree.baTsheed UonSGsiSmimloardecalliwbarasticoonmdpalteateadndusbionugnVdiasruyalcoMnoddiftlioonws The USGS groundwater model did not address groundwater seepage from the adjacent bedrock aquifers, whereas the URS Diamond groundwater model did address 2 this seepage. Preliminary analysis of both models show close agreement in groundwater flow directions, calibrated heads, and rate and volume of groundwater flow. The model data that follows is primarily from the URS Diamond groundwater - emfofdoertl.in TcohrepoUrSatGioSngwriothuntdhweaWteVrDmHoHdRe-lBwPilHl ,beOfpfuibcleisohfeEdnavsirpoanrmteonftaallHaregaelrthmoSdeerlviincges (OEHS). URS DiTahmeoUnRdSmoDdiealmodnodmamiondwealsbo5u.0ndtaor7y.9wamisletsh,ecaolnlsuivsituimn,gaonfd1i5n3torobwesdr,o2ck3.5 The - columns, and 3 cells deep. Fifty-one discharge wells were included in the simulation. In the beginning stages of building the models, a major gap in the data occurred due to ack of data concerning river bottom geometry. The data gap was eliminated by a great = abundance of new data obtained from recent surveys compiled by the Army Corps of Engineers for construction projects at the eastern endof the model domain. - GeoLoaY: The alluvium was found to be between 60 to 80 feet deep on terraces and 10 to = 15 feet deep in the center of the river valley. Alluvial aquifers in the model domains were mostly unconfined, with some locally confined by Holocene overbank deposits ; These alluvial aquifers consist of coarse sands and gravel underlain by predominately horizontally bedded sandstones of the Pennsylvanian Dunkard Group. The Ohio River creates a groundwater divide in the Pleistocene alluvium under the river. This ~ groundwater divide does notappear to exist in the bedrock aquifer. Typically, the permeability of the alluvium was 100 to 300 feet per day. Bedrock - aquifers were primarily confined, and consisted of Dunkard sandstones with some minor limestone. Permeability of the bedrock aquifers ranged from 0.5 to 5 feet per day. Hydraulic conductivity used in the models were 330 feet per day for coarse alluvium, 30 _ feet per day for reworked alluvium, and one foot per day for fine alluvium. Hydraulic conductivity for bedrock aquifers was 0.1 feet per day. Alluvial aquifers on ~ pBoloelnnleervhelasosfe5t8t2Ifseleatndabhoavdeasheyadrlaeuvlelicwcaosnduuscteidviftoyr tohfe20hy0drfaeeutlipcehredaady.ofTthhee Onohrimoal River. = Divisionof Water and Waste Management 000049 Final C-8 GIST Report page 46 MODEL CALIBRATION: - A total of 50 industrial and public water supply wells are located in the model domain, 44 of which were actively pumping at the time when synoptic groundwater elevations were being measured for model calibration. The well locations to the model - domain are: + DuPont Washington Works Facility (WV): 13 wells - + Blennerhassett Island State Park (WV): 12 wells + GE Facility (WV): 14 wells + Lubeck (WV) PSD: 6 wells - + City of Belpre (OH) pum1 pwienlgl w(eNloltse;: thBeeliptroetahl afslofwivweas assigned to one well for the model) - Little Hocking (OH) Water Well Field 4 wells (wells PW-1, PW-2, and PW-3 were included in the model. Although well PW-5 was included, - no pumping was simulated) - `The mass balance of the groundwater flow model had a total error of less than one percent, indicating very litle error in simulating real world conditions. - Recharge was estimated to be an average of approximately 8 to 10 inches per year, according to the USGS model. URS Diamond's model was calibrated at eight inches per year and, as the modeler for the USGS agreed, seemed to satisfy - conductivity calibrations better. Differences in the two figures arose from different interpretations of possible areas of incised valley bottom fills under the Ohio River. These areas may have slightly different hydraulic conductive properties from the. = adjacent sediments. Sensitivity analysis was run on three parameters: hydraulic conductivity, - recharge, and river boundary conductance. This sensitivity analysis indicated that most of the uncertainty associated with the model was in the value assigned to the re-worked _ Pleistocene alluvium under the Ohio River. ~ CoNcLUSIONS: The calibration of both models was tested and highly refined over the course of ~ the modeling effort. Both models were only slightly different. All parties placed high confidence in the somewhat more sophisticated URS Diamond model. The USGS further refined their model by incorporating some of the data presented in the URS - Diamond model. The Ohio River creates a groundwater divide in the Pleistocene alluvium under - the river. The principal conclusion, supported by both models, was that the groundwater _ Division of Water and Waste Management 000050 Final C-8 GIST Report page 47 divide under the river, along with the pumping rates from the DuPont and neighboring GE Facility wells that draw down a cone of depression, precludes C-8 impacted - groundwater from the Washington Works Facility from being drawn into either Lubeck PSD municipal well field in West Virginia, or the Little Hocking Water Association well field in Ohio. Some limited groundwater may migrate off-site in the northwest corner of - the DuPont facility in response to GE pumping wells #3 and #4. Sources of C-8 in the Lubeck PSD and the Little Hocking Water Association wells, are most likely coming from the Ohio River and dispersion by air. RECOMMENDATION: Itis the recommendation of this report that the URS Diamond model be accepted as representing real-world conditions in determining groundwater flow and contaminant - transport. Division of Water and Waste Management 000051 Final C-8 GIST Report page 48 - `CardwellW,eDsutdlVeiyrgiH.n,iaRGoeboelrotgiB.caElwainn,d EacnodnHoemribcerSturP.veWyo,o1d9w6a8r.d, 1968 Geological Map of West Virginia, ~ Corporate Remediation Group, an Alliance between DuPont and URS Diamond, Letart Landi `PGarrokuenrdsubwuarlge,r PWreosttecVtiirogninPila,anJ,aSnuWa-rNyP7,P2e0r0m0i.t WV~76066, DuPont Washington Works, - Corpor"aDtaetaRfeomreWdaisahtiinogntGornouWpo,rkasn,ADluliPaonncte bWeatswheienngtDounPoWnotrkasndSitUe,RSWaDsihianmgotnodn,, CWoempsitlaVtirigoinnioaf, HJiasntuoraircyal 2002 - Corpor`aGtreouRnedmweadtieartiMoonniGtorroiunpg,RaenpoArlltifaonrceWabsehtiwnegetnoDnuWPoornktsaFnadcUiRlSaDnidaLmoocnald,,LDeteacrte,mabnedrL2e0t0a1rt Dry Run Landis, Washington, West Virginia, January 2002. CorporIantveesRteigmaetdiioantQiuoanliGtryoAusps,uarnanAcleiaPnrcoejebctetPwleaennfoDruWPaosnhtinagntdoUnRWSorDkisamPolanndi,, WGarsohuinndgwtaotne,rWest - Virginia, January 2002. Corpor`aStaempRleimnegdPiraotpioosnalGrfoourpt,heanWaAslhiianngcteobneWtowreekns FDaucPiolntty aannddtUhRe SLetDairatmLoanndd,iO,hiJaonRuiavreyr2W0a0t2.er CorporMaotneitRoermiendgiPaltainonfoGrrWoausph,ianngtAolniaWnocrekbseFtawceielny,DJuaPnounatrayn2d00U2.RS Diamond, Proposed Groundwater - Corpor`aStaempRleimnegdPiraotpioosnalGrfoourpt,heanWaAslhliianngcteobneWtowerekns FDaucPiolntytaannddtUheRSLetDairatmLoanndd,iilO,hiFoebRriuvaerryW2a0t02e.r - CorpoWraatteerReamneddiGartoiuonndGwraotuep,r MaonniAtloirainncgeRebpeotrwteefonrDWuaPsohnitngatnodnUWRorSkDsiFaamcoinldty, aJnadnuLaorcayl2,0L0et2arStu,rafancdeDry Run Landis, Washington, West Virginia, March 2002. = CorpoWraatteerReamneddiGartoiuonndGwraotuepr, MaonniAtlolriianngceRbeepotrwteefnorDWuaPsohnitngatnodnUWRoSrkDsiFaamcoinldty, aFnedbrLuoacarly,2L0e0ta2rtS,uarfnadceDry Run Landfils, Apri 2002. Corpor`aatned CR-em8eSdaimaptliionngGRreopuopr,taannAdlOihainoceRibveetrwePuebnliDcuPWoantetraSnudppUlRySSaDmipalmiongn,d,DOunPeo-nMtiWeasRhaidnigutsoSnurvey _ Works (December 2001-February 2002), April 2002. CorporIantveesRteigmaetdiioantPiloann GfrooruLpi,teanHoAcllkiianngceWbaettewreAesnsoDcuiaPtoinotn aWnedllUFRieSld,DiLaimtoendH,ocPkirnogp,osOehido,SaAmppriili2n0g02. Corpor`aGtreouRnedmweadtieartAiosnseGsrsomupe,ntanWoArlikaPnlcaen,beDtuwPeoenntDWuaPsohnitngatnodnUWRorSkDsiFaamcoinldty,aCn-d8LIodceanlt,ifLiectaatrito,n aanndd Dry _ Run Landis, May 2002. CorporWaatteeRreamneddiGartoiuonndGwraotuepr,MaonniAtloirainncgeRebpeotrwteefonrDWuaPsohnitngatnodnUWRorSkDsiFaamcoinldty,aMnadrcLohca2l0,0L2etSaurrt,faacned Dry Run Landis, May 2002. _ Corpor`aatned GRermoeudnidawtaitoenrGMroonuipt,orianngARleipaonrctefboertWwaesehninDgutPoonntWoarnkdsUFRacSiliDtiyaamnodndL,ocAaplr,ilLo2t0ar0t2, SaunrdfaDcreyWRautner Division of Water and Waste Management 000052 Final C-8 GIST Report page 49 - Landills, Washington Works, West Virginia, June 2002. = Corpor`aStaempRleimnegdIinavteisotingaGtrioounp,FlaannfoArllLiiantcee Hboectkwienegn WDautPeorntAsasnodciUatRiSonDWiealmloFnide,ld,ReWvaissheidngPtroonpoCsoeudnty, Ohio, June 2002. - Corpor"aatned GRreomeudnidawtaitoenrGMroonuitpo,rainngARlelipaonrctefboertWwaesehninDgutPoonntWoarnkdsUFRacSilDtiyaamnodndL,ocMala,yL2e0ta0,2 SaunrdfaDcreyWRautner: Landis, July 2002. =- Corpor'aatned CRe-m8eSdaimaptliionngGRreopuopr,t,anDuAPlolinatncWeabsehtiwnegetnonDuWPoornkts aFancdilUtyR,SanDdiaLmoocnadl,LaTnwdfoi-l,MiWeeRsatdiViursgiSniuarvey (March to May 2002), August 2002. - Corpor`aWtaeteRreMmoendiitaotriionng RGerpoourpt, faonr AWlaisahnicnegtboentwWeoernksDuFPaocinltitaynadndURLoScalD,iaLmetoanrdt,, aJnudneDr2y00R2u,nSLurafnadcies, Washington, West Virginia, August 2002. Corpor'aatned CRe-m8eSdaimaptliionngGRreopuopr,t,anWaAslhiianngcteobnetCowuenetny,DuOPhoinot(MaanrdcUhRtSo JDuinaemo20n0d2,),OnAueg-uMsitl2R0a0d2.ius Survey - Corpor`aMtoeniRteormiendgiRaetpioorntGfrooruWpa.shainnAgltloianncWeorbektswFeaecnilDtuyPaonndtLaocnadl,ULReStarDti,aamnodndD,ryJuRluyn20La0n2dfiSlusr,face Water Washington, West Virginia, September 2002. Corpor`aStuerfRaecemeWdailaetrioanndGrGoruopu,nadnwaAtleliraMnocneibteotriwnegenReDpuoProtnftoraWnadshUiRnSgtDoinamWoonrdk,s TFhaciirlditQyuaarntdeLro2ca0l0,2Letart, ~ `and Dry Run Landfils, Washington, West Virginia, October 2002. Corpor`aStuerfRaecemeWdaitaetrioanndGrGoruopu,nadnwaAtlelriaMnocneibteortiwnegenReDpuoProtnftoraWnadsUhiRnSgtDoinamWoonrdk,s FFoaucritlhtyQaunadrtLeorca2l0,0L2etCa-r8t - `and Dry Run Landfils, Washington, West Virginia, December 2002. ~ Corpor"aatned CR-e8meSdaimaptliionngGRreopuopr,t,anWaAslhliianngcteobneCtowuenetny,DuOPhoinot(JaunndeUtoRSSeDpitaemmobnedr,20T0i2w)o,-MDieecReamdbieurs 2S0u0r2v.ey CorporFaltoewRMeomdeedli,atDiuoPnonGrtoWupa,shainngAtloinanWcoerkbse,twWeaesnhiDnugPtoonnt, aWnVd.UJRanSuaDriyam2o00n3d., Revised Groundwater CorporWaateteRremMoendiitaotriionng RGerpoourpt, faonr AWlaisahnicnegtboentwWeoernkDsuFPacoinltitaynadndULRoScalD,iaLmetoanrdt,, aNnodvDermyboRrun20L0a2ndSiulrsf,ace ~ Washington, West Virginia, January 2003. Corpor`aRteepoRretm,eCdoinasteinotn Group, Order GaWnR-A2l0i0an1c-e01b9e,twDeuePnoDnutPWoansthianngdtUonRSWoDrikasmoFancdi,litCy-a8nDdatLaocSau,mLmetaarrty, and - "Dry Run Landis, February 2003. - CorporWaateteRremMoendiitaotriionng Group, Report an for AWlaisahnicnegtboentwWeoernkDsuFPaocinltitaynadndULRoScalD,iaLmetoanrdt,, aDnedceDrmybeRru2n0L0a2n,dfiSlulrs.face Washington, West Virginia, February 2003. - CorporWaateteRremMoendiitaotriionng Group, Report an for AWlaisahnicnegtboentwWeoernkDsuFPaocnilttyanadndURLoScaDl,iaLmetoanrtd,, January 2003, Surface and Dry Run Landfils, Washington, West Virginia, March 2003. -- Corporate Remediation Group, an Aliance between DuPont and URS Diamond, Sampling Investigation - Division of Water and Waste Management 000053 Final C-8 GIST Report Results. Like HockingWater AssociationWell Field, Washington County Ono, Apri 2003 page 50 CorporWWaaatsteheiRrnegMmtoeondnii,taotrWiieonsngRtGerVpoirougpri.ntiao,arnAAWplarisahn2i0cn0eg5.tboentwWeoernksDuFPaocnitalnadndURLoScalD.iaLmoownad., Faenbgrueasryhe2m0s03r,amSumreface DuPontWoCrokrsporLaettear,ReWmeedsitatViiroginniGa,rouJpu,y L1o9t9a5t Landfil Hycogediogical Evaluation, DuPont Washinglon DuPontWaEsnhgiinngeteorinn,g,WePsutblViicrgWinaita,erJuSluypp5l1y,R2e0s0u2ls, West Virginia and Ohio, DuPont Washington Works DuPontWaEsnhgiinnegetroinngW,or3k0s,02Waasnhdin4g0l0o2n,PuWbYli.cNWoatveermSubpeplry R20e,s20u02l.ts, West Virginia and Ohio, DuPont ONeil, Colleen M. C- Health Level Estabishe, InDEP, June 2002, pag4e Tetra Tech Richardson, Ic. Monitoring Well Installation Program, October 1389 Tetra TAeucguhsRtic1h5a9r0dson, nc Monicring Wel installation Program at Letart Land, Summary Report, West VAisrsgiensisamDeenptarotfmTeonxitciotfyETneviacmon(mCeAnTt)a PRreopteocrttionA,ugFuisntal2A0m02monium Perfuorooctanoate (Ct) WestChVHiaurpgmitaneinarRD1ee6sp,oauorrftctmehesen,tooCsfotnEsnVveiinrrtgoinOnirmadeCenortdaIels,sPurNeootdevPcuteirosmnubaa1nen4tdr,tto2hAe00rW1ieests V5iragnindia12,DivCihsaiponteorf5H5eaalnthdaanndce 1, iIn } a Cee sc t alE i m` % ny [YR| PciR se A a Fell g 5g a Fc EE agLrnaonuidnridrwoattaeryrcmoinnigoninggnwallliantghae nLootwart --Divi-- sionof Water and Waste-- Management TODOSH _ FinalCBGISTRept APPENDIX A: - Site Maps Topographic Maps - Plan Views Groundwater-Top Maps - Site Cross-Sections - Division of Water and Waste Management 000055 -[ [------ | - { Lote LETART LANDFILL fd LOCAL LANDFILL. HRA eon, DRY RUN LANDFILL | | - SeonuINyET ihood0 N KHEo R, poBpeese | || elNy oe DETR 6 | Ta apa] N oo cose K(h3e proie} - Bs ed 3 53 guna Joovic on _ wnB)h | (GoCfRendYpo a He' p erga | RE SE Re Sion] _ wy hpi oe i Jcus Grasses) Snein_Y,rtd| uelTeE e - Li 7 . [Zee | Gemem rt] BEE EEE Figure 1.0: Index map for the four Dupont sites. - B o o nay Ladinieals cafB = AES lA COVA Sy nih GENT =A ee IRR SEi ie AE Ie dy SA Pa Sa | EE leap eal q EVaE nAL E(yRnA a L TT| = ~ Tie [ee - Figure 2.0: Location map for the Dry Run Landfill. 000056 - ----- A 8i - - 3 : vs Cor dy - LT % Yi \ ;E i, -- ee Pp 2 1. p Lire - LS IS , TyR i Tipl aEhl il " iH J TY| hd] "3i |{ iif janPes | 4 had] J; EI po 1| I TEE of - _ Li ie vg INS Ty Y wu mH eir la | my o5 - ay \ p i S yg } _ . gat EES N{ oam] :a Ro "aig be - Ca SLi 1 Snr ply ty i | ` 4 - = +, pe i dAi | 0 3 - Bere ont terme erm ern deen] - Figure 2.1: Dry Run Landifll with sampling points. 000057 ~ = a AN + =) = ' AE A JS J 0A = 2 {; . Eo - - te :oY --teyd Te ` - i ow. Eo | aJm---- Figure 2.2: The Dry Run Landfill Geological Cross-Section Lines. " I - HO = en - te we fy |- - . oo" - mdm me FE Te 2 e = Figure 2.3: Dry Run Geological Cross-Section A-A" - 000058 1.1 - f*e boE d EE d pT os iHha _ HARIRI a LW Gilg ok i - \ MinikIs olh"i ~ Ml 1 A| i | -_ A\k'|eiLphe I:st ili: AH - Bil o 1; Phe Hd 1 -_ R4Vo aIh* i} a - et Had - | | - Hin 1.0 Wi ifo i , Poi gq 2ol3s . ib Bill=14d = Foy iV i Ee _ Figure 2.4: Dry Run Geological Cross-Section B-B'. 000059 _ op = - - " = |e --/ A li m - ma ewo EF pf we Foo P - - - [ _ - aE VE a E 1 Ty Figure 2.5: Dry Run Geological Cross-Section A-C. T wv - -l J J} Ll - u| N. sl / |i = _ i wl "Ew lu B | -- - wld _ ttee E PIR aL n a sores BR -- Figure 2.6: Dry Run Geological Cross-Section D-B* 000060 _ M& ei lPRA - -- 3 \ E of T N EAK NaE +; LR =r y RPC , v Ih aN 7 - ', L{eamp ec 4. - Co BR ~ /oAoA 2i Td - Sl tare E [= - -------- Eo | | Figure 2.7: Dry Run Zone A Top-of-Groundwater Map. sn - )& , : # To Nd - cA co owsT el EIN [BES es fp . . - SiEIEEA gem 3 _ mpra nyaut NX3 ; : _ ; )framoeCe osNus rT ~ | 7 foe , _ Co " \ core vi LdSe ft _ ------- TT 000061 - - md fpirnomemgrutr atin Figure 2.8: Dry Run Zone B Top-of-Groundwater Map. LETART 3 |. PERIMETER- - } Ry ) Zz . Vos" J 2i Tob ; :A |: She A "LS re Figure 3.0:LetartLandfillLocation Map. SS EY me | Sm WUE Ue | | BomsINON ZF Nl rel ND lhe JP PK - Lge wi _ E SCA xaN n N1E & | Figure 3.; LotaLanai | ie fife re) OF 7 4/ _ Location Map Close-Up. : ) Su / | 4{ - ORS J F - SE iw) yy 7 - Fa 7 do Naw C Lis Ln | @ FREE - pr| em BzEEA 000062 SL } % j 5 AN LE Vs = J _- 7 / J NY bo y ~N ] 2 ) TAY 3 bo v/ ] haaTNPUNET = "eo |j - . "oa i i | LT = KR 1. - n> ie | - oLh2A Po J . i| --r i ! 3 - = 0 aN ! k D , ! wil 7 - wf {47 | - Fa A ry 4 15 a | _ | Jem 3 ! / ly4 / y pe 7 - gh Saal | BR R | T 1 @A-- cio we oe]| FE Sr BE ------ Mmmm - Figure 3.3: Letart Landfill Geological Cross-Section Lines. 000064 - | rear fTrriiiss ih - : 5 f Sl Ire : loiod _ I< : Kaonzey Jf Sy I1 ey1 anrHHEHE WCifd - | Jal 01 1 6 EN TE dg HI - C2 i - | b Af l HH | NSiDogi flgiJ Nooo tito - oSotd ji i pfyy - Jfadl CEE RI ! ffdo LifyiE t| h - LE sfond BRYfEEHaTd iit,y = la El fo fu--1} | FaFriay LhEE L! ubi ll bog fri, - NH Woy fey RB CEL i oe - Figure 3.4: Letart Landfill Geological Cross-Section A-A'. _ 000065 _ - f RL N ~ | . iA -- I - - - :i pLo eop Awi a - - f 1 z NED] mem - - Life | . - uCswo- n SI IEEELL LL [w [wioem (wm foe | imme| - "Fi35g:LetuartLrandfeill Geological CrosSection BB". ka = -- = - ! a = N 1| ELN [:-= - Tey - | J == ---- New = IN fm - - 3 oe. asm EET. remeron a ET aod? H -- Figure 3.6: Letart Landfill Geological Cross-Section D-D'. 000066 - PE EEEH - Fol AT fey = . ! H | T / a TH TT ith gfl h _ JD Ji / bo TE ii - F Pho Y all E i [ RB . L |I i WE iL rE{ TTT Hii Rr pa e . - 7 p oo dp a ie1]] |:: 177 wl hd - CL ori - TVTO T TTT { B VV Ed _ TTA ET NNJ!fLo MWiaiglhd obi = Yr i io Al yl Rr _ oda y Ley! - / iyi HC tga! {Ne HYono Ho jie iE - N Lona --- - Booviiiiaiiiiiiaa - Figure 3.7: Letart Landfill Geological Cross-Section C-C". 000067 - { . - oo | | v | - Bs fneSegee J.Lo || > / | eh | _ ABe | - A | MN. || A " ~~ i|| Fr o )0 | - tsNS LD // - [oo guteL=ATbeEs pyris - - Ceol SN: wl Rg - J wi od (a - Tl (ogi.| _ 1a rs EET - Sn O lnSSs| 2 FERReEw. wae eS SE | Figure 3.8: Letart Landfill Zone D-E Top-of-Groundwater Map. _ 000068 - ",, | - EE _ || oe nm | ,; | _ R pR L LSA 5 7 || . wg vise" LO [- | "N/ | - > Er ry - "4 > | z - A _ 2yr mn ; |r | Po | LmD% | \S os A - Ty WN eZ F NZU | - } .A | V1r7aauy ~ {eCmaip SL W Li Ey " aSA AA y 7 ls 5 pas - Ed- a)ol ns A _ . | Tam =, To wmme| - rewon Sorpirtin Ausslion trois ops = EerEReeE. wewew Zeooe ous] - Figure 3.9: Letart Landfill Zone F Top-of-Groundwater Map. _ 000069 - I=E = : TUN LETT 9e nd --_ "1" ( BB Lop R\ 7k ! | _ i fon 9| | oe Vela | - I . . roan Wi - | J N <* 4T foe"s ' mem PROPT ERTT Y ee, if ST TE RvER LINE Ci] - le a ern | [fr en hae | _ LEE mp = Te * NE _ L | o sEasaeEl s AR] LJ/" PLEANLNODCFAILLLx _ LF J LANDFILL: Yong le /- wer PERIMETERS. ER Hf ~ [tle - | wSoheT EPyo wei a Ma: If " MEETS LATE --- gg ee | ny [Sef FREE Figure 4.0: Local Landfill Location Map. RB 000070 = i mre _-- me i, Pe Ae _ 7 ip ; NE 4 A i 5 - ax _. SNoepde Wa BF MEER = FigureE4.2:ELocal Landfill Geologi-cal Cross-Sectioen yLines. E 000071 24 Ii TL i - eT - gt 08 Toi2 8o% d % Co 3 Loi 3 fof, |i Hl [iu - . Biphbeo! H LoyM] Co - i i iCo [iH . or!/ | 0i - s! ot SinT ~mAF M d B Boo rirn fl ib[IloEHElp - TiaN Sug | iil 5 ods 8 /| - NY i)Ul go>i . =| 3 \ 5% ol Soh Been [= - q Bal Q |4 I Bori g2 T5E EgCl, 155e2p = FBR LN b\ h E WyEn = a PoWe l jae | [Jum - uANE| i18 48 = } TSow m\ F 18 " jpeg] LE - $08 8B ire sFOr F 8B % 8 = Figure 4.3: Local Landfill Geological Cross-Section A-A'. - 000072  iy _ iia) WEEE - uyCE$0E85 8 Tyo 2 8 & 8 5 isloily I i" _ _ o Sa pa A lRr Hy Ee SofIhiiF EAWhoHL il = .oaTH Hy Pony J] - NNlE EE Hb Hai ~ so HE os LH es 3 pa LEE log 2 - fod N oe Mow 8So1e5 PRN fe EEE - NE Swh f Hae Hy i e5 m ESRI ii LI ii - ii 1I3 - i084 tk EE oz Ek Figure 4.4: Local Landfill Geological Cross-Section B-B'. - 000073 | ow in - wp i4 EEEe Fdy4 Ty HTiTlR - 0 ST | il _ bovWois i if | . IHi |bi oad 3 JF : - re & - e// Eionvl Whol - NN Boule So - i ~ Nd 5 Ng ! "1 1 nti3 ol i ii | i ul, rl 14 0| 5 Nu = ] ydooa d$Fe. - } ERE AE a sd on| - | { HE A WoRnE 1 ai = NG SG idk oo ius | IH iF 2 FFF dd | Figure 4.5: Local Landfill Geologieal Cross-Section C-C". - 000074 = | ii a _ Y A} --= i FIA ANSE - (77. i 7S 0 a fa - HAARN Seg edire.4 =5 3; ] | ) TT Fo () : / - [Fe AR OEE -------- Figure46:Local LandfillZone A Top-af-GroundwMataepr. - rT ems = i ha E Va ~ i her i Nye it _ Ad 2A 7( - ZN vi ENV 2 E RM "PoE _ EMS TRO - --Ft Zone C TopatGroumdmater ow 000075 ~ oT NA 45% i] _ I | - BE 1 oF PRN CE lk | | eo po - . =\ r AiR | -- | - } - | - . WASHINGTONWORKS WA ETRY - WoL aT ese \mg | C(R NENNT.7 A TTST O - [Ee err A Ir CR A sly, | - I a pRR A rea - | CN PL ulster ew | AEs 0 TTT Se - | SRT ro ) \5 / TySR JY SA 1 | il Ae LON Le - |I J 7 en" 2 TPNA E ny REG - | ,~ 0Te A Ltown?A nE S J~aN] - Ary &Cy * (aw ai oomonee | || Comor ranRe uegea ten d oC m saR ms soT ne =] = Ne EERE mag TEER _ Figure 5.0: Washington Works Plant Location Map. - 000076 - .i wtlH, ETd _ =e J | 3 [f5h4 ) - >A Af wi) BE) o - ld | Ji - isl| li v| - l\n iTTT - 4| = E foot JI - , Be " ah - | a el . 4 via, - DogpiRREE 5a, Kon J . ! - TRL Lb g AE e fi H 1H - Fv N gl goeofiof - BA EH - rot | - 000077 Figure 5.1: Washington Works Facility Sampling Points. - [a A ] Sr _ TA 7 - 4L: l _ 4AY Iifl7 i , ibr ai 1 - Bfiram |- ' TJES THne rh 1 12 h ifiill 6 add plEeECl es. - Ra raa) n Eo Lon inhe }- CPhelMaES glHi } SL = Figure 5.2: Washington Works Facility Geological Cross-Section Lines. - 000078 - J mE eT yi i Eda - thy : rm ti) 4] N r Ae) BONY hi | ed fi jiu i SEE ee ik - Tr ) RE 1 Ll -- ALhNE e i i p a - bili "ge ~ Hy . Se " 1g Ls | mi | | i bd a -3 N| il Sp ETERS ; -- - Figure 5.3: Washington Works Facility Geological Cross-Section A-A". N 000079 - Coe - 1 4 2 lef - Fi + Ag th] _ Hy | - i - ' Ft - A wi d iir 4| -- SwEhe TE } A= i ] egy Lm HE hy i:Ji:1 si) of ! ulrt i| iil bhi aiy fian) Jit Ai wi = Figure 5.4: Washington Works Facility Geological Cross-Section B-B'. - 000050 - hi - lig I Sit ET onan BY - _ Aio ee FR isi 23009 5 en" Tn Toafla toad Cogbone 000 oy ii Fi ~ E P Be N RR : plIih oe 2 00%of i IT - flee Bg | dl - Foes qrgg i wo emai i 5 i 0 I: 1s7 Co i ~ # RE 0oboo 2 M2 0 I. Co. Ffra) r2eLZohce Blheu lodnl] | fiit Ro EN hen CoMioe laa 3 Pe Yn i on Wns |i CONP SE e i L[i ean - Spe d a _ ei lWolaRsey iB nesetdi - 0Yo {PrTTrETrebEi Ty TyHoeo TPcyo ol i A IH1 | Ba] I Figure 5.5: Washington Works Facility Geological Cross-Section C-C'. _ 000081 - ihe - tl ~ maf SE pre [EEN `a : \ | | } wi |G i _ a 1| | {Lg I| i - HY gE of" _ a24.0 n "3113 TTrLo bol i | | _ Ll :i i i asi s.i i |i ) y i3 [ - } / | | [iy E we lA a | | B| didr - ali, pw |W if "wo IH uN J i Jb . Himay RN Amd, went il| o#2h _ bo ki nay HT _ Figure 5.6: Washington Works Facility Geological Cross-Section D-D'. - 000082 - - fitJET] Hi J ne i = TE m T of Fah so . _ Bobi So1 Tae"g 10|ol ofiH _ i - CLE " al a Sav ! "| i i AL . a I P j g U| sutend - Bo HR . on dn Wo at _ NL , Io - ND NN 2 [i PRL, - aX bi | two ; 57% phopede ml Thy - ed | = < 5 4 0% fod | ia - Figure 5.7: Washington Works Facility Geological Cross-Section E-E'. _ 000083 PE ili rr te dase fig = EE RH IE Ela OFENE -- ~ i mwmili | 413 4 - ENN - i - = \ \\ op iiil Nk i Iiil - "aN ji - -| - _ - = AN i| Ped fe oy FVeLo L od T2dH i1 LEEF | iiiidt ih ee i wid SS Lohr}pha3 basi i Hepel Pil ug rl - anvoJ4 a w| iit APOlONa NLfGSnT to '| | L8bLil ou :ol viAYvo. A3 - SET TTY fi _ ht Figure 5.8: Washington Works Facility Geological Cross-Section F-F'. - 000084 i= Joo +wd iG al | - Tile - |e - ie pr lie | i 5 er a hed - wows 2 pal i l&" ion win ANS 0 so, aye | 0 7 anele- - a 7 Tei |B 4 aaa Lo al - ASERRRE rT - BE a eee - [EmEnT m EDma)OQ vow ae EESEE - Figure 5.9: Washington Works Facility Geological Cross-Section G-G'. = 000085 - on 7 _ TEN Po ASL Ji - - PERE hy SHEH Tf 5 (gir | i hi =] Ed :F . Fy ty - 157 ih - Lo Ay - CSHf Ean of TE "al DN - ENC - S ME iO r Rs Fr cu, STE ii il ofiF ith | SND g itll - FR | Cy 4 cl 0% ` ACTIN _ BNY AS %Nytd GH i oR - Sa JT Len 5 _ fiWgytlc | ST&o T i EL GER LATS iis - " len > CEXNN a E$L8i3%t _ SON Nw 84 _ PRRY N\ | Figure 5.10: Washington Works Facility Top-of-Groundwater Map. 000086 Final C-8 GIST Report APPENDIX B: Groundwater data (both graphs and tables) Division of Water and Waste Management 000087 [1] ITE 5 110 0 0 11 MEC er N nerere 000 EE 1111 1 10 11 1 CH . 010 0 HHH E0 H4 HEH "%. g| 1010 01 CY g 0 0 01 1 10 0 001 a 9, 3! 1 0 1 i OY i1 1 11 11 5 1 00 0 0 01 11 EY oo ITECCanie e er gl w a % gl ST [mere Ae err1 gl sz EEE rrHeer erreo 7 FSR 1 1 11 x IHD aAIH DHE t "9% a x 2 MTNA HHH AH Bea E [PE CN N A71 <07%, S2 |(:8 DT 7 1172 51 101 3 gE THE HH 14 0 111 2 g THR INL] Z MTRTHINN MET Arr HAH % 2 05201100' 1 Zz ZEA 1 8 E 0SS 10 0 0 Fo 01 a 1 1 . 2 HHH MCRAE 1, 3 [rr TE IN @, 3 110 1 119EI MH I Terr yo, reer i 11 3 100 0 11 I 3 11. 1 01 2 00 11 1 HEHE EHH OE %, *. 10 01 = HEI ni HEY O : E< 3 en %, gl > 4 3S (6H) 80 VOVOSS | 108 1 1 IHL Zeer yn er merrere1 11 i 0 1181 1 1 1 1a 1111 00 QFE en i ee ney ner ET Hera HR "% 01 1 1 ~ ner meg TET peer se JUN 1 1 1A 1 1 FO 1 11 FES I 1 1 JES 11 1 ae "2 5 [ETE Hera 110 1 8 FN 1 1 7411 TEE ermeerWy Fee oe, ee o NTEEECITETirr mn Timer1 se F110 1 1 1 z 1 1 1 F110 1 1 1A A SINE were re 5 J EE %,, 2 E10) 1 "8 FE. 1 10 1 F110 1 0 11 a mr EE %, 1110 11 1 1 ` 1 (PPE ern weer Ria I WHEE) 5, (nr a 110 1 1 110081 A * 11EE 11 01 1 10 rr) 8-0 VOVVSY | il ML WHE i IL , 2 1 1OE iH 9% 2 HIEELT HAR Sn er) z E01. 1 8 10 1 10 01 1 CE 000 a 1A z MUECLIO ATWTE -- E JE EERE } [RCE ee nee eT ou BH MH ga IEEE re HHH % 22 F101 0 1EE EE cM eT AeA ef wo JET WATE E RET I' EES 10 OC SIT TrMe EPRI] 2 2 22 3 eT HHT gure) = Ss 58 FE 11 1 11 BP 1 0 10 PY 2 NET Herr eeEmer 3 S HH AH RHE HE > EE 5 le HAJ %, 58 z [ie HHH I "% [ EERE Ih I, . 8 zm iH 11111 Sr a %, zz IEEE er % [38 litionm HE PHEEE , ti iL WHI Hl if Hh MIRC WEE i il [a ER 101 01 1 + fre HHH NET REE 17 HF 15 1 " IEEE 11111 (Bet) g-0 VOVOSO DuPontde Nemoursand Company `DWroyoRduCnouLnantdyfill C8 water data '-- AUnzietrsoareequpagls a Non Detect concentration Ayellow-colored concentration is above the WV-DEP limit `Groundwater monitoring well MW-218 is actuallay "Zone C"well ~ Groundwater Zone A Date DRMW-12 DRMW-13 DRMW-15 Limit MAapyr--9913 150 150 = Jl94 150 JAupnr--g956. 0 115500 - MaJyu-k978 00 927 150 150 Jun-98 150 Js 0134 36 0263 160 - Juk00 0.16 98 0763 150 Dect 0.085 986 494 180 FeJba-n002z 0011116 1615s 433655 115500 T Martz 00829 126 491 160 May02 00817 189 5 150 - SOecpt0o22 00.0160296 2130.91 a3999 115500 Mar03 0.101 15 a4 150 -- `GroundwaterZone B-Dale DRMW:6 DRMW.6A DRMW-124 DRMW-128 ORMW-13A ORMW-14 DRMW-168 May-01 0 -- ApJrub-g934 04 05 Jun-95 08 Apr-96 097 019 0 1 0 ~ MJuakyss7 1 003267 00 1857 0 Jun-98 0 0 Jul-98. 0096. 0.081 54 007 25 = DJuelc-0t0 0211.024 00..112588 02150 9649 ots JanG2 0824 0.168 0085 597 0 Feb0z 0822 0.125 0 373 0 -- MaMya-c0022 0814234 0000788352 00 2314 00 SOecpt-0022 071.8153 00..108818 0.2508 56.8164 00 0 --- Mac03 0727 0.059 0.052 15 0 0 DaMtaey-91 DRMW-175 DRMW-168 ORMW-198 ORMW-208 ORMW-21A Limit 150 = AJuple-9s4 115500 Jungs 150 - 000081 irpeorcresst 1555000 - eiSuee] 5Ji0H Decy % = JFeraonr-ese0s2 1Ji50 woShreopdas:z ois o ;0 S0 oaokw iie _ GBortheoeurndGwZraontaeeGzr- mt 150 srornosss i%i fri eeedr %%i - ouYrseeo i%% _ omFieenmatsay i4 . 2 ooryc0s3 %15 Neeeodss 0HE.ie oSBuree foarcezWoat*Oer*u-t- 001es Oulnt003 Ouiel004 PrBoopeurntyd a Stma#m1 Stoam2 DLroysiRnutne nda Pond. Link @ 5% forrnoegn osSs om ae wm % = ii8 - SrGuocxt as S0Wes omo`rhme zmmeee aawe snmsa 18m WA ei Mae ewnm ws GwSoso ooYsmee amseese aSmwwe amwyre im 1m Ie oeoss ae ws or woos MN moa 8i - prnWenStd ar ss ae wee me 15i%% rboerl % _ 000092 FaJabn0033 884] 115500 _ DMalaer.03 Oulet80815 Oulet03 Oulet004 Boundary13Stam1124 Siream#6211 Leachate97 Underorai7n Limit 150 - 000083 EEE J i I1 1 " i. 11 He 2A,OS WHiErRi R r AR He mEmIme 1 a 0% |?e EAlHEeiEsRRaENegiHsEbE pH W Hi E R ES E =, 2= WTEEE ERRE HSEt E i E a I HninR HeE )E H iaihgItamEeamySnf aaEmisEt e i Re An m e AOE[3 w HTE TMA AN| imma E I DHE EE E HyE HHH L0o " FS CEO EH HE AEE NANR E B 1 EE RiE a1aET RteEe a, Z| il FF EO 1 C E ECR R RIi eTe HI m ESe m iae m m i) nmtteACIR0 N E3a T [Tan eee Mi me . g&S 3 HHHA EEEAIR AIR T EIBETEREEH E EEEE ) , :g E 2 mmr rL e ienneeH meHiHa nmiee s .A t|4: RIO EH 1 8 ERm 5Emal e C n ma e 1 H1r Ai aEg fl 53= IWTENNT pHTH yf %, : Tr HHHEt PI im EEI nn R mI te1 E e OC]3 IH HEEREEE:a EEHERE E mEa AOR=, 22 H 1amH aHt AA A ivg i ERi EAE =20 34) FEE A =e er 18 . Br) 85 000094 A TT, MEA ih Ei AN BH % HEHE LIN . 188011120 11A1R 1 BE E 1 HHH EH M 50 1 1 4 HEH HHH CE g ERE Ai a, |! CIO GATE 11 EAA HRHES a E 2 HA Hp Lo H $I RL [110 : SN Hb LH %, 3 g [ITN HR IEE 5 2 a hi IT] | SESO a = JUREUTIAEC TE T i z 5 J EEE mEH C Tym T p HH %, 3 R661 F000 A BIE il TA By JH Wie EE JL 11 1) 0 1ES HERR HE 1.1 1 0UVO9S Hy HHH HI HHH ERARRIS HHH HH HHH % naraan AO TET = AT 5 AINE 5, INTRO i CHE ' i HHH Tm : : INTHE TH =, 3 HHH Hr 8 INTHE CEE NE HEH EITN EE TH = CT INT TN A = HEHE HR CEEEEE EEEFETTTEE = g 8 Bore 8 00VVI6 SE 1 1 1 1E10 1 (Eee mee meer E1011 0 HEB 51 11 1012001 0 ES TTT Ci "Ie nee emir1 10. HHH <, NTC HEH ME, a 11 NO [TfHn HHH 3 HHA [iia HHH ME (rr Cm TEE 100 EE 2, H| < ERVIN a" - FI 2 1110ES WHEE i ye 11001 01 AY @ w ICCTA ne Ee 2, | FE 1 00 1 "n 3 FESR 1010 1 EE , ICE py HE "ez | z 1100 1 1A HHH HH @, 8 |2 3 [EET HHH "3 FA 100 Bl 1 HHH %, . DR 1171 HHH HHH Hr | z HH [EE rs HHH HH , z| FJ 11001 1 I HHH % Z| 2 [ENE pe i 11 IY 1 - EEN 1 1 t a HHH [IESE CET <THE EE * Ss [IE A hi AE Mr 0021 002081 01} (TIN Te IA ", (TT TOT Ve uaTerHe | HHH % HEHE Ji HEH [l , 11 1 10 ed 10 AL WHR % HHH TTT IEE MeL i IEEE Iti MEE o VOI 1[C1C 101 10 1 EET 1TI1T 01 1 EN ON x 1 i1 1 1 1 0 11 1 1 110810808) 10 1 10 = 1 ITE 0 CS0 E T0 I 00 ET 2 1C 018 0 EE 0T1 T e 0.0e 811 8 m i a= 1 1 1 11 EN M 0 0I 1MI0 E1 T Ie 1 E I 1T es E i N IT E E1 T Ce, 2 JFOrR 10 011 1 1 A+ LES 1 [T 0 ESO 000 RO 1 CIE a4 [ INM TOT TEIrT iNCSn TTT ET T M oCvy 22 3E11 E 1I 1N C 1 I 1 Cy 2 2 5EJ 1 E 6 E 1 R e2 1 e11e F4o JJ I 1 M 1 O 1 01 AACy F3R 1 mmmTHTm 11 1 5 z < To [ MI EITTA AEITT C e 5 I 105EEE IC 1 EE CA g IEREMD T TE I To,A 3 i 0 1 110 1 1 1 1 0700 0 81 21 08 10 A8g M 10 TC1E 1 TAT SO 3 IIEEEC IEEEEIEIC EE CE 6 ` I 0E1E0E E0C0E 1 CI1E1 E EE ITE T CT - sg wi) 8 000098 CDuorPoonnLtadonNiemours and Company Mason Courty ~ AGcazaerttareiorqcusglansna Non Detect concentration AYello sored conceniration s a concanratin above the WV-DEP's vel -- GFrzoounnadwwealter data ate lion Muss WME MWS LWMO LWMTI LWA LMW-1OB LMW14DLim Naorvso 8so aa00 2zs am 02 0150 is Mvaar.s0a m0 1s2a0 115500 = Sepea aaw0 a0 i1%s MTaiyesr aoww ws 2 iis ~ SWams ao0w 1m0e% iis _ ATnnae x4e dmm0 es Wo am wo i0s 0 SSnooot 4a2s 181680 se oss orm one - lo we sm 0is 0 DSeecnocie T8a0 1168800 te1 oes ors ois 1050 _ VFeercee 7774 ilse 1144ss oosem ooiis o0i1e2 1050 VSewyoez e 2 e0 210075 o0a7r1ss 0x8 00006s9 11550 ~ Voauc;s een inam 11861 oososr ootzt oosuss 1104s 11%0 -- DOaEtWezoanreswe"lUs-MA0 LWAE0L1SA8 LMW-ISA LMWAAdA Limit 150 - NWoss w3s0 sw 08 i0 Joarngoo 27mn 115500 _ mJonto s0ee wsomm 3sas 0150 WFeaboa:z 11021 2wsm seez 1155 ~ mSoehpm0o2 da Tteeoe am sw ere am so em i15s0 0 Mees 14 iso ows DCa.tzeonewetsLwws um = NPovael 10000 115500 - Decor 1wow 000099 Janz 1700 150 Febo2 1920 150 = MMaay0z2 21277800 115500 Sep02 - oxo 0 115800 Mar.03 150 _ ADZaotenewellLs MT LMWT LMWS Limit NMoavr-.o911 6608 01 280 115500 - AJpuees7 51170000 5135 2200000 115500 May-98 24000 260 2700 150 _ OJcitsos 12682000 73833 7328600 115500 JAparnoo0 1173480000 221119 22118000 115500 = OJctoo) 1088000 213518 22310600 115500 ~ Jmnoot 961900 22429 21815200 115500 DJeanc0o2 2200640000 343946 33294300 115500 = MFeabr0z2 2108040000 312840 23250200 115500 MSaeyp-0022 2300050000 S16977 34100200 115500 -- octoz 2500 300 3480 150 Mar03 25000 218 1720 150 = SDuartfeacewat0er2-- 003 SRutnoorfmfwateSrtReoau3mte3 BRruinnker CRaupmof Limit Apr98 18 150 Jug? - ues 2 223 115500 Octes 3240 Jano 820 115500 -- AJ w00 11385000 o0s73 150 150 Ju01 159 201 Novol 532 115500 ~ Dec0t 381 039 Janz 501 014 19 Me 115500 Febo2 355 392 -- Maz 131 01s 126 115500 MAapyr0022 1464330 000268523 0.188475 7mo0 115500 = Jwun-e02 0 150 150 Asuegp0022 2405820 047 224 150 150 ~ Noonv0e2 e6d3s9 s09 283 o0os12 615012 150 150 Dec 1170 Jan03 ats 115500 = MaFre.b0o3s 221 0247 115500 - 000100 Date 002 003 SWRunON33 Stream Brinker RurCap RunofiLimit - 000101 EEE ed HEH BTA Er Henry T= fi Eh o ier ae %, a DSL HH 2, Mr HEE HEIN HHH ,, @ i Here Flee 1H HITE ", rrr rE pL eTTEE o, 7 1 HHA EAE EE |) % rE a @ = = 00 40 a LE A 93 LE %, 3 HE HL % rrrirr Are 1 rrI r TET rr ry rrr ro 5 2 Tr a LL = grrr sr CERT 2 3 $ 5 I HE HR a yr."on 1} w Ee Ee e rT peat ni "9 @, gz prerere PO ITE) , g |2 & 2 [TET TET THE HHH EET CITEL| 8 Pe po) 3 HL [ CHT @, 3 Emr HH rr ert 2E 2 HHH 7 Tr mre r 1 o 3 0150 4 11001 i 3 - [HEE HHH , 3 [HrrrRnrer LLL " FQ 10 11 ni = EE Tre1 2 3 rere nam A @, CIT] = + rE INTE 1 o - perry rrr EAE 150 IN 8 rTTo 3 1EE 0 pr "5 3 merry er Ye ES | Merrie HHH Ld "9 1t rE PEE Vn a HE EE ErHET HHA FL TM%, EE Ae 8 g YT LE =, 2 - ry 000102 iE eH PE no AE BON 0 on H Yao mvl mam amdJgObHl I m Tg O mT mn OTR - 0TTR H fe e pofeia HLA a, 1i1t 3IO NCES nae Ed1o01m0me a CI I 11 T 0A h RO 0 MEH p 0 t2 DIE ice itesa 1A a VVV1V3 | TE TEEPE NE EEE Jr - UETTEyTerI WR | HEE EH HL] 2, IEEEELErT e ee eer pT by DORN 00 i HHH : PI 101 RS R1 ES1 EE 2 CHL E g HE Hi EE : AEE BE Tse zl i 148 ns wu, 8 2 5 Hiei Ji pl HH 3 3 CEIT I 4 5 I 3 HHT pi MH| =, 2 INTE J 3 VTE,Wr ny mie, IEErere Ty PH By HH Hp Lr ICC THESE ES HHH HH : IEEE MAECE =, 000104 TIPE] | rrr er We Miele | ", 1 5 EE IHRE Pi NEE MOE Fo eerpn a Wmet |, . J . IER : PO 11 1 EE FTO 1 1A RE EH g HEE IH WEE ee Z:||g 2 HEH 2, % 2 (MEE 3 Ht HHH eerny a, i tM3 i a P32 3 Eeee er ey ; WEE HEH oy (CEE IE | EH By (ET BEE i HHH A, Hb Wry NEEM EEE +, Br) g-5 000105 wn H IfHa y | lie H| 8 E =hi i - IEfH8 e e })", " ie \ ~ mh | . 0 He :2. L i nm Hh h | : i |] is g:: i royll iIs ]I}i E;r | |\ ; 3 " : i inHr - iia 3 2i i | iiit HI]t [1 1[1] il tHTghi i | is Lit }: | :iiIaaEie tr i 'B . (1/6rh) Du Pontde Nemours and Company Local Landfill - Wood County. C8 water data -~ AUnzitesroareequpagls a Non Detect concentration `Ayellow-colored concentration is aconcentration above the WV-DEP limit GDartoeundwateLrLMZAo-n4e A--LLM: LLWM9 LLMW-10 Limit - Apr-96 39 15 May-98 2 9 150 o oz 150 May-99 May-00 162 10 132 0 01s 142 0038 150 150 = May-01 14 Deco 546 3 0 119 0046 0133 150 150 - Jan-02 Feb-02 584 122 502 104 0 014 ot 112 150 150 MaMyar--0022 a57527 15 188 0 06% 150 0 0% 150 - Sep02 635 137 0 0357 150 Oct02 Mar-03 796 52.4 199 16.1 00569 0 0395 031 150 150 `DGartoeundwateLrLZMoWn-1e2B8--Limit Apr-96 150 = MMaayy--8998 150 150 May-00 150 - MDaeyc-0011 150 150 Jan02 150 - FMeabr--0022 150 150 May-02 150 - SeOpc-t0o22 00658 150 150 Mar-03 0 150 - `GroundwaterZone C-- Date LLMW-T1A LLMW-138 LLMW-148 Limit Apre96 150 - May-88 150 May-89 May-00 150 150 - May-01 150 Dec-01 150 Jan02 150 Feb-02 150 = Mar-02 May-02 150 150 - OScetp--0022 222 661 0488 150 150 Mar-03 208 638 0317 150 - `Groundwater Zone D-- 000107 - Date LLMW-118 Limit Apr96 150 May.98 150 WMMaayy.-9090 115500 - DMeayc-ot1 116500 - FeJba.n0z2 115500 MMaary.0o2 115500 - oScetpo022 115500 Mar03 150 - Surface WaterDale Oufal 004 New 004 Oufal005 New005 Outlet 101 Oulet LM Limit - FAeprb--%o64 1Bl3 3s30 115500 May.o7 Juns8 13 12 a 3s 54 150 150 - Deacn.g6e9 37018 683 15 115500 ~ DSeectp 473 133 81224 115500 FJeabn0o22 111049 51a4 a81t4 115500 = AMoar-0022 15W1s 114458 40383 316 438624 118500 MJauyn-0022 10 em 213 W3o 115500 - Augw:o0z2 116 2 321 760533 115500 - SOecpt0a22 718156 115500 NDoevc-o0z2 125 107 31 est 975 811207 115500 = JaFenb0-303 42335 115500 DaeMer03 Ouffall104047Now001459 Oulfall404059 New005 Outlet 1051a Outet LM{ Limit 150 - 000108 PRR LAS CHIEHE TERiTYh wd iiE ie iYr [rs ig Tel [1 Wir pA i i il ll i iit %, HIRE ERIIE H A ie li HE ; lH E i1e8) H8I e e tard n Jay te a D% eRB . a at Hite H Seifiininnk1 evlimnlBer-Tu Bocidd [7 EA LE HE the, | FREER g3 2 m iHmCmfi Ce H nRieE ict eC ETE hEr > >. 12c23 `f : HiiEho h nualii ltfiEafnnnge ed ieNesR]co| P:Poiia i a et 31 i3= moe iHEHi E 1 pi R a N Le Ees ye HHHRIpEaE Er HEfR peAE rtii >R(f2ih5:i3s iWd r apriEE. i.i EERE H LiH he a ee ... (bd) go 000109 iE SE He HET Ho | H HEFE ERH HT Ii. SL" IAE Li A - d hnW1i LFe] ,vo iH m HEHE e AEpaRCy [2 me m HEe EHE[HH e feCar ete iEEHHe] s aNOa 2 yb MJETLiI 2 me i | [ECLLMPt Toiiy a of na lg Nl H jHin Er H nEeHi E H HTA ZoMlEFE m 2, i 31% | icicrei ys) w23 HE EE EE E1HETYL YoAeTnE ii ifB r TH aasr, 3[28 Yo, 3 2 i 2 H MEE E CA 0 LaTHE {AS EH m Y p EE arK9 R|2 | 2Ez RM HEEEeErEEE S H HH E E i TtrHo)ao%r% ||5 lg g:= EE e hh m IE mL EE FT t le -- He " |8[58 os IiEEEEEEEr l m jiiaM HEH fnni eiHmEHEEyi Em)eEsHHH 2,n 2z g8 be sIeAsl ia = Fr Hi fp a%%, 3 lf FIRE HERE eire a I 0 HHI WERE HittEEE iH or 3 ) - i) 80 ee 000110 WaDsuhPionngttdoonNWeomrokusrs and Company = Wood County C8waterdata ~ AUzneirsoaerqeupaglls a Non Detect concentration A yellow-colored concentration is a concenlration above the WV-DEP limit --~ GDartoeundwaAtEeTr1-MWO! AMOT-PWO! AOO8-PWO1 AXI3-PWO1 DOBMWOT E1SMWO! KIGPWOT LOPWO! NOS-MADT Apr-98 Jun97 004780 005525 = Nnoveaes 041 04 19 1 2 048 79 Feb99 -- Meyso 060 0082 os 0307 0085892 162 58 ANuogv0o0 0071 oer 024 04 7s 13s = Jparno0t1 399 JaJnuk0021 12 0131 038s os2 2m 105 0320092 689 _ FMare.0?2 128425 00117219 0o4s3e9s 11.208 01a27 21632 722 2a50 Apr02 -- Msaye.0p2 122 115225 00210879 0040s79 0191a1 o085a1 224447 3224 116811 0335 042 osu 017 23 871 308 Moacrt0a32 117387 02690 0o4w1s5 0712017 0a1ns 33135 s1e2s 1t4e0e3 DalAepr98 NISMWOT POLMW2 POSMU-OT QU4MAOZ ROSMAOZ VOSPWOT YI4MWO!WestWellFold - Jnuengm? FNeobv-9998 208 0 138360000 6000 81492000 0162s4 4925 = Mhayw-9o9 JaNonv0-0t0 12600 13800 17 = porort 5484 213518 FoJabn00z2 578 2623860000 42047 11480800 44705000 25210 2079 21838 -- mao 32300 Apr-02 36500 2120100 654340000 a0r9e 113595 676792 SMeapy0-022 3442440000 12420 6686150000 334588 118843 76a019 - Maor0u3 4366980000 120 ms0s 3s20a0 541225 118527 17023 = Dalheess AJOG-MU-02 NOAMAOS Y14-MA-02 Limit 150 JJuunngee7 150 150 -- FeNobv9e9s 115500 MAauyg-0909 150 150 = Novo 150 - 000111 Jan-01 Apr-01 - Julo1 Jan-02 Feb02 - Mar2 Apr-02 MaSyep--0022 - octo2 0.133 212 Mar-03 0.089 244 150 150 150 150 150 150 115500 150 0 150 150 _ Surface water Dato Outlet 001 Outfall002 Outlet 003 Outfall 005 Outlet 007 Outlet 105 Limit Fev-01 174 158 150 -- MaArp-0t1 851.54 413919 115500 May-01 0436 143 150 Junot 0.59 74 150 Ju01 0.558 120 150 = Aur 216 150 Sep01 0118 286 150 Oct.01 28 65.7 150 -- Novot 484 915 150 Dec01 ar 198 743 32 199 078 150 FJeabn0022 914039 442636 319383 114317 00837319 71.4563 115500 - Ma2 214 585 291 926 0483 132 150 Apr-02 197 245 276 38 0567 159 150 MJauyn--0022 2172.49 341836 00510735 197896 0024894 638267 115500 = Juk02 863 228 0291 102 0597 47 150 Aug-02 294 256 0268 124 0207 673 150 - Seop-a02 120155 324184 0038177 5120.21 0251 534699 115500 Nov-02 7 528 124 18.1 856 105 150 Dec02 975 237 068 662 0263 607 150 ~ JaFne-b0033 315889 454165 017056 4363.44 517.71 11879 115500 Mar-03 514 an 043 431 0.897 925 150 Date Oullet001 ~Outfal002 Outlet 003 Outfell 005 Outlet007 Outlet 105 Limit --- 000112 Final C-8 GIST Report APPENDIX C: Consent Order No. GW-2001-019 - TT DivisionofWaterand Waste Management 000113 CONSENT ORDER ISSUED PURSUANT TO - ARTICLES 5 and 12, CHAPTER 22 AND ARTICLE 1, CHAPTER 16 OF THE WEST VIRGINIA CODE. - TO: E.1 DUPONT DE NEMOURS AND COMPANY DATE: November 14, 2001 ~ `West Virginia Department of Environmental Protection Order No. GWR-2001-019 West Virginia Department of Health and Human Resources `This CONSENT ORDER is issued by the Director of the Division of Water Resources. and Director ofthe DivisionofAir Quality, West Virginia Departmentof Environmental = HPreoatletchtiaonnd, Hanudmathne RCeosmomuricsessi,opnuerrsoufantthetoBtuhreeaauutfhoorriPtuybsleitcfHoeratlhtihn,mWoersetdVeitragilinbiealoDwe.partment of 1. INTRODUCTION OF PARTIES. - This Consent Order is entered Environmental Protection [WVDEP], into the by and between the West Virginia Department of West Virginia Department of Health and Human ~ Resources - Bureau for Public Health [WVDHHR-BPH], and E. 1. du Pont de Nemours and Company [DuPont][collectively referredto as the "Parties". IL. PURPOSE OF CONSENT ORDER. - `This Consent Order sets forth a seriesoftasks to be performed by the Parties in order to determine whether there has been any impact on human health and the environment as a result of releases ofammonium perfluorooctanoate [C8], CAS Number 3825-26-1, (0 the environment = from DuPont operations. C8 is a material used by DuPont in ts fluoroproducts manufacturing process at its Washington Works facility located at Washington, Wood County, West Virginia. C8 is not identified as a hazardous substance, hazardous waste or otherwisespecifically regulated - under West Virginia o federal statute or regulation. "This Consent Order has been negotiated in good faith and the actions undertaken by DuPont pursuant to this Consent Order do not constitute an admission of any liability on its part. = DuPont retains the right to controvert in any implement or enforce this Consent Order, the other proceedings, other than proceedings to validityofthe findings of fact and conclusions of } law set forth herein. DuPont agrees to complywith and be bound by the termsof this Consent Order and further agrees in any proceeding to implement or enforce this Consent Order that it 1 - 000114 _ will not contest the validityofthis Consent Order or the jurisdiction of WVDEP and WVDHHR- BPH(0 issue it. IIL DEFINITIONS. - Whenever the terms identified below are used in the Consent Order or in any exhibit or attachment hereto, the following definitions shall apply: - 1. "The Agencies" shall mean the Departmentof Health and Human Resources, `Bureau for Public Health and the DepartmentofEnvironmental Protection, including the Divisions of Air Quality and Water Resources. 2. "C8" shall mean the chemical compound ammonium perfluorooctanoate. - `within 3. "Detection specified limits of pLriemciits"iomneaanndsatchceulroawcyesutnadnearlyrtoiuctailnelelvaeblotrhaattorcyancobnedirteiloinasblfyoarcahieved _ specified matrix. I is based on quantitation, precision and accuracy under normal operation ofa laboratory and the practical need in a compliance-monitoring program to have a sufficient number of laboratories available to conduct the analyses. 4. Order. "Effective Date" shall mean the date set forth in Section XVII of this Consent 5. "EPA" shall mean the United States Environmental Protection Agency. - 6. "Force Majeure" shall mean conditions or circumstances beyond the reasonable cwointthrooultolfimDiutPatoinotn,wahcitscohfcGoouldd,naocttihoanvoerbieneanctoivoneorfcgoomveebrynmdeunetdailliaggeenncceieasn,dosrhaaldlmiinnicslturdaet,ive or = judicial tribunaolrs other third parties, or strikes or labor disputes (provided, however, DuPont shall not be required to concede lo any labor demands), which prevent or delay DuPont from complying with the work plan. _ the grou7.nd mad"eGbroyudnidgwgiantge,rbMoorninigt,ordirinlgliWneg,lldr"isvhianlgl, mjeetatinnga,noyrcoatsheedr emxectahvoadtsiofnororthoeppeunripnogsientoof dteetremr"mmionniintgotrhiengphwyesilcla"l,incchleumdiecsapli,ebzioomleotgeircasl,anodr orabdsieorlvoagtiicoanlwperlolpse,rtwiheisochfgarreouinndstwaaltleedr.forThe . purposes other than those listed above, but does not include wells whose primary purpose is to provide a supplyof potable water. 8. "Groundwater Well" or "Well" shall mean any drilled or excavated groundwater cionlclleucdteiodnrisnyksitnegmwtahtaetrswueplpllsi.esAwsatuesredfoirnptuhbilsicC,onpsrievnatteO,ridnedru,sttrhiiasl,teorrmagarpipcluiletsuroanllyusteo awnedllsshall 2 = 000115 _ located in West Virginia. - work 9. of Dee "Reimbursable Ann Staats, Ph.D. Costs" in the shall mean negotiation costs atributable (on and implementation an hourly basis) to the of this Consent Order, the cionsAttstaatcthrimbeunttabClettootahnisyCootnhesrenptarOtridciepra,ntwshoonatrheesCe8rviAnsgseinsstmhaetntpoofsiTtoixoincaistcyoTnteraamct,orass tdoescribed WVDEP, costs Atiachment C, incurred and costs by WVDEP atributable in to acnoynnceocnttiroanctwoirthretthaeinpeudbalticthmeedeitriencgtsiodneosfctrihbeed in `Groundwater Investigation Steering Team (GIST) located 1i0n.Wash"iWnagisohni,ngWtoonodWoCrokusnt"y,shaWlelsmteVainrgtihneiam,anasufdaecptiucrtiedngonfacEixlhiitbyiotwn1 etodtbhiysDCuoPnosnetntand - Order. ~ depicted11.on Exh"iTbhite F1,actihleitLieetsa"rtshLaallndmfeilalndtehpeicWtaesdhionngEtxohnibWitor2k, sanadnd tthheeDrLyocRaulnLaLnadnfdiflli,ll depicted on Exhibit 3 `per 12. haps an ord "Reference Dos er of magnitude e"or "RID" or greater) shall mean an estimate of a daily exposure level (with for th u e ncertain human ty spanning population, - iefnfcelcutdsindgursienngsiatilviefestiumbep.opuClhartoinoincs,RithDast iasreliskpeelcyiftiocbaellwyidtehvoeultoapnedap(p0rbeeciparbolteecrtiiskvoeffdoerlleotnegr-itoeursm exposure to a compound. water, o1r3.soil, t"hSatcrieselniiknelgyLteovbeel"wsihtahlolutmeaannaptphreeccoinacbelnetrriastkioonf dinelaetsepreicoiufsicefmfeedcitsadsuurcihngasaair, - lifetime in the human population - IV. WAIVER OF RIGHTS. N requireDmeunPtosnotfwtahiisveCsonasneyntanOdrdalelr,riaghntdssihtamllaynohtacvhealtloeanpgpeetahleojrurcihsadlilcetniogneotfhethvealAigdietnyciores to issue this Consent Order. "This Consent Order applies to and is binding upon the Parties, and their successors and assigns. V. FINDINGS OF FACT. I. C8isa chemical substance which has no established state or federal effluent or emission standards. 2 C8isaperfluorinated surfactant manufactured by the 3M Company and others. 3 - 000116 _ Spirnocceestsheeseaatrlitys W19a5s0h'isnCgt8ohnaWsobrekens ufasceidlitbyy, DloucPaotnedt iinnWitosofdluoCrooupnotlyy,meWre-srtelaVtiregdimnaianufacturing - `Washin3g.ton WoRrekssidaureesocrohnatvaeinbienegnCr8elferaosmefdltuootrhoepiorl,ymdeirscmhaanrugfeadcttourtihnegOhpriooceRsivseers,atdisposed of ~ actaptthuerFeascifloirtireesc,ycalnedasoitghneirfwiicsaensthpioprpteidonofoffsiutseedfoCrSd.estruction and/or disposal. DuPont also - contain4s.pecificNolipmeirtmatiitosnsiossnutehdetoamDouuPnotnotfaCu8thotrhaitzimnagyrebleearseelsoeafsepdoltlouttahnetesntvoirtohnemeenntv.ironment Hasowpearvteircu,laCt8e mraetlteearse,sPaMryeoad(dparretsisceudlamtoermeatgteenrerwailtlhyainn aWeVroDdEynPamDiicvidsiiaomnetoefrAlierssQutahlaintyorpeerqmuiatlsto - 10 microns), or as a volatile organic compound. - to detect5. the preSsienncceeasancdarlleyveals o1f99C08, iDnuaPnodntarhoausndpecrefrotraimneodfrietgsulFaarc,ilviotlieusntianrWyewsatteVrirsgaimnpilaianngd _ asasmprleepsoratnedd rtheeporretssulCt8s ocfontcheisntsraamtpiloinnsgintowavtaeriroaussrgeoqvuierremdebnytpaegremnictisesi.ssuCeudrrbeyntWlyV,DDuEPPonatndalso EPA - in and a6r.ound cAesrtaariensouflittsofFaDcuilPiotniets'sinsWaemspltinVgir,gCin8iah,aisnbceleudnidnegtpercitveadteindrvianrkyiinngg wcaotnceernwterlaltsioannsd public water supplies. 7. Service DistricAtn(al"yLsPeSsDo"f)wdartienrkisnagmwpalteesrhsauvpeplrye.ported levels of C8 in the Lubeck Public is the 8. likely DuPont, by and through ts use of source of CB presence in and around Cce8rtianinthoefiftlsuFoarcoiploitliyemserinmWaenusftaVcitrugriininag. process, 9. participated in mAullotnigplweistthuedinevsireoxnammeinntianlgstahmepploitnegntfioarl Ce8ff,eDctusoPofnCt8haesxppoesrufroeromnedhaunmdan health - and the environment. _ doses, 10. i.e. Studies considering performed by both amount aDnudPodunrtatainodno3fMexhpaovseurdee,teirsmtionxeicd that CS in to animals sufficient through ingestion, inhalation and dermal contact. Studies have also found that C8 is persistent in humans . and the environment. the envi1r1.onmentA,ltthheouAgghenDcuiPeosnbtelhiaesvecotlhlaetctaedddiatiloanragle ianmfoournmtatoifondawtiallonasstihsetptrheesmenicnedoefliCn8eatining tchoelleexctteendtbaynDducPoonncetntirnadticiaotnessotfhaCt8Ci8n itshepreensvenitroinnmtehnetsautrfoarcneeaanrdthgeroFaucnidliwtaietse.r aAtvathielaLbelteardtataand 4 - 000117 - Dry Run Landfills and at or near the Washington Works facility. . Source o1f2.drinkWinVgDwaEtPerafnodr pWeVrsDoHnsHpRo-teBntPiaHllhyaevxepdoesteedrtmoinCe8d itnhagtroituinsddweastierrabolre stuorafsacceertwaaitnertshe in the areaofthe Facilities. - another,13h.ave reEqPuAe,stWedV,DaEndP,DuaPnodntWVhaDsHsHubRm-itBtPedH,,ininfocromnastuilotnatainond danodcucmoeonpetrsarteiloantiwnigthtootnhee detection and presenceofC8 in and around the Facilities and documents with respect to the - `human health studies being performed related to C8 exposure. - WVDEP1,4.and WBVasDeHdHuRp-onBPinHf,ortmhaetiAognensucbimeistbteeldiebvyeDtuhaPtonadtdiatnidonraelvdiaetwaedwotuolddataessbisytEiPnAt,heir a eevxaplousautrieonpaotfhwwhaeythteorhtuhmeagnrsouanndd wahnedtshuerrfapceerwsaotnesrisnnaondw acroontuanidntihneg FCa8cilhiatvieesaacreomaptlreitskeof adverse health effects from C8 exposure. 15. There have been no independent governmental or non-industrial studies performed on the human health effectsofCS exposure for the purposeofestablishing an exposure standard for C8 applicableto the general public. to 16. ascertain The Agencies have the extent and level of concluded that full C8 concentrations site and health assessments are necessary in the environment and to assist them in - determining whether C8 presents any possible danger to the public. DuPont has agreed to participate and assist in this effort = 17. The fluoropolymers industry has commitied to EPA to reduce total actual C8 emissions for either the year 1999 or the year 2000 by 50 percent within three to fiveyearsof cach company's commitment date. DuPont committed to this goal in 2000. 18. DuPontinstalled, in March 2001, a filter and carbon treatment system at its ~ Washington Works facility tht is demonstrating removal efficiency of 90-95% of the C8 in its major C8-containing wastewater stream. B VI. AUTHORITY TO ISSUE CONSENT ORDER. - 1. The WVDEP is the stateagencyvested with the authorittyo protect the environment in West Virginia. Act, gra2n.ts to tAhnetWicVleD1E2,PCthhaeptaeurth2o2riotfytthoeprWoetsecttVtihregiSntiaateC'sodger,outnhdewGartoeurnfdrwoamtearnyPrcootnetcatmioinnant 5 - 000118 } and, where contaminated groundwater is found, to institute a civil action or issue an order requiring that groundwater be remediated. > grants 3. to the WVAnDiEcPlet,heCahuatphtoerrit2y2toofprtohteeWctesttheVSitragtien'isaaCirodfer,omthpeolAliurtaPnotlsluatnidontoCoinnsttriotluteAcat, civil action or issue orders to enforce the statute. 4. The WVDHHR-BPH is the state agency vested with the authority to regulate and protect drinking water supplies in West Virginia. the auth5o.rity toApnrioctlecet1t,hCehpaupbtleirc d16rionfkitnheg wWaetsetrVsiurpgpilnyiaofCotdhee,stgartaenatnsdtotothpeerWfVorDmHaHllR-BPH - tinhveeasuttihgoartiitoyntnoeciensstsiatruytetaocatsisounrseaintds piusrsiuteyoarndderssafteotry,esatnordeftuhrethpeurrigtryanotfsstaoidthweaWeVrDsuHpHplRy.-BPH VIL REQUIREMENTS OF CONSENT ORDER. - which tTohdeetAegremnicnieetshehasvceopceonacnldudpoetdentthiatalitriissokfogfrtehaetpirmepsoerntcaenocfeCtSo have sufficient data in the environment upon in and - around the Facilities. Therefore, the Agencies require the following: A. Establishment of Groundwater Investigation Steering Team. members1. of theAt"eGarmoucnondswiasttienrg IonfvWesVtiDgEatPi,onWSVteDerHiHngRT-eBaPmH",(GEIPSAT)ReshgailolnbeIILe,satnabdliDsuhPeodnwtith - TtheaemWaVreDsEetPforretphreisnefnutlaltiinveAtwitlalchbmeetnhte AteofamthliesadeCro.nsTehnet oObrjdeerc.tivHeoswaenvdersp,ectihfeicprtiamsaksryofputrhpeose = orfetqhueirGemIeSnTtswislelt bfeorttoh oivneSresceteioannseAxptehdritoiuoguhs,C.phTahseedwaoprpkropaecrhfotromfeudlfwililtihngovtehresmiagjhotriftryoomfthtehe GIST shall be funded by DuPont in accordance with Section VIIIofthis Consent Order. - GIST 2. shall Upon conclusion issue interim or final of key milestones in reports setting forth the tasks set forth in Attachment A, the findings of fact and conclusions regarding i. bA.ackAgnryougnrdoudnadtaw,atgerroumnodnwiattoerrinmgonpiltaonrdinegv,elaonpdedplpuumrseuaidnetnttiofiActattaiconhmaesndtesAcrsihbaelld siunrAvtitveacthhmeent - ttehremFiancailtiitoineso.fDthuiPsoCnotnsreensterOversdetrhearnidghsthatlolrbeequiensctormpoodriaftiecdataisonaomfintoher pplearnmsitupmoodnirfiecnaetwiaolnoffotrhe Facilities' permits. B. National Pollutant Discharge Elimination System Requirements 6 - 000119 I. sampling for Except C8 at the as occasioned by Local Landfill at no-flow certain conditions, DuPont outfalls identified in shall West perform monthly Virginia/National Pollutant Discharge Elimination System ("WV NPDES") Permit No. 0076538 as Outfalls 101, - 004 and 005. = 2. sampling for Except C8 at the as occasioned by no-flow conditions, Washington Works facility at certain DuPont outfalls shall perform monthly identified in WV NPDES Permit No. WV0001279 as Outfalls 001, 002, 003, 005, 007, and 105. - 3, sampling for C8ExacteDprtyasRuocncaLasnidofnieldl batyanllo-ofultfoawllcsoniddietnitoinfsi,edDiunPiotsntWVshalNlPpDeErfSorPmermmointthNol.y _ WV0076244. - 4. sampling for Exceptas C8 at Letart occasioned Landfill at by all no-flow outfalls conditions, identified in DuPont its WV shall perform monthly NPDES Permit No. WV0076066. - samplin5g. shall WbeitpherrfeospremcetdtpoutrhseuarnetqutioreesmteanbtlsiosfhepdaEraPgAragpuhisdeVlIiLneBs.,1wthherroeugahppVlIicLaBb.l4e,, aalnld - rsehsaullltrseschoarldl abnedderleipovretreadlltoatttheempWtVs DtoEsPamwpiltehiunndtehirrtnyod-afylsowofcornedcietiiovnisn.g such results. DuPont - obtain a6.sampleWiftrhoimnc9a0chdasyursofafcteheorEaflfleucvtiiavlewDaatteerofintthaikse CfoornpsuebnlticOrwdaetre,rDsuuPppolnitesagarleoensgttohe OahndioonReivreirveirnmtihleeaurpeasterxetaemnodfintghteeWnarsihveirngmitloensWdoorwknsstfraceialimtyo.f tIhfecWoancsehnitnrgattioonnWsoofrCk8s faacbiolvitey = tdhoewnDesttercetaimonseLigmmietntasreinfiotuianldlyisnaamnpylesda,mptlheedsepgumbleinctswawtietrhisnupwphliychwiitnhtianketshearuepsttorbeeamsaomrpled _ Isfhaclolnbceenetxratteinodnesdatbootvweenthtey DreivteerctmiiolnesLidmoiwtnsarterefaomunodritnwaonryivseergmmielnetssuopesxttreenadme,da,saadpdpirtoiporniaalte. sampling will be performed on water intakes within thirty river miles downstream or three river - miles upstream, as appropriate. - 7. incorporated The additional monitoring requirements into the Facilities' West Virginia/National contained Pollutant in this subsection shall Discharge Elimination be System `permits by minor modification. DuPont reserves the right to request a modificationofthese: requirements upon renewal of the permits C. Toxicological and Human Health Assessment Order by1.establDiusPhionngtanagersecersotwo afcucnodutnhteavtaariboaunsktaasgkrseesdettfoobrtyhtbheelPoawrtaisesa, poarrbtyofsothmies Coothnesrent 7 - 000120 ~ T`omxeiacnistaygTreeeadmtoLebaydtehreaPnadrtDieusP.onDitsrbeuprrseesmenetnattsivferjoominstaliydaessdcersocwrisbheadllbbeeloawuthorized by the C8 - 2. ACS AssessmentofToxicity Team ("CAT Team") shall be established with `members of the team consistingofrepresentatives of - WVDEP WVDHHR-BPH EPA Region Il - NICS ATSDR DuPont 3. The WVDEP representative shall be the Team Leader. - 4. The individual team members, the tasksof the team, and the team objectives are set forth in full in Attachment C of this Consent Order. - issue s. a final Upon conclusion report setting forth ofall the tasks findingsoffact asentdfcoortnhcliunsAitontsacahsmteontwhCa,ttehxetCenAtTthTereeammasyhablel - health risks associated with C8 at the Facilities - D. Emission Modeling Assessment. - 1. ("DAQ") The within 30 following information shall be submitted days of the Effective Date except where to the DivisionofAir a different deadline is Quality provided in this subsection: ~ structures locataed withiAncothmepWlaestheianngdtoanccWuroartkeslifsatcoiflibtuyitlhdaitnhgadviemaenssiginoinfipcaarntamiemtpearcstfoonr atlhle - dbiasspeedrsoinontohfe "Ca8reeaomifssbiuoinlsd.ingSiwganikfeiceafnftecitmsp"aacstdfeofrienaecdhisnttrhuectEurPeAonUstehre'ssiGteuishdaelltobethdeeBtueirlmdiinnegd Profile Input Program (EPA-454/R-93-038 Revised Feb. 8, 1995). - emission b. rates and confAircmoemdplaecttuealanCd8acecmuirsastieonlisrtaotefsDuinPopnotun'dsscuprerrenyteaprerfomrittiheedyaelalro2w0a0bl0efor - aalclcsoorudricnegstlooictastsetdacwkitLhDi.n tahnedWcaosrhrienspgotnodninWgorpekrsmiftacinluimtyb.erE.acFhoermciascshiosntapcokinitdesnhtailfliebdealbiostveed as. emitting C8 DuPont shall list all relevant stack parameters to be used in air dispersion modeling. c. For cach emission point (stack) emitting C8, the following information shall be supplied: 8 - 000121 i. Phaseof C8 (solid, vapor or aqueous solution) at stack conditions - ii. The panicle characterization to be used for modeling including the `particle size distribution (microns), the mass fractionof C8 in each particle size category, and the panicle density (gem'). iii. For particulate emissions, scavenging coefficients (hr/s-mm) for - bpaortthiclliequsiidzeadnidstfrriobzuetniopnreacnidpitthaetiEoPnAt'osbeInudussetdrifaolr SwoeutrdceepoCsoimtpiloenxm,odVeelrsiinognb3asMeoddueplonGutihdeance (EfEfPeAc-t4iv3e4/DBat-e9,5-i0nf0o3rbmaSetpito.n t1o99s5u)p(po*rItSCtheGuuisdeaoncfe"th)e. noDrumPaolnitzemdasycasvuebnmgiti,ngwictohefifnic3i0endtayisn tohfethe - o1rSCdiGsuaipdparonvcee w(iFtihgujruest1i1fiocfatIioSnCinGuwiridtainncge,)DfuoProCn8t''ss sscuabvmeinsgsiionng.coSefhfoiuclidentDsA. QDAdiQsapshparlolvea,pprove _ DuPont address shall have the right, within the deficiencies set forth in seven days, to request a meeting with DAQ DAQ's letter and to request reconsideration and USEPA of DAQ's to = dseccaivseinogn.ingFocolelfofiwciineangtsmeweitthiinngosfevtehnedpaayrtsieosf,tDheAmQeesthianlgl.isDsuAeQa dreecsiesrivoens ltehteterrigrhetgatrodrienqguiCr8e's `asmseearstuarecmleanitmooffcoCn8f'isdesnctaivaelnigtiynginctoheeffeivceiennttssuicnhitas mdeecaissuiroenmaenndtDisuPmaodnet.reserves the right to iv. For gaseous emissions, scavenging coefficients (hr/s-mm) for both liquid and frozen precipitation to be used for wet deposition modeling will be provided as a - Cfu8ncatnidoncoofndsirsotpelnettwsiitzhe Suescitnigonfo1r.m4uloafethien IthSeCoGpueindalnictee.ratuDruePboanstedmoanytshuebpmhiyts,iwcailthpirnop3e0rtdiaeyssooff the Effective Date, information to support the proposed scavenging coefficient for gaseous - efmoirms.sioDnAs QincslhauldlinagppirnofvoremoartidoinsaopnprthoevepewrictehnjtuasgteifoifcaCt8ioneminiswsriiotninsgt,haDtuPwoonutl'dsbseubinmigsassieoonu.s `Should DAQ disapprove, DuPont shall have the right, within seven days, to request a meeting - wreictohnDsiAdeQraatinodnUoSfEDPAAQ'tso addecdirseisosn.theFodelfliocwiienngciaesmeseettifnorgtohftinheDApQar'tsiesl,etDieAr aQndshtaollreiqsusueesta dreecsiesrivoens tlheteterrigrhetgtaordrienqguiCr8e'msesacsauvreenmgeinntg ocofeCff'icsiesnctasvweintghiinngsceoveeflnidciaeynstsofinthietsmdeeectiisnigo.n aDnAdQ DuPont reserves the right to assert a claim of confidentiality in the event such a measurement is - made. 4. To the extent that the phases exist, a solid, liquid and vapor phase (T-P) - dshiaalglrbaem rfeoprreCs8enwtiatthivreeospfeecxthtaousptregsassurceonadnidtitoenmpsebreaftourree.anTdhaeftteermcpoenrtartoulreeqaunipdmepnrte.ssurEestriamnagteess of C8's critical properties shall be provided along with measured rangesof phase transition temperatures. 9 - 000122 - Inlieu ofa binary phase (T-x-y) diagram representing the vapor-liquid equilibrium between water and C8, the solubility and Krafft Point of C8 in aqueous solutions, - c`omnecaesnutrreadtpioKnsvaolrureelfaotreCd 8acdiidsssoocbisaetrivoendinwhaqeunetoeusstesdoliuntaiohnse,adansdpamceeaGsuCreamt evnatrsiooufs C8 ocopnecreanttirnagticoonndsi,ttieomnpse.raFtuurrtehse,ramnodrepaHsdirsecpursessieonntarteigvaerodifntghethreanvogleastiolbistyerovfeCd8 duirnianqguaecotuuasl - Solutions as submitted to a function the DAQ of pH within will be provided. The information 60 days of the Effective Date. in this paragraph shall be - f Henry's law coefficient for C8 and adiscussion of its dependence on pH. The coefficient shall be defined at various temperatures covering the range observed during actual operations. g Any carbon adsorption data in the formofisotherms for C8 adsorption. - DAQ will provide DuPont an opportunity to comment on modeling methodology and assumptions prior o finalizing the modeling results = 2. Any expenses incurred as a resultof accurately supplying the information requested above shall be covered by DuPont. - 3. reserves the rigUhtptoondsiusbampipsrsoivoenaonfy tdhaetainiffotrhmeaatniaolnytriecqaulimreedthboydtohliosgSyubosreqcutailointyVcIoLnDt,roDl AQ - procedures are deemed inappropriate. VIL REIMBURSEMENT OF COSTS. this Cons1. ent OrdDeurP.onEtxpaegnrdeeistutroeesstfarbolmisthhiasnaecsccorunotw sahcaclolubnet mtoadfuendupRoenijmobiunrtsaapbplreovCaolsbtsyaundduelry - ndoetsiicgenaotfesdurcehprdeesseingtnaattiivoeon fshtahlel bWeVsDenEtPtoatnhde poefrDsuoPnsonitde(nt"idfeiseidgnpautresduarnetprteoseSnetcattiiovnesX)V.IoWfritthtiesn - aCnonessetnitmaOtredeorf.RePirmibourrtsoatbhleeeCxoesctustitohnatoWf tVhiDsECPansexepnetctOsrdteor,inWcuVrDuEndPerhtahsisprCoovnisdeendt DuPont Order. with 2. Within 10 business daysofthe Effective Date, DuPont shall deposit in the escrow - aecsccoruonwtafcucnodusntinmtuhsetabmeousunptpoofrtfeidftybythaonusiatnedmidzoeldlaarcsco($u5n0t,i0n0g0,).incElaucdihnegxipnevnodiicteusraenfdroremcetihpets. - tSeanidtheosucsraonwdadcocloluarnst(s$h1a0ll,0b0e0)r,epolreansisahgerdeewditthoabdyditthieondaelsifgunnadtsedwhreepnreevseenrtatthievebsa.lanAcneyis less than unexpended amount remaining in the escrow account at the conclusionofthe work to be | performed under this Consent Order shall be retumed to DuPont. 3. DuPont's obligation to pay Reimbursable Costs under this Consent Order shall 10 - 000123 - nwohticehxcaereedatdwdroehssuenddrseedpaarnatdelfiyftiyntthhoisussaecntdiodno,llaalrlso(t$h2er50c,o0s0t0s).incEuxrcreepdtbaysDtuoPRoenitmbiunrcsaarbrlyeinCgoosutts its obligations under Consent Order shal be the sole responsibility and obligation of DuPont. IX. QUALITY ASSURANCE/QUALITY CONTROL. guidancAelresgaamrpdlinigngquaanlditaynaaslsyusreasnpceer/fqouramiteyd cpounrtsruoaln,tdatotathviasliCdoantisoenn,taOnrddcehrasihnalolfccounsftoordym to EPA - procedures. The laboratory performing the analyses shall be approved by the Parties prior to sampling X. C8 REDUCTION PROGRAM. - overall1.C8 emiNsostiwointshtsotatnhedianigr tcourneonmtopreermtihtatneadcetmuailssciaolnenldeavrelyse,aDru2P0o0n0tlaegvreelessotnoalicmailtendar N yTehaer rbeapsoirstianngd rsehqalulirfeumrtehnetr cpornotvaiidneedtohethreeiWn VshDalEl PbemmoondtihfliyedemtiossquiaorntserrleyporretpsorrtesgaurpdoinngthC8e. issuance ofa Screening Level derived following the procedures set out in Atiachment C. - collect2i.vely byDu5P0o%ntfraogmreaecstutaolr1e9du9c9eleevmeilsssiboynDsetcoetmhbeearir3a1n,d2d0i0s3c.harges to the water of C8 system3.at its WDaushPionngtlsohnalWloorpkersatfeacialnidtymwaiitnhtatihne tghoealfioltferacahnidevcianrgbo9n0-b9ed5%trCe8atrmeenmtoval - efficiency in its major C8-containing wastewater stream. - dates: 4. DuPont shall conduct the following construction projects and abide by the specified - T6IZC on a permit DuPont R13-815D. shall install an improved Construction shall begin scrubber filer o replace recovery device no later than February 28, 2002. Initial operation shall begin no later than the date of start up afte the April shutdown, or June 28, 2002, whichever is earlier _ emission b. DuPont shall modify point elevation is 170 feet above gtrhaedset.acTkfhoersetmaickssdiioamnetpoeirn,tvTel6oIciZtCy,E so that the and flow rate shall bRuelseisz,eSdetroiepsro2v0id(eGoefofdecEtnigviendeiesrpienrgsiPornacotfpiacretaiscuAlpaptleiceambilsesitoonSstaaccckoHrediignhgtst)o.45CoCnosdteroucftSitoantes.hall buepgaifntenrothlaeteArprtihlanshFuetbdrouwanr,yo2r8,J2u0n0e2.28,In2i0ti0a2l,owpheriacthieovnershiaslleabreligeir.n nAotltatiemretshwanhetnheddeavtiecoefTst6aIrZtC is not operating, permitted emissions from scrubber TGIFC shall be emitted to emission point n : 000124 - TOIZCE. - that 5. shall DuPont shall conduct a scrubber optimization consist ofa studyofscrubber operation for device and recovery CZDWC2 on improvement program permit R13-G14A. The study shall be complete by the end of March 2002. Provided the results are encouraging, the - ucnoimtspaCn2yDsThCal?l iomnppleermmeinttRi1d3en-t6i1fi4eAd,iCm2prEoHvCe2meonntspefromritthiRs1d3e-v1i9c5e3a,ndansdimCiIlaFrSiCm2proonvpermoepnotssedfor permit for R13-2365A. Implementationof the improvements for the latter devices will be complete no later than the end ofNovember 2002. XI. COMPLIANCE WITH SCREENING LEVELS. = 1. The following requirements shall apply only if the procedures set out in Attachment C have been followed: - or a. information No developed later than pursuant 60 to days after receiptofnotification from the Agencies that da this Consent Order or other information that is recent and ta - valid demonstrates that DuPont's operations have resulted in C exposures above the Screening rLeevveilesw daenrdivaepdprfoovlallowbiyntghteheAgpernoccieedusrtehsatseits douetsiignnAetdttaocrhemdeuncteCs,ucDhuPeoxnpotssuhraelsl tsoublmeivetlsa bpelalnowfotrhe - Screening Levels within 2 reasonable time (the "Remedial Plan" or "the Plan"). - WVDEP b. shall, upon Within 30 daysof consultation with receipt of the Remedial the WVDHHR-BPH and Plan submitted by DuPont, the based upon accuracy, quality, and Pcloamnp,lettheenWesVs,DEciPthesrhaalplpnrootviefyorDudPisoanptprionvweritthienPglathna.tItfhethReemWeVdiDaElPPldainsahpapsrboeveens tdhiesaRpepmreodvieadl - and shall specify the reasons for such disapproval. revised to address the deficiencies identified in the DuPont notice. shall resubmit the Remedial Plan DuPont' failure to submit an as approvable Remedial Plan shall be deemed a violationofthis Consent Order. 2. Inthe event EPA or the WVDEP develops and finalizes a reference dose/screening level for C8 in accordance with applicable statutory and regulatory requirements ("the Regulatory - CEoPnAseSnttanOdradredr",)DtuhPaotnwto'uslodblbiegaatpipolniscaubnldeertotDhiuspoSnectt'isonacsthiavliltibese odrettheermFiancielditwiietshirnedfeepreenndceenttootfhtehis _ aRpepgeuallattohreyREegPuAlaSttoarnydaErdP.A SDtuaPnodnatrdreisneprrveosceaelldirnigghstsseiptamraatye haanvdeatpoarctofmrmoemntthiuspCoonn,soebnjtecOtrdtoe,r.or - XII. COMPLETION OF CONSENT ORDER. - DuPont'1s. obligEatxicoenpsthaesrteounDdueProsnhta'lls toebrlmiignaattieonuspuonndeirssSueacntcieonoXfaI,ctohmipslCeotnisoennltetOtrerd(es)r farnodm the Secretaryof the WVDEP or his designee and from the Commissioner of the WVDHHR-BPH to 12 - 000125 - DuPont. In a timely manner following receipt ofa written request from DuPont the respective `Agencies shall issue the completion letter(s) to DuPont or shall issue a leter to DuPont detailing the obligations and work that have not been completed in accordance with this Consent Order. The - Parties agree that the Agencies' obligation to issue this letter shall be deemed a non-discretionary duty. 2. DuPont's obligation to achieve and maintain compliance with the Screening Levels as provided in Section XI of this Consent Order shall survive the terminationof this Consent Order. Such obligation shall terminate only as provided in Section XI or upon agreement of the - Parties. - XIIL ADDITIONAL ACTIONS. _ `The Agencies, individually or collectively, pursuant to their statutory duty and authority, `may determine that additional action, beyond the tasks set forth in this Consent Order, is necessary 10 protect human health and/or the environment. Nothing in this Consent Order shall be construed - as restraining or preventing the Agencies from taking such actions. Nothing in this Consent Order constitutes a satisfaction of or release from any claim or causeofaction against DuPont for any liability it may have pursuant to the federal Clean Water Act, the federal Clean Air Act, the federal - Safe Drinking Water Act, the West Virginia Groundwater Protection Act, the West Virginia Air Pollution Control Act, other statutes applicable to this matter, or West Virginia common law. Nothing in this Consent Order in any way constitutes a modification or waiver of statutory requirementsofDuPont and nothing in this Consent Order shall obligate DuPont to undertake any actions not specified herein. XIV. ENFORCEMENT. = Enforcement of this Consent Order may be had by the filing ofa civil action by anyofthe Agencies in the Circuit Court of Wood County, West Virginia. Violation of the terms and . conditions of this Consent Order by DuPont is a violation of the West Virginia Code and may result in enforcement action being taken, including a request for civil penalties as set forth by law. DuPont shall not be lizble for violations of this Consent Order due to any "Force Majeure" _ condition. ~ XV. CONTENTS OF CONSENT ORDER/MODIFICATION. The entiretyofthis Consent Order consists of the terms and conditions set forth herein and - in any attachments or exhibits referenced herein. Modificationofthe terms and conditions of this Consent Order including any modificationof timeframes or deadlines established in this Consent Order shall be made only by agreementofthe Parties in writing, except that modifications to any 13 - 000126 _ requirement membersof set the out in GIST the attachments to or the CAT Team, this Consent Order as appropriate may be made upon consensusof the XVI. ADDRESSES FOR ALL CORRESPONDENCE . All documents, correspondence, to be including submitted report, approvals, under this Consent notifications, disapprovals, and Order shall be sent by certified other mal, retum - roercteoipsturcehquaedsdtreeds,sehsanDduPdoelnitveorry,WoVvDemEiPghmtamyaidlesoirgbnyatceouinriwerritsienrgv.ice to the following addresses Documents to be submitted to WVDEP should be sent to: WV Department of Environmental Protection 1356 Hansford Street - Charleston, West Virginia 25301 . Attention: Armando Benincasa, Esq. `Attention: Dee Ann Staats, Ph.D. Phone No: (304) 558-2508 Documents to be submitted to WVDHHR-BPH should be sent to - WV DepartmentofHealth and Human Resources Bureau for Public Health 815 Quarrer Street, Suite 418 - Charleston, West Virginia 25301 Attention: William Toomey, Manager of Source Water Assessment Program - Phone No. (304) 558-2981 Documents to be submitted to DuPont should be sent to: E.1. du Pont de Nemours and Company N Washington Works P.0. Box 1217 Parkersburg, West Virginia 26102 ; PAthtoennteioNno:. Pa(u3l04B)os8s6e3r-t4305 and 14 - 000127 - E. 1. du Pont de Nemours and Company Legal Department, Suite D-71 1007 Market Street - Wilmington, Delaware 19898 Attention: Berard J. Reilly, Esq. - Phone No.: (302) 774-5445 - XVII. AUTHORIZED SIGNATORIES/NON-ADMISSION. The undersigned representatives state that they have had full and fair opportunity to - arenvditehwertehifsorCeoennsteenrtthOirsdCeornasnednthaOvredehradfroeeplpyoarntduwniittthoyfaullllkownofwolretdhegier ocfouintssetlertmosdaontdhecosnadimtei,ons. _ Order a"nTdhehauvndeetrhseigauntehdordiotyhetroebbiyndcotnhfeiirrmretshpaetcttihveey have party. the authority to enter into this Consent ~ admissiNoenibthyeDrutPheontteormfsanofythfiasctCoornosfeanntyOrldeegra,l nlioarbielixtyc.utDiuoPnotnhtereexofprsehaslsllycroenssetrivteutsealalnrights and defenses that may be available in any proceeding involving third partes or involving ~ WVDEP"ThainsdCoWnVsDenHtHORr-deBrPmHayinbeansyigontehderinmactotuenrt.erparts and shall be effective upon signature ofall the Parties below ("Effective Date"), Entered this 4 day or Mttaaserco, by: - WEST VIRGINIA DEPARTMENT OF ENVIRONMENTAL PROTECTION - TLLIAM . West Virgfhia ADeDpAaMrtSm,ent of EnvirSoEnmental Protection ~ 1356 Hansford Street Charleston, West Virginia 25301 : Entered this_/>5Ydoayyooft Mhvfe0n0le#%2001, by: 1s - 000128 _ WEST VIRGINIA DIVISION OF HEALTH AND HUMAN RESOURCES ~ BUREAU FOR PUBLIC HEALTH - BY: - PA --ay Bureau for Public Health - `West Virginia Departmentof Health and Human Resources Diamond Building, Room 702 350 Capitol Street - Charleston, West Virginia 25301 `Entered this J2 S" ,of n -- 22001, by: - E. 1. DU PONT DE NEMOURS AND COMPANY }A 16 - 000129 Attachment A C8 GROUNDWATER INVESTIGATION STEERING TEAM ~ drinkingAwtateearm, ogfroscuinedntwiasttesrshaanldl bseurafascseemwbalteedr atot aanssdesasrotuhnedprteheseDnucPeoanntd extentof C8 Washington in - WInovrekstsigfaatciilointyS,taenerditnhgeTLeoacaml,(GLIetSaTr)t,shaanldl DirncylRuduenscLiaenndftiilsltss.frTohmeWGVrDouEnPd,waWteVrDHHR- BasPHpr,ovEiPdAedRiengSieocntiIToIn, aVnIdIDoufPtohnet.attDaucPheodntCosnhsalelntfuOnrddetrhe(G"tIhSeTCovinaseannteOsrcdreor"w).account ~ aDinsdbtuhresDemuePnotnstfrreopmretsheinstaatcicvoeu,nAtnsdharlelwbeS. aHuatrhtotreinz.ed jointly by the WVDEP GIST leader, - A schedule summarizing key GIST tasks, submittals, start and end dates is provided at the end of this document. - GIST Member Organizations/Representatives/General Functions WVDEP disbursDeamvenitd oWvaetrksiignhst;GrprooujnecdtwmaatneargPermoetnecttiaonnd- cGoIoSrdTintaetaimonleader; escrow funds `DGeeeorAgnenDaSsthaeatrs-,adPvhi.sDor-aadnvdistoerchnical review - EPA Region Ill `JGaacrkthC.CoHnwnoarn-gsc--ieHnycderoagdevoilsoogrist RogerRheinhart-Environmental Engincer Dupont - AprnodjercetwmHaanratgteenm-ePnritncainpdalcoPorrodjiencattLieoanodferf/iHeylddroigneveosltoiggiasttitonecahcntiivciatliers;eveisecwr,ow funds disbursement oversight. WVDHHR-BPH - William Toomey-Manager, Source Water Assessment Program- Bureau for Public Health advisor A, 000130 GIST Team Objectives and Efforts and "The primary objectiveof the GIST is to efficiently review and direct surface water monitoring and investigation activities as prescribed in groundwater the Consent - Otredaemr daencdisiinotnhismaAktitancghmteonwta.rdThmeeeGtIiSnTg witlhle utrielqiuzieraempehnatssedinapparnoaecfhfiacinedntemapnldoytirmaepildy - mpaenrnfeorr.med UbnyleDsusPoonttheorrwiitsseredpirreesecntteadtibveys.the GIST, the tasks outlined below shall be = groundwTahteerGIqSuaTliwtiyllinissauned aafrionuanldretpohret(sF)aciwliittihes,finadnidngsthaendexctoennctluosfiongsroruengdawradtiengr contamination in recommendations and around the Facilities. regarding the need for any The GIST further work foirnaalctrieopnosrtthsahtanlleefdurttohbere make taken - to assure protection of groundwater quality and human health into the future. = The tasks set forth performed by DuPont and below and in the the GIST pursuant Consent Order to the Consent are the Order. minimum tasks to be Additional tasks may be necessary identification, to assure the and receptor goals [full groundwater assessment identification] of the GIST and the and C8 Consent impact, plume Order are met. "Those tasks shall be agreed upon by the GIST. . Key Tasks of GIST Task A: Groundwater Use and Well Survey/Groundwater Monitoring Objae1c-tmiivlees(:andCopnodsuscibtlay d2isatnadn3c-em-iplhea)serdadgiraloudnidswtaantceerowreldliraecntdiownaatlelry ufsoecussuerdvediyswtiatnhcien - Suomf mthaerWya:shTihngetpohnasWeodrakpsparonadcLhoctaolt,heLewtaartte,r and and Dry Run Landfills.' groundwater well use survey will - aclelaoswe tachteivGiItiSeTs itnodfiorceucstieofnfsorwthsearleonigmpeasctatbsliarsehendotC8priemsepnatctortrwahnesrpoertthpeartehawraeys and `minimal concentrations. allow the GIST to meet, Data results tables will be generated in a evaluate the data, and determine the next timely manner to courseof action. - The GIST will determine when the final groundwater well use survey shall be released. DuPont agrees to perform, under the supervision of the GIST and through - aalnl aggrroeuendd-wtaottehrirwdeplalrstyw,itahginroaun1d-wmailteerraudsieusaonfd twheellthsruerevelayndifdielnltsisfeytinfgoratnhdasbaomvpelianngd. the Washington Works should field conditions facility. require, The phased approach may e.&., lackof sampling wells be in amended by the GIST the 1-mile radius, lack ofquality sampling points `Sampling shall within the 1-mile radius. be performed with the specific purpose of finding and `gmreoausnudrwiantgetrheweCl8lscoenxcceenetdra1tiuog/nliwniwtahtienr.theSh1o-umlidlecroandcieunst,ratthieoGnsISoTf Cwi8llfoduentderimnine . The water ue survey should be in substantially the same format as Atachment B. a 000131 wdihreetchteiorntoonelyx.paDnrditnhkeinwgelwlatseurrvweeyll0s ath2at-mmielaesruardeiuasb,oave3-m| iulge/lrasdhiaulsl, or be in a specific re-sampled at a frequency to Note: The be determined level of1 ug/l by the GIST. is utilized in this Consent Order for monitoring - purposes only and not as a adjustedasdetermined the benchmark for determining GIST in furtheranceofthe risk tasks and and this level may objectives set be forth in - + this Attachment, Timing: The initial well survey within a 1-mile radiusofthe Facilities will be csuornvdeuyctaecdtivwiittiheisnwi6l0ldbaeyscoofntduhceteCdonosnenatscOhreddeurl'es tEoffbeectdievteeDramtien.edAbdyditthieonGaIlSTw.ell Task B: Assessment ofExistingGroundwater and Surface Water Monitoring Data - Oabnjdecetxitveensto: fDCev8eilnopdrainndkiingmpwlaetmeer,ntgraomuonndwiattoerri,ngapnldansutrhfaatcedewtaetremrininesanthdeaprroeusnednctehe ~ cWoamsphiilnagttioonnoWfoarllksavfaaiclialbiltye agnrdouLnodcwaalt,eLre/tsaurrt,faacnedwDatreyrRmuonniLtaonrdifnilglasnadndhypdrroovgiedoeloagic - + characterization data for each facility, as Summary: The GIST will be tasked with reflected in Table A-1 an expedited evaluationofexisting historical dcaotnatiannudinhgydgrrooguenodlwoagtiecrimnofnoirtmoartiinogn ainndoradneyr taoddpirtiioorniatlizientvheestiingiattiailonscaoctpievoitfiewso(rek.g.f,or - `pmroonviitdoerianllghwiesltloriincsatladllaattaioannsd) rheyqduriorgeedoluongdiecr pinlfuomremaitdieontnifiticmataiyonh.aDveuProelnattesdhatlolthe - Facilities. Timing: Within 30 daysofthe completionofTask A, the GIST will review all the C8 `garnoaluyntdicwaaltaenrdmofnaciitloitryinhgydarnodgeaodldoigtiiocnailnfionrvmeasttiigoantitoond.etTerhmeinGeISthTe scope of will then work for establish a - sincfhoerdmualteifoonrftohroseeacahcftaivciitliiets.y wi11llisbaentsiucbimpiattteeddthtaotGaIsSuTmwmiatrhyino6f0aldlahyisstoofritchael Consent Order's effective date. Task C: Plume Identification/Groundwater Assessment - + O`bgjreocutnidvwea:teDreetxecremeidniengthe1 vuge/rltiocralaasnddirheocrtiezdonbtyaltheextGeInStTo,fwahniychanmdaaylldCe8teirmmpiancetaed - liomwpearcttehdregsrhooulnddtwhaatner1 uagt/Lle.taTrhtisLatnadsfkilslhaalnldalitssoiimnpcalcutdeonanthaessOehsisomeRnitvoefr Can8d public water supplies Summary: The along GIST the river. shall first review historical data and resultsof Task A to d`gertoeurnmdiwnaetearn palpuprmoepsricaotnetrsicboupteinogftwooorrk.witAhcttihveitpioetsensthioaulldtobfelporwitoroiwtairzedd otfof-asdidteress receptors, with emphasis on those areas where groundwater is used as a drinking water source. a3 000132 - predUicptoend gcormopulnedtwiaotneorffilnovwesatnidgactoinotnamacitniavinttietsr,aDnsupPoornttmosdhaelllsptroovaisdseestshefuGtIurSeTplwiutmhe migration. Timing: Upon reviewofall available information and on a schedule to be determined - by the GIST, the GIST will complete an inital evaluation of data to determine and prioritize plume identification. "The timing of the initial phase of plume identification/investigation activities and - oactthievritaicetsivnietieedsewdilalndbeagorneeadstcohebdyulteheeGstIaSblTisthoecdabrryytohuetGtIhSeTg.oaFlusrotfhterheinGveIsStiTgasthoalrly be performed by DuPont on a schedule established by the GIST. Modeling `Any and all modeling performed pursuant to this attachment and the Consent Order - Shall use Groundwater Modeling System, or some other model as approved by the GIST. Ad 000133 TABLE A-1 a Dependent upon the availabilty ofcerain |= |+ A location map. A site map showing the locaton ofall known groundvater | | ~ information, an historical data summary| monitoring wells, residential groundwater wells and public water supply within a 1-mile radius the Facilities. | - dthoactuimnecnlutdeeds:in areport | sTaompp-loifn-ggrliofuenodfwtahteersmitaepasn.d Tshheosuledsbheounlod span the less than entire yearly. tIfhDenuPtohenste hmaasposnlsyhoonuled ybeearf'osr weoarcthhquoafrtdeart;a iffoDruaPgoinvtenhsaiste, - Several years worth of data for each site, then these maps | can be annual. + C8 concentration contour maps. These should span the - entire sampling lifeofthe site and should be no less than yearly. 1f DuPont has only one year's worthofdata for a = | given site, then these maps should be for each quarter; if DuPont has several years worth of data for each site, then these maps can be annual. - AlThlestehedCat8agsrhoouunlddwbaetesrubdmaittattehdatinhaesasbye-etno-croelaldectatbeldest.o date. `cTohnecseenttraabtliesonsshbouelldowustehethleabmoertahtoordy,'s"<mxi",nitmo udemsidgetneactteiaolnl | - limit (not "ND" or some other abbreviation), and they should use "mg!" or "jg" as the unit designation. . If unable to provide the above datz, DuPont shall document | the reasons why it is unable to gather and submit the | information. b. A groundwater `monitoring plan for the + C8 sampling. The samples should be taken from all the wells a the three landfill sites and from a select number of Facilities which should wells at the Washington Works plant. These select wells - address, ata minimum: | are (0 be chosen by the GIST befor the groundwater `monitoring program begins based on evaluationofhistorical datainformation. The frequencyofsampling shall be - | Dmaotnethalnydfqourarttheerfliyrstthefroeuarftmeor.nthAsnyfonlelowwiwneglltshereEqfufiercetdivfeor `monitoring or plume identification purposes will be i - oinnteagsractheedduilnecaacghreseidtet'os bgyrotuhnedGwIaStTe.r monitoring program | AS 000134 - | RepWoVrDtEoPfGRresouulntds.watReerpoPrrtoignrgasmhoautltdhebefoqlulaorwtienrlgyaaddnrdestso.the. | - | 'WVDEP Division of Water Resources Groundwater Program | ! 1201 Greenbrier Street Charleston, West Virginia 25311 | --- Re: DuPont/C8 monitoring. Each report should include the following: (a) A site location map. = (b) A site map showing the groundwater monitoring | well locations. 1 (A C8 concentration map. (e) Groundwater elevation and well screen data. - | (f) A taboflalel the historical C8 sampling data. Note: | -- `where available information used to designate No Detect allows, abbrevi concentrations atio and ns should not be the units "ppb" and "ppm" should not be used. - (g) Laboratory analysis sheets. (h) Chainof custody records. | ao 000135 Attachment B Name - Address: GROUNDWATER WELL USE SURVEY Phone: - Best Time to Contact Owner: _ 1. DIofoy,osuthopavneoownaenodrrmeotrume wsautrevreyw.ellYse)son this properNtoy?_(It_n_eed not be i use currently.) - County Water Well Permit No. 2 Isthe wells) curently (circle one) used unused or filled in? - 3. Isthe well(s) used for drinking water? Yes ___ No ___ - 4 Isthis well(s) used for other purposes? Ifyes, please specify uses below: . -- -- ------F------ ------------ --__------ - 5. Whats the approximate frequoefnucsey? Circle One: - Daily Weekly Monthly Summer 6 Datelastused? 7. Isthereapumpinthewell? Yes No ___ - 8stem?Is thereYaecsonditioner, sNooftener, chlorinator, filter, or ther form of treatment for the - 1fs0, what is the formof treatment? Bl 000136 - 9. Is thereYaensy faucet wherNeowa_t_er_does not first pass through the ueatment system? - Ifyes, sit (circle one) inside or outside? 10. What year was the well constructed? 11. Please provide the following information regarding the wells) ifknown: (circle one) - A. Total Depth (feet below ground surface): ~ 30.60 60-90 90-120 1200rmore B. Casing Type: - PVC steel stone none other _ C. Well Construction: dug drilled openoruncased bedrock - D. Screened Interval (length in fect): - 0-10 1020 2030 30.60 60 or more E. Well Diameter (inches): 06 612 1224 24 or more - B2 000137 Attachment C C8 ASSESSMENT OF TOXICITY TEAM - : health aAndttehaemoenfvsicrioenntmiesntts sahsaslolcibaeteadssweimtbhleexdpotosuarsesetsosatmhemotonxiicuitmypaenrdflruioskrotoochtaunmoaatne - (TCe8a)m)reslheaalslesinfcrloumdeDuscPioenntti'sstsacftrivoimtieasc.adTemhiea,C8goAvsesremsesnmten,tnoofn-TporxoifciittoyrTgaenaizmat(iConAsT, and industry. The CAT Team also shall include the WVDEP Environmental Advocate, Pam Nixon, as arepresentative ofWest Virginia's citizens. contractTwhiethWVanDoEn-Pp,rouftiitliozrignagnifzuantdisonf,rotmheaNnateisocnraolwIancsctiotuuntte ffournCdhedembiycaDluPSotnutd,iesshall - (NICS), Taylor, for the services d Ph.D. The NICS escri shall bed herein. subcontrac t Point with MoafrcsohnatlalctUnfiovrerthseitNyI'sCSCesnhtaelrl be for Jan Rur a l _ aMn.dD.Enavnidrohnismesntatfaf.l HDera.lBtehcfkoerrsesrhavlilcefsamiinlriiasrkizceohmimmusneilcfawtiitohntphreotvoixdiecidtbyyofJaCm8e,sthBeecwkoerrk, pinerrfisokrmceodmmbuyniTcEaRtiAona.s dTehsecrNibIeCdShesrhealiln,saunbcdonatttreancdt pwuibtlhicthmeeneotni-npgrsoftiotpsrcoivenitdiefiecxpertise ocrognatnaicztaitsioJno,anToDxoilclaorlhoigdye,ExPche.lDl.enTcheefoTrERRisAk sAhsasllespsrmoevnitde(sTeErvRiAc)eswihnotsoexipcooilnotgoyfand - risk assessment. Work assignments, tasks, and deliverables are described below. ~ CAT Team Member Organizations' Representatives'/ General Functions WVDEP Dee AnndiSstbauartss,emPehn.tD.ov-erSsciigehntc;epArodjveicstomra-ntaegaemmelenatdear;ndesccoorrodwinfautnidosn; - toxicology/risk assessment and communication; Pam Nixon - Environmental Advocate - advisor; NICS Jan Taylor, Ph.D. ~contractor administrative oversight; James Becker, M.D. (Marshall University) - consultant in risk communication; - TERA (point of contact: Joan Dollarhide, Ph.D.)- consultant in toxicology/risk assessment; - qTuahlieficpatairotnes.s may. in their discretion, lect to subsite thei representatives with personsofsimilar ci 000138 DuPont - Gerald Kernenveideyw,erDitroexcitcoorloogfy;ApepslcireodwTfouxnidcsodliosgbyuarnsdemHeenatltohv,erHsaisgkhetl;l Laboratory - John Whysner, M.D. - toxicology/risk assessment and communications; Paul Bossert - Washington Works Plant Manager ~ communications; The following membersofthe CAT Team shall act as reviewers or advisors. = WV Department of Health and Human Resources~ Bureau for Public Health (WVDHHR-BPH) - BWairlblairaamTTaoyolomrey-- D-irMeacntaogr,erO,ffSiocuerocfeEWnavtierronAmsesnetsaslmeHnetalPtrhoSgerravmic-esad-viasdovri;sor; Local representative - advisor; Environmental Protection Agency (EPA) - Headquarters - Jennifer Seed ~ reviewer and advisor toxicology; _ Region Il Philadelphia `Samuel Rotenberg, Ph.D. -reviewer and advisor toxicology! risk assessment; ~ `RGoagrtehrCRoeninnhoarr-t -adrveivsioerwheyrdarnodgeaodlvoigsyo;r Safe Drinking Water Act; Cincinnati - John Cicmanec, DVM ~ reviewer and advisor toxicology; - Agency`AftolranTtoax-iJcoShunbWshteaenlceers,aPnhd.D.Di-seraesveieRweegrisatnrdya(dvAiTsSorDiRn)toxicology! risk assessment; - Philadelphia - Lora Wemer - coordinator for ATSDR; Non-CAT Team Efforts TeaOmthteoruteiflfizoer.tsTahree cCuArrTenTtleyaumndwielrlwcaoyorwdhiincahtemaanydpcroomdmuucneiicnaftoermcaltoisoenlyfowritthhethCeAseT - other efforts. These include: 1. Dupont'sair modelingof C8 emissions from the Washington Works plant; 2. WVDEP's air modelingof C8 emissions from the Washington Works plant; C2 000139 3. USEPA Draft Hazard Assessment which summarizes the available toxicity information - regarding C8, to the extent completed prior to the assessment contemplated herein; - 4w. itAh TCS8DiRn'dsriHnekailntghwCaotnesrulftraotmiotnhethLautbeesctkimPautbelsitcheSerrivsikcteo Dtihsetrcicotm,mtuontihteyexatsesnotciated completed prior to the assessment contemplated herein. - 5. Existing C8 concentrations in Lubeck Public Service District data. 6. Groundwater C8 Analysis (see GIST activities described in Attachment A) and Well = Use Survey (see example survey in Attachment B) at the residences in the area ofthe 3 landfills and the Washington Works Plant. Tasks of CAT Team = "The tasks to be performed by the CAT Team are described briefly in Table 1, and in more detail below. These tasks are discussed below within the context oaf Scope of `Work for both Dr. Becker and for TERA as well. _ those Tasksof the CAT Team shall be organized into three phases. tasks necessary to prepare for and hold the first public meeting. Phase I includes In Phase II, TERA shall conduct such scientific tasks as: reviewing available toxicity and epidemiological studies; developing Provisional Reference Doses and Screening Levels for protection of ~ `human health; evaluating existing information relative to ecological health; and conducting one general risk assessment involving comparisonsof exposure ~ cPloanncte,ntarnadtitohnesLtuobSeccrkeePnuibnlgicLeSveerlvsi,cefoDristthriectt.hreTeElaRnAdfislhlasllanpdretphaerWeaasrheipnogrttoonn Wthoerikr s findings. Phase [Il includes those tasks necessary to prepare for and hold the second public meeting. The results of the C8 groundwater analysis and risk assessment shall be ~ presented in the second public meeting. No communication between Dupont representatives and NICS, Dr. Becker, or - TERA shall provided to be Dr. permitted without the Becker and TERA by participation of WVDEP; thus, Dr. all Staats. All information information contributed will be to the effort by Dupont shall be sent in triplicate to Dr. Staats for forwarding to Dr. Becker and - TERA. Phase | TASK A-1: First Public Meeting Two public meetings are anticipated for this project. The First Public Meeting - shall occur in parties to the Phase public; I for the relating purposesof introducing the CAT Team and other historical information on previous concentrations involved of C8 in Lubeck Public activities; and Service inviting District water supply; informing the citizens the public to participate by cooperating with of the ensuing sampling and survey - efforts in the Groundwater C8 Analysis and Well Use Survey. In order to prepare for the - C3 000140 First Public Meeting, CAT Team members shall familiarize themselves with the available - toxicological information conceming CS. - t0: (1) cAonCduAcTtaTesiatemvmiseietttiontghsehatlhlrebeelhaendlfdililmsmaenddiattheelWyapsrhiionrgttootnheWfoirrsktspuPbllainct,maenedting surrounding residential areas; (2) discuss prepare an agenda for the public meeting; the (4) toxicityof C8 and other coordinate and prepare pertinent data; for the public (3) - meeting. Finally, the First Public Meeting will be held and public questions and comments will be recorded by WVDEP. = Task A: Public Meetings (two Objective: to inform the local meetings arc anticipated) citizensof the following: (in Meeting #1) intent to perform - aangdrotuonadswkatfoerrtwheelirl cuosoepesruartvieoynainndcaonnadluycstisinfgorthCe8;waitnetrenutsteosduervveelyo;panSdcr(eiennMienegtLienvgel#s2;) `remseuelttisongfmsauyrvbeey,recqhueimriecdalshaonualldyssiisx, maonndtrhisskpaassssesfsrmoemntt.heNfoirtsteptuhbaltiacnmienetteirnigm apnubdltihce - CAT Team Final Report has not been issued. Primary Task B: Responsibility: Staats DevelopmentofProvisional Reference Doses - Oibngjeescttiiovne:(atnodddeevremlaolp,iPfropvoisssiiobnlael) rRoeufteerseonfceesxpDoossurees.for C8 for the inhalation and _ Primary [Task C: Responsibility: Development TERA of Screening Levels Based on Protectionof Human Health ~ Objective: to utilize Screening Levels for the C8 Provisional Reference in air, water, and soil. Doses to develop human Note a determinationof health risk-based the potential cParricmianorgyenRiecsiptoynosfibCi8liwtiyl:lTbEe RcoAnducted as well. - Task D: Ecological Data Review Objective: to review available information to determine whether sufficient studies have been performed and data have been collected to developscreening criteria for ccological = receptors. | Primary Responsibility: TERA - Task E: Draft Report Objective: to present and and Final Report discuss the resultsofthe above tasks. Primary Responsibility: TERA - Phase II Tasks B, C. D, and E DevelopmentofProvisional Reference Doses and Screening Levels. and Risk Assessment - After haIvniPnhgarseeviIIe,wTeEdRthAe sthoaxlilcocloongdiuccatl tihnefotromxaitcioolnogriecgalaradnidngrCis8k apsrsoevsisdmeednbtyacWtiVvDitEiePs., = TreEgRarAdisnhgalilts cpornospulotsewditahpptroxoiaccohlofgoirsttshios nprtohjeectC.ATFoTlelaomwi,nagsscuocohrdcionnasutletdatbiyonD,r.TSEtRaaAts, C4 000141 - psohaslslibdleev)erloouptePsroofviesxipoonsaulreR.efeTrheennceTDEoRsAesshfaolrlCc8alfcourlattheeSocrarle,eniinhnaglaLteivoenl,safnodr dweatremra,ls(oiifl rainsdk aaisrsbeasssemdenotnitnhveolrvisikngfaccotmorpsartihseyonhaovfeeexsptoismuarteedc.oncTeEntRrAatsihoanlsl tpoeSrcfroermenoinneg gLeenveerlaslfor - the three landfills and the Washington Works Plant, and the Lubeck Public Service District water supply, that focuses on current risk to human health, including workers and - rleasniddeunstes,. suTrhfiasceriwsaktaesrseasnsdmgernotusnhdawllatienrcluudsee:; ((21)) iiddeennttiiffiiccaattiioonnooffrerceeapstoonrasb;ly(3a)nticipated icdoemnptiafriicsaotinonofoefxepxopsousruerecopnactehnwtaryasti;o(n4s)tiodaepntpirfoipcraitaitoenoSfcreexepnoisnugreLecveolnsc.entTraEtRioAnss;haalnld (5) - w`iglriozuenddwaattaeorbCt8aicnoendcefnrtormattihoenostihnerreesfifdoernttsidalisacnudsspeudblaibcovweellssu;chreassidaeinrtimaoldeglrionugn;dwater - wCeolnlsuulsteatsiuornv(eiyf;atvahielUabSlEe)P.A'TsEDRraAftalHsaozsahradllArsesveiseswmeanvtai;laabnlde AiTnfSoDrRma'tsioHneatoltdhetermine swchreetehneirngsucfrfiitceireinatfsotrupdrioetsehctaivoenobfeeecnopleorgfiocralmehdeaalntdh,dpaatratihcauvlearbleyeanqucaotlilcecltifeed. tTo EdeRvAelop = sshuamlml aprriezpeasratehedrdaafttaauntdializfeidnaflrdomocoutmheerntefftohratts.disAcsustshees ttahseksreosfultthseoCfAthTeiTr eefafmortasndanodther - involved parties' progress, datagapsand research evident, These shall be included in TERA's report recommendations may become as suggestions for further research to elucidate the toxicity of C3. - Phase Ill_Second Public Meeting The purpose of the Second Public Meeting is to present to the citizenry the results offrotmhereefsfiodretnstioafl twheellGsIaSnTdapnudblCicATwelTlesatmhse sicnrceleundiinngg lCe8veclosnacenndtrtahetigoennserianlgrriosukndwater _ aalsssoe.ssTmheentW. VADirEmPodweilllinagddrreessulstsaonfytfhuertehfefroartcstoiofnsWtVhaDtEmPayanbde Dupont will necessary. be discussed - cs 000142 SCOPE OF WORK FOR ~ JAMES BECKER, M.D. Dr. Becker is a medical doctor specializing in environmental health a the _ Marshall University Schoolof Medicine Center for Rural and Environmental Health. He will be assisting the WVDEP in his specialty areaofrisk communication at the two anticipated public meetings. The specific tasks assigned to Dr. Becker are described - below. Phase Task A-L: First Public Meeting - Dr Becker will assist in preparation for the first public meeting, and attend the `meeting providing expertise in risk communication . He will familiarize himself with the - available toxicological data, which will be provided to him by WVDEP, with particular emphasis on the epidemiological studies. Note that the toxicological data already has been summarized in the Draft Hazard Assessment prepared by USEPA. No literature ~ search or document retrieval will be required. Specific subtasks rquired in Phase I to prepare for the first public meeting are described below: - Subtask 1 - Familiarization with toxicological data provided by WVDEP including but not limited to ~ a. 8 compact discs of information provided to USEPA under TSCA by 3M Corp (note only a small portion ofthis information concems C8); b. Draft Hazard Assessment document from USEPA; = c. ACGIH Threshold Limit Value (TLV), d. Joumal articles and other information provided by WVDEP. = Subtask 2 - Attend a meeting prior to the first public meeting to a. conduct asite visit of the 3 landfills and the Washington Works Plan, and = local residential areas; b. discuss and prepare an agenda; c. discuss the toxicology and risks associated with C8 with the other CAT Team = `members. _ Subtask 3- Attend First Public Meeting Phase III Task A-2 Second Public Meeting - `meetingDprrBoveicdkienrgweixlplerastsiisset iinn rpirsekpcaroamtmiuonnicfoartithoen.secTohnedfpoulblloiwcinmgeestuibntga,skasndwialtltbeend the ~ required: Subtask 1 - Familiarization with the toxicological and risk assessment report - prepared by TERA; - C6 000143 - Subtaska2 --dAitstceunsds athmeeteotxiincgolporgioyratnodtrhieskssecaosnsodcpiuatbeldicwimtehetCi8ngwitot:h the other CAT Team members; - b. discuss and prepare an agenda. Subtask 3 -- Attend Second Public Meeting Nreostuelttshoaftdtahteasecoclolnedctpiuobnlmicamyeweatrirnagntisaadsdistuimoenadltpoubbelitchemefeitnailngpsubalnicd maeneetixnpga;nshioownevoefrt,he - Scope of Work. - c7 000144 SCOPE OF WORK FOR TERA that applTiEesRsAou(nTodxtiocxoilcooglyogEixcacleldlaetnacoe ftohreRriisskk aAsssseessssmmeenntt)prioscaesnsont-oprfoifnditcoormgamnoinzation - pgrroovuinddinbgetsweerveinceesnviinrtoonxmiecnotlaolg,yianndudstrirsyk, aasnsdesgsomvenetr.nmeTnEtRgArosucpise.ntiTsEtsRwAillwiblle be ~ developing assessment risk factors and screening for the 3 landfills, Lubeck criteria; and conducting Public Service District one general risk water supply and the Washington Works Plant. The specific tasks assigned to TERA are described below. - Phase II Tasks B, Screening Levels, C, D, and E: and General Development Assessment of of Provisional Risk Reference Doses and - provideSdutbotabsyk W1 V~DTEEPR.AsNtoaffliwtielrlatufraemisleiaarrcihzeorthdeomcsuemlevnest wriettrhietvhaeltwoixlilcobleogrieqcuailredda.ta Toxicological data to be provided to TERA shall include but is not limited to the - following a 8 compact discs of information provided to USEPA under TSCA by ~ b. 3M Corp USEPA (note Draft only a Hazard small portionof this Assessment for C8; information concerns C8); c. Joumal articles and other information submitted to WVDEP by - DuPont Subtask 2 - TERA staff will: a diedveenltiofpyinalgl RpeofsseirbelnececrDitoiscaelstfooxrictohleoogriacla,lisnthuadliaetsiosnu,itaanbdledeforrmal (if - b. possible) routes of exposure; outline methodology for developing said Reference Doses and for developing Screening Levels for air, water, and soil based on said - Reference Doses corresponding to each critical study identified in subtask 2-3; ~ c. convene a meeting at the TERA facility in Cincinnati, Ohio, to present their findings in subtask 2-a and 2-b, and consult with CAT Team toxicologists as coordinated by Dr. Staats; - d. finalize Reference Doses and Screening Levels based on recommendations of the CAT Team toxicologists as coordinated by Dr. Staats. landfillsSuabntdasWkas3hi~nTgtEoRnAWsohrakllscPolnadnut,ctanodnethgeenLeuraelcrkisPkuabslsiecsSsemrevnitcefoDristthreictthrweaeter - supply based on current risk to human health. This risk assessment shall include: a) identificationofreasonably anticipated land use, surface water and - `groundwater uses; - cs 000145 b) identificationofreceptors; ~ ) identification of exposure pathways; d) identificationof exposure concentrations; ) comparison of exposure concentrations to appropriate Screening . Levels; TERA shal utilize the following data in the risk assessment process: a) air modeling data from DuPont; b) air modeling data from WVDEP; --- ) water use data from the Well Use Survey; d) groundwater data from the Groundwater Well Analysisof C8 for residential wells; - ) 9) drinking water data from Lubeck Public Service District any available ATSDR Health Consultation that assesses wells; potential health effects from exposure to C8 in public supply drinking water. Subtask 4 ~ TERA shall review the ecological data and determine whether there is sufficient information to support the development of a C8 Screening Level for protection - ofecological health Subtask 5 ~ TERA shall compile and discuss the results of the above tasks into a - comprehensive report (draft and final versions), which also refers to and provides a brief summary of the following: = a) USEPA's Draft Hazard Assessmentof C8; b) DuPont's air modeling data; ) WVDEP's air modeling data; = d) groundwater data from the Groundwater C8 Analysis and Well Use Survey of Local Residents, and Lubeck Public Service District; ) ATSDR Health Consultation that assesses potential health effects from - exposure to C8 in public supply drinking water,ifavailable. _ Additionally, TERA shall include in the report any insights or recommendations for future research gleaned during this process that would further elucidate the toxicity of C8. Also, TERA shall provide in the report ofa summary discussion ofthe relevance the _ carcinogenicityofC8 in rats to humans - co 000146 - oN i} = - vd roan ' I - ET . -- -AF m e5 nn J.s ,E eTe eE snERe je T . . Le . 0 . LE -- i f - I7NQo E oCee mE AYE Le Q 5 ~ STLT vo) $f _ Na DNA E 0.0K ' 3 s = | WLR, > . " : - = her *<% - 5 - = Ts / - - ~. J1 J af EL } WashinLgo LL g a o oh ~; fo TN >hs = on Washington. West Virginia 000147 _ ! CTT mE Fira Pps - ) ) - - iecrsenon JlY e YN 7% ge Yn of f. - LETART LANDFILL " CS =| SITE A 0 oo - : } FI oNB a oSs EA Er i &. :} . EE Cm itn SE . -- 5So%n VE en ] - TLRS # i NAN ewLoN m A - oye rlME - Le RNEN inde, ~ scale 200--0 ----3------2000 am & J pa Parker. W EXHIBIT2 000148 Fo fe TE aSh ==p i S J LA hSdS 2 G7 5ik ] g A rd 1, 0, o 8