Document YBXadGwgBDb1yDxxvQb5L0NE

AR 226 _ 1194 Document 10 of 20 ` COMPILATION OF HISTORICAL C-8 DATA DUPONT WASHINGTON WORKS MAIN PLANT AND LANDFILLS : am } CONTAIN NC CRI 000492 EID168057 * JABLEOFGONTENTS ~~ 11.21 DC-O8CHUiMStEONriOcaTlGLAaIbZOATOatNO.r.y.A.R.A.I.S.S.I....oer rvec neoere1-11-1 13 PhysicochemicalDataforAmmoniumPer{luorooctanoate (C-8)............1-2 14 RERCTCNCES.rr " emma 20 Washinglon WOrkS Main PION... 21 Introduction.d...... wmmm------------ 2-1 22 ENVITONMEDNA] SEUNG ..rrrrreren 23 RDS CG ssrmagummentigmamgmmmmmmsmasnn 13 222 Hydrology, HydrogeoloagnydGroundwater Flow.............. 23 23 Wer QUIRY.co -- 231 Surface Water Quality... rem 26 232 GrOUIWAIETQUAY censors 26 233 Drinking/Tap Water QUality.....vrrormrormrororersroninen 21 24 SHECOCOPNUE! MOC... -- 2256 DREaFnACGNCtES ammmmmmm mmo mmn arn m--------im 30. Local Lani... nF SE Crediton mmanmmm------ -------- 32 E3O0V0ITONG MENI] SEHe ING ri rs rmar --3 33 322 Water Hydrology, Qualiy.. Hydsrmoanegd Gmeromuondolwa--toer--g--y--Flow.------ 33 331 Surface WaterQuality ---- 332 GroundwaterQuality... creme 3354 SDHAEBCGOENPCSCPUA MOGE...rrrrsrmoemoenosoens emerson 3-5 36 36 References... nmmms------ 40 Letart Landi... smite : 41 IOUOAUCUON.......o ors -- 42 EAVIIOMNENE] SEUNG rrr 2 442212 HGyEdOrIoOloRgYy,cHoydrrogeology and GroundwaterA FIOW................4-3 43 WAC QUAY. 43.1 SUITSCeWAerQUAIRY renee sessme neem A mrmsmemsmemreronon 44 4SH3E2CONCGErPoUuAndIwMatOeGrEQ.uarlritryovrrersosmr--ess--sn--ons--oins------4--6 45 46 DUNBS 1r.rcorosemmmmmmmome------------------] REfErenCeS.....romoo emim---- - 0004393 _ coesose MAHO000430 si Pot ants Table of Contents LIE A I-- | 52 ENVIONMENE) SCHING vr 52 S50212 CHydOroOloNgy,mHsyidroangdGerooundlwaotergy Flow......... 525-3 a S31 SUT WRRE QUI cmrmmermsmsmnsenemeemmerermeeren So 54 532 GrOUDIWaterQUAIIY Si6 CONCEPUA MOBelcor vrei rrr 3-8 5 55 DHAGHS.merrormrmomn 35 RUS mmm -------- 56 n--------------_ TABLES Table 2.0 Washington Works Main Plant Monitoring Wells Construction Data Table 214 Washington Works Main Plant Analytical Data Table Surface Water Table 2B Washingion Works Main Plant Analytical Data Tabl~e Groundwater Table 2.1C Washington Works Main Plant Analytical DataTable - Drinking Water Table3.0 Local Landfill Monitoring Wells Construction Data Table 3.14 Local Landill Analytical Data Tables~ Surface Water Table3.1 Local Landfill Analytical Data Ta-bGrolundewatser o Table40 Letart Landfill Monitoring Wells Construction Data Table 1A Letart Landfill Analytical Data Tab~lSurefasce Water Table 4.1B Letart Landfill Analytical Data Table-s Groundwater Table 5.0 Dry Run Landfill Monitoring Wells Construction Data Table S.1A Dry Run Landfill Analytical DataTables - Surfoce Water Table 5.18 Dry Run Landfill Analytical Data Tables-Groundwater FIGURES Figure 1.0 SolubilitiesofC;F15 COOM in Water as a FunctionofTemperature Figure 20 Washingion Works Main Plant Location and SWMU Map Figure 2.1 Washington Works Main Plant and Loeal Landfill 1-mile Radius Map Figure 2.2 SWaamshpilnegLioocnatWioornkMsapM.ain Plant Monitoring Well and Surface Water Figure 23 Washington Works Main Plant Cross Section Location Map Figure 24A Washington Works Main Plant Cross Section A-A" Figure 248 Washington Works Main Plant Cross Section B-B o Figure 24C WashingtonWorksMainPlantCross Section C-C* Figure 24D Washington Works Main Plant Cross Section D-D" CoWmaplnantgenoOonElhsoyemazeewn 02 TW . 000494 _ eoiesoss MAHO000431 iin Pian a Lngtis Table of Contents FFiigguiree 22445E WWaasshhiinnggttoonn WWoorrkkss MMaaiinn PPllaanntt CCrrosssSSeecttoionn EF--E* Figure 2.5A Washington Works Main Plant Groundwater Elevation Map - November 2000 Figure 2.58 Washington Works Main Plant Groundwater Elevation Map - February 1999 Figure 25C W1ashington Works Main Plant Grunt Elevation Mop -Novenber Figure 26A Washington WorksMain Plant C- Concentration Map - February 1999 Figure 268 Washington Works Main Plant C-8 Concentration Map-November 1998 Figure30 Figure 3.1 Figure32 Local Landfill Location Map Local Landfill and Washington Works Main Plant 1-mile Radius Map Local Landfill Monitoring Well and Surface Water Sample Location Map Figure33 Local Landfill Cross Section Location Map Figure 3.47 Local Landfill Cross Section A-A" Figure 34B Local Landfill Cross Section B-B* Figure 3.5A Local Landfill Groundwater Elevation Map-November 2001 Figure 3.58 Local Landiill Groundwater Elevation Map-December 2000 Figure 3.5C Local Landfill Groundwater Elevation Map - November 1999 Figure 35D Local Landfill Groundwater Elevation Map - November 1998. Figure 35E Local Landfill Groundwater Elevation Map - November 1997 Figure 3.5F Local Landfill Groundwater Elevation Map- December 1996 Figure 3.5G Locel Landfill Groundwater Elevation Map- December 1994 Figure 36A Local Landfill C-8 Concentration - May 2001 Figure 368 Figure 3.6C Figure 3.60 Figure 40 Figure] Figure 42 Figure 43 Local Landfill C-8 Concentration - May 2000 Local Landfill C-8 Concentration - May 1999 Local Landfill C-8 Concentration - May 1998 Letart Landfill Location Map Letart Landfill 1-mile Radius Map. Letart Landfill Monitoring Well and Surfice Water Sample Location Map Letart Landfill Cross Section Location Map Figure 444 Letart Landfill Cross Section A-A" Figure 448 Letart Landfill Cross Section B-B" Crna mmo i. a _ oovess W -- MAH000432 Main Plotan Laval Table of Contents Figs 450 Lett andl F-Zane Gods Evin Mop Jory 201 Figure 4.5A Letart Landfill F-Zone Groundwater Elevation Map - November 2001 Figur4e SC Letart Landfill F-Zone Groundwater Elevation Ma-p October 1999 Figure 45D Letart Landfill F-Zone Groundwater Elevation Map - October 199 Figure 4.55 Letart Landfill F-Zone Groundwater Elevation Map - December 1994 Figure 4.5F Letart Landfill F-Zone Groundwater Elevation Map - December 1992 Figure 4.6A Letart C-8 Concentration Map - July 2001 Figure 468 Letart C-8 Concentration Map - January 2000 Figure 4.6C Letart C-8 Concentration Map - July 1999 Figure 46D Letart C-8 Concentration Map - November 1991 Figure 50 Dry Run Landfill Location Map Figure 5.1 Dry Run Landfill 1-mile Radius Map Figure 5.2 Dry Run Map Landfill Monitoring Well and Surface Water Sample Location Figure 5.3 Dry Run Landfill Cross Section Location Map Figure S.4A Dry Run Landfill Cross Section A-A" Figure 4B Dry Run Landfill Cross Section B-B* Figure S.5A Dry Run Landfill Groundwater Elevation Map - October 2001 Figure S.5B Dry Run Landfill Groundwater Elevation Map - October 1999 Figure 5.5C Dry Run Landfill Groundwater Elevation Map - October 1998 Figure 5.5D Dry Run Landfill Groundwater Elevation Map - October 1993 Figure 5.5 Dry Run Landfill Groundwater Elevation Map - April 1992 Figure S.6A Dry Run C- Concentration Map Bedrock Wells- July 2000 Figure 5.68 Dry Run C- Concentration Map Bedrock Wells - July 1999 Figure S.6C Dry Run C-8 Concentration Map Bedrock Wells-July 1997 Figure S60 Dry Run C- Concentration Map Overburden Wells - July 2000 Figure S.6E Dry Run C-8 Concentration Map Overburden Wells - July 1999 Figure S.6F Dry Run C-8 Concentration Map Overburden Wells - May 1998 Appendix 1 Consent Order APPENDIX Spm eso mw 0004358 Emes0st MAH000433 000497 Eie0s2 ) MAHO000434 ii rt ng Loci Introduction 1.0 INTRODUCTION AEnvmiurlotin-mmeendtiaal CPorontseecnttioOnr(deWrVwDaEsP)en,tethreedWienstto bVeirtgwieneina tDheepaWretsmtenVtirogfinHieaaDletphaarntdment of Human Resources-Bureau for Public Health (WVDHHR-BPH) and DuPont on cNoonvteaminbeedrin14A,p2p00e1n.dixA1c.opyofthe Consent Order (Order No. GWR-2001-019) is `(TWheVDCoEnPs,enWtVODrdHeHrRi-deBntPiHfi,edaandscDriuePsoonftr)eqiunoirrdeemretnotsdteotebrempienerfwohremtehdebrythtehreePhaarstibeesen paenryfliumoparcotocotnanhoutmea(nC-h8e)a,lCthAaSndNuthmebeenrvi3r8o2n5m-2e6n-t1a,staortehseuletnvofirreolnemaesnetsoffraommmDuoPnoinutm ``aonpderDartiyonRsuna).theThWeasCh-i8ngGtroonunWdowraktsermaInivnesptliagnattiaonndSttheeeraisnsgocTieataemd l(aGnIdSfiTl)lsw(aLsocal, Letart cesotnadbulcitsehdedtoinatshseesCsotnhseenptreOsrednceer atondovcexrtseenetoifnvCe-st8igiantdiornisnkainndgawcattievri,tegsrotuhnatdwwaitlelrb,e:and surface water at and around the main plant, and the Loca, Letart and Dry Run Landfills. aPnurdseuvaanltutaotetdabcyhtmheenGtISATo,fTtahseksCoAn,sBe,ntanOdrdCe.r,TthhirseeretpaosrktsawdidllrebsesepderTfaosrkmeBd. bTyheDuPont pdertiemramriynoebsjtehcteipvreeosefnTcaesaknBd sextteondteovfelCo-p8ainnddriimnpklienmgewnattear,mognriotuonrdiwnagtpelranantdhasturface o pwraotveirdienaancdomapriloautnidotnhoefmaavianilpalbalnet,graonudndtwheatLeorc/aslu,rLfeatcaertwaalnedrDmroyniRtuorninLagndrfesiullltss, aanndd to hmyedertotgheeoldoagtiaccochmaprialctteiroinzaotbijoenctdiavtea for each location. Thisdocument was prepared to. 14 Document Organization StheecLtoicoanl,st2h.0e,3L.e0,ta4r.t0,anadndth5e.0DrpryesReunnt tLhaendhiiisltlosr,icraelspdeacttaivaevlayi.labElaechfosretchteiomnaiinnclpuldanets atenxdt, staebclteiso,n,andadtafiggaurpessasrpeeciidfenitciftioedt.h Tsihtee bseaimnegoduistcluisnseisduisnetdhaftorseecatcihons.ecAttiotnh.eDeantdoaf each pavraeislcaabtleed)ian eraecqhuessetcetdioinniTnacblluedeAsIionffortmhaetiCoonns(etontthOerdeexrt.entIntheadtdiitnifoonr,mastuipopnlewmaesntal ifnofurorlmoactaitoinonissdpirsocvuisdseedd.as needed io develop and presenta site conceptual model for the 1.2 C-8 Historical Laboratory Analysis of C-8 hTahsecahnaalnygteidcaolvmeertihmoed., mPertihorod0d1e9te9c1t,iDonuPliomnitt,apnedrfolrabmoerdatCo-ry auntailliyzseidsfaotrtChe-8DuanPaolnytsis IEnxvpeesrtiimgeantitoanlwSatastcioonndiuncWtieldm,ihnegtaonna,lyDseilsawwaarse.conItnra1c9t9e1d,twohtehne CthHeyMRHCiRllALVaebroifriactaotriyonin Mbaosnetdgoanmaelrytyi,caAllambeatmhao.d wBiotthhdaetbesctuisoendlaimGitassfoCrhrCo-m8atthoagtrraapnhgye/dMfarsosmS0p.e1cttoro1m.e0turgy/l CVoimmepgetotne0d8 noma moe i 000493 EID168063 MAHO00435 Non Panostants Introduction o c`eCaHs:eMdEiolplercaotniodnu.ctAetd tCh-a8ianmael,ysDiusPfoonrtDuhPaodnctomnptloettehed foanlleorfou1n9d9o8fwahnealnytshieslfaobrortahteory. RLaCboRrAatoFraiceisl,itLyaInncvaesstteirg,atPiAo,n (fRoFIt)h.eTRhFeTasneacloytnidcraoluwnodraknawlayssitsrainnsFfeebrrreudartyo L1a9n9c9aster OLcantcoabsetrer20L0a1b,orwahteorniedsevceolnotipnmueendttaoncdotnedsutitngCw-a8sainnailtyisaitsedusoinnag nGeCw/ManSalyftoricDaluPmoentthoundtil `dCehvreolmoapteodgrbayphEyxyTgaenndReemseMaarcshs,SIpnec.ct(rloocmaetterdyi(nLSCt/aMteS/CMoSll)e.ge,DPuPAo)ntthaatduotpitleizdesthLeiquusiedof LCIMSIMS for C-8 analysis in November 2001. DusuiPnognttheinLtCe/ndMsS/toMSsu.bmiTthetoaWnaVlyDtiEcaPl m/eEthPoadAlolldoogcyu,mesnatmaptliionngrmeeltathiondgoltoogCy-,8aanndalysis Aasppsluircaanbclee qPuraoljietcytcPolnatnro(lQquAaPli)ty0absesusruabnmcietptreodgtroatmhewiGlrlobuenddowcautmerenItnevdestiingaatQiuoanlity Steering Team (GIST) i carly 2002. 1.3 Physicochemical Data for Ammonium Perfluorooctanoate (G-8) mCa8n,ufsacotuirdienngtaitftiheasmaFiCn-1p4la3nt,.i aFifgluuroeri1n.a0tesdhsouwrsfatcthanstoluusbeidliincsthoefluFroypoClOymOeMr in wfiastts teahre pahyfsuincctoicohneomfictaelmpdeartaatauvriel(aFbilgeurfeor6.9C-8in(KKiissssaa,, 11999944)).: The folowing summary Q Molecular Formula = CFy(CF:),COONH: Q Molecular weight = 431.098 gimole OQ LDio acute oral rat = 680 mye 0 BCF=18 Q pH ~5 (0.5% aqueous) Q pKa=28(-CO0H) Q Meliing Point = 56-58C (COOH) 9 COD =700 mye Q Koe=25 Q Water Solubility > 1000 mg C-91L Q Vapor pressure (at 22C=) 7.1 x 10% mm Hg Q Krall Point =25C 0f0QLe aCriDtioca0l MiDceelolevCo0n%centration = 33 mdmeo,l-- /L DXCNoT envce Sons t mbrsais ccoshsen-Mesa afc orish Carogonm58ey be ne 000499 i% Enissoss MAO000436 Moin lantandLandis Introduction 1.4 References Kissa, E. 1994. Fluorinated Surfactants. New York: Marcel Dekker, Inc. WCamago ion, r OE. gsai mbaa nzoeown teo z lhey - 000580 13 EID168085 MAHO00437 FIGURES ---- 000501 ee EIDIGG0G MAHO00438 35 25 10 occ \ 0 3d ~ \a FT WE FARA E % S \g, 3 > a2 No 2& = 0 4\ 8 % \Q o | B% V @ 2 \* \ e x ve - 2 32 34 36 Tx 10% Figure 1.0 Soluwbialtietrieassoaf C;F,s COOM function of in temperature (Kissa, 1994). 000502 Etssosr 1000435  000503 . ED168068 MAHO00440 inPlanta Lan Washington Works Main Plant 2.0 WASHINGTON WORKS MAIN PLANT dion. nmms---- oo 22 EY WeerQuy sr ---- lt SteConcept. - eons I2 DIGap _-- - rssh Reese irs -------- ro as Tabs eo Wahingen Wor Mia PstMainWelsCosionOsa TWEZIA WagsWor Mun PstAnyDit Tale -SieWar Tei Waker Work MoinPstArtis DsTl-Granda THERE WagonWoks Ma Pi Aric)DtTl DisTkpWienr Fous Fie 20 WinnWks Main PrtLectinsnd SYMUMap Fines Wingo Wor Min Pn Los Lani -ne Rad Mop, Fiwe22 Fee) WainWork Msn FnMorin Wel ndSrcWtSrlLocsinMop Waking Werk Ms FlotCosScionLecston op. F[neaian W-- akerWorks Ma Pa CrosSetonAN Fipse2aC WailoginVor MamFa CrosSecon.C Fipee2d0 WahagonVos Ma Pl CrosSein FameldE Wage Voss aePlsCros Scion Fed WainVonksbn PCr Secon 5 Fipwe 25h Wabiogin Wks Mai Pa rundats Evan Mop Neer3600 Fiwe250 Waigin aks MamFist Gamer Ecaon Mop Ferry 1099 Fic 25C WaingonWerks Mon Past Godt Eatin Map Novant 1990 Finc20n WaWksiMonPn otC3Cocenrton op Feb 199 Fione263 Waingao WksMain farkC3Centon ap oven 1998 CoWmnpetgolnon,buiyGam Oa za wn ez - 000504 a ED168069 MAHO00441 HanPintsnd Loess Washington Works Main Plant @ 21 introduction `The Washington Works Main Plant (main plan) is located along the Ohio River in WViarsghiinnigat(oFni,guWrees2t.0V).irgAiniwaa,taeprpursoexiamnadtweellylsseuvrevnemyiilsecsusrroeuntthlwyebsetoinfg Pcaornkdeurcstbeurdg,foWr ethset a(rFeiaguwriet2h.i1n).a 1-mile radiusof the main plant and Local Landfill property boundaries Significant historical hydrogeologic and groundwater quality data for C-8 at the main plant is available from previous investigations that have been conducted. The most sIingvneisftiicgaanttiosntu(dRyFTw)ascoandRuecstoeudrcien tChoensfearlovafti1o9n98anodnRfeocuorvSeorlyidAcWtas(tReCMRaAn)aFgaecmileintty Units (WaSsWtMeUASm)enatdtmheenmtasin(HplSaWntA)toPseartmisiftyNrueqmubierremWentDsof04th-e58R7C-2R5A91H(aDzuaProdnotu,s 1a9n9d9)S.olAid briefdescriptionofeachof the SWMUs investigated is presented below. SWMU Tocations ere shown on Figure 2.0. Q SWMU A-3, Riverbank Landfill: The Riverbank Landfill is about 4,500-feet Tong and lies along the northem edge of th site near the Ohio River. It was oipnecirnaetreadtiboentawsehe,npl1a9st4i8csa,nrdubtbhleel,ataend19p6l0anstatnrdasrhe.ceAifvteedr pcloowseurreh,ouitsweaasshc,overed wdietnhse6v1e0ge3t5atiinocnhe(soonftshiels.loCpeudrearneat),orthbeyRibuvielrdbianngks Laannddpfaivlelmsecnotveirnetdhewith o manuf ring ares, Q SdiWgeMstUionB-p4o,ndAsnaacrreocboi-cloDciagteesdtiwointhPionnadspo(rDtiigoenostfitonhePoRnidvse)r:baTnhkreLaendffoirllm.erOne pond: dates from the 1950s and two others from the 1970s. The ponds received wwahsetne tfhreopmotnhde cfolnutoernotcsarabnodnumpapneurfafcetwurfieentgopfrcolcaeyssli(nienrcalunddinpgonCd-8b)eurnmtilma1te9r8i8a,l wwietrhetroepsmooivl,edanadndthdeiasrpeoaseidsocufrorfefnstiltye.vegTehteatpeodnwditahrcgarawsass backfilled and capped Q S`WWasMteUInCc-i6n,erPaotloyrascceotnasliWstaesdtoefItnwcoinebrraitcokr-sli(nWeadsptietsIinncitnheerawteosrtse):rnTphoertfioonromferthe manufacturing area.TheWaste Incinerators operated between 1959 and 1990. The Waste Incincrators have been excavated andbackfilled with clean soil. . Q SWMU H-14, Buming Ground: The Buming Ground is located in the central portion of the menufacturing area and was operated betwen 1948 and 1965. Sgrianvceel,1a99n0d,ctohveerBeudmbiyngbuGirlodiunngds haansdbaespehnalletv.eled,backfilled with clean fill and gAropurnevdiwoautserVeartiftihceaRtiiovnerIbnavnesktLiagnadtfiiolnl(,VDIi)gefsotuinodnePvoinddesn,ceaonfd rBeulemaisnesgoGfrCo-u8ndto(sDouiPloanntd I1n9c9i2n)e.ratLoirttsl.e eFuvritdheenrceinovfersetliegaasteiosnwsearnedfeovuanlduaitniosnoislawertehepesirtfeoorfmetdhedfuorrimnegrthWeasRtFeI to determine the extentofreleases in groundwater. CWoinmtmoneOFrce Dzes 000505 22 entero MAHO00442 sin Prt acts Washington Works Main Plant PCliannit,witdhe ghraounindwNaotveermsbaemrpl1i9n9g8wsansdatlseosceocnodnudctiendFedburriunagrytw1o99s9epadrantegmohneitRoErLingThe sinasmtpallliendgweevlelnstassfsoocciuasteeddownitehvatlhueatBiunrgngirnoguGnrdowuantderaqnudalRiitvyeartbeaxnikstLianngdafnidllnDeiwgleystion Ponds SWMUs. 2 rAlol uplnandtewerllssamspalmepsl.edCd-uricnongctehnetrRaFtTiownesraenadntahleyzeextdefnotriCn-g5.rouCn-d8wawtaesrdiestdeicstceudsisnedaliln Section 2.3 Water Quality. 22 Environmental Setting 22.1 Geology t"ThheeVgIeo(lDougPyoontf,th1e99m2a)iannpdlarnetviissesdhboawsnedononsiaxddgietoiloongailcfcirnodsisngssecftiioomnsthdeevReFIl.opeTdheduring sleocctaitoinosn,soAf-At"heangedoFl-oFg!i,cacrreosssh-oswenctioonnsFiagruersesho2w.n4AinanFdig2u.r4eF.2.3.FouTrwnooretahs-ts-owuetsht ccrroossss.- sreescpteicotnisv,elByB. ,ThCe-Cc,roDsDs-'s,ecatniodnsE-wEe'raeredesvheolwonpeodnfFriogmurdeesta2i.l4eBd,g2e.o4lCo,gi2c4lDogsanrdec2o4rEde,d uprroidnugcttihoenVw1ealnsdaRnFdI,geaontdecfhnriocmallbeosridnetgisdlreidlhliesdtoirnicthgeeoaltoegi1c95l0o5gsthrroomughtestth ncdarly 19805. Some monitoring wells shown in Figure 2-3 were later abandoned. The current site map (Figure 2.2) shows the monitoring wells that currently exist at the site. ""TThhee malaliunviapllatnetreasctesisontoQpuogartaepmhaicrayllalyluflvaitalantderiaecseadpepproosixtismaitnetlhye5O0hifoctRiavbeorveVatlhleeyO.hio Risivuenrd,erwlhaiicnhbfylaowfslate,asrtivteorw-escsoturpeadstbtehderomciknspularntfo(asfcetheFeiDguunrkear2.d0). SeTrhiecsaltlhuavtirailsetserrace steeply and outcrops in the southern edogfthee site (0 form the vallcy wal. TdhoewnQwuaartedrnuanrcoynaslolluivdiatuemdrrainvgeersdfeproosmit6s0of1p0o1o0r0lfyee0t ienldle-pstohriaendd, cbornoswisntsaonfd cgoraarysseannidn,g vsairsi,coclloaryeadnsdangrdayveslh.aleT;hegrDayu,nkgraeredn Saenrdiebsrboewdnroscakndcsotnosnies;tsanpdrmiinmoraobifelrdseyodfacnods, claystone, black carbonaceous shale, and limestone. c"TiheevaavieornaofgethrieveOrhwiaoteRrivleervaetriroanceisdeapboosuitts55u0ndfeerethaebomvaeinMeplaanntSaeraeLaebvoeult(6M3S0Lf)eeta:nd the : athbeovneorMtSheLr.n bDouunedtaoryroivfetrhbaenmkauinndeprlcauntttianlgo,ngsotmheesrliuvemrpsiendggoef.cFliagyuarend2.si4lCt esxhisotwssaalonng. exampleofth relationshipoffil and clay ayers along th riverbank. 22.2 Hydrology, Hydrogeology and Groundwater Flow Hydrology Regional water needs are primarily satisfied by the Ohio River and Lite Kanawha River near Parkersburg. These sources provide water to the cities of Parkersburg, StTere = 000506 eoteaon 000443 oi lrsnd Loni Washington Works Main Plant I`oWceasltcVoirmgmiunniiataineds rBeeclepirev,e wOhaitoe.r fIrnolmesssmaplolpulloactaledwaatreearsc(oim..p,anneiacrstthheatmoabitnaipnlatnhte)i,rtwhae.ter from production wells srcened in the Quatemary river alluvium. wSaurlfeasc.e wSaeteeprsaltotchaetemdaailnopnlgantthdeirsicvhearrbgaensk tmharyouogrhigdirnaaitnesfarnodmsptroercimpisteawteirosn,tahnatdhdarsainage idnifsiclhtarartgeedstaolposonigltohrefrlilvearnbdantkh.at Tlwoowsdraalionnaggethsewtaolpeos,ftohnee ulnodcaetreldyiinngthsehaflalciolwitcyl'asy and ssuoruftahcweesrutncoofmfedru,rianngdrtahienyotwheeartlhoecratteodtohenOthheioexRitvreerm.e cDausrtienrgednrdyowfetahtheerfa,ctilhietyd,rcaionnavgeey swales are dry. Hydrogeology RRievgeironaalllugviraoluntedrwraatceerdespuopspiltise.sTaheesoabttuarianteeddfrpoormtitohneoDfutnhkearOdhiGoroRiuvpebreadlrluovcikalantedrOrahcieo Pderpoodsuicttsiocnomweplrlisscothmeplperitnecdipianlhriesgiaoqnuailfearquhiafveer ubseeedn fkonrowwantctrosyuipepldlyupputropo5s0es0.gallons pceormmmeirncuitael(wgaptme)r (sSucphpulltyzc, o1m9p8a4n)i.esBaosbetdaionnwathteesrefhriogmh tyhieeladlsl,uvniuamlearqouiufseri.ndTushteriyailealndd fwerlolmaasllfuovrimalataiqounifgerraiwnelsliszeisarnedlattheidckonetshse well' position with respect to th river, as `plTahnetO. hTihoeRwivaetreraltlaubvliealoctceurrrascaetdaepdoespitthsocfonatbaoiunta6s0intgol7e0kefeyetaqbueilfoerw ugnrdoeurnldyisnugrftahceemianin `tchoemspluetredfoianfctthheeeiutnedearqluyiifenrgyDiuenldka2r0d0G1r0o4u5p0.gTpmh.e oTn-hseituendperroldyuicntgioDnuwnaktaerrdweGlrlosup is nwhoitcahmcaojnosrisatqsuipfreir.marTihleyoufppseharlzeoannedosfiltth,eliDkuelnykbaorudnGdrsotuhpe (lWoawsehrienxgttenotnoFfortmheatsiiotne), aquifer. bedrock wTinlladidkiteiloyn,rerseulgtioinnalupgwraorudndgwraatdeiernctosmtmoutnhiecaaltliuvoinalbeaqtuwiefeern. the Ohio River and `hiGgrhoeusntdwmaetdeiraqnucahllioyriidne,thseulaflatleu,vihuamrdinnesthsis(arsecgiaolncituemndcsartboobneatnea)t,uriarolnl,y apnoodrm,ahnagvainnegstehe `aclolnucveinutmragteinoenrsaolflayillsahcyadlrcogioulmogbiiccaurbnonsatien ttyhpeer,ewgiitohn n(eSacrhunletuztr1a9l84p).H aWnadtehirgfhrdoimsstohleved solids content, Natural recharge o the alluvial aquifer comes from various sources, including: Infiltrationofprecipitation falling dircetly on the alluvium Q gLraatveerlalzmonoevsement of the river water through the alluviumvia permeable sand and Q Seepage from stream tributaries that discharge to the Ohio River hTyhderamualixcicmounmneactmioounnttoo fthweartiever.avaTihleabdleegtroeetohefahlyldurvaiuulmicdecpoennnedcstoionnthiseadefgurnecetioofn ofthe pemeability and thicknessofthe riverbed, permeabilityand thicknessof the alluvium, and hydraulic gradient between the groundwater and the iver. Pumpingofon-site active _ CVionond,p08tavayidaonra o2f0 Jan -- 11.02 --3 000507 EID168072 MAHO00444 iPlrtand Lois Washington Works Main Plant well fields near and parallel to the river (i.., the Ranney Well, the DuPont-Lubeck Well Field, and the East Well Field shown in Figure 2.2) lowers the groundwater level in the: aalllluuvviialumaqtouwiafrtedorthbeewleolwlsr,ivwehriscthagree.plTahciessiwnadtuecrepsuwmapteerdffrroommtshteorriavgeerion tfhleoawqiunitfoerthaend helps sustain high-yield pumping wells. ~ Groundwater Flow gGrroouunnddwwaatteerregleenveartailonlsy,lfolwosw doirtehcetisoonus,tha-nsdouftlhowwesrtatiens otnh-esailtleuvairaelsatqruoinfegrl.y iHnofwlueevnecre,d by ithneclOuhdieothReivRearnnanedy bWyelplu,mapriandgiaolfcoonl-lseictteorpwreoldlucwthiiocnhweplulms.psTh8e00ont-osi1t,e00p0rogdpumc;titohnewills saonvdetnhewefilvle iDnutPhoentEa-sLtubWeelclk Fwieelllds,,wwhhiicchhppuummpp aabcooumtb7i0n0edgapvmercaogmebriatneeod.f2,000 gpm; ``mGeraosuunrdewdatienrNeolveevamtbieonr c2o0n0t0o,urFembarpusarfyor19t9h9e,alalnadviNalovaqeumibfeerrd1e9v9e8loapreedprfersoemntdeadtaa5 Fthiegufrleosw2a.r5rAo,wsB., aAnsdsCh,orwenspoecntitvheelgy.roTunhdewdaitreercteiloenvoaftigornouconndtwoautremrafplso,wgirsoiunnddiwcaatteedrby cfelnotwrailn ptohretinoonrotfhetahstepsatret, ogftrhouendswiaetiesrtofwlaorwdisthteowEaarsdt Well Field well. the Ranney Well. In the north In the central aLnudbewcekstWeelmlpoFretlido.n oPfhumepisntgeo,fgtrhoeunpdrwoadtuectrifolnowwiellsso(uRtah-nsnocuythWweelslt, tEoaswtarWdesltlheFiDeludP,oanntd- the DuPoni-Lubeck Well Field) eliminates off-site migrationof impacted groundwater othbattaimnaeyd ofrriogmintahtee GfernoemratlheElSecWtrMicU(aGrEca)s.proApdedrittyiolnoaclatgerdotuondtwheatweersteolfevatthieomnadiantaplwaants. `Dgartoaunfdrwoamtetrhemomdaeiln p(lDaunPtonatn,d G19E99w)e.reThuesegdroiunncdawliabtreartimnogdtehle cWoanschliunsgitoonsniWnodrickasted that tghreousnidtwpartoedrucftoiomntwheellmsa.in plant area is contained to the DuPont property by operation of 1D1u1P2o1n9t9-0LuhbyedcrokgWeeollolgFiieeladssaensdsmtehnet,EapsrtodWuecltlioFniewledlwlasspeccoinfdiuccctaepda.citTyhetesrtesiunlgotsfwtehree (usDeudPotnotca1l9c9u0l)a.teItnhtehteravniscminiistsyiovfittyhaenDdutPhoenhty-dLruaubleicckcWonedlulctFiievlidt,yotrfatnhsmiaslsliuvviitayl vaaqluuiefser rviacnigneidtyobefttwheeenEa1s1t4W,e9l0l0 aFinedld1,2t7h,e50tr0agnaslmliosnsisvpietry dvaalyupeesrrasnqugaerdebfeotowte(ensp16),0.50Ianntdhe 5va0l,u0e0s0 fgorptdhe.EaHsytdWrealulliFcicco.nduFcotrivWietlylvsalAuXe1s 3w-erPeWOcaIlcaunldatAedZIf3ro-mPWthOeIt,ratnhsemhiysdsriaviutlyic c0o.n0d1u1c0ti0v.i0t4y9vcamlusecsc,rarnegsepdecftirvoemly0..013 10 0.055 centimeters/second (cm/sec) and from vUasliunegstdheetheyrdmrianueldicfrcoomndgurctoiuvnidtwyatvaelruleosvfaitoimontsheme1a9s9u0rsetdudiyn a1n9d90thaendhyadsrsauulmiicnggraandient esfefveecrtailvweeploropsaiitrys wvaalsuecaflocrulsaatnedd.anTdhgergarveolunodfw3a5te%r,ftlhoewgvreoluocnidtwyawtearsfelsotwimvaetleodciatty for o 5pofrteieotndoafyt(h1eds)itbe,etAwegernomuonndiwtaotreirngflwoewllvselTo1ci3t-yMoWfO3LfdanwdaLs1e8s-tiMmWaOteId ibnetthweeesnouthwest monitoring wells POG-MWOT and K14-MWOL in the westem central portionofthe sie. CWionmrgmoen,n0d amomze mo 25 000508 ED168073 MAHO000445 MNaannPPelwtdaindoLnasts WaWasshhiinnggtonWWoorrkkssMMaaiinnPPllaannt foInrththeecsaitsetaequpiofretriboneotfwteehnemsoint,itaorgirnogunwdewllasteArLf1l0ow-MveWlOocIitayondf2A.O50f9d-MwaWsOLestimated `(thGDeruoPRuoinvndetwrab1t9ae9nr2k)c.LapnAsdnfialatlcttshieivneRcFierve1en9r9cb1ha.-nDkTrLahaienndRfgFirIloluvnwedreiwrfaeiteieddretnhctaoitlfltiehecedtiacoonnldlhesacastmibpoenleesndyisdntueormpienrgatthieonVIat effectively captures waterat the seep area. 23 Water Quality 2.3.1 Surface Water Quality `mHsieasamtspourlrieceladlocisanut2ri0foan0cs0eaawrneadtseh2ro0Cw0-1n8aoctnotnFwcioegnuotruretaft2a.il2lo.sn,sS0au0rre2fpaarcneedswe0an0tt5eerdaCnin-d8Taatcbotlnwecoe2nr.ti1rv.aertiloSonucsratfwiaoecnrese.waTthere cooulnfcaelnltsrahtaivoensbeheanvesarmapnlgeedd mfornotmh1l.y43siungc/elFeb1r9u9aruyg/2l0w0h1.ilOeutOfuatlflal0l0050C2-C5-8 ocgefonniecnresantlta,rllaOatutitiofonanslolofvCae-r8caalclrobnhocanevnaetdrbsaeotreipnotnmisounhcathvreelaostwimegernn,itfrisacyansngttilenymgdifenrcoltmihne0e.ld4ui3rn6o2pu0o0gl1/y.m(e0Tr.h8si.p5sr4oiuscegtsh.se. rIeTnshulet system isdesigned to emove a major percentageofC-8 from the process wastewater, 232 Groundwater Quality bbsieeneecnne vm1aor9ni9ia1tblo(er.TeadbSlqoeuma2re.t1ewBre)ll,ylhssothwaaevvteeirbni,egnethnJeamnwouenalirltyso2sr0ea0dm1pa.lnenTduwaalonldypltshaienntcs-eawm1ipd9le9i6gnragonfudrnedoqtwhuaeetrnescry.hahvaes. qsaunaadmlpialtriyenfdgrieosvcmeuensxtsisesdwticbnerglcoawcn.odndnTuehcwetlesydaimanpsltpaialnrlgtedoefvwteehnltlessRafFsoIscou(csiNeaodtveoednmwebivetarhlu1tah9te9i8nBguargnnrdionFugenbdGrwruaoaturenyrd19a9n9d) RiverbankLandfillDigestion Ponds SWMUs. LadAenltldefcpiltaelndltDiwinegglerlssotuisnoadnmwpPaloteneddrsdauanrrdienapgr(eitvnhietohRueFsIwsecwseetprerseanampnpoalrletysiz.oendoFiffgtourhrCec-s8R.2i.v6eACrtbatanhnedkR2.L6Diadvnedefripblailn)c,ktC-thewas wHweeEll/llLs..lomCcoaantxciioennmsturamantdcioornnecsseunlwttesrraeftoirboeCn-ls8o.rwan4Mg0eeaudsgfu/rrLoeimdn3c28o8n0co0efntt1hre3a,t36i70on0wseulrgla/sLn.gseadTmhpflereodhmi;g<hi0ne.st1the10ot1h3e,r6090 cDoingceesnttiroantiPoonnsdswearrcea.measured in monitoring wells PO4-MWO2 and RO4-MWO2, near the TwehreeRpFrIepCa-r8edcoanncdenatrreatpiroesnevnatleudesinwFeigruruetsil2iz.e6dAfaorndco2n.t6oBu.ring. Isoconcentration maps CVinaingpione, OnFheybe 000509 _. Eotesors MAHO000446 deMannfPoowaadnlgnotanndtts WaWasshhiinnggttoonnWWoorrkkssMMaailnnPPllaanntt @ 3? DrinkingTap Water Quality dPtihrseotdrmuiacbiutntiioponlnaWnpteo.lilnCtAs-MoOnc7otn-hcePepnWltOarnIattpie(orhniisosdtioinrciadclralilynlkysikingnn/cotewapnMawaaystwe1er9lhl9a93v3(e6T)abbesleuenpp2ml.ei1Cae)ss,uproetadbaltefwoautrer to s0`C.ao4mn2pc3leinuntgrga,ptoirioennstspsercitaninvgteheledy.dfirsNtoromib0ou.bt2vi1oi3nouussgy/stltre(e0mnd0os.na5r8Oe9ctsueogebn.erinC1-1t8,he2cd0oa0nt1ca.enwterraeti0o.n5s07d,et0e.c4t5e,daantdthree 24 Site Conceptual Model c`alTnahdsesfmiufatiiuerndeaphsluacnmotamsnpiltaeentcdeoneocrceoiplntocugoaimlcpamlleortdeeec.elptdoerssc.ribPeostetnhteiaploteexnptoisalureexproosutuersewreoruteeesvfaolrucautrerdeanntd DnGoirnro-euecnxtdies,txeWpnaotss,utrbeeeIctnaocuisCne-er8tahtbeoesraser,imaantgnedmraiDtaielgrseisahtlaisvoecnobnPetoeannidnsre)edmoworivtcehodivneartnehdde raSenWgdrMavdeUgeesdtaoitrsepdm.aivneiTdmhea(rlBeofuormrien,g contact with these materials is considered to be an incomplete exposure pathway. wAatlearrgceopnotratcitownoitfhtCh-e8pliamnptaictteedissociolvscorredgrwoiutnhdawsapthearltisannodtcloinkcerleytei.n tHheesnecaeresausr.face s`etTxhoperormseufsorerewee,prasstu,hrwfwaahyci.ecwhMautulecirhmcoaotfnettlahycetdipinrsgecchCia-pri8gteaitmiipnotanoctftaehldeliOsnohgiiloosniRssicivtoeenr.sisirdPoeruretceeiddpitttoboawteiaoarndnfdairlnaicinongmspoalnnedte tohcecurrivienrpblaanckesslaolpoencgitthheerrpievrecroblaantkcsarientportohbeabsoliylcoarursuendsboyfpteforctohleatrievderw.atTehrethsaetcps that catohcanctsuiumdnuedleraretldeisetoatbobeposvaoeinltiahnencdosmlfpuilmlepateledo,enxglpotowhs-euprreiervmeperaabtbaihnlwki.atyyCdoculncatyaatconttdwheistialhctotiifmvpetahcferteeOndhcihso-edRrpaiivwneartedrepjossits `groundwater collection system. prDoiaurttehecutfaoeyrxbpgeorcsoauuursneed0wgargotruieonusrdnwvdaiwtaaetcroenritailcmotpcawactitetedhdawtbayatbcCor-up8tu6ims0paelfesdcotfcbroynossm.ipdTrehordeeudocn0tlioybnepowatenellnist,niacloWmcapotlneteratcet ppruomvpiedidngfriondmusptrroidaulcptrioocnewseslwlastie.used for two purposes, supplying drinking water and emWiaegilhlnt tApliMamnOets.7.-OMPtehWeaOrsLuwreielsdlosncoeaonrcefetAnhtOrrOeaetSi-poPrnosWodOufIctCia-onndiwAneQlthlOis9s-twhPealWtlOpsLruo.vgigAdeesMstOeddTrit-nhaPktiWntgOhiwsawetaxesprostsaoumrtpehleed pdorawitenhkrwiatnyhgawinsatcthoeenrsmiiadpxeoriiemndtutmoofubcseoneccoe(mnwpthlrieacttheio.inssHaodmewteeivcetxre,dtoiafnvuewaranratygeeesricnfogrnlcoeemwnettlhrl.eattihCoronensetowafeclCtl-ws8i)wtiihnllbe: impacted drinking/tap water is a complete exposure pathway, `VCO-S8-wPaWsOdIe,teacntdedLiOn4p-rPoWdOu1c)t.ionTwheellmsapxriomviudmincgonicndeunsttrraitailopnroofceCs-s8wwataesrd(eKte1c6t-ePdWiOnIw,ell iKnId6us-tPriWaOl Ipr(o1c6e.s2seusg/li)n.cluWdaitnegrnfonr-ocmonthteascet waenldlscoinstnaoctt ucsoeodlifnogr wdartienrk,infgi,rebwuattreart,hperrofcoerss CVioinmigpoen S6 yao zee 57 000510 Entesors MAHO00447 HdaiePofrtensnLan WaWasshhiinnggttoonnWWoorrkkssMMaaiinnPPllaanntt o `aemxtapeneruc,ftaeccdotnutvoreibrnesgimpoirnoncitemosadslee.sm.iAnveTreharelarigezeeisdcoawnapcotetenertnrttaiotaigloefnnosoerrflaitmCi-st8teediancmo,pnrtaoanccdetls,osrhwocawotenevsreuram,iptthhiieospncooiinntttahocetf is pmuasaetxh(wiwahmyiocihsccioosnmcapemlniettxreta,utriioetonissfdcweoatntesecirtdeefdrreiodnmatsoneybveesrimanilgnlpiermoawdlel.ulc.tiTohnewreelflos)rewiwlhliblee tlohwseerxtphoasnuce TrevehaselouuRartcFieosenmccoaloyongcbilecuadelexdepvotashleuadasttuioronfsiaftcoeec-sruolsiaeltdeatdontchoiendsRetniitvtieuferynbitansngkrweLhlaeentahdseferidlsflirDgoinmgieftsihcteainoStnWePMcoUonlSod.gsiicaTlhtihse ocIonnncltiyancpctortawetinottishaalCn-edcoBilumorgpniaiccnatlgedeGxrspoooiulsnsudroerSgmWreModuUinusdmwaarwtieetrchoiisvnentrohetedlRiwFkiTetlhsygtbrueadcvyaeular,seeaa.stphhSeaulWtr,faaogceebwuaitledrings `gagrnrodouudnnoddwwnaaottteeprrrdaoorveeidsneontoetceoxdlpioosgsciuhcraalreghmeaebtdiotiasatuo.rffSacucoebsnwucarteferarcfeaotrstoehicelol(sogierg,eiactaelrrtehcaenpi2orfse,eta)nadnd 25 Data Gaps The following data gaps were identified for the main plant: oo 9 gArrdodouiuntndidwownaaattleermrolanniodtwo0riinentvghaelwuebaletldesragorrceokunbneedclwdoaewtdettrhoelfuounrwtchodenirfvdieecnlteiodnneasal,tleupvaCirat-licaucqlouanircfleeynrtfroartions in 3 Continued refinementofthe groundwater model for the msi lant fs requir 0 arneedvathlautatneootfhatsgirtoeumnidgwraatteironcoafptCur-e8biympthaecpeudmgprionugndewlatserisisococcucurrrriinngga.t the ste Q pSluarnfaicsecuwrateenrtlqyuableiitnygindetshiegOnefdiotoRiavdderresshsotuhlids bisesuecv.aluated. Aseparate work Activites o fil the data gaps will be proposed and discussed in the work plan. 26 References DuPont.Wa1s9t9e0.&WGaesohliognigctaolnEWnogrikneser1i9n9g0DPerpealritmmiennatr,yHydrogeologicAssessment. Solid Wo1r9k92s.AprVierlif1i9c9a2t.ion(VIonlv.es1t)i.gation 1. DuPont de Newours Co. Washington 30,919999.9.RCCoRrApoFraactieliRteymIendviesattiigoantiGornoRuepp.ort, Dupont Washington Works, June Haskell Laboratory. 1991. Ammonium Perfluorooctanoate (FC-143). CarnCS iti a S on2a nT, 000511 enissors MAHOOO4s8 MiMapnwaitmnoguawentss WaWsashhiinnggttonWWekekssMMaaiinnPPllantt o Schultz,vRr.A,. W1e98s4.VGirgounnadwaterHydrologyof theMinor TributaryBasimsgihe Ohio -- Vines 5 FE - -- 000512 Enters MAHO00449 TABLES 000513 . eee eowem oo oo MAHO000450 Table 2.0 Monitoring Well Construction Data DuPont Washington Works Main Plant mmm TT `Washington, WV Sooap)h|| Dniaemester Fon sTsmEe eT]P E Re ovW W mwaT] CeCiTnYYao l O H |--3--u ------n t a |a--[ssoefe-=eseoe]|| [bie tewT or |ersTbIawsTerniia| 0 | || see5e-5somr] Sr ET EETn C 5 i t a 2% | T 2 c Lavo 1tA isTe5 s 0| A 3r w --T--S ---- 5--E ----+n -- m ism rvore 1c bu agsn eeanr we [wp --e --t ---- B---- -- [s7 m immoo |itswaassn{eeeosn|-- wS ma |--e--s ------S--a-- i [oC I oCmT wor{we2 ar cam[esos0|e 172T o J] m777a% 7] [[arosesamTor war |twas [oepnier0T7ame ||g e 2J S 0 s7o5a] Fa Foen inswo oorf1twwege [[se0aisanr[{ 05fT -- e-- --s ---- --o --S --] --e -- [[aacosmneisstawmoor| [trvevasno T[eeowi7 esnr[ 7T 2|e g--------e-- 2e -- [[o --E ammsaveor{| tvm i s seesws | |m g e --------e --------------------|| wwweeer1----1--1 -- @ T e CEyr 2 e TCCEo T7w w S 727a eTr s wnt7 s on r] Page 1012 000514 cores MAHO00451 Monitoring WeTlalblCeon2s.t0ruction Data DuPont WasWhaisnhgitnogtnoWno,rWkys Main Plant - mmm Newid DTeotpatlh SLecnrgetehn|| ScErloeevnatiinotnerovfal Forme Fo (eo) 1 fee ee y ee TT Foto ens eo [ge] 2 rs | eneETr| 72| I g WO ] 75 eso 1 rw so sonsTag[a] mas [ef] oe| wes TH 2 Fano en|e 57 ------------ 72% | aso Er wes vn S | e p To pe ise e] v2TE 10 [aoa 2E5 ene0 [2T2700 1 75 |sesso] [ Fe ABoT TWaIs STeessisor[ 2Th aio o0OiNjoo 25m |ssa] srei-seser| Eo ws ess| 2 Ti 0 oTio]st1si5ae.r] Feder 2 Twn 5 30 1 wisTo [ewes Tio 20 --io{smssens] fon I savor | wees{t ve e[[3366[ 7 20 i0T a o| wer nas [8 7Tio sre sere] srresere] 2 ET 0 TC EON NJ | io] setaesere] 0 ta CH OT 1 F517 | [sI eve Tw2 as | EJ 3 esis [gs | sano [0 100 io[517S5e2-w5s6s53.218| [vawesaor TW w tvs s sn ToToes] eenoosrT705 7172 --io[ eoe Ts sers25sssseaisze]r] [iaMworTwoT6993T9020] Zev FZavo est s: el| Taio eserTnTaio] 0 srr ser] io]sserseser| 2 0 1 0 1m [nsmworTry ETE 2 ei| Co7o T r 1m 1wsw E 0_ o setr s | `BRoeldda-ndTalkaelnicfsr-omapRpFrIoWxPi.mate ~ takenoffcross-section Pago2ol2 - 000515 Entssos MAHOOO4S2  Summary oTfaAbnlaely2t.i1cAal Results: DuPoCn-t8 WinasShuirnfagcteonWaWtoerrkSsaMmapilnesPlant Washington, WV I -- COAL sor -- I 1-- ---- -- -- 7-- t -- --] FFrLm ---- ose -- ] Ea T Z7um s -- -- SRS a oozn o --a ---- meme 7 ---- ------ T eRe e i e mr e e n or | OL.7 OLOW 7X o = estimated value (blow laboratory quantaton mit) 000516 | Eotsa01 MAHOO0453 Table 2.1B Summary of Analytical Results: C-8 in Groundwater DuPont Washington Works Main Plant WashingtoWnv, sme TomTeam = He eesTe ee zsTe a EE------ a ---- Tess |or] a or --2=Ton--s a 1 -- -- = = EE = E = a = = = = T ness--os oe a | Ime on =E 35 [nee 1 Z 7; Y S-- ea e |= Ea CE o -- e E = --e e -- 2958 Te; i B= i [e1 ssae es s| we amoTe 22 i femme fees Tp sme es 1 000517 -- -81n Groundwate`rSDuumPmoanrtyWoafsAhnTiaanlbgyltteoi2cns1W8RoerskusltMsacionn'Ptl)a:n, Washington, WV EE a EE-- rv-- r---- -- TT -- a ToT m a= m w=] -- 1 -- am-- --T-- ------ s-- S e----] |E [E[ se o a a m] t m mre TI e r ee o --e -- -- -- r ---- ---- e Hmsiene T E e e o 1-- -------------- wm rw-- Tae + -- E--e ------ Fee ra e aBeo S T a a ----r ---- o 1 e es -- g wm -- 7-- ---- -- -- ee i ese -- 1 e am-- --a -- I C1 o17e a -- -- ae Te I F reT e --ia n e ] TET r oeew w | Se m i ae --e --] -- rree ms ------] ---- EE e 1 oe--s T-- ea] r-- am om ---- . o Ee rem i ---- mem --T---------- [vee ie] 000518 _ Enisons MARO0O4SS, :81n Groundwater`SDuumPmoanrtyoWfasAnhTaialnbygltteioc2nal1W8RoerskusitMsa(icnonP'lta)n:t, WashingloWnV, eRe oT TESwT ---- -- am ow C E B eme-- s T w o -- e] ] E m --e morem -- -- e T r ie -- -- --I-- e ] -- -- mom mmsse we -- -- e r mee m7 T e i -- a T -- e a -- -------- sews TT[I wrmew-- T t| y Cr m ----semmerwsse T T em T r e es e n -- J BE=C5reoosoiwaebeoossetHoe-- Csrhhaoy-- s. iSHaO,nin) es ns ctomts ctctontos 000513 Eots084 MAH000456  Table 2.1C SuDrminmkiaonfgr/CTy-a8p AWnaatleytriScaalmpRleseuslts: DuPont WasWhaisnhgitnogtnoWno,rWksVMain Plant == == ES---- E m-- em T --r op YoTre -- ------ L TET=e= ewmm o eeCTr o --y F -- mee Tem --------o------] 000520 Einres08s MAHO00457 FIGURES ee---- 000521 ee ETON MAHO00458 EY ! : \ z-- AER \ aI X |: i Feo BBE {L.P :R\.E CoTen als nll es NT mim RS fo Ee Xb - SU 2 .. WRAeSHINGS TOlNraad~a~ LE Eo | vf yi. -WORKS - TI [5 eT MAINP ooLmA--NT fo NAT RET oon esgmmnvt \ [RER Sle, 0 roi SR. L fo e Trarn Sm SEopam no "I nao ; id 0 ON Lo eLoneer Sl Li A Bodg IN NA DE rE GE Sm Vir ~S To ; wre & Wik Ye LU BE SCT a clk. CAE NTs Ro * oS ye pm FET Ny arm& ~ ~ ey G, l it YER weeLa"ke FL, .i ~"e tm, HE Ses nro vrwe en reeso 17 etnCoben 05 omit Went Won [Eels] = er _-- . -- 000522 eotesosr MaAR000459 19 3gi A T 48J T gar7 E A a hY eE e OyaiC nANcE SGEEeT OT ReNTedSiT s#Ted 0Tp u | PS a a e HF Ae Re ReE tafo e Ri RR SCUAT eT ST S IEB -- ea AN Fs NY GeSB TP T am ie eSa TEn1 SU EaGE | vA al ora Br UST iii N TT he fas TosRE- N B(r Logie VE E NO INAEeSIS BNBRCNL S ATirVsNeS of F4 SBR EERMeSEr R TRE RTNTC aTE TeT ES O [FTE ANTTIN Ee [oon ISNPGE AEi CLEfe gUiS pE l SRo nS T ahyle geet iF: NTs AE a = a] Liia SoS Bi Ia LYWea l 1 Lg KT FoR ea ee= [5ASRLNAYERTed 4 yo | VE fon SEE re al 7) 2s; ake y WT 1siN Sr e,sfP7 R:E8FSELCEEE YL BN omwiE DontaeEfMiItwsNRS, AyE hs at oo pind. 7Je 7% BE scale a Coporats Remediation ro[c memowse | I in br Woshington, West Virgo 2400 0 2400" eB TE =m] _~ C oooszs cores JAn000460 FVEy4 A 77 a(lg7 a bial ooo | i i Srl I [ ki} Sod A 1h Ha l A eel fy Ii Ba |* all +` HidH]H nil J gl i| ha SNYe | 3 Thi AE lh i & FOS . L% Ha e LyPR i . hHii ! pak # i iiiyd ! B 000524 : v7 _ = EN 3 T smaliifp =X TT Ler |, 17 fp | a1] re me if HA + i | } | i -- - ! i of i Lal | 1 | -fJelli a ----Lo : elri ! NeLL Li RETRE iy bo fede 5Cli Wy, RNe SE | han E CaT ehE e A 1. [EY LAL i Hi | { 5. sill 000525 a 3 puisiocene ace ee =ufx CS] a Ss . EA aoe ug HE Lamina naninetigeti thw EVsguy ov o> teeth el k.isf VF RSNIFLfJ3e0S22a059s02hi000 oMotfPeda 0set0caamh4 3Bg IRE N 22a RoNCBe R: G ogreEon] i REET 5 Se R TRIBE a on "otoo Re olof2g | [A NN min BN TNR ewstto o:r gBhRiEa| ' NES Naren IN ree PEN252 HA prERfR EiE 0 e5 00 0n600 0a60a[02to0n8soTdTo3saR)d toffee [oe oe 5 [I GTONN ANYe o gEeb eR00EoilPa eSReHEH, Nf cl ~ANe ee tEareosdcggii LT Hi Tlie g i tl #4 Uf i fi 3 (yidsyo1l TD 1 tr (35 thi 1 w13i4 fitmyi!s 5 if 3gdi s IH EE :8 000526 - - - [---- EID168091 1H i i % FinFr i on]ear HHii Fa 1 oe stk erat iN or NeN eeielsh s t) mheee] jtpi I ol Lai He ETN iii NESE EN : NeE n5 d2l . NNGeos LEN : EAR i A Foo gy uf BET ih PEE bi o[f Bo ottb iniey iyyh SNAH : (iil oY Ra fr Bl : 000527 iloib iii A o3 VToTe erapas n ee a E N e Y [Eel ly 3 0\biome e1t0e00c0t00gpLolnm eesd nd 8 NG ih oiif Vo BERENS g Joes CRERRAIN 3 ETT Jose Sn BERN Ll [| ([23005030 oun BguydLieEs ope 5 4, sgo0s S80 Flee C4 Sesh BAIN ost llsd BHe eiasosseSn UE aml) BLHARRS 3e2t08S5e57ghZ eyN commer {IN N E > goedEdyn 2COANE 2 WN z e. | Nh pitt P= Pye EL RENR 2 SV} 5 | ry hf iHitH} i1334 . ii} 3 12 . 2300: nmeS ENRN 00 0 SM 05008 8 Cng199)fnoua 38 8 D8} a! 4 gl 13 808 ed 000528 allif 1 fl | Ohi vpeurisTTaorcaecNeEADceept [osmiam7asm 3 1 & =09%BOSH090 05R%E12Se0e5e0%) N No \rAnFoauitnsAN ENN 02too od Hh C0 Neermitben RN 2 Nee bE Ed ANE bok BoE 5 N EONWe ae s 0 0R8 oc%Boo dNNE 8iFON N eEe0E 0reeodLgieheE todN Bre LEN gRrEO S I oR RnN 0G g, D8h2A 8A ZN EN FEEF h 00e % 0e 02roua tf M252at RRNN E RESe55tBSneeop o gLraC%,o0ao7 d NG Ny 2228 090.00 NE z $008 Em EN 832 19:&%5ogAR" NRAR EINN RNN\d0o6.&i06.m000 ddq 4\g 5 gs 8 ff 3% (151 199) NOLYATIS 5g i i Broor | i ofhi i i iL|o || il) i E1ioH {15.3 oa ng 3: 43 3 in B06 8 000523 a a a --eo-- resone gu o e o Tor rm E3S EntAiRtiSEeL s.N bioh 1 Ee eagse rite id rerio |) E BoneBRAN Er acne oF 7 hettates SEE J $iHF [LPyoo 30l0il029d05g00"00d BBH l[Bnelephlem Fg es wo oe 2B Met et BE toe Ne fe|e aal gm B50 AN I Hs Purl8 ay "S3O00S8E0I0N0 if, Gshenkarin iy | LE Beato tN je ] I Ll bk | [ap | siiid | HH EaE R< NaEeEfSot GM C8i8In8i0N2oSE eNf lco. l --E\ON WNNN $Ss EVew5T6r2 0s000 gl HJii a B03 00 i T 2 RSRNl 80oe 2 L3f fu oa= f IA N P0:2oLo ANE | Onga:d 2 foGianE fos 2a ee (YS 199}) `NOUVATIZ t.i Te ang -_-- 000530 corasss sanooose? fHnH : ] B SENN i aEE2EN N |"i EA gy i " = hn i y FE NE [BEE L.C -ENN TNNN i IN = E aiN 1 SONNE | yi FI. S.A z i 2 it me iiii)f | S SyE 7iJ J+Y/1i7 d14A a iid } wlEE, i 4 wifi, fi ef Ji mlb ARie aAElA 1N8; R+ paqHi tfl L Alei n, | aE iKiEi I ml | || i ([FEEVERSrOy N i; RT Ted Xi i {J1ERd4 RnlA;hXrOiOseKle 2 ERR at WEREASENHN \ % SWE i NNSNC EY 002 ?N SHiik pi gil gi will saz 000. a ' 4i VID ; i) YY 1T3a](f 4 MA | 5 Id CSaE lI at 49 AER g a X.or i5i1l :i gilli | Li Alor | ils 173 iiE !ilml RL RY 5 Ua lel / 56 LET BU << i Fi = TURES Rg Sela r FSRAn 3aE Hiil PRR Hii - 2: " 1 000533 EID168098 " MAHO000470 - : AWWF iA i/ i 74 HBoRi 1 | [th aL 88 I h| e 2loasl114 AE PFSs f| A Shelf il Siieoan Asli ax LAN Te ToJn y PFYEAa RS GE E AN if Li aRHETameTllATTLTRSNS CR bii! fi re \, st Pugs TTR, 5 fio B CN Co | +e LETT Pra >& gin st g3k 800 000534 so 0) Lil [Ait = ra EY, 33 2 ig " 7 wi Gili i frBr Aais Lil I lad A CEE F178 LRN DoE i J A PN 5 lEe sl2} I fi 1 El EBEi Faeler] ;i ofi 343 TIT] i 1H No LER NS, Habel TEENS p BRR] | RE CEN HBL IAC, ON A 5, LBaEggil IAN GfRiAx2N . 4$i 3 A LN ET RON0Y iLEiELlE 4 Vo wPl EJT S,F \ 5 gqo HHH ai SA 000535 Tes ~ : sanEoIoD1o6a8r1020 [i EN Ts HBi y Ah2!pr5Yira 1Sis i FE le A HiaidlalLg ImM4 ELA [ a i TESA ia 7| A NEY i7 L UE ffa Su eK S RCEEoA S EAGNEN 4 N > LONE IN do Hi NE aS STII SB CRA ER aE _ Sd . hl i ohlilol 4 ' i : i i[CtH ' i [iF i i| 3! Ig 1] Hi 2 hie HH eeiet - 000536 even \An000473 9 000537 Ept6s102 MAHO000474 MainPlantand Lands 3.0 LOCAL LANDFILL Local Landfill h or m sm mo m tomato m rss E te eI rsee rir es m mL i m mm e ee ee @ I Tn I m meI eeT e e ee en ee ee e =e Compiatonobeloydnb zisJ 02 31 00538 saoncoosrnnss Nin lot oct Local Landfill 3.1 Introduction p"TehreimLeotcearl(LFaingdufriel3.i0s).locTahteedlainmdmfieldliaantedlpylaandtjaacreentlotcoattehde amlaoinngptlhaentOohfifotRhievseoruitnhern WViarsghiinniag.toAn,wWaetsert uVsiergainndiaw,ealplpsruorxviemyatieslcyusreevnetnlymibleeisngsocuotnhdwuecsttedoffoPrartkheerasrbeuargw,itWheisnta 1-mile radiusofthe landfill perimeter (Figure 3.1). T25h0e-aLcorcealsitLea.ndTfihlel cceolnlssiswtesorefotpherreaetseedpfarraotme 1c9l6o4setdoctehlelsmliodcdalteed1o9n80tsheunhdeearviWleyswtooded V0i0r7g6i5n3i8a./NaTthieonpalePoilluistacnutrrDeinstclhyaurngdeeErlgiomiinngatrieonnewSaylstaendm (isWeVxpNePcDteEdSt)o PbeeremfiftecNtoiv.e in `Jgarnouuanrdyw2a0t0e2r.moTnihteorpienrgm,it requires monthly surface water sampling and semi-annual MPaotweerrihalosusleanadsfihl.leAdppinrcolxuidmeadtseclryap14pr4otdouncsto,fswcarsatpemeptearl,yewaorowderpaelldeitsspaonseddbiinnst,haenldandfill. Powerhouse ash comprised abou 70 percentof the fotai waste. The specific sourceofC8haisnrhoitstyoerticbaelegnrodeutnedrwmaitneerd.anTdhseurcfealclse wwaetreercslaomsepdleasndcoclolevcetreeddfwriotmhoanp-psriotexilmoactaetiloynstwo feet of low permeability soil. sFaimguprlein3g.2posihntosw.s Tthheelcoeclaltsiohnaovfe tnhoe ctohmrepeaccetlelds,omrosnyinttohreitnigc wbeoltliso,manlidnesrsu.rfaHcoewweavteerr, a composedofreddish conductoifvaibotuyt brown clay and weathered 5 X 10" cm/sec (DuPont, shale 1990) having a very low hydraulic and ranges from 3.5 to 19.5 feet in thickness. 32 Environmental Setting 32.1 Geology `"TThhee sLloocpaelsLaapnpdfairltoibseiatuactoemdbiinnaathiiolnloy afrenaatwuriatlhrteolipeofgorfaapphpyrwoixtihmtaetrealcye3d0ou0tc4r0opfseeto.f mJaansdsfiilvlelsaatncadusst.oneThanedlsoiclaitsitoonnseoufntdweorlycirnosgsv-asreyctiinognasmdoeuvnetlsoopfedsofiolr tchoeveLroacanld Lmaannd-fmilaldea:re shown in and 3.48, Friegsuperceti3v.e3l.y.The two cross-sections, A-A' and B-B, are shown in Figures 3.4A TAhsehcallalyowcotnitgahtincslasyolmaeyemrisntoarrisnagndatygarnodusnidltsyuzrofnaecse,raanndgessofmreompetbhbrleees1a0.n2d5ffreaetgmtehinctks. of scaonmdpsatcotneed,inosftoemnedilsocpaltaiyoinns.g aTlhaemicnlaarysstarruecotfurleo(wDupPloasntti,cit1y99a0n)d. aUpnpdeearrltyoinbge twheellshallow bcleadyrloacykerisipsrweesaentthearteddepsthhaslerraannggiinnggffrroomm211010to3450 fefeetetbtehliockw.grBoeulnodwstuhrsfcceo.mpetent CWiorapgeiomn a08nmabe mE . - ; 000539 32 Etesios MAHO00476 MsiPintsnd Lots Local Landfill "cTahlecabreedoruoscskhaatlt,haenLdocgarlayL,agnrdeielnl, aconndsibsrtoswonf isnatnedrs-tboendeodefdtrheed PaenrdmviaarnicaogleorDcudnskaanrddy or c`Grroosusp-.secTthieonmsasxhiomwutmhatthtihceksnaensdssotftonheelDayuenrksadridpGgrenotulpy itnowthairsdrsetghieonnoirst5h.70Mfoesett.ofThteh.e sHaatnedrsatlloynedilsacyoenrtsinluoocuaste.d Tinwtohelautpepraelclypcoonrtitnouifotouhsensasntdrasttiognreaplhaiycerssecatrieonloacraelteedntiinctuhlearand Tower stratigraphic section. 3.22 Hydrology, Hydrogeology and Groundwater Flow Hydrology In general, infiltrationofprecipitation is limited due to the very low hydraulic conductivity (5 x 10cnvscc)ofthe surficial clays (where these clays exist) and the `weathered bedrock (DuPont, 1992). In addition, infiltrationofprecipitation into the cells oisftlhiemitceeldlsb.y Laepapcrhoaxtiemaftreolmyt2h-efeseotoutfhelroncweplelrmaenadbitlhieteyassotielrnancdelvefgleotwastifvreocmovteher sceaepppsinign the steep valley walls to leachate collection ponds, Pond I, 2 and 3 (Figure 3.2). wLehaecrheatitepfasrsoemstthhersoeupgohnsdtsoirsdmiwsacthearrOguetdfailnltonoa. p0i0p1eliinnetoatnhdecOohnivoeyRievdert.o tMhoenmiationripnlganotf `combined pond effluent conveyed in the pipeline is conducted at Outlet 101. Hydrogeology GzornoeuncdwoantesroiufnsdtehtrellyianygstahnedLoucnadlerLlaynidnfgilwleoschceurresdinbtewdroozcokneasn.dThhse adivsecroyntlionwuous upper hydraulic conductivity (DuPont, 1992). The lower zonc consistsof the continuous and discontinuous sandstone layers having low permeability of 1 x 10 cmsec. The sandstone layers are separated by laterallycontinuous shale layers. Well yiclds from the: suapnpdesrt(oannedltahyiecrksearr)eovfetrhyeltowwo, rlaatnegrailnlgy fcroonmti<n0u.o5usgspamndtsoto1.n5eglapymer(sDluoPcoantte,d i1n99t2h)e. loTwheer zone at clevations between 710-740 feet above Mean Sea Level (Figures 3.4A and 3.43) has been designated as the "underlying significant aquifer" and is currently monitored `semiannually as required by the permit RInic1h9a8r9d,seoing(htLmLoMnWit-o1ritnhgrwoeulglhs8w).erHeoiwnesvtaelrl,edfaitvetohfetLhoecsaelmLoanndiitiolrlwbeyllTset(rLaLTMeWc-h1, 2,- 3,5, and ~7) were closed in 1996 because hey were screened in the discontinuous shallow clays and underlying weathered bedrock. LLMW-8, 2 bedrock well, was closed iinnst1a9l9l7edbienca1u9s9e5iat nwdas19d9ry7., rTeswpeoctaidvdeiltyi.onaLlLbMedWr-o9ckwwaesllisn,stLaLllMedWa-s9aabnadck-g1r0wouenrdewell These wells are screened within the significant underlying aquifer. Table 3.0 summarizes the well construction data for the existing monitoring wells. Groundwater Flow e`lGervoautnidownactoenrteoluervamtaiponssfhoarvtehebesiegnnimfeiacasnutruenddseermliyianngnuaaqluliyfesrinhcaeve19b9e4e.n Gprreopuanrdewdatferorm pthriessednattamaaprseqfourir2e0d0b1ytthhreouWgVhN1P99D6EaSndPe1r99m4i.t NToh.e0g0r7o6u53n8d.watFeirgucroenslo3u.r5sAwtehrreough 3.5G CWirinogionmOF pudotmzeees mE 33 000540 etes1os MAH000477 sinPian arama Local Landfill transferred from the original maps submitted for the permit to the updated Local Landfill base map. iEnvsatlaulaltatiioonnoifnlfiomrimtaetdiognr)oiunnddiwcaatteesraeldeovwantwieonarddatvaerftoircatlegrcaldoiseendtwbeeltlwse(ebnastehde uopnpweerll `duinsdceornltyiinnugosuisgnwiaftiecranbteaaqruiinfegr.zonIen aadnddittihoenl,oCw-e8rpsraensdesnttoninetlhaeyeurnsdceornltyaiinngisniggntihfeicant aquifer provides further support for adownward vertical gradient. `fTrhoemgtrhoeunsoduwtahtetro cthoentnoourrthmatopwsarfdorstthheeupnladnetr.lyTihngessiagnndisfitcoannetsoaqfutihfeerusndheorwlytihnagt.flow is sHiogwneifviecra,ntgarqouuinfedrwaotuetrcrmoapyinatlhseo fvallolweydowwanllsslowpheerweitdhiisnchthaergferamcatuyreodccruorckassosfeetphse.valley wallsand ultimately enter the alluvial terrace deposit on the main plant. Groundwater cdiasncdhiasrcghianrggteodsoewepnswualrtdimtaotelleyacmhiagtreactoelsletcottihoen pploanndtstharnodupgihpaesn1u0mbtheeromfapiantphlwaanytsw.herIte it enters storm sewers and discharges fo the Ohio River. Groundwater also can seep to stmeamlalcesturnecaomnsfidnraeidnaiqnugitfheer pwrhoepreertpyutmoptihnegnoofrtohn-asnidtefalcotwiivnegwoellthfeieQludsatceonmtarroylsalluvial ogfrtohuendLwoactaelrLfalnodwf.illG,rioutnodwwaartdesrtfhleopwuimnptihnegalwleulvlisalloacqautifeedrn,eaadrjaacnedntpatroaltlheelvoaltlheey Owahlilos River. The pumpingof these well fields also lowers the groundwater level to below river pnstudamgpeW,iningidwuecmlilns.gissWudraiftsaecchreawfrargetodemrtfhertophmuOmthhpeiiornigRveiwrveleol.sflisowusiendtofotrhenoanl-lcuovnituamcttocwoaorldisngthpeurposes 3.3 Water Quality 33.1 SurfaceWater Quality Table 3.1A presents the historical C-8 concentration data available for surface water. Figure 3.2 shows the surface water sampling locations,ifthe location currently exists. `hSaavmeplbeesenfrcoomlltecwtoedouptefrailold,icfaolulryosuitnlcetes,19t9w4,o sCt-reamcso,ncaenndtroartieolnesaicnhattheesoautmfpallilsnganldocation outlets range from <0.2 uy 10 80 ug/l. Stream sample C- concentrations ranged from. 4.12 ug/l to 15 ug/l. The leachate sample, collected in the pipe fiom the leachate ponds, . had 2 concentrationof 31 ug/} (February 1994). For sample locations having more than two sampling events, the concentrationofC-8i decreasing with time although it is cdiofnfciecnutltrattoiaocncuatraOtuetllyetid1e0n1t,iflyotcraetneddsaitntsheamnpolrethsewaisttehrtnhpeolritmiiotnoedfdtahtea sseitd.e,ThhaeveC- decreased from 54 ug/l to 12 ug/l over the course of three sampling cvents. 3.3.2 Groundwater Quality Analysisof C-8 in groundwater has been conducted annually on a voluntary basis since 1996. Table 3.1B presents the data available for C-8 in Local Landfill monitoring wells. o GLrLoMuWn-d4w,a-te6r,waansd s-a9.mplLeLdMaWn-nu1a0llwyaisn s1a9m96p,leadndtw1i9c9e8inth1r9o9u8ghan2d001199f9o.r tThhreeelwiemliltsc,d CWoinmimogeonn0d8 aba me 4 000541 EID168106. MAHO000478 Nain ioandLatte Local Landfill ``maomnoiutnotroifngdwaetallmsaakreesloitcaditfefdicaultthtroeedesveepalroaptecorneceanstr(caetlilosn) cofotnhteoulramndafpisl.; tIhneraedfdoirtei,on, the annual data for the past four years is posted in Figures 3.6A through 3.6 but is not contoured. } C8 concentrations in LLMW-9and-10range from non-detectable to 0.22 ug/l. The outg/hleratndwofrweolmls1,.3L2L0MW15-4ug/alndre-s6p,echtaivveeltyh.e Ahligthheosutgchotnhceernetriastliiomnist,erdadnagtian,gthferodmata1.s4h1o0ws3.9 a distinct reduction in C-8 concentration over time for wells LLMW-4, -6, and -9. 3.4 Site Conceptual Model "The Local Landfl site conceptual model describes the potential exposure routes for current and future human and ecological receptors. Potential exposure routes were: evaluated and classified as complete or incomplete. Access to the Local Landfill i restricted by electronic and locked gates at the road entrances. However, a posted nature tral has been established on the east sideof the elannddifnilglnperaorpetrhtey.lanTdhfeiltlrsaiellelcotorpiscaallryouonpdertahteedcagsatteer.n Tpahret nofatthureeltaranidlfiislastmaartriknegdantrdail and docs not cross the cells. Access to the site from surrounding roads is possible but is discouraged due to the heavily wooded nature of the property and the hilly terrain. "The three cells at the Local Landfill are covered with a low permeability soil and o vegetative cover, "This cover prevents human ad ecologies HCeplors" sxposurs to the lHaonwdefivlelre,d mtahteesreiamlastearniadlstoctohueldoiplostepnottieanltliyalbleyeixmppoascetdedbybyexttheenslainvdefidlilgmgaitnegrioarlrso.oting in the soil by animals or unauthorized people. Therefore this pathway is considered to be potentially complete but minimal, An additional potentially complete exposure pathway exists fthe soil and vegetative cap iisnesrpoecdteedd bqyuaprrteecrilpyitfaotrioenv.idPeenrcmeiotfWcVr0ac0k7i6ng53or8crreoqsuiiornes(wthhaitchthceolualnddfailllloswursfuarcfeacweilwlabteer o1f0seunrtfearctehewastoelri)d.waPsetreCdoenpdoistiito)naGnd-1e6voifdetnhceeopefrsmeiti,liangsotforsmowlaitdewraesrotsi(ocnauisnisnpgecptoinodniinsg conducted annually. Therefor, this potentially complete pathway i considered to be minimal. dAottwhnewalarnddftilhlr,opurgehcitphietavteigoentaisteexdpseicltecdovteortaaknedoinnetoo fthtwcoellpsa.thsH.owTetvmeary, itnhfeilltorawte permeabilityofthe soil cover reduces the amountof inflration.Ifthe precipitation idnofwilntwraatredsst.he1stoimlacyovbeer,priet vweilnltepdosfsriobmlyfeunrtchoeurndtoerwnthwearladndmfiilglramtaiteornibalystahnedlwoiwll continue: pdeorwmnewaabrildi,tyitcslhaoyusladnednwceouanttheerretdhebesdarnodcskt.oneHsowaenvdesrh,aliefthlaiyserwsa.teGrromuignrdawtaetderfurftlhoewring through the sandstone layers that outcrop in the valley walls located above the plant site's o sToocuatthieonmofesdcgeepwsouatldsboemeexpplaocseesdoant tthhee spurrofpaecretyinhaseveepsb,eeifnseoebpseserxviesdt,.paTrthiecuelxairsltyetnhcoesaend mentioned ncar the leachate collection ponds. Muchofth site remains unexplored, CWoanmaiginodn0,s8o mom za mE 000547 3% Etestor MAH000479 Main lantsnd Logit Local Landfill tghreoruenfodrwea,tceormtpolseutrefaecvealwuaatteiro)niosfctuhriesnptoltyenntoiatlaveaxiploasbluer.e pathway (surface water (0 oAvneortlhaenrdpfolsoswibdloewmnisglroaptei.onIrnouthtiefsocrasperetchiepiwtaatteironwoisuldidrencottleoncwouanstseurrftahceefwllatmeartevriiaals at any point it time. This potential exposure pathway is considered incomplete. aConndtafuctturweithhugmraonunadnwdaetceorloigmipcaacltreedcebpytoCr-s8. iHsoawneovtehrer,pcootnetnatcitalwietxhpogsruoruenrdowuatteerfourncduerrrent vtihae slaenedpfsililsipsolsismiibtleed,inaltthheovuigchi,nictoynotfacPtownidth1,lenaecahrattehetshotuhthaesrrnemaocshetdcetlhle.gProonudnsd asurreface: ogpreounnadnwdataecrcefslsoibwliengtothlriomiutgehdtnhuemsbaendrsotfonDeuPlaoynetrsetmhpaltooyuetecsr.opAis tthaetevadllperyevwiaolulssly,located baebcoavuestehseepelpasntinittheissasroeuaathreernnoetdgeeviwdeonutl,ditbies alipkoeslsyitbhlaetcgornotuanctdwlaotcaetriofnl.owHsodwoewvnesrl,ope. tweirtrhaicne.thDeeftrearcmtiurneidngrotchkesoexfisttheencvealalnedy wlaolclastiaonnodfdsiesecphasrgoenstthoetphreompaeritnyphlaasntnoalllbuevieanl completed therefore, this potential exposure pathway cannot be fully evaluated. 35 Data Gaps "The following data gaps were identified forthe Local Landfill Identify the locationsofsecps in the valley walls anddetermine water quality o with respect to C-8 concentration. Q Determine the C- concentration in streams and other surface water bodies. Q Acquire additional geological data to refine the Site Conceptual Model. aInnsdtagllroauddnidtwiaotnearl qmuoanliittoyrdinagawells to provide additional groundwater low data Gdealtihneeartiaodnd.itonal C- concentration data from monitoring wels for plume Activities to fll th data gaps will be proposed and discussed in the work plan. 36 References DuPont.Wa1s9t9e0.&WGaesohliognigctaolnEWnogriknese1r9in9g0DPerpealritmmiennatr.y Hydrogeologic Assessment. Solid Wo1r9k9s2.ApVeerlif1i9c9a2t.ion(VIonlv.es1t)igation EI. DuPont de Nemours Co. Washinglon We inigion, OFT 000543 Emtes108. MAH000480 TABLES a 000534 ee Eptssios_MAHO000481 5% |nlel3[3) 5 ZgISIRK T8E[EFRREE g8< #355F8a5le5l1elSe]2l380) s 3 @ S:E5E5S2 S825583828s | | HzEE=3i8klapl s $s laf 5 RE 8 : : Senses Eotesto MAHO000482  Table 3.1A SCu8mmian rSyuroffaAcneaWlyattiecralSRaemspulletss: Local Landfill Washington, WV eF Fr ae e mOUToFAw LL 60% Tews15 | ema Tams [emnes 1306} Pe TT er [apne Tw 1 Tene Tn-- [Tens =m --es 1 [e 1 am --ee 5--1 s ] EE [sans 1730 7 anesTw ---- 71 Teese Tw = [ome emer pm 72 I am--"m-- [ao 1 ns 20 es LI = oe== : [eaneeTw re ==> STREAM 2 T mmaw} otosss sn  Table 3.1B `SummaryofAnalytical Results: C-8 in Groundwater Local Landfill Washington, WV a: == see [ey 1 me [Cem [on | eeo 14a -- or| wo |asmwnasemsT Ta s e| = -- [ones 1m EE E e== anise | = "0.1 wwe ees [oe [se | wi "e om e -- s 000547 FIGURES 0005438 ---- ee JE MAHO00485 oe I --_-- @.:.: Ll LE A v Co Qo Mi) J (Lp iR\.E Cot a A ord 5Na] Te i s3 B : ~No--1 ---- Purvi 10 1 co Lena TE Ai Ta, 207 aWeSTT Tl PROPERTY | Co Te LINE Brann, as |e o Ee FP aaEd.e JN -5 Ai Jt 0 REY X [Ei NED } CL sr EY # SJ WV AR x . . CO Ess of SN Local SOE See | "= <LANDFILL., s / % LANDFILLCELL ~~. fv. : a4 PERIMETERS EN ~ Sa A AR]Ly waking tTA ~|. 7oS EET am se, MR . oo qeoses corre @ 0 Baas UIE LeoSd EU Ae N, S rTlga h n Ve1g Dl Bd fe n LH peel LBA IO , FY J SOT ee fy = Cm Tey SE V A he 7ns me oT le Rn e I AMOR ET ne Ci = 7SO N (Ns S AREL oSZTeE S n AN P E d NLSR ThERy /7J SRSERITRe EEr RRl pr SCYAfBaHiE LatE Nhe] Aa i5 jE MUL A CN U T NAR TE C Nmhyv e 1 ges BTeST Foo = fo]i Fe A Cag AGL A foe o JAAN ESE REV AETeLn ET ENT on, NE a LA NE S I3RLeV Ic e | S Sa S T eo vCeearF lT EaT TBL ERA{RT7 UDiRy Sh V| YfVi arSERm,EB PUUrENN RYHD TZSST nagll peWnen seave Jo------ -= aewy TT & "IMILEpeRADIUS MAP. pm Vemingon we Veo TERE a 000550 eons { R T p Ie NEe a ey)AS SspyLYJRilt JE i pe FI YONA GE Hl a | Ir CNL FINAN TT ii {A IESR SO NNN Z EE a zL i hot. TN Wo SN ZN gi Md = Sy iit FoN e NT or N NNa T yGlidii (7 IE a eTR N NGAEmoEE N o;s \b LFn il BRNREESNi B BANL NCDyVi tofyrZEN 5 ole ih A LE I vie 5 Anny ERO gO NEHE BP idl ASE no 3 i NSAE els)ISbNL ases | i INVER ay Ses iy i OE i) AE J oi CNS fom - oozes ar i SN A= =o L3 Tg = 1 a INC omayS Awvay I ING RByL o/ P R e NR R S) AreA iny fal a NN NEN E FO Se Fn Cp TENN Te if ih y Ted! A iY i Sh Fong BA = =F Coe he AE EEN ay AE SON set pe AYES i SY 28 NN fo oq 3] | VNEATAETL el eeree2 4 8 | NEE ERY aye fii Z Lae : es be == r . AF TN 7 AEE) dg ! NGF: Ne i i | \i 137 cr WL Oe oy Nel OVA To Ee (1i ee - S INEHA = GSa aovssz antanoas | J fi dl all AAR 5 o VES THE Ch Lhrriiilirrrn 8 y iiiirr TN AINN ER k Wr 5 eo eTEpl rTe8 tTAEA eO5 Y A flEEe le t IH CB [ JH id NR NoOGRtAA e IANf erAreir 2 if ii 3 P 1 d iOhTR eAE N RWrT EW IN DNE A A E I e [ eHal (8dwBiE A LSee iT ardn ENO NEE e CAe eN]R8Titen SAN se Ll # fi E Sg ORE NN i=T 4Ve ie e Sy NET PG HER NEN EEE EREA Wp CENA dothem ERE AN TSE 5 ! \oV atraE \ is LlGa Arcot LIE N31 vii MONE (Ne J i i W\ CE U eRe N E hiA SEeA"Sh N g:l | |CA O\ LVTE T N jie 8| Nanste| HdiHH Io fp !| N R N RE e]R 7a4 a p= aN =dai btil SEEvss Lielli Cell T peNpeeT) Iaon eaIed E(N BET s JI INET LN fRy Lei 84 SN II 6D SONS = ey o i N ee A TN RIN EI ar ET:: EEE | ANN CSNINNR Zn ee) 3id pPALS R NNN e ee. 8ig 1H C EE RNN STTaeXX i LEAR We ToS > Ara NAAT OA I E TS INI WEm EN V ETy RRONpAN TEEES WET f VE e AT INGEN2CpyI 11d aE a i NERY) A = i Hf \ LEANT NR AEE V L2EhiRna 0 Ns iN A A388 Sst TA CE VHRNER AR ae [me Eg | NH IJ EEAURNaaIN 3 \ OR Sea| !Lo ACWN OECEAL ENN, BR eem T| TH: t UR 7; Jel | Ii Ny N ft = .luHit -- N 000556 EID168121 MAHO00493 rn CI fope, woag JET pileSCmT l INT Fre/tiBth y fp ANS ne Tl a NTN : C Yl R AN SONNSS Ian Ts [8iy HHA) CENEan| i HW se N AN N EON F Tae ldit i Paz 1 T- =) ZT i "AA {iv ga =< (i ws = 3 D | E e EARTNh VLE NN W YW;s Jo Go ke CS UA edb DASH ON Vi Pade A Ao VINE ETB NeHEE AON uN ; : { oA y E ERLe 0 i 3 OAASNEicBhUN AN N En E | SRA (7g Non Re Se Be if ; ENA meri - tL gC leaf] 000557 MAHO000494 g ISr=e)eINws )oedsf JEiE] dR CIN LR LePe BERli | oJ Re NNT i le: yy A WRNCa TR ER fi LLIhN S CEEN N= N= A | iihY pT ROMANS bo {res eT 0mr SZ PN gS NE ih ci i PE JE re oN GET I NSE AY ET aE RN NE WC CER Wa VL a= NS Gd CH I fe Sh VAR AT ha Lk ox Nex AE CAESNT2K = hebLgoi g oO FER goEk, 5 TE 3 CASTAER 5 WEE &f[eBl 4s NERA i24 \ Ri gROaltN ] LRpEee iil :! i ANO ASRR ! Nf Jeoes=hi| i]1h : EN SN eA li Heli GoTmmeTT [ C= ld 000558 coe MAHO000495 [ETAS mr Ag /i A ITTY =) Sas) BEE UN ARS | Ji JINR 3 HRS EIEN NNT ONONTA n (e log N W AL S,L0 S NI NNE E Esh | a 1Hf Cli, A L = ER AS RAGg 10 ] (RC == A ~~ (LL Gi HEE = \ sd ! WAL Lo LE LATION A SEY Hof A Ss gE PAE . AE = SE--~ Uy Re NATTA nis a eNe T Goo EEE Et VAN NS \NDeeYCiASJA NNLER M T N RLEN7E %e\dl T dyio iPd L(eMdO\CR at) BYeE Spe ii FORE fee i VN em i ; WWW Frei es k NI R A e= m=l} il reMBER -- Yc El J-- ) TEE Rg J Ea NE TT ASNyaeif fis Ei NA fe SNL TOR WANE ed } iEyUANA ACROON AARa SEes iThhA : Wi li ! ZN) CaN fd A Ea ANNE fH ed WFNS NaN, UHHH ( TI eE g C 07 N am y oN a = SE N AEN E ST No IF 1 NENG 1 Fah LEN aS nt] : 2 NNESEAS MTN ( TLCyERaOEERE, \ VINEE FB p ON OWEREAR A ariAR Le XAALTRCE VE || 3 LORE Re Ee i REE ERTT | |} i SATO Lk VON ames| ond mat cal FH oN i gLli WF = Hin i AEs Nh pu 000560 Too ly snno00457 hesA W ITINNo g Ea= ey S)EEI nmNyeiPRadgf efsi 8 V FIy L RER INA SRANI SA Z INT NU C7raee Tel FAN Z LIYN) N ORNS T 5 Ei]ns (SCEEI NZA | [i I pEEGeTTN aOR EZ Ae O SER EEm T Na 6 FON NaN | | VF 1 BEasE e SIIr SNa CAESaEENNAoINCTs pg VN ES) Ly EY AG ed NAR 2 DON es pe | CC eNdo T EA HETTRIBBED o3 t eEgR,55 ERR| NGF A 1 ||FAN LoCAmSNeET ) NEE= E ! CNG ds aL = ILNANGEW= e S A= o am m m= ee[i SbHd onsen 2 ------ Aa 7 iA [TA [%F \ f > AHR \; =5 4 . Th TR . z My I5L) {LE POye bh 5 | 3 3 i 58C Ssoi aNNY LJir= i 1 ws", ---- ! nm: ANN \ or 1 a) A \ Lrg fe NEE TE | iA a ee o Lye Pp (TA iJ < leg --% Lees /- gl i WEEE _d FN BP Foe :| 1 iA 7S TH CESA LARR N k {f: ES ori 4 FE CNB ee CL o = aff u ; . (12 - 1 Sw | heck 3 1 RNS I --- 000566 EID168131 MAHO00503 eimai `MainPlant andLandfils Letart Landfill 4.0 LETART LANDFILL EnvironmevsalSets... -- ------------ harris ws tl WS i meV en-, rots m isese oe mh I m eee eIE ions @ ID IE eee Fa e ----e--e --o--e a ee wma ln mtm-- ET Compton ofNeycumoa 2a 0 - -- 000567 3 snaonoson EID168132 ES MainPantandLandsils ee Letart Landfill @ 41 introduction wTWiheteshtiLneVatiarrg1ti-nmLiiaalned(frFialidlgiiuussrleforc4.oa0)t.medtAhjeuwslatatnnedofrirultslheopafenrtidhmeewtetelorlw(nsFuiorgfvuLereyetai4sr.1tb)e.iinnMgacsoomnplCeotuendtyfo,r the area oTWpaheserhalitannedgdftiaolnlndcWcoolvroeksrsesd.aupInptdrweoarxsiWmeianstotepleVyriar1tg7ii-noaincarfeSrsoolomifdtahWe2a0es5at-realycNra1et9pi6ao0rnscaetllo Po1of9l9ll5au.ntadnTothwDenielsadcndhbfriylglDeuwaPso.nt r`Emloaiuimnnitdnewanataitnocener.SmyosntietmorPienrgm,iotutNfoa.llWanVd 0su0r7f6a0c6e6w.atTehris.mopneirtmoirtirnegquainrdesenqguianrteeerrleyd cap ssFloyoiincgltauthrrieeeotsni4sec..n2btToshtuhetnoodwlmeasrnldtitfhniheelerlsll.awannaddHfsfoiilcwllolenevmsxeatttrree,nurtcia,taeolhdryiidwserincottohagmtieinpoolonaos,gnetiadotepuoerofavghlarilargupahahvtlyii,ynoenpalnaiandnsddtmii`occhnaaltiseatndoyortiahcnnaotgdmtwpshefaeltclntaetduroarl pfeeertm,eaavbeirlaigtiyongfaabboouutt10f7ecetmiinstehcic(kDnuePssant, 1993). The sol thickness ranges having a fro4m to 14. @ onevede iobeesuc os C-nheis pmLlieatsnactretltlhLaaatnnedcfooiunlsslitsrrteaescdhe.ipvrAeidpmpawrraioslxtyioemfwastacesrlfayrp5o,pm0ro0td0hu,ec0Ft0,l0uspocorruoanppodmlseoytmfaelr,wamwsaotnoeudfpaepcratlyuleeratisrnagwnepdrreobcidneisss,spaoatnsedtdhe in the landfill. This waste is believed tobe the sourceofC-8 in the Historical sTehoesyLmetthaerttiLcanadnfdilsloiwlacsappe(rDmuaPnoenntt,l2y0c0l1)o.sedIbncyluindsetdalilninhgeancleonsguirneeaecrteivditmiuelstwioleaysetrhe cihnastianl-llaitnikonfoencfaingl.eacThhateeccaopllceocntsitornuscytsitoenmw,aesrocsoimopnlaentdeddrianiAnpagre] c2o0n0tr1ol measures and 4.2 Environmental Setting 4.2.1 Geology TV-hsehaLepteadrtvaLllaeyns.dRsesisdiutuaaltesdoiloncovehresavmiolystdilsasnedcftield aprleaast.eIaungceonnseirsatli,ngthoefsseovileraat lthseeseipte has been described as residual in nature, consisting primarily athmeawxeaitmhuerminthgoicfkbneesdsroocfk2.0.A5tfmeeo.st landfill areas, the soil is of heavy less than clays derived ten feet thick, from with The underlying bedrock at the Letart Landfill consistsofiner-bedded red and variolored ifsDenauetnFr.dikgyTauhrordere Gcl4aro3lco.cautapirT.ochnooeuTfshtewsthowmalocaer,xcorsiaosnms-sdus-emsgcertctaityhoi,inocsgnoksrnf,eeesAnts-,oheAaf"untndahdenbedrrDlouBywn-inBkn"ags,ragdcncrdoGoslrstosooginuynepgoafirtnchetsthhhleiasonPwdrefneirglmilioaanrnefsasg5he7o0wn - 4.4A and 44. on Figures EVEinton 5 -- _ 000568 Enis MAHO00505 MeaoiPiaowaLrdcstttwss LetLaetratrLtaLnanddffiillll o Gbeeaorlionggiczoinnevsestthiagtatwieornes dceosnidguncatteedd aatstZhoenLeetAartthLraondufgihllZoindeentFi,fiweidthsiZxosnteraAtigbreaipnhigctwhaeter- sfihnaellgorwaeisntedzocnryestaanldliZnoenseanFdstthoendeewepietsht.occTahseisoenazlosnheaslecolnesnissets.ofZmoansessivAe,tvherroyugfhinFe taore tsheipcakrnaetsesd. bZyolnoecsalAlytchornotuignhuoDu/sEshaarleeudnisictosnttihntuoaurse.geZnoenrealFliystetnhefefeitrsorlagtreeraatlelry in caonndtailnuoonugsthzeonOehiuondReirvetrhenelaanrdftilhle. soZuotnheesrnAe,nCdo, fD/tEhealnadndFfilolu.tcrop on the valley sides 4.22 Hydrology, Hydrogeology and Groundwater Flow Hydrology `lTahnedfLieltlaerdtmaLtaenrdifaillsl.enPgrienceipeirteadticoanpfsalylsitnegmopnrtehveenctnsgisnucrefraceed wcaatpesryfsrtoemm ctoankteascotnineogftwo piamtphesr.meItamblaeygienfoimltermatberdaonwenawnadrtdhtehnrfoluogwh ltahteeravlelygetdaotwendsslooilpeanodne0ncpooufnttehrethe vgeegoemteamtbivreanlea.yerAdloiwenmsaltoipveel.y,Inpreeictihpeirtsaittiuoantmioan,ytfhlisowsuvrifaacoevewraltaenrddfolcoswnoont tcoonpotafctthte.he aldanjdafcielnltedtomattheerciaalpssaynstdemm.igrParteecsipdiotawtnisolnofpaelltiongwaorndsthdernaoirntahgweedsittcshiedse cooftnhsteruucptpeedr pinarotr of tdhietcchatphaftlofwlsowdsotwonaslsoepdeimteonwtartrdasptnhearsoLutMhWw-es6t., aPwraecyipfirtoamtitohnefallalnidnfgiolnitnhtoe aredmraaiinniangge,. o portionsofthe cap flow downslope and towards the south in drainage ditches. Hydrogeology CH,ydDr/aEulaincdcoFn)doufcttihveitbyetdersotcikngzfio. nessilnudgictaesttess(tZhoantehAes)eaznodnebsordeihsoplleaypalcokwehryfdersatusl(iZcones croanndguicntgivfirtoym(1Te0tracmT/escehc Rtioclheasrsdtshoann, 110990)c.miZseocn.e(AThheyrderaaruelincocwoenldlusctmiovniittyoirsinlogwZ,one rBa,ntghienrgefforreo,m it10wascmn/ostectesttoedl.e) sZtohnaens1C0annsdeFch.avZeonveerDyIlEowhyhdyrdarualuilciccocnodnudcutcitviivtiiteisesare also very low and range from 10" cm/sec to 10% emjsec. ZViorngeinFiahaSsolbiedeWnadsetseigMnaanteadgethmee"nutndReergluyliantgiosnisgnbiefcicaaunsteaiqtuisifelrat"eraaslldyefcionnetdinbuyoutso tuhnedeWrest tTahnedfllaln.diilMlosantdciusrrtehnotugghrtoutnodbweathyedrrmaoulniictaolrliyncgoinsnceocntdeudcttoedthienOZhoinoeRFi.ver southofthe : wTahteerl-obweahryidnrgauulniics.conIdnuacdtdiivtiitoyn,camnanbeyastarnidbsuttoendetuonitthse ivnertyhefrineeg-igornaitnyepidcnaalltyurdeiospflatyh.e effilfleecdtiivnebpyoraoustihtiygeansiclomwinaesra1lpser(cee.ngt,.kaTohliinsitleo)wspoomreotsiitmyeraefstuelrtsorfirgoimnaplosreedsipmaecnet being deposition. tZhoenseoFutghrwoeustndawnadtefrroamvetrhaegenolritnheatrovtehleocsiotuitehsewasetre(DcuaPlocnulta,te2d00f0o)r.flTohwesferovmaltuheesnaorreth to rzeolnaetiivnedliyclatoew,th0a.t01graonudnd0w.a0t0e3rff/ldoawybreenspeeactthivtehley.lanTdhfiellloswvveerlyocsiltoiwe,s actatlrciubluattaebdleintothteheF CoWamrpiwsgoonno08vesabe ma 43 - 000569 EID168134 MAHO00506 veresieets Main PlanadLanncft ils LoLtetaarrttLLaandnfdilml ry low hydraulic conductivity presen nth F zone and al th overlying nits as wel, Low vertical hydraulic conductivities in the overlying shallow zones limit infiltration and recharge down to the F zone. `The saturated thickness ofZone Franges from 22 feet in the upgradient well (LMW-24) mtoabneytiwnesetnan2ceasn,dth8efmeoetniitnofriivnegdowewlnlgsraatditehentlwaelnlds (cLanMnWo-tSbAe,sa-6m,p-l9e,d-u10r,an4d8~h1o1)r.s I(nor slcorngeeern)natfrtveralp.urging, when a sufficient quantityof groundwater has recovered in the well `ThGirroteuenndmwoartietrorFilngowwells have been installed at the Letat Land in the Zone A, C, DLIMEW,-a1n0d2FsnadndLsMtWo-n1e1u,nitwser(TeetirnasiTaelcedh iRnicOheatrbdseorn,301091891;0 1p9r9o0v)i.deTawtodoifiotnhsesdeotwselflse,m 2Z0onnce aFndtoptrhoevindoersthwealnldcsoonuttrhuocftitohne liannfdofirlmla.tioTna.bleWa4t.0erlilsetsvetlhemewaelslus.remmoennittosrainng each calculated groundwater elevations have been measured quarterly. Figures 4.5A through 4tfo.or5tFhtehperupopevdriamdtieet.davLaTeirtlaiarsbtldeLataaannnwduaaisl rbgaarssoefuenmrdorw,cadtefrieolmevtahtioorngcionnatloumrap`msapesufbomriZtodnefFor haserpeequrimrietd TrelheenvaltsoicoantdsieomtneearamsniudnraloitdmiioitnneodtfhnegumrmoobnueinrtdoowrfaitmneogrnwiletlowrsidniingrdeiwccetalitloesnaswdiwtoihwtihmniwnZaotrhndeesseveAzr,otinCceasl.angdrHaoDdwiIeeEnvterw,ithin ctheentsirtoefgtrhoeunldawnadftielrl snyastneomr.th-WsioluitnhdZiroencetioFn,.a gGrroouunnddwwaatteerrdiavsitdeofehxiestsdicvaiddeerltohews rssthowoeuttumhoaensandstdtenstooroutwtlahhwroeedwrsst.mtinohenZGiOarthnooieruoinFndRgiwivawetehrel.srl iGiaernrvodeauitncidaowtneaadstaestri,wgeihsntccloofumdtiphnoegnehdnievtiondefewofllryoiwiwsnactirotwdeadrdLsAtWhe-11, Rsiinnyadsptitiecesdampcdoisenncstre2he0aatt0os1aetsniheniwndiintchesaeqatuleoiabtltshiiaebotrrnvgiueormdfotsvuhtonaeltdeeuanmftgoeiorenfgefrweloraouetwndeudranwdapdetiressrcytshhftaeelrmogA.winGhgIanTsfranod1odmibtytihieoenn.lbgee(arehcnerhaaretteedayucccohstleeliddeoucncteidon eCvoanltuiantueeldomnogn-tietromricnhgoanfgegsroiunngdrvowsutnedrwaelteevratfiloonwsroefsZuolnicngs(ArotmhrcoluogshurFeiss eretqusire 10, 4.3 Water Quality 4.3.1 Surface Water Quality TUVhpoilpsuenrdtaaatnradyissLuporrwfeaescerenptwoeandtdeisrn,sTnaaombpllloinengge4.r1f4.eorxiTCth-.e8 Dthuwsroiblneogcecatopioennrsfcosirammrepdcleopidefrotmihoonedsitecnaeglqilunycssenirtnelctye,c1o9tp9e1, o scyxsctaevma,ictdheasnedppolnadcsedweinrelodwewaarteesroefdtnhedlatnhdefisleldpirmieonrts uhnedermlaytianlgitthoenpoonfhde wceerpe Currently, only two surface water locations still exist (due to landfill cap construction) Sn te Complain tMhottoeryyddaotaarOrka 22 cJmaneaz2 a34 _-- 00057 eoesiss 0 MAHO000507 Meiaess `MainPlant and Landfils LeLteatrarttiLaannddffilill `and are being sampled. These locations include the leachate from the landfill [location o 002(leachatc basin)] and the stream located slightly eastofthe property line along Rt. 33, `The locationsofthese surface water-sampling points are shown in Figure 4.2. 4.3.2 Groundwater Quality - GforroCun8dwpaetreiordifcraolmlytsheinmcoeni1t9o9r1.ingHowweelvlerh,assaalmspolibnegendivdolnuonttatraikleypslaamcpeloend aanndanannuaallyzed `aabvdaadsiielsdaubntltoeiltfhoe1r9pC9e-6r8mainftrdoaqsmu2ammrotoneniritltoyorsiranimgnpgwleiplanlrgsabmaeettgetarhn.e tLheTetaabsrletecLoa4n.ndd1fhBiapllrlf.eosTfehne1t9sl9ia9ml,litwheihdsetdonartiCac-as8lotawnmaaaslkyseiss ccoonnttoouurreidn.g tFhiguvraelsue4s.d6iAfftihcruoltugthhe4re6foDrep,retsheenvtatlhuecsCw-erceonpcoesntetdatoinonmavaplsueasnfdo noJtuly 2001, January 2000, July 1999, and November 1991, respectively. caAopnnpceieannrittsiratalhtaeitxoantmhtiernceanotdniscoe(nnTotarfbaltteihoe4n.gs1rBm)oe.uansdFuworaretwdeerilndla1t9ha9ad1voiewnsegrndeoatttahsehfilooowwmeast1n.9y9o1Fbrtvhioromouus1g9oh9v1e2,r0a0tl1hle, it concentrations in all wells increased. Currently, concentrations are now `decreasing again cipnoemrtpfhloeirmcmoatsthetedraebncyaelntythssesafmabptelthiwanelgeetnvher1ne9tes9.1diafHnfordwee2n0vt0ea1rn.,alIiyndtieacndatdliiftlyisiobnngo,rtatrhteeoenrdifss ihfn atvehoeeftbdteahsteean iicsnosnttarlalcattieodn to onoftthbeeeonbgsienrevearbeldecianpthsysltimeimte(dprreevceennttidnagtafurther surface water inflation) may or may Fanoarlytthiecamlosptrorceecdeunrtess,amapnlditnhgeeavneanltytaincdalainnasltyrsuimse(nOtcattoiboneru2se0d01w,ertehemosdaimfpileidngaangdain cbfooerntacelerlntafrcuacttuuirroeancasyniainlnygstrihoseuoCnf-dgw8raoatuneanrldywitsiacrtaeelqruriessrauelmdtpstl.oesaTcfhcoeursrCeat+me.oldyCiefovinaelidunaputreeodhceemdoulnroientsgo-rwtiielnlrgombfefrCaetn8ldisziend `oundwater quay, ulIFiitmiatealsysummiegdaltchsat 0impthaectOehdiogrRoiuvnedr,wattheerCl-o8whsistforroimcaZlomneeanA fdoorwLnMwWar-dSBto(ZToaneblFean4d.1B) cfiavnerb.eTuhseedfaollloonwgiwngitasthsumpesttiiomnastwedergeromuanddewaitnetrifslucxalctoulcaatliconu.late the C-8 loading to he O Tgrhoeusnadtwuartaetredetlheviactkinoenssmiesa2s5urfeamtenLtMaWn-dSBth.ereTfhories,iisshaigchoenrsetrhvaantitvhee mvaolsuet.recent - @ Tgehoelolgeincgtchroofstsh-seecatqiuoinfser discharging to the Ohio River is 1000 ft based on the Q The historical mean value of855 ug/l for LMW-SB, adowngradient wel, TrleihnpeeraevrseevlneotlcsoicttiyhteioefcsognfrocoreuntntdrhwaFetaitzoenoroniefnaCtrh-ee8caailnqcutuhileafteaieqrdui10f0.e0rb1.ef0i.d0a1y.dGaroyunfdrwoamttehreanvoerrtahgteo the southwest and 0.003 fUday from the north to the southeast (DuPont, 2000). o Using these assumptions, the calculation for loading to the Ohio River is shown below: CVoimnmotn88 ym es 3 } 00057) Enotes MA000508 E [H-- EBSEEEEEEESE--------Le--tartELandn fill o A=Area=1000ft length x 25 ftsaturatedthicknessforZone F = 25,000 fi! V = Velocity = 0,01 Uday (estimated) Q=flux=AxV=(25,000 f)x (0.01 fdayx) (7.48 gal') x (365 day/yr.) = 682,550 galiyr Me=s(8s55 ug/l x (12/x1(10kg/10u00g)x)1 10/2.205 ke) x(4.785 gal) = 147610" Ibigal x 682,550 galiyr = 1x10" bly sEhsotuilmdatreedsualntniunaal vleoraydilnogwtoC-th8ecOohncieontRriavteironisivnetrhyelOohwiobaRsievdero.n Tthheeclaolcwulcaatlecdulmaatesdsmaansds oisbsreearsvoendabinlethgeiFveznotnh.e low hydraulic conductivitaineds low average linear velocities 4.4 Site Conceptual Model c`TuhrereLnettaarntdLfautnurdeihusimteacnonacnedpetcuoallogmiocdaellredceespclroirsb.es Ptohteepnottieanltieaxlpoesxuproesurroeutreosutweesrefor evaluated and classified as complete or incomplete. TenhgeinLeeetraretd Lcaanpdfsiylsltecmlo.suTrheewaensgcinoemeprleedtecdapinsyApsriiclm2p0r0e1vewnittshhtuhmeainnsatanldlacteioolnoogficaanl contact with the landfilled material. Contact with landfilled materials would only be pbinoysstseaixltblelenedsiiffvetenh,ceivncigagporerssotyurssitcdtesimgawgceicnregsesbtyboybaneuinmiaanulttseh.notiroHinzoaewldelyviebnrdri,evadicdehuneasdlesbvayengwdeotaranktieimroanslsao.rndtTrhaeepsrpperaofsporerireas,toerly dpiartehcwtaye.xposure to landfilled materialsi a potentially complete but very limited cxposurc Esstyxosprtomesmurrudenrooaffifnliaasgnedaflcisolonlaterdoplomtsaetwneetririaaelldhbeuesmciaagunnseedaonftdoeecrcooonslvioeogyincotafhletehrxeupnoeosnfugfrifenrepoeamrtehtdwhaecyal.pansdHfyioslwtleecvmaedpru,teoct1aop dceaspi.gnIantaeddddiitsiconh,artghee lpaonidnftilalncdaptoiselriemqiuniarteed tthoebpeotiennstpieacltefodrartulneoafstf-qrulaartteedrleyro(spieornmiotfthe PrreeqvueinrteimoenntPlCa.n1.2.TAh)erfeofroerev,idtehniscepooftenetrioaslioenxpaosspuarretpofatthhewsatieysSatsoorma WpaotteenrtiPaollllyution complete but minimal exposure pathway. TclaahnpedfsLiyelstltaerdetmmaLatanenrddifaiilslsld.iesnScguhiranfreageceredewdaacttaehpre smsyiosgutrtahetemerpnsrteeodvwegnaetrosdftsshudrrefaailcanenadgfwiealltd.eirtcBfherecosamcuoscnoesntttrhaiucscttiseundrgfaicnet.he `wcaotnetarctdoweisthnotthicsosnutrafcatctehewaltaenrdfiisllaendimnactoemripallest,eitexisponsoturiemppaatchtweadyb.y C-8. Therefore, `thGirsouinmdpwaactteerd cgornotuancdtwiangtetrheprleasnednftilslaedpmoastseirbilaelhhuamsabneeanndimepcaolcotgeidcablyeCx-p8o.suCroentpaactthwwaiyh pdruieortotogrthoeunidnswtaatlleartifolnoowfptahteteemns.ginGereoreudndcwapa,tesurrfflaocwe uwantdeerr itmhepilnagndifnigllohnasthsehloanwdnfiltlhat CoVmimpntgoionn s2hetoyaan bona wmv 5 000572 Enter MAHO00509 MawionnPlranwtwanidLbaentdisss LeLaetratrtlLaannddfimlln @ ovina he cued rock orb vay hen a 1 `migrated downward through the landfill material. These waters continued to flow as o groundwater downward towards Zone F where it then flowed laterally to the west and south. Currently, the engineered cap prevents surface water from contacting the landfilled `materials may still caolntthaocutgthhegrloaundnfdiwlaltedermamtiegrriaatlsi.n g laterally and Groundwater vertically under the underneath engincered the cap landfill migrates to the leachate collection is piped to an outfall (002(achate system. basin)] Discharge from where it enters a the leachate collection system small, shallow, wet weather stream that flows with leachate is a approximately 400 feet beforeitdischarges to the Ohio potential pathway exposure route for current and future River. human Contact and erecsotlroigcitceadlarcecceepstootrhs, aca however, this pathway is considered complete but limited due to the `ZGornoeusndDwIaEtearndflFowoicncgurfraomcltehvesaeioznsolnoweoertthehasnoutthhe ldeiascchhaatregecsoltolcthteonOhsiyostReimv,er, `Contact with this water is limited 10 the areas where these zones may outcrop on the valley walls. However, in general, groundwater flows downslope within the shallowsoil, scuorlflaucveiiufms,eeapnds ferxiasctt.ureCdurrroecnktsloyf,tthheerevailslneoy wdaaltlasavaanidlawboluelodnotnhleyebxeisetxepncoeseodr at the location of seeps on the slopes adjacent to the landfill or along the Ohio River. Therefore, evaluation orfetschpitsorpsotiesntnioalppsastihwsaeyaetxhpiossutriemeroute for current and future human andecological iGrnoaungdewastyesrtetmhastnfldow0s tuolitmheatweelsytmfigormatZeo0netFheisOhkieolRitvoerd.iscAghaairng,egfroonuenadrvbiynvearllleoyws pltohoteceansttuiiroafnolacpfeasiftesheewpeaspyisnexetxphioests.aulrlCecuryosrutrseoyfuot,h ctohfuterrheeenitslaanndnofdidllaf.tua aTrvhaehirlueamfboalern,oaenvtdahleucaeotxliioosgntieconafclehrioescreptors s not possible at tis time. 45 Data Gaps "he following da gaps wer identified fr the Letar Land: cwoIandlcelenniltforyanttgihoetnhleocOahtiioonsRoifvesre,eapnsdndettheermvailnleeywawtaelrlq,upaalrittiycwuliatrhlyreisnptehce tsoteCp.8valley . 2 Determine the CS concentration in the Ohio River. 3 Detemine the C-8 concentration i streams and other surfacewaterbodies. Q 9 Acquire additional geolog sInrsotualndaadtdietrioqnuaallimtoyrdittso.r iwcealllsdattoaptroorveifidncadtdhietSointaelCgornocuenpdtvuialteMroldeolw. data and dGealtihneeartiaoin.ional C-8 concentration data fom monitoring wels for plume o Activities to il the data gaps will be proposedanddiscussed in the work plan. Siren 58 I 0090. 00573 EID168138. AHO00510 MteannPPteaatngtLneontiss LeLfeatratrtlaLanndffiill @ 6 References DuPont.Rem19e9d3i.atLieotnarGtrLoaunpd.fill Hydrogeologic Evaluation, July 1993. Corporate WY2000007.60L6e6t,arJtaLnaunadrjyi7l,2G0r0o0u.ndCwoartpeorraPtreotReecmtieodniaPtliaonnSGWrIouNpP.DES Permit No. Co2r0p0o1r.ateCeRrteimfeidciaatitoinonReGproorutpL.etart Landfill Cap Construction, June 2001. Tetra Tech Richardson. 1989. Monitoring Well Installation Program, October 1989. `Re1p9o9r0t,. AMuognuisttor1i9n90g.Well Installation Program at Letart Landfill ~ Summary CViomomgiioon,nOdFoywRDAZEE nT 000574 3 ED168133 MAHO000511 TABLES 000575 EE -- AR000S12 3% [3sl8l-[al=lelzlalw]s) 2sRRREERE EE HE &{8l=lal] 3121315] 3} ug BREREEENEEERE % 588 i=l! z weg S13] @ 3% [ad LEl lle $055 | REEpiERERRErEEy F283 3 2 13(3[8]5 [=z (38 855) = a LL 1 LEE] 000578 . Entssrer MAHO00513 o Table 4.1A SCu-m8minarSyuroffacAneaWlyattiecralSRaemspulletss: Letart Landfill Letart, WV E Ea a ------ m --a -- Ye r-- ---- TERE [ e77ew e -- ege ia-- ----s ---- OER [msmemsoser [io I -- -- --TToziiesese-- s 2i02000 mre i r 1500 a ---- oo o ZSee sar nae ee | PRR FLOW RTS [ oemre oso mao [ mecror m Bm es -- TREATS [ EFirs:m -- e--e S TPPERFOND s mpesss e m ormies e aZowewnr Snsriorss oaoo --] Somtiosenres Tfe o Sao 70 . 000577 Eotssie2 MAHO00514 Table 4.1B `Summaryof Analytical Results: C-8 in Groundwater Letart Landfill Letart, WV TsWmAe aie Teme cay E E E s H H s E H e = = LeHS=a e e e = e = = [sare Te E I 77 T _-- E= =e=== = 300uy] 3020 * E H Saae= e = e = [ Vignr e TT 0 e| = e e ow r e --eswr Cows TT ome os E Sm e E e = m a eT = aa g ag = e] m wee I ee 000578 Table 4.18 Summaryof Analytical Results (Con't): C-8 in Groundwater Letart Landfill Letart, WV taeTe sme TT beeTem [ametTw TeEa e e S ES -- TI -- -- TT -- E =a = --to 1 arm 0600o001 [meee Tie 1 L E = a e H EF==--B--=e =e a anogoot I ae | = 2160 fame TTT [nseemsTai foe ae -- s [eam omes [a[ nimg esT a TTom m 00 er | wvearom TaT ~ 000579 EID168144  Table 4.18 Summary of Analytical Results: C-8 in Groundwater Letart Landfill Letart, WV Ee S ma m [e vm eTa ------] He [es Ea [names o = E E E m H e e H t ==a =--e a e e a e e = TAWss 7 -- [go de o |--_T200ticup|) ao I e ea ) 1 [avre s s| [7ronses Ear 530 IEeaIe==: = os [Seno eee 5------ or] Sng Tae = E E = e e - | BEE = ee e |sowien1 ew | CC ee eens Top 1 = -- 000580 EID168145 Table 4.1B Summary of Analytical Results (Con't): C-8 in Groundwater Letart Landfill Letart, WW = [e Siew The eeTa ee y [s 1asi e n FF = Some awa 1i mDaatee------ c ----h se-- e ----m ---- e ri y s| [eI v merr --riaio-- ----1 -- o [ass momoorTp a 1a04n720e00-- m [g ama n]1 mwems eemy I 7 7-- -- -- = -- -- -- 7 -- --1 ee I eazon TT ow0 I amoo00 To T e} * T [w o -- m we-- e| [mone TT ie [s1 owi are os| EE 22a00 7] - 000531 ~ Enissten MARO00518 FIGURES -- 000582 ems MAHO000515 eee - ' oy Fura - "ary > LETART LANAcDcFesIsLnoLsy - PERIMETER : | wo :- F v \. ga] Sl Ve el . CF & nT mN a | ome we Sel PT Ne Joo TAO . ne ~ i 52 s wotoo23k) g iNE ed en sone LE NH FeiC d FE E PE J < f=) Ns 3 CEA -i - 5' * on , NO5 NNwE fa Noa RN NN rg NE 3 % : LEN He re - co i scale 200e 0 3d2000 fone mn om sna 19 se aw & Corporate Remediation Group : rE Letort, WY. pny, [Eoe e l --- - OWES cosas 1n000520 -- = |8 & # ao ANDFILL ee ~ : Twbmile ----TeEy - & 7 y - CH ~ ar Jisetl) fe LETART LANDFILL: ---- / accesspodgh | N\A "ga .. ; SC J 7J 2 ol To .| A otDob SL l ET PA4 pe 2 Ne EVA 7i eX TINK jo Coa ! Nd and ES , . | o 0 , LEE / / 25 fury oF Mud un J ES / Lt i # COINS oOTN he LT a Les eng SL 5 te ee SNe - i wok lh NE ih etar van AA tes e wr N >, N p= SEs Pali Con en . Pe S 2 SCALE ri, ac ta nt en wna PTo ERS `Corporate Remediation Group rr Letort Landfill Site F= m tr ea tent, WouT t. Viegivlr a 200ESE eoissies MANO000521, " eo N= NN 9S SEL wo PN A ey Ses S 7 AN a CEA aa =N \J ) = / = BL A|,FkR= OGx A = 5 RY \ N = Nie T NS 7 VA 4 wh = ro J yi In Wkp> 000536 g . : i% i IF i aly Uy ar rie il Lafe Eaf Ll f| LL e i ol, Hbli: Ts 8wl . oF : :< . A] l Se aHEE:L MR ts 3 8 3 3 |B3gf (JT) Re484 1 Hr i E 0 8 Y] R =Nm|| #11 5g EI S = E 8 | I 3 AGONE iE)E LH| EE EEA sitde EH gdgpe HI I EAi ElEl fi i] anion. ATEN gBhE pe egline | EaEg 82 82. af aad 5 LI I [IE] HEN IEER Bi FE cs var ii : ; 0005s coum \nno00525 a NC fll L~ 9E \ | y0 = Sp | F| ERLE\Y8 H /L3 /yy IPS JA AS \ LN } = i EN == SWZA XNA NS"\EA " \ \ flo /9 A ) \ iv / TE) 1 |S { 3 5S Pr < 2 I| NOT IN SV NL --= (l= VvARS l SS ) SI[7 a (FAY ia Ne 7 ANN "aN Se Wi BAN oN W Ng! So ae mm Fete -- 000590 oan ETT ede --h N N WA WT ) (0 ( AFFS= c A= f )o 1p -0A80 N NN"OWW e=wAi t / NA( Yf( = 1 s ND = ESeeo = 7 73 \ 2 ANS = 8 iNN S ES I -- Wz C7 Wee| nN INE) lin NLo, gAY NN =W .e e s 0 a ) IN Ne fe AN RIN TSN INS oN ~ INNS A i \ VF ! f i | . ! / SIN Wi hoz UNS (DA : _ im . CEREAL crme <---- cRouoRomwTAvEowR. win bos adBor Err 000591 aoe No ----J<f~ SOW ASSTETNA N Wae s mUoN i NS he { JE4 l ) ETO. 2 S oe)t \A 0)' IN Now = y ) C= Dy Lp A<NIS \O| L| AMRSeES og | He EW ei) ENE SN X Le v Po f mA Z2ANI TR = g7 4 wSo e EN IMf ISEa X s SEE - eed 000592 EID168157 NLZ77CS NA Xo N\A // 777 -- Sh T = EEN /(rRo ENr s= Oo JooNnNN SEA = UE Za oN No -- |) A \ = Are o)1 hoc 1 "A FE Al ', NE ) LOY Lo wYrN. 1 --17A. S - CfU iI L/ / 3 WE ; l J! y WX Bi IE N */. pi i =X 0 o |LnH dN e Uf >= HOIRNy REJ lscauc glme - Lo mr t, om |a aC5oV oI nN tson o&n[ Etn Ta E TERE em EEERE 000593 Entesiss =7 -- FR o ~N~ WWZA02OdKAESEO= A 95oR S ER T SIoEn AND == Be PR \ 5re" |J il TiPs ON= S 14 IN 2 \ ha 2 AolSy k Nee VT on Ae Niles NsVIN A VYTxK | } Lo Neer - [EARNS ATs NN | Nos J Wn DIAL J -- Tm | Semen EERE 000594 EID168159 / == NS Bo > Yd 4SAbRIyN 2 Le EN ZN WE gas a L Y : a E = 2TUEENS2 C2 R= L4YAbLEN = a MY hey ] AE, SN) pm [Zoe AEE 000596 pen) AT Ls {lil /ih I Ne a Tone SEE 000597 = NE = WS)(NYW= e WASP R R7 O IA EW 7 44 Way WvZ l NLe -  000593 _ eotestes MA000536 Msn Plant sngLane Dagtun Landfill 5.0 DRY RUN LANDFILL [Ee -- imestp Sr --------t-- EAVONDRBI!SEBO. erm em er meee eres ST A ------" SHECERCA mee ee 88 [ES re------------------------ Rete A Taber Teso Dry Rn Landi MoWer t Coni sncionrDsn TSI iyRunLand AscDasTbe -SrcWr TSB DyRuaLas Abt DasTbs Gromer Fipseso Dry Lard Lecstcn op Fim Figees1 Ory RnLandi ileRadinMop Figees2 Dry Rn Landi MoWei lndSnc WtSplLocoMsp. Fines Dry unLandi CrsSectionLacsion sp FipreSan Ory Ron Lad Cs SciAon o Fiwesdn DyRonLand CosScien 85 FieSSA Dry RonLad GenterEvo Hop Oc 201 FneSSh Dry RonLoni GentsHratonMap Ochs 197 SIC ny on Land Granda Bevstionbip- ctr 198 Finne350 ny Kon Ladi GreamvnerHvston Mop- Octonr 19) FipneSSE Dry Ron Lal GreaterBeton Map-Ape 172 Fipresen Dry Ron ConcMopnrtockWaelk isy2n000 Fines Dry Ron Consmain Mop Denk Wel. cy 199 FigneSC Dry Ron Concenicn Mop ick Welk cy 199 FigresD Dry Ron CA ConcopeOcrhrne Welk lyX00 Fipne SE Dry Run C8 ConcemaionNopOcc Weliy 1959 Pipa S6E Oy Ran C3 CocenMaspOtvoind Wilh May 198 . . CoWirrpinlgionmdOtF eoyam banzseeno 000600 51 Emtestss MAHO00537 isn tartnstants Dry Run Landfill @ 51 introduction "`TWheestDVriyrgRiunniaL(aFnidgsuirle i5.0l)ocaantdedisweasbtooutfetihgehttomiwlneosfsLouubtehwceks,tionfWtoheodWaCsohuinntgyt,on Works `cmoamipnlpeltaendt faonrdtthheeaLrocacawlitLhanidnfaill1.-miAlewaratdeirususreoamndtwheelDlrsyurRvuenyLsaenadrfcihllispbeeriinmgeter (Figure 5.1). "bTyheDuDProyntR.unThLaendlfainldlficlovbeergsaanpoppreorxaitmiaotneilny 11978-6acarnesd oisfati5ll35c-taicvree aptarpcreeslenotf. laTnhd eowned lEalnidmfiilnlatiisoonpeSryastteedmuPndeerritWeNsot.VWirVgi0n0i7a6S2o4l4i.d WTahsitsepeNramtiitonreaqluiProelsluqtuaanrtteDrilsychgarroguendwater `monitoring and monthly outfall surface water monitoring. Fsicgmuprlein5.2g posihntosw.sTthheellaondcfialltwoifatsohnceonlsatndrfuicltle,dmownitihtionritnhge dwerlalisnaagnedbsausrifnaocfeDwratyerRun, a RtruinbutLaarnydofifllthheaNsonrothcoFmoprakcotfedLeoerCsryentchke,twichibcohttiosm ltirnierbsu.tarHyoofwtevheer,OhniaotuRriavlers.oilTphreeseDnrty under the landfill materia is composedofclay and weathered shale. "wTahsetDeriyncRluudninLgansdcSriapl percoediuvcet,s swcarsatpemfertaolm,twheoomdaipnalplleatns,t fcloynsaisshtianngdofbinrso,n-ahnadzasdous dmiisspcoesleldanicnouthsetrlaansdhf.illA.ppCruorxriemnaltye,lyth5e0C,0-00s,o0u0r0cepisobeuloienfvwedadsttsoebpeerthyeeaslrudhgaevsefbreoemn the r1e98m8a.iniTnhge fDifreyonRutnheLcaxnidsftiilnlgrceemlaibnaisncgd coanpaaci1t2y8c,a0l0c0ulyatdio'nsnfeotrf2ll00v1olsuhmoew c4o.n4syuemaprtsioofn (DuPont 2000). 52 Environmental Setting 521 Geology @ RT penne vel nsalanpom pred Te `VT-hsehDarpyedRvuanlleLyasn.dfRielsliidusailtusaotiledcoovnearshmeoasvtyladnidsfsielctaerdeaps.latIenaguecneornasli,sttihnegsoofsileaverthaelssitteeep hthaeswbeeaetnhedresicnrgoibfesdhaalser.esidual in nature, consisting primarily of heavy clays derived fiom "AThgeeointveecshtniigcaatlioinnvceosntsiigsatteidoonffoardtvhaencDirnygRsuoinl Leasntdfbiolrlinwgass, ecsotmpplitest,eldabboyraDtuoPryonttes(t1in9g96o)f. dsoeitleprhmyisniecdalthpartoptehretineast,ursatlabrielsiitdyuaanlasloyisleusn,daenrdlysientgtltehmeenltanadnfaillylseeds.matDeurPioalnstc(o1n9s9i6s)ted of Stsiafnfd.toThveertyhhiackrndessisltoyfctlhaiys anantdurcallaysoeiylsrilatnwgietdhforcocmas1i2ontaol2r8ocfkeetfriagtmheenttesstanbodraintgrsacweiotfhin the landiilled area. A 1989 monitoring well installation program, prepared by Tetra Tech CoVannmiingoonnd58he amazesno . 000601 sz eoteates MAHO00538 Mo ltang Lois Dry Run Landi o overburden 1017 feet. wells (DRMW 124, 12B, 13A, 6A) were installed to depths ranging from 11 vTahreicuonldoerreldysiangndbyedorroccaklcaatrtehoeusDrshyalReu,nanLdangdrfaiyl,l gcroenesni,stasonfd birnotwr-nbseadnddesdtroendeoafntdhe: tPheerDmiuannkaargde DGurnokuapridn Gthriosurpeg(iToentrias T5e7c0hfeReit.chTahredsloonc,at1i9o8n9o).ftTwhoecmroasxs-ismecutmiotnsh,icAk-neAs's of TanhdeBt-woB,crcorsoss-ssiencgtitohneslaarnedfsilhloawnndidnoFwinggurraedsi5e.n4t7ofatnhedl5a.n4dB.fill are shown in Figure 5.3. `tThheelraenadfriellon(lDyRaMWli-m1i4t)ed.nuDmabsehreodfgdeeolcopgmiconciotnotraicntgliwneelslswearreoudnrdaawnndounpcgrroasdsi-esnetctfiroonmA- DA"RM(FWi-g1ur4e,5.t4he4)upbgercaaduiseentthweerlel,isannodtDsRufMfiWc-ie1nt3,dattahetodocwonngfridaednitelnytewxetlrla.poMlaotreebetween dgoeowlnoggriacdailednattacriossasv-asielcatbiloen,(BD-RBM"W(-F6ig,ur-e115,.-412),waintdh~m1o3r)eacnodnfwiadsenucsee.dCirnodsesv-eselcotpiionng Bt-he sBtYrastuipgproarphtisctuheniisntoefrspraentdastitoonnsemlaadyeersinsecpraorsast-seedcbtiyonshAa-leA"laoyferras.ther flat ling 5.2.2 Hydrology, Hydrogeology and Groundwater Flow @ a a reelynshh fed soe,Ny Hydrology `VT-hsehDapreydRvuanllLeayns.dfiDlrlyisRsuintudartaeidnosnthaehevaavillyledyisinswehcitcehdtphlealtacnaduficlloinloscaiteods.ftseMivaennragylssmtaelelp North Fork of Lee Creek. Potesta & receiving sAtsrseoacmiabteels,owIntch.e(D1r98y9R)ucnomLpalndeftielld.a Thyhderyoldoegtiecrmainndehdytdhraatutlhiec waanatleyrssihseodftsohiels aa1re48s1pictubbeitcwfeeeetn pheyrdrsoclcoognidc (stohialtgirsogurpesat(eHr StGha)nCthaen1d0D-yaenadre2s4t-ihmoauterdsttohrem)f.lowPoctaepsatcaity (co1n9d8i9t)ioalnssoatevtahleualotceadttihoen 2w4h-ehroeutrhpereccaippaictiattyiownaasmeosutnimtattehda.t wPooutledstraedsueltteirnmiunleldltohawt precipitation values between 5.25-5.99 inches in 24 hours would result in fll low. TinhaectiinvsetallolwateironhoafaolfltefhaechalatnedfciollllewcatsiocnosmypslteetmedabtyhePoDtrcystRau&n ALsasnodcfiilalteesncInocm.pianss1i99n9g. the tLheeaclhanadtieillfr(oFmigtuhreel5a.n2d)fitllhrdoiusgchhapregrefsoriantoedapliepaecshabtuericeodllaetctthieonlsouwmepdgleoocafttehdenofrilthawreeas.t of T"Tohceatleedacathattheeitsoppuomfptehde hfirllomLtehaecchoaltleecstiponumspuemdp tforoam50t,he00c0o-lglaecltlioonnctoalnlkecttoioantnankker ttrruecakt,mewnhticplhanst then hauled 0 the main plant for treatment in the site's wastewater Hydrogeology bGerdoruoncdkwaatqueirfeirs fisoucnodnsiindtehreedovteherbuunrddeernlyainndgsitghneiufnidcearnltyaiqnugibfeerdrfoocrkNaPquDifEeSr.peTrhmeit o rDerqyuiRruedngtroomuonndiwtaotretrhmeoonvietorrbiunrgd.enAantdotabledorfo1c5k maoquniifteorrs.ingAtwehlilss htaimvee,bfeoeunr oinvsetrablluerddeatn CVommepioenn0d8ia raoza ne 5 000602 - Eotsster MAHO00539 MnP a Lats Dry Run Landfill awnedlls15()DRsMtiWl-eGxiAs,t -T1h2e4,ot-h1e2rB,seavnedn 1v3eAl)s,waenrdefaoubranbdeodnreodckiwne1l9l9s9(bDyRMPWo-t1i2,&-13, -14, Associates, Inc. as required by the permit because they were not being utilized for quarterly monitoring (Potesta, 1999). Table 5.0 provides the well construction data for existing monitoring wells. : Groundwater Flow Water levels measured in November 2001 indicated overburden groundwater was. encountered betwee4n and 6 feet below ground surface. Although 3ofthe 4 wells completed in the overburden monitor the same hydrogeologic unit, well DRMW-GA is `Ncoomgprloeutenddwaataterrelfaltoiwvemlayphsigwheerrezopnree,pawrheidchforistdhiesschoanltlionwuowuasteatrleonwceorunttoeproegdraipnhtihceareas. overburden section. Annual groundwater clevation maps for the underlying significant aquifer were available. forthe years 1992-1994, and 1998-2001. These maps are presented in Figures 5.5 through 5.5G. The groundwater contours were transferred from the original maps. submitted for the permit to the updated Dry Run Landfill base map. These maps show that groundwater in the bedrock aquifer flows from the southeast towards the northwest. '`TDhReMgWro-u1n3dwaantder~1el3eAv)atairoenssimmeialasruraendd tfhoer nsecsrteeednewdelzlosne(sDRarMeWc-o1ns2t,ru1ct2ed,realnadti1ve2lBy,calonsde: to each other, indicating thatthe overburden and bedrock aquifers may be in hydraulic communication downgradientof the landfill i werQuality 5.2. Surface Water Quality Hpoiisnttosr.icaSlamsuprlfiancge lwoactaetrioCn-8focrosnurcfeancetrwaatteiraonrsasempprleisnegntpeodinitnsTsatbillein5e.x1iAstfeonrcseixcasnambpeling found on Figure 5.2. Surface water samples have been collected periodically from these (lDocRaLteiaocnshastien,ceOu1t9l9e6ta0n0d1 haanvdeabtetehne cporlolpeecrtteydbcoounsnidsatreyn)tlsyinfcoret1h9r9e.e loTchaeticonosneeniation of uCg-/8l)inwhtihleelceoanccheanttersaatmiopnlefsrhoamvtehebeoethnedrelcorceaatsiionngs oavreervatriimaebl(efarnodm 6d2o ungo/tlidnodiwcnatteoa27c.le4ar trend (Table 5.14). 5.32 Groundwater Quality cHoisnttoirniuceasl (grDoRuMndWw-a6tewrassamapblainndgobneedgainn i1n99199;96P.otFesotra,we1l9l9s9)t.hatCc-urcroenncleyntexriastti,osnawmeprle.ing ccoonncteonutrreadtifoonr scoonmteooufrtshceansabmepfloiunngdeivnenFtisgufroersth5e.6oAvetrhbruorudgehn5a.n6dF.beDdartoackshweolwlsn. inThese FDiRguMrWe152.-6BwaansdplDoRttMedWbIu3t-noAtfcoornJtuoluyre1d9d9u9eatpopetahresdaantaomsaprleoauds.cTohmepadraetda ftoorthe other diasttasfoirntmhoensiettowroinwgelwlesl.lsT1h3eacnodnt1o3uAr,mbaepdrsoschkonwdthaotvethrebuhridgehenswteclolnsceenstrpaetcivoenolfy.C-8 CoWmipmrpaivonno0i6hewysa Onzoe snv2 - 000603 54 etesies MAH000540 oaPtan Lact Dry Run Landfill These two wells are located downgradient from the central axisof the landfill. For the `majorityofthe sampling evens for mostof the other wells, both overburden and bedrock, the C-8 concentration has been less than 1 ug/l. The C-8 concentration for the 1999 sthaamtptlhiinsgweevleintsainn DopReMnWb-e1dr4ocwkaswehlli,ghaenrdtihanreoltahtievrevlyalculeosscmetoastuhreeldandffoirllt,hitshiwselhli.ghGeirven concentration may indicate communication ofsurface or shallow aquifer waters through the open well, particularly because groundwater flow in the underlying significant gberdoruoncdkwaatqeuriffelrofwlionwgsffrroommtDheRlManWdf-i1ll4tonwoartrhdwtehsetDtRoMwaWr-d1t4hewlealnld.fill area as opposed to 5.4 Site Conceptual Model "The Dry Run site conceptual model describes the potential exposure routesfor current and future ecological receptors. Potential exposure routes were evaluated and classified as complete or incomplete. a`AncdcelsosckteodthgeatDersyoRnusnmaLlalnedrfirloladbs.y iIsncaodndtirtoilolne,dbbecyaeulsecetrtohneiclagndaftielslosnatchteimva,jtohrerreoaisds2 crewofworkers on the landl] area during normal working hours. The daily activity discourages trespassers on the ste. Therefore, direct contact with landfilled materials is a complete but minimal exposure route, limited to the workers in active portionsofthe Tend. Direct contact with landfill materials in the inactive, lower halfofthe landfill is incomplete due to the leachate collection system's geatextil and geomembrane cover. o Contact with leachate at the landfill (or at the main plant where the leachate s treated) is considered a potentially complete but limited exposure route fo the landll and plant workers and samplers. Currently, the inactive lower haoflthfe landfill i covered by geotextiles and `pogretoimoenombfrtahneesloanfdftihlle dloeaecshantoe ccoolmleectiinocnosnytsatcetmw.itThhetrheefloarned,lplreecdipmiattaetriioanlsf.alTlihnigson this dprreaciinpaigteatdiiotnchleoswasnddoewvnesntluoaplelyviraeaocvheerslaDnrdyfRluown zCnrdeedki.scThhaerrgeefsoirnet,o tshtisorpmotweanttiearl exposure route is considered incomplet. Precipitation falling in the upper haolfthfe landsill may also flow via overland flow dthoiwsnprseclioppietattoitohnemdarayininafgieltrdaittechaensd, acgoamine,ianncoinntcaocmtplweitteh etxhepolsaundrfeilrlouetde.matAelrtieamlzstaisveitly, : mcoilglreactteesddboywntgheraldeiaecnhta.teHcoolwleevcetrio,ntshyisstiemmp.acItheidswaitmeprafcltoewdwinagtewirtmhiignrathteesladndofwilnlwmaaryd be tshharloeusghantdhesalannddsftiolnleeod fmattheeribaelsd,roitcmk aayndevmeingtruaatlelydocwommgeraidniceonnttawcitthwiinththtehebeudnrdoecrklying, aaqlutihfoeru.gh Ccounrteancttlyw,itnhotiemnpaocutgehdhgyrdoruongdewoalotgeirci da2tpaoetexnitsisaltloyaccocmuprlateetley eexvpaolsuuatree trhoiuste. exposure pathway. Plans are underwayforthe expansionofthe leachate collection system and foar final o cinafpillctroavteirngsaysntdecmo.ntTahcetsinegalcatinvdiftiilelsedinmattheerifaultsu.re wil further reduce precipitation CVoimnitngeiond08he me 000604 55 E1616 MAHO000541 Mia rana Lets Dry Run Landfill @ 55 DataGaps "The following data gaps were identified for the Dry Run Landfill: Q Identify the locationsofseeps in the valley wals and determine water quality with respect fo C-8 concentration. Q Determine the C-8 concentration in straendaotmhesr surface water boics. Q Acquire additional geological data to more accurately develop the Site Conceptual Model. Q Install additonal monitor wells to provide additonal groundwater flow data and groundwater quality data 9 Gather additional C-8 concentration data from monitoring wells for plume delineation. Activities to fill the data gaps will be proposed and discussed in the work plan. 5.6 References DuPont. 1996. ReportofGeotechnical Investigation Dry Run Landfill, Washington `Works Main Plant, Parkersburg, WV. Geotechnical Group, Civil Engineering Systems, DuPont Engineering. April 23, 1996. 2000. 2000 Dry Run Landfill Operational Report. Submitted January 26, 2001 Pot&Noe.As1s.socOitcattoeabse,rIn9c,. 1918998.9. LeHtytderroflroogmicD.anMdarHykdrKiasuelrictoAnDaalnysWiseobefrD.ry Run, Area 1999. Monitoring Wells MIW-1, MIW-1.4, MW-4, MW-44, MW-, MIV-10, MI10 Abandonment Report, Dry Run Landfill, DuPont Washington Works. March 1999. "Tetra Tech Richardson. 1989. Monitoring Well Installation Program, October 1989. Cfroamtmareawe 000605 5% eotssir0 MAHOO0S42 TABLES ------ 000606 i NAH00e05m13 5% | lolol] [5 22gsSEE [efglelole | HAE oi3 e $2: 532 olole| 5[5|3)5| Je | o lolol 8z3% "22S24x33 | B3E%ES a lal] 2 2gflsloleilag LL E15)EEIEEEE] 000607 eosin MANO00544 o Table 5.1A `Summary of Analytical Results: C-8 in Surface Water Samples Dry Run Landfill Lubeck, WV E == j-- "DRSLaEp mApClHeATEo . T w 1n wamnes eeH seT T T TTR s C E e r a A eN )| ae = gone -- Tse TT = BE ---- PROPERTY BOUNDARY --owao --T----"""03----------] [re| H EBE=e e E e =E| I7S CT -- 000608 Y Table 5.18 SummaCr8yionfGArnoaluyntdiwcaalteRresults: Dry Run Landfill Lubeck; WV E ----mmwiaS sTIe-- T T --o Ti T-- m I mmeearnT -- --o -- -- m ---- ------ [v 7 mwe-- ro m x -- s) ] TT [m1 rm emsoT T -- oo e m-- e ] r [ mao n wee r s mes ------se572 --------1 [rssToo] B 7 o [e Ce o --w3s e --s| [o1 e7mmm a --om-- [m [e [ moessr Te o m eor rms ] [ Tr o [[rrawvmaeeew sseT Tw o o om m w ) ] [sa mmTreees ro oosm------1 2 timated value below Iboratory quanision li), 000609 Eteo17s MAHO00546 FIGURES 000610 em MAHOE00D5I47TS rrRNieI, 57 | % i JEN eR ed I) EesRiEa NyR EYR TYrePSLy gl ComnsdegivA nilEeA iec | LHHT] te gy Py LAA 5 @EIETHENE SINS Ly NS AC) Ie rh: JR EMW eiso ]a17Fah s r SnrSdols ) EEENE EE AIUERE Ea EdS SNRTg5 NeCSVHEYOR50DD 1 ao EESR NERY) 7st S aR iN e SR eERn Vs A Be - hi 000611 snaooaes eo oUEF TREa|] AE AR Le & Sy SA RE BR S PNGHE 2 L ESS PTRheo]Peey e) - EAN NE 5 Oy a A VR Fa SESE R EaESaNENNN (a a Ara. T r fed Nd ES ,2) 18 mersme | T---- - - mpm - [Te FE 000612 EID168177 Ds IANA Fo I QO| dad w C =e ONOR NE <ACe 8feZNSANN eer X Xo a Bee]A 7 =X 7 ay - 7 a: ==o + E=lse Fi sexn] NAN E Hem SY = J t wi RY CRS SR EY -- N === = A-- \) 4 ) A\ \ Ny rT oe I/l 280" fe DuaP nd Oo RSOnmatn =] army [oeTor [oo Tor 000613 EID168178 DG] NLilaDaFAn ih) if i2 g aE =e Bnll Nh ENEiY Whof NA il AN = A yD a le ji BiLi ZN nl A Hq i. eg Re i<fA s oti T APy o i) e i The RE jeZs = ll -= =%hl 7 an = Vit fit Se - Rr ai bil: fev J 5 ET By mm i1 J_eEn_Rg, gr8 ftaec Lu dinoann-11 o0oc1s ES Erm \n iy i nr GNH NLREEE A \ tl ; ul. a L ig e <i .+ 1 1 :J al he 5 Lh J ve fnid i !fii s| 0 rli iLL] hE g Siti {ard | fi : i itn |i Ft ME url. gi | ef a oes a ea we =r Ea NA RN SS =e \TAN ES (ey hNoIlNlNEeEZrA"S0 A N li eC " = fiil dt el La = oo MST pay 4 =lA eesORA27[5 EE i No a ES E FL 8 O 2fit]i] Na ERr nwa iilh B =E =Ne= HI,RNek Ne anol Ki J ON nDieWid J l iE SAN UE kr Se WATT, LAs 8 10) JiFon 7 7 a eaa a B= et A bE EreoHfN (eGrEC--\\N NNe=E ie2s Phi i Aa fi a ail eJass e =a a Fm - a 000617 Io" ut Foced4 wfH0 A0H, 1 NTEh NS ot n hSiTiZ E 5 A 0l [Fo | T N nE NS TE ON eg SUNT i ~ il I bo hE Te So cls RT Nl o NEtIRETASy A as SgEVN oeys TAERRACe SIeI ] Serf LAN HN RiEh ! *! ii i 8dl HT Caf a RUN rin PE oy Sb iMEE pMill RSoRxE JAARE ki aRiA AN0GNNTILLTIE | hE RETR LR = Se) , ey el ETA Ty aslm Te pETi A WEIN,eTN sRety TR Ra alll NERO wr J bl, SOOO AT [ls SENN CRONE bd it i7 AASI aA EE aN NNN ie ; i M or oe VoSil aera =} E6818 cd ea~T dLe T TRE s eEe ly hT ona daEeon pee i Io NSiEfFyrE}hUaSam2 rHiNA] pe | jers fiil WT AA 8)ji PSSST mR gt So PUL ZN NST RO hs | Pe HHL I iE ps NN A Ne a a : Tr soTETiNNS oosE e ON : 8 p Le aO NaQdn Te], Sendai = TTTTRI / hEA Lol" <Ls Ji Di AA Fi i JN SEIN ok OF oe mas Lo ls SoLP La SE [77 [re FEN -- : |) A N fees oUR STE =Um o] gd L | o M ee ne rPE eee s ZH EeSyZR4 sense ANS AS a MAHO00556 sol A pl ad] )ERIF ATA Sef : JRLE T8 3 Vs ii i hSoosAtReNA id [LH Hi e lL ligt! } LF =SEN T = e] a : Nao SE i J ! EE AAT He SE A fos FERN hb ov le ET TES A ET -wy Afy sit] " hy ST ~ adMO sp | ELby NT fi [o Zha g gi el) CV : 5 v Lr eNsoel Y i pdt alPEL ae ag Ty 7f Ns LR t No Sgt oA bA rS kA JAoNe Ci od i 2 l. RIS s, | [0 WAL | Sent iki 7 G5] CETa o ~p~ aoo or e EN;O |PENT N y df oT led iily e[vsahodAemETmUnEn Sr SE EN i pt Lie aSEE a A Sl| oosz0 isoirssn1ss NA Ne er Ea cemd SpI laAtAE TY Sm A a NET 5 CN TES Lash ET AH ei ET E h Ni E E = g Ao BLAe Bl Rs i Lika. TEN Shon lcrSeA F LY L A Sis Sop i LLA ETS aBi)Nf TT bide Dad glue i ii il ia Hid] ONT ee aN 2 a A ZE7NP VLIiYk Xi lTieedeTy NTiL oi ZPPELrNNIwyC Wh T R aiN SR R EE J 0 =o ar wd8 Jd: 5 fTCrAitTeTs oa ab a ul a Vi NY MESA SNE RN She oy fh i ir oY Gri bn m| s SELEN A Voi =) aT A ghiil ai ii- A tp TE EE] il ovos2a I coves Mody by i8 H 755 fC 4 Ty YR = las 8} =pat7 S s n AESNT i gi ~ vo 73) A A a ES 33 88 5 a . al 000622 EDt68187 ody od He dai -ws wy A ' 0) cone ji] . -es / /i7:2 Aid sl gi i LH @ =i { { cl i AN FL Bi => Donen, yd AE DRS a " wip / " i yi ia iH 000623 588 gid ' oid EID168188 F--l-- r yr l3 l - TA% C*HE aE - DeFya. | TE i as RR Fa YEN AN) JA) E/N . 4 ( Fi SR exi . // of = ol WOARC PS VAT WI NN `wot fe A ISNh Eg Se, pifI: &i tH - uke Ne % Mop mr / g Joh LE 7i i es = 1 000624 ox: Eise1s ek ; i i ne eee (Br g & 4 3 i #53158 o Fr - ol 2 i rn she FANE yn Joo &s corr a Ny 8 A~AASre : I H$ii a AF SNNN ,7 A UA E a GA=NE INEBY 5s 9 ad a A L 7 N ERIE KE RQ WN gi 8 ; . i 3 Zn) 7 fe 5 i Fp / AN - ) Ford 5 / 3, 3 ns 7 ~F PL Ve 38 / 85 uf :as - 000625 *| wnnoEoIDo1s68s1z90 iy TH fat = A ot yf CN | hie sf A) J 24 ] &= 5 ) was | w;iy/ oe GANT abe (ieS : " WW 4 A Ae "EB N oe =] |oa 77 i J5 yp / iiBn 7 - 000626 -- T T r y tig d sno ST oh) = Lass) | T / Glen LE (8 0 RSE & 7 i i 2 a i AIA 2 an w WF hf x y/ al | 7 yA / FEEo ol 000627 EID168192 z 000628 ED168193 MAIH000565 APPENDIX 1 CONSENT ORDER (ORDER NO. GWR-2001-019) 000629 - GOS A00566  CONSENT ORDER ISSUED PURSUANT TO ARTICLES 5 and 12, CHAPTER 22 AND ARTICLE 1, CHAPTER 16 OF THE WEST VIRGINIA CODE. TO: E.1.DU PONT DE NEMOURS AND COMPANY DATE: November 14, 2001 West Virginia Departmentof Environmental Protection Order No. GWR-2001-019 `West Virginia Department of Health and Human Resources `This CONSENT ORDER is issued by the Directorofthe Divisionof Water Resources and Director ofthe DivisionofAirQuality, West Virginia Departmentof Environmental Protection, and the Commissioner of the Bureau for Public Health, West Virginia Department of Health and Human Resources, pursuant to the authority st forth in more detail below. 1. INTRODUCTION OF PARTIES. @ cou"ThisnConPseetnetcOirodnerWisDeEnt)er,ed tinotoWbeykanVdibregtiwneseDnetghaeiWmeesnttVoifrgsinhiahDeapnadrtHmeentnof Resources - Bureau for Public Health [WVDHHR-BPH], and E. I. du Pont de Nemours and Company [DuPont[collectively referred toas the "Parties"). IL. PURPOSE OF CONSENT ORDER. This Consent Order sets fortha seriesof tasks (0 be performed by the Parties in order to determine whether there has been any impact on human health and the environment as a result of releases of ammonium perfluorooctanate (C8), CAS Number 3825-26-10 the environment from DuPont operations. C8 is a material used by DuPont in its luoroproducts manufacturing, process at its Washington Works facility located at Washinglon, Wood County, Wes! Virginia. C8 is not identified as a hazardous substance, hazardous waste or otherwise specifically regulated under West Virginia or federal statute or regulation. "This Consent Order has been negotiated in good faith and the actions undertaken by DDuuPPoonnttpruertsauiansntthteo rtiigshtCtoonscoennttroOvredretridnoannyototchoensrtpirtoucteeeadninagsd,motihsersotfihaaonnnpyrolcaebieldiitnygosntoits part. iamwplseemtefnotrtohrheernefionr.ceDtuhPisonCtonasgernetesOrtdoecro,mtphleyvawliitdhitayonfdtbheebofiunnddinbgys tohfeftacetrmasndofcotnhicsluCsoinosnesnotf Order and further agrees in any proceeding to implement or enforce this Consent Order that it 1 000630 Etestes MAHO00567 @ notcots the validity of his Consent Ordes the uiditon of WVDEPand WVDHHR- BPH to issue it. IIL. DEFINITIONS. `Whenever the termsidentified belowareused in the Consent Ordero in any exhibit or attachment hereto, the following definitions shall apply: Bureau|for Publ"iTchHeeaAlgtehncaineds"thsehaDlelpmaretamnenthteoDfeEpnavritrmoennmteonftaHleaPlrotthecatnidonH,uimnaclnudRiensgouthreces, DivisionsofAir Quality and Water Resources. 2. "C8" shall mean the chemical compound ammonium perfluorooctanoate. 5. "Detection Limit means th lowest analytical level tha can be elsbly achived wspietchiifniesdpemcaitfriiexd. liItmistsboafsperdecoinsqiuoanntaintdataiocnc,urparceyciusnidonerarnodutaicnceurlaacbyoruantdoeryrcnoonrdmiatlioonpserfoartiaon ofa Jaboratory and the practical need in a compliance.monitoring program to have a sufficient umber oflabortorisavilable to conduct the analyses. Order. 4 "Effective Date" shall mean the date sct forth in Section XVII ofthis Consent 5. "EPA" shall meen the United States Environmental Protection Agency. controlo6.fDuPo"nFtorwcheicMhajceouurled"nsohtalhlavmeebneecnonodvietriconosmeorbcyidrcuumdsitlaingceenscebeaynodnsdhatlhleirnecalusdoen,able Jwuidtihcoiualt tleibmiutnaatlisono,racottshoefGtohidrd,paacrttiiocn, oorr isntarcitkieosnoorflgaboovredmimsepnutteasl(apgreonvciidcesd,, ohrowademvienri,stDruaPtiovnetor Shall notb required to concade to anylabor demands), which prevento delay DuPont from complying with the work plan {he grou7.nd mad"eGbryoudnidgwgaintge,rbMoorniintgordirnlginWge,lldr"ivsihanlgl, mjeetatinnga,noyrcoatsheedr emxectahvoadtsiofnororthpeepnuirnpogsientoof dteetme"rmmoinintitohnreigngphwyeslilca"li,ncchleumdiecsapli,cbzioolmoegtircasl,aond orbasdieorlvoagtiicoanlwperlople,rtwiheiscohfgarroeunindswtaaltleerd.forThe ppruorvpiodseeas ostuhpeprltyhoafn ptohtoasbelleiwstaetdera.bove, but docs not include wells whose primary purpose is to 8. "Groundwater Well" or "Well" shall mean any drilled or excavated groundwater Qo collection system that sauptplsiesdweatseersfor es Comsestoi sim esol public, private, industrial, or agricultural use and shall 2 000631 eotestes MAI000658 Qiong `workof9D. ec An"nReSitmaabtusr,sPahb.lDe.Cionsttshe" nsheagloltimaetiaonncaonsdtsiamtptlreimbeutnatbaltei(oonnoaftnhhiosuCrolynsbeasnits)Ortdoetrh,ethe icnosAttstaatcthrimbeunttabClettootahinsyCootnhserenptarOtricdiepra,nwtshoonatrheesCer8viAnsgseinsstmhaetnptoosfitTiooxniacsitcyonTteraamct,orass tdoescribed 'AtWtVaDcEhPm,enctosCt,sainndcucrorsetdsbayttrWiVbuDtaEblPe tion acnonynceocnttiroanctwoirtrhetthaienpeudbalticthmeedeitriencgtsiodnoesfcrtihbeed in Groundwater Investigation Steering Team (GIST). located 1i0n.Wash"iWngatsohni,ngWtooondWoCrouknst"ys,haWlelsmteVainrgtihneiam,aansudfeapcitcutreidngonfacEixlhiitbyiotw1nefodtbhyisDCuoPnosnenttand Order. 11. depicted on "The Exhibit Facilities" shall man 1, the Letart Landfill, the Washington Works and the Local Landi, depicted on Exhibit 2, and the Dry Run Landfil, depicted on Exhibit 3 @ Eston i lly bith an vce okof trios perhaps1a2n. orde"rRoeffemraegnncietDudoeseo"r ogrre"atRerD)o"fshaaldlaimleyaenxpaonsuersetilmeavteel(fwoirtthheunhceurmtaaninptoypsuplaantniionng,. including sensitive subpopulations, that is likely to be without an appreciable risk ofdeleterious exposure to a compound. water, o1r3.soil, t"haStcrieselniiknelgyL(e0vbeelwishtahlolutmeaannaptphreeccoinacbelnetrriastkoiofndeilnetesrpeicoiufsicefmfeedctisadsuurcihnaags ar, lifetime in the human population. IV. WAIVER OF RIGHTS. requiremDeunPtosontfwtahiisveCsonasneynatnOdrdaellr,riagnhtdssihtamllaynothacvhealtloeanpgpeetahleojrurcihsadlilcetinogneotfhtehvealAigdietnycoires to issue this Consent Order. assigns."This Consent Order applies to and is binding upon the Parties, and their successors and V. FINDINGS OF FACT. 1. emission C8isa standards. chemical substance which has no established state or federal effluent or 2 C8is a perfluorinated surfactant manufactured by the 3M Company and others. 3 000632 Etes1sr MAHO00569 @ piroccescsescatutts W1a9s5hi0ngClosn Wobrkesnfactilitbyy, lDoucpaotnedtiinnWsoodoCropuonttya,eWesstlVeidrgimnaaturing Washing3l.on WoRrekssidauresocohnatvaeinbienegnCr8elferaosmedMoutorhoepaorl,ymdeirscmhaanrugfeadcttoutrhiengOhpriooceRisvseers,adtisposed of caatptthuereFsafcoirlre,eancd oystihgcenriwfliiscaeensthpioprpteidonofoFfsiutseedorC8d.estruction andor disposal. DuPont also contain4s.pecificNloimpietmatiitosnsiossnutehdetaomDouuPnotnotfaCu8thotrhaitzimnagyrebleearseelseoafspeodloltthaenesntvoitrhoenmeennvtironment aHsowpaervteircu,laCtBe mrealteaes,esPrMeyoad(darretsiscueldamteormeatgteenrerwailtlhyain aWeVroDdEynPamDiicvidsiiaomneotferAilresQutahlaintoyfpeeqrumailtsto 10 microns), or 3s a volatile organic compound. to detect5. the preSsienncceeaasncdarlleyvealo1f99C08, iDnuaPnodntrohuasndpecrefrotarimnedofirtesguFlaa,cvioelsuntinarWyewsatteVrirsgaimnpilaianngd shaasmprleepsoratnedd trheeporretssuCl8socfotnhciesntsraamtpiloinsngintowavtaerrio3ussrgeoqvuierremdebnytpaegremnictisesi.ssuCeudrrbeyntWlyV,DDEuPPonatndiso EPA. 6. Asa result ofDuPont's sampling, C8 has been detected in varying concentrations @ p7ubalinc waartoeurndsucpeprltiaeisn. ofits Facilities in West Virginia, including private drinking water wells and Service7.DistricAtn(a"lLysPeSsD"o)fwdartienrkisnagmwpalteesrhsauvpeplry:eported levelsofCS in the Lubec Public is the ik5ely souDrucPeoonft,C8bypraensdentcheroiungahntdsaursoeuonfd cC3ecinathoefiftusoFraocpioliltyemserinmWaensuftaVcitrugriinniag.proces, paricip9.aed in mAulloinpglweistthudeinevsireoxnammeinntianlgstahmepploitnegntoiarlCe8f,fecDtusPoofntC8haesxppoesrufroeromnedhuanmdan health and he environment . doses i.10... consSitduedriiensgpbeortfhoarmmoeudnbtyaDnudPdounrtatainodno3fMexhpaovseurdee,teirsmoixniecd ttohaanCim8alinsstuhfrfoicuigehnt ainngdestthieone,nviinrhaolnamteinotn and dermal contact. Studies hve alo found that C8 is persistent in humans ihe envi1o1.nmentA,ltthheouAgghenDcuiPeosnbtehlaisvecotlhlacttaedddiatloanragleianmfoournmtatoifonawtialloansshisetpthreemsineodneflciCne8eatiinng @ cihe edxtentBaynDducPoonntcedntrsatoihfoCrn8sCiBnstherensvirtonmhenteaso sneaandhgerFoaucnidlee.r AvhaielaLbelettdaatand s 000633 eta AH000570  Dry Run Landfill and ator near the Washington Works facility. sourceof12d.rinkiWnVgDwaEtPerafnodr pWeVrsDoHnsHpRot-eBntPiaHllhyaevxepodseetedrtmoinCe8ditnhagtroituinddweastierrabolrestuorafsacceerwtaaitnertshe in the area ofthe Facilities. another,13h.ave rEeqPuAe,stWedV,DaEndP,DuaPnodntWVhaDsHsHuRbm-itBtPedH,,ininfocromnastuilotnatainodn danodcucmoeonptersarteiloantiwnigtthootnhe:e hdeutmeactniohneaalntdh sptruedsieenscebeoifnCgSpeirnfaonrdmeadroruelnadtetdhetoFaCc8ileixtpeossaunrde.documents with respect to the 14. 'WVDEP, and Based upon information submitted by WVDHHR-BPH, the Agencies believe DuPontand reviewed to date by that additional data would assist EPA, in their `eevxaplousautrieonpoaftwhhweatyhteorhtuhmeagnrsouanndd awnhdetshuerrfapceerswoantserisnnaonwd acroontuanidntihneg FCa8cilhiatvieesaarceomaptlreitskeof adverse health effects rom C8 exposure. perform1e5d. on thTehehruemhaanvehebaelethn enfofiencdoepfenCd8enetxpgoosvuerrenmfeornttahle pourrnpoons-einodfuessttraiballissthuidnigesan exposure standard for C8 applicable (0 the general public 10 ascert1a6.in thTehexeteAngteanncdileesvehlaovfe Cco8nccloundceendtrthaattiofnulslisnitteheanednvhiearlotnhmeanstseasnsdmetno.tsasasriestnetcheesmsairny pdaertteircmiipantienganwdheatsshiesrt iCn8thpisresefefnotrst.any possible danger to the public. DuPont hus agreed to emission17s. for ciTthheerftlhueoryoepaorly1m9m9e9rsorintdhuestyreyarha2s00c0ombmyit5t0epdetroceEnPtAwittohirnedtuhrceeettotoalfiavcetyuaelarCs8of cach company's commitment date. DuPont committed to this goal in 2000. 18. Washington WoDrukPsonfatciilnisttyatlhlaetd,isindeMmaorncshtr2a0t0i1n,g arefmilotveralanfd ciarcbonioterfe9an0tm-ce9n5ty%syosftetmheaCt 8itsin its major Ci-containing wastewater stream, VI. AUTHORITY TO ISSUE CONSENT ORDER. 1. environment inTWheestWVViDrgEinPia.is the state agency vested with the authority to protect the Act, gra2n.ts to tAhsetWicVleD1E2,PCthhaeptaeutrh2o2roitfy ttoheprWoetsecttVtihregiSntaitaeC'sodger,outnhedwGartoeurnfdrwoamtearnyPrcootnetcatmioinnant 5 . - 000634 Ent6s199 MAHO000571 [|J requi-- ring that groundwatergrboeurnemdewdaiatteiersd.found, to institacuivtiel action or issue an order grants o3.the WVAdDiEclPe t5,heCahuatphtoerrit2y2oofptrhoeteWctesttheVSitraglien'isaaCirodfer,omthpeolAliurtaPnotlsluatnidontoCoinnsttriotluteAcat, civil action or issue orders to enforce the statute. protect d4.rinkingThweatWerVsDuHpHplRi-sBinPWHesits tVhiergsitnaitae.agency vested with the authority to regulate and the autho5.rity toAprrtoitcelcet1t,hCehpaupbtleirc 1d6roinfkitnhge wWaetsetrVsiurpgpilnyiaofCotdhee,stgartaenatnsdtotothpeerWfVorDmHaHllR-BPH tihneveasuttihgoartiitoyntnoeciensstsiatrutye(a0catsisounrseaintds piusrsiutcyoarndderssaffeotyr,esatnordeftuhrethpeurrigtryaonftsstaoidthweaWteVrDsuHppHlyR.BPH VII. REQUIREMENTS OF CONSENT ORDER. @ etterTr which tTohdeetAegremnicnieetshehasvceopceonacnldudpeotdentthiaalitriissokoffgrtehatpirmpeorsteaonncfecCt8eo hianvtehesuefnfviicireonntmdeanttaiunpaonnd around the Facilities. Therefore, the Agenciesrequire th following: `member1s. of theAt"eGarmouconndswiasttienrg oIfnvWesVtDigEatPi,onWSVteDeHriHngR-TeBaPmH",(GEIPSAT)ReshgailolnbeI,esatnabdliDsuhPeodnwti.th t`TehaemWaVreDsEetPforretphriensefnutlaltiinveAtwtialchbmeetnhteAteoafmthliesadeCro.nsTehnet oOrbdjeerc.tivHeoswaenvdersp,ectihfeipcrtiamskasryofptuhrepose rofeqtuhierGemIeSnTtwsislelt bfoerttho oinveSresceteioannseAxptehdirtoiuoguhs,C.phTahseedwaoprpkropaecrhfotromfeudlfwililtihngovtehersmiagjhotriftryoomfthtehe GIST shall be funded by DuPont in accordance with Section VIIIofthis Consent Order. GIST 2. shall issuUepionntecroimncolrusfiinoanlorfekpoerytsmsieltetsitnognfeosrtihn the tasks st forth in Attachment A, the findings of fect and conclusions regarding Ab.ackAgnryougnrdoudnadtaw,atgerroumnodnwiattoerrinmgonpiltaonridnegv,elaonpdedplpuumrseuaidnetnttiofiActattaiocnhmaesndtesAcrsihbaelld siunrAvtitvaecthhmeent ttheermFiancialtiitoienos.ftDhuiPsoCnotnsreesnetrOversdetrhearnidghsth0alrbeequiensctormpooirfaitceadtaisonaomfitnhoer pplearnmsitupmoodnirfeinceawtiaolnoffotrhe Facilities' permits. B. National Pollutant Discharge Elimination System Requirements. 6 000635 Eot5200 MAH000572 o samplin1g. for CBExactetphteaLsocoaclcaLsainodnfeildlbay cneor-tfalionwocuotnfdailtsioindse,ntDifuiPeodnitn sWheaslltpVeirrfgoirnima/mNoanttiholnsy! P0o0l4luatnadnt00D5i.scharge Elimination System ("WV NPDES") Permit No. 0076538 as Outfalls 101, samplin2g. for C8ExactetphteaWsaoschciansgitoonnedWboyrnkos-ffalcoilwitcyoantdicteirotnasi,n oDuutPfoanlts sihdaelnltipfeiredfoirnmWmYontNhPlDyES Pemit No. WV0001279 asOutalls 001, 002, 003, 005, 007, and 105. samplin3g. for C8ExacteDprtyasRuocncLaasnidoinieldl batyanllo-ofullofwalcsoniddietnitiofnise,dDiunPiotsntWsYhalNlPpDeErfSorPmermmointtNholy. WV0076244. samplin4g. for C8ExacteLpettaarstoLcacnadsfiilolneadt ablyl nouot-fTallolwicdoenndtiitfiioendsi,nDiutsPoWnVt sNhPalDlEpSerPfeorrmmimtoNnot.hly WV0076066. Orion neers sos samplin5g. shall WbeitpherrfesopremcetdtpoutrhseuarnetqutioreesmteanbtlsiosfhedpaErPagAragpuhisdeVlIiLnBe.s1, whtherroeugaphpVliIcLaBb.l4e,, lanld results shall shall record abneddreelpiovretreadlltaotttheempWtVs DtoEsPamwpiltehiunndtehirrtnyod-afylsowofcornedcietiivoinsn.g such results. DuPont `oObhiiaoinRiavsearmipnltehefraormeaeeaxcthesnudrifnagcetenorriavlelruvmiiallewsadtoerwnisnttarkeeamforofptuhbelicWawsahtienrgstuopnplWioesrkaslofnagcitlhiety athnedDoenteecrtiivoern mLiilmeitupasretrfeoaumndofinthaenyWassahmipnlgetdonpuWbloirckwsatfaecrilsituyp.plIyfwciotnhciennttrhaetiuopnsstorfeaCm8orsbove dshoawllnsbtereexatmensdeegdmetnottsweinnittyialrliyvesrammpilleesd,dotwhensstcrgemaenmtosrwtiwtohirnivwehrimcihleisntuapksetsraeraem,oabseapsparmopprlieadte. sIfamcopnlcienngtrwaitlilobnes paebrofvoermtheedDoentewcattieorniLnitmaiktesarweitfhoiunntdhiirntyaniyvesregmmielnest dsoowenxstterndeeadm,oarddtihteicoenrailver miles upstream, as appropriate. incorpor7a.ted inTtohethaeddFaictiilointailesm"oWneitsotrViinrggirneiqau/iNraetmieonntaslcPoonltlauitnaendt DinistchhsarsguebsEelcitmiionnatshiaolnlSbye:stem : preerqmuiitrsembeyntmsinuopronmordeinfeiwcaatlioofnt.heDupPeromnittsr.eserves the right to request a modificationof these C. Toxicological and Human Health Assessment, Order by1. establDisuhPionngtanagersecesrotwo afcucnodunthteavtaariboaunsktaasgkrseesdettoorbtyhtbheelPoawrtiaess,a porarbyofsothmies Cotohnesrent 7 000636 Enresz01 MAH000573  ToxicitaygrTeeeadm10LebaydtehreaPnadrtiDeusP.onDtisrbeuprrseesmenetnattsivferjoominstaliydacssdcersocwrisbheadllbbeeloawu.thorized by the C8 member2s.oftheAtCeaBmAcsosnesissstmienngotoffreTporxeisceinttyatTiveeasmof(:"CAT Team) shall be established with WVDEP WVDHHRBPH EPA Region I NICS ATSDR DuPont 3. The WVDEP representative shall be the Team Leader. set 4. forth in ull The individual in Attachment team Cof tmiesmbCeornsse,nttheOrtdaesrk.sof the team, and the team objectives are issue a f5i.nal repUoprtosnectoinncglfuosritohnfoifnadlilngtshoeftafsakcst ascntdfcoornthcliunsAiotntsacahsmteonwthCa,ttehxeteCnAtTthTereeammasyhablel: health risks associated with C8 af the Facilities. D. Emission Modeling Assessment ('DAQ")1. withinTh3e0 fdoalylsoowfintgheinEffofremcattiivoenDsahtaellexbceesputbwmhitetreedadtoiftfheerDenit vdeiasdolifiAoinisenrpQruoavliidteyd in this subsection: structures locatae.d withiAn ctohempWlaestheianngdtoanccWuorartkeslsftacoilfbiutyitlhdaitnhgavdeimaensisginoinfipcaarntamiemtpearcstfoonr atlhle dbiasspeedrsoinontohef"Ca8reaeomifssbiuoinlsd.ingSiwgnaikfeiceafnftecitmsp"aacst dfeofrienaecdhinsttrhuectEurPeoAnUstehre'ssiGteuishdaelltobethdeeBtueirlmdiinneg.d Profile Input Program (EPA-454/R-93-038 Revised Feb. 8, 1995), emission rates abond confAircmoemdplaecttueaalnCd8aeccmuirsastieonlstraotefsDiunPpoonutn'dsscpuerrenyteaprerfomritttheedyeaalrlo2w0a0bl0efor aalclcsoorudricnegs(l0oictastsetdawckitLhDi.n tahnedWcaosrhrienspgoinodninWgorpekrsmiftacinluitmyb.erE.acFhoermciascshiosnacpokinitdesnhtiafliebdealbiostveed as emitting C8 DuPont shall lst all relevant stack parameters to be used in air dispersion modeling. @ Meic. For each emission point (stack) emitting C3, the following information 8 000637 EID168202 MAH000574 i. PhaseofC8 (solid, vapor or aqueous solution) at stack conditions. ppaarrttiiccllee sdieznesidtiyst(rgilbeumt?i)oi.in.(microTnhse),patrhteicmleacshafrraacctteiroinozaftiCo8n tionbceacuhsepdarftoirclmeosdiezleicnagteignocrlyu,dainngdtthhee Forgoons cisions, scavenging eens smobth both liquid and frozen ipiri.ecipitFaotriopnarttoibcueluatseedemfiosrswioentsd,espcosaivteinogninmgodcoeelfifnigcibeantssed(hu/pso-nmtmh)e for p(aErPtAic-l4e5s4i/zBe-d9i5st-r0i0b3ubtiSoenpatn.d1t9h9e5)EP(A"1'SsCIGnduuisdtarinacle)S.ourDcuePCoonmtplmeaxy,sVuebrmsiti,onwi3tMhionde3l0 dGauyisdoafnctehe EIfSfCecGtuiivdeaDnactee,(Fiingfuorrema1t1ioonftIoSsCupGpuoirdtanhcee)usfeorofCt8h'es nsocramvaelnigziendg csoceaffviecnigenitnsg. coDefAfiQcisehnatllinatphperove oDruPdoisnatppshraolvlehwaivtehjtuhsetriifgihcta,tiwointhiinnwrsietvienng,daDyusP,o0nt'rseqsuuesbtmiassmieoent.inSghwoiutlhdDDAAQQadnidsaUppSrEovPeA, to daedcdirseiosns.theFodlelfoicwiienngciaesmesettifnogrothfinthDe paQrtiesl,etDteAr aQndshtalolriesqsuueestardeeccoinssiiodnerlaetttieornroefgaDrAdiQn'gsC8's smceaavseunrgeimnegnctooelflCic8i'esntsscwaivtehnigninsgevceonefdfaicyiseonftstihneimtesedteicnigs.ionDaAnQd rDeusPeornvetsrtehseerivgehsttthoerreiqguhtirteo asserta claim ofconfidentiality in the event such a measurement is made. Jfiuqnucitdioannodffdrroozpelnetprseicziepiutsaitnigonftoormbuelaucseidn ftohrewoeptendelpiotseirtatiuornemboadseeldionngtwhiellphbyesipcraolvipdreodpearstiaes of `tCh8e aEnffdecctoinvseisDtaetnet,wiintfhorSmecattiioonn o1.4osufpptohretItShCe Gpuriodpaonsceed.scDauvPeongnitngmacoycsfulbimciitn,t wfiorthgianse3o0udsays of efmoirms.sioDnAs QincshlauldlinagppirnofvoremoartidoinsaopnprtohveepewrictehnjtuasgteiofifcaCt8ionemiinswsriiotninsgt,haDtuPwoonutl'dsbseubimnigsasisoeno.us SwihtohulDdADQAaQnddiUsaSpEprPoAvet,oDaudPdroensts sthhaelldehfaivceietnhceiersigshet, fwoirtthhiinnsDcvAenQdaylst,ietroarnedquteostreaqumeesetting dreecciosnisoindelreatttieornroegfaDrdAiQn'gsC8d'escissicoanv.engFionlglcooweiffnigacimenetsewittohiifnnthsgeovpeanrtdeasy,soDfAthQesmhealeltiinsgs.ue Da. AQ reserves DuPont the right reserves lo the require right to maesassturaemcelanitmooffCc8o'nsfisdceantvieanlgiitnygincotehfefiecvieennttssuinchtsa decision and measurement is made. diagram for d. C8 with reTsopetchtetoexptreenstsutrheaatnhde phases exist, temperature, aThsoelitde,mlpieqruaitduarnedavnadpporrespshuarsee (T-P) ranges. osfhaCl8l'sbeerrieicpalrperospeerntoitefsaestxhahilalvusbetegparsovciodnedditailoonnsgbweiftohremaenadsuarfteedrrconatrnoolfgepqhueiapssmeenttr,ansEisttioinmates temperatures. 9 000638 Eo165203 MAHO00575  equilibrium betewe.eInnwaiteeruanodfCa8,bitnhaerysoplhuabisleit(yT-axn.dy)KrdaifaRgrPaominrteoprfesCe8ntiinngaqtuheeovuasposro-lluitqiuonisd, `comnecaesnutrreadtpioKnsvaolrureelfaotreCd 8acdiidsssoocbisaetrivoendinwhaqeuneoteusstesdoliuntiaohnes,adansdpamceeaGsuCreamt evnatrisooufs C8 coopnecreanttirnagtcioonndsi,ttieomnsp.eraFtuurrtehse,ramnodrepa HdirsecpursessieonntarteigvaeordfintghethreavnogleastiolbistyeorfveCd8duirnianqguaecotuusal ssoulbumtiiotnesdatsoathfeunDctAioQnowfitphHinw6i0lldabyesoprfotvhideedE.ffeTchteivienDfaotrem.ation in this paragraph shall be `The coefficientshall beHednerfyi'nsedlaatwvcaoreifofuiscietnetmpfeorraCt8uraensdcoavdeirsicnugsstihoenroafnigtesodbespeernvdeedndcuerionngpH. actual operations. & Any carbon adsorption data in th formofisotherms for C8 adsorption. assumptDioAnQs pwriilolrptroofviindaeliDzuinPgotnhteamnodoeplpiorntgunreistuylttso.comment on modeling methodology and requeste2.d aboveAnshyalelxbpeencsoevserinecdubrryedDuasPoantr.esultofaccurately supplying the information o reserves3.the rigUhtpotondsiusbampipsrsovieonaonfythdaetaiinfftohrmeaatniaolnytriecqaulimreedthboydtohliosgSyubosreqcutailointyVcIoLn.tDr,olDAQ procedures arc deemed inappropriate. VIL REIMBURSEMENT OF COSTS. this Cons1. ent OrdDeurP.onEtxpaegndeistutroeesstfarbolmisthhaisneacsccoruonwt sahcaclolubnetmtoadfeunudpRoenijmobiunrtsaapbplreovCaolstbsyaudnudelry dnoetsiicgenoaftesdurchepdreseisgneanttioaontfsihtvahlel bWeVsDenEt P10atnhde poefrDsuonPsonitde(nt"idfeiseidgnpautresduarnetprteoseSnetcattiivoens"X)V.I Worfitthiiesn CanonessetnitmaOtredeorf.RePirmiborurtsoatbhleeeCxocsctustitohnaot fWtVhiDsECPonsexepnetctOsrdoer,inWcuYrDuEndPerhtahsisprCoovnisdeendtDOurdPeorn.t with account2.funds iWnitthheianm1o0unbutsoifnefsisftdyatyhsooufstanhde dEoflfleacrtsiv(e$5D0a,t0e0,0)D.uPEoancthsehxapllenddeiptousriet firnotmhetheescrow eSasicdroewscarcocwouanctcomuunsttbshealslubpeporretpeldenbiyshaendiwtietmhizaedddiatcicoonaulntfiunngd,siwnchleundeivnegritnhveoibcaelsaanncde risecleeispstst.han tuennextphoeunsdaenddadmoolluanrts (r5e1m0a,i0n0i0n)g, ionrtahseaegsrcereodwtaocbcyoutnhte datestihgencaotnecdlruespiroensoenftatthievews.orkAntoybe performed under this Consent Order shall be returned to DuPont, 3. DuPont's obligation to pay Reimbursable Costs under this Consent Order shall 10 00063 Ei0168208 MAH000576 @ wchiechearde atddnroehsusendtseedpanradteilytyintthhiosussaencdtidoonlalllst(h5e2r50c0o0s0t)s.incEuxrcreepdtbty DouPRoenitmbiunrcsaarbrlyeinCgoosutts it obligations under Consent Order shalbe the sole responsibility and obligation ofDuPont. IX. QUALITY ASSURANCE/QUALITY CONTROL. uidancAellresgaamrpdlinigngquaanlditaynaaslsyusreasnpcee/rqfuoarlmietdy cpounrtsruoal,ntdattoathviasliCdoantsioenn,taOnrddcehrasihnaolfl ccounsfioodrym to EPA Sparomcpeldiunrge.s. The laboratory performing the analyses shall be approved by the Pasties prior to X. C8 REDUCTION PROGRAM. 1 Notwithstanding current permitted emission levels, DuPont agrees to limit yoveearrablalsCis8aenmdissshailolnsfutrothtehrepsriorvtiodneotomotrheeWthVaDn EecPtamloncatlhelnydaermiysesairon2s00r0eploervetlsreognaradicnagleCnSd.ar iTshseuarnecpeorotifangSreerqcucinrienmgenLtevceolntdaeirnievdedhefroelilnowsihnalgltbhee pmroodciefdiuerdetsosqeutaorutterilnyArteptoarctshmuepnonC.the o collect2i.vely byD5uP0o%ntfiaogmreaecstulaolr1e9d9u9celeevmeilsssiboynDsetcoetmhbeearir3a1n,d2d0i0s3charges to the watoef Cr8 system3.at its WaDsuhPionngttoshnalWloorpkersatfeacailnidtymwaiitnhtatihne tghoealfoiflcerhiancdvicanrgbo9n0-b9ed5%trCe8atrmeenmtoval efficiency in ts major C8-containing wastewater steam. des: 4. DuPont shall conduct th following construction projects and abide by th specified TOIZC on perma.it R13-D8u1P5oDn.t sChoanlsltirnuscttalilonanshiamllprboevgeidn nscorluabtbeerrthfainleFetborrueaprlyac2e8,re2c0o0v2e.ryIndietviailce wopheircahteivoenrshisalalrblecgrin no later than the dateof sar up afer the April shutdown, or June 28, 2002, b. DuPont shall modthiesftayck for emission point TOIZCE so tht the ebmeissiszieodn(p0opirnotveildeevaetfifoenctiisve17di0sfpeeertsiaobnoovfe pgarratdiec.ulTatheeesmtiascskiodnisaamcceo,rdvienlgoctioty4,5aCnoddfeloofw rSattaeteshall Rublegeisn,nSoerliaetser2t0ha(nGoFeobdruEanrgyin2e8e,r2i0n0g2.PraIcntiitciael aospeArpaptliiocnabslhealtlobSeagicnknHoeilgahtters)t.hanCotnhsetrduactteioofn ssthaarltl @ up afeCrr the Aprileshmutdtownc, ornJunne 2o8,n200s2, wbhichTevRerCissearllier. iAtt etidmesowchernodenvicie nTIZC 1 00j06a29 eptes0s 1AH000577 @ roc: 5. DuPont shall conduct a scrubber optimization and recovery improvement program that shall consist ofa stofuscdrubbyer operation for device C2DWC2 on permit R13-614A. The study shall be complete by the endof March 2002. Provided the results are encouraging, the `unciotmspCan2yDsThCal2loinmppleermmeinttRi1d3en-t6i1f4ieAd,iCm2pErHovCe?m2eonntspeforrmitthiRs1d3e-v1i9c5e3a,ndansdimCiIlaFrSiCm2proonvpermoepnotssedfor permit for R13-2365A. Implementationof the improvements for the latter devices will be complete no later than the endof November 2002. XI. COMPLIANCE WITH SCREENING LEVELS. 1. The following requirements shall apply only if the procedures set out in Atiachment C have been followed: A ---- a Nolater than 60 days aftr receiptofnotification from the Agencies that data or information developed pursuant to this Consent Ordero other information that is recent and valid demonstrates that DuPont's operations have resulted in C8 exposures above the Screening Levels derived following the procedures set out in Atiachment C, DuPont shall submit a plan for review and approval by the Agencies that i designed to reduce such exposures to levels below the Scrcening Levels within a reasonable time (the "Remedial Plan" or "the Plan"). WVDEP shall, upon consultation with the WVDHHR-BPH and based upon accuracy, quality, and completeness, either approve or disapprove the Plan. If the WVDEP disapproves the Remedial Plan, the WVDEP shall notify DuPont in writing that the Remedial Plan has been disapproved and shall specify the reasons fo such disapproval. DuPont shall resubmit the Remedial Plan as revised 10 address the deficiencies identified in the notice. DuPont's failure to submit an approvable Remedial Plan shall be deemed a violationof this Consent Order. 2. Inthe event EPA or the WVDEP develops and finelizes a reference dose/screening level for C8 in accordance with applicable statutory and regulatory requirements ("the Regulatory EPA Standard") that would be applicable to Dupont's activities or the Facilites independent of ths `Consent Order, DuPont's obligations under this Section shall be determined with reference to the Regulatory EPA Standard. DuPont reserves all rights it may have to comment upon, object to, or appeal the Regulatory EPA Standard in proceedings separate and apart from this Consent Order. XII. COMPLETION OF CONSENT ORDER. 1. Except as to DuPonts obligations under Section XI, this Consent Order and DuPont's obligations hereunder shal terminate upon issoufaacomnplcetieon lette(s) from the. Secretary ofthe WVDEP or his designee and from the Commissionftehre WYDHHR-BPH to 2 jovgs4 1 E0168206 MAHO000578 @ runt. stint manner lowing epof writen request fom Dont he respective tAhgeenocbliiegsatsihoalnls aisnsduewothrekctohmaptlheatvieonnoltttbre(esn)ctoomDpulPetoendtoirn aschcalolrdiasnsuceeawiltihetrhtios CDounPsoenntt dOertdaeirl.inTghe dPuatyr.ts agree that the Agencies" obligation to ssue this letter shall be deemed a non-discrtionary as 2. provided in SDeucPtoinotn'XsIoobfltighaitsioCnontsoaecnhtiOervdeearnsdhamllaisnutraviinvecotmhepltiearnmcienawtiitohnotfhte iScsreCeonnisnegntLevels Order. Parties Such obligation shall terminate only as provided in Section XI or upon agreementof the XIIL ADDITIONAL ACTIONS. `may det`TehremAignenthcaitesa,ddiintdiiovniadluaacltliyoon,r cboelyloecntdivtehley,tapsukrssuseatntfotroththinerthsitsatCuotnosreyndtutOyrdaenrd,aiustnheorcietsys,ary a10s prreosttercatinhinugmoafnphreeavletnhtianngd/tohretAhgeeenncviiersonfmreonmt.takNiontghsiuncghiancttihiosnsC.onNsoetnhtinOgrdienrthsihsalClobnesecnotnsOtrrdueerd cloianbsitliittuytietsmaasyathiasvfaectpiuornsuoafnotr1r0etlheeasfeedferroaml aCnlyeacnlaWiamtoerrcAacuts,eothfeafcetdieoranlaCglaeinasntADiurPAocntt, tfohreafnedyeral Safe Drinking Water Act, the Wes! Virginia Groundwater Protection Act, the West Virginia Air NPooltlhuitnigoninCotnhtirsoCloAncste,nottOhredresrtaitnutaensyawppalyiccaobnlsetittouttehsisammaotdtierf,icoartiWoenstorVwiarigvineiraofcostmamtuotnorlyaw. arcetqiuoinrsemneonttsspeocfifDiuePdohnetreiann.d nothing inthis Consent Order shall obligate DuPont to undertake any XIV. ENFORCEMENT. AgencieEsnifnorthceemCeinrctuoifttChoisurCoonfseWnotoOdrdCeorunmtayy, bWeeshtadVibrygitnihae.fliVnigooflaactoivfiitlohanecttieonrmbsyaanndyof the croesnudlittiinonesnoffotrhciesmeCnotnsaectnitonOrbdeeirngbytaDkeunP,onitncilsuadviinaoglarteiqouneostftohre cWievisltpVeinraglitncisa aCsosdeet afonrdthmbayylaw. DuPont shall condition. not be lable for violationsof this Consent Order du to any "Force Majeure" XV. CONTENTS OF CONSENT ORDER/MODIFICATION. in any a"tTthaecehnmteinrtestyoorfetxhhiisbiCtosnrseefnetreOnrcdeedrhceroenisni.stsMoofdtihfiectaetrimosn oafndthceontdeirtmisoansndstconfodritthiohnesroefinthainsd OCrodnesernsthOarlldebreimnacdleudoinnlgyabnyyamgordeiefmiecnattioofnotfhetPiamretifersamineswroirtidnega,dleixnceesptestthaabtlmioshdeidfiicnatthiiosnsCotnosaennyt 3 - 000642 Eotss207 MAHO00579  mreembqeursiorfestehmetoeGuIntStT oinrthethaettCaAchTmeTnetasmt,o 2tshiaspCproonpsreinatte.Ordermaybe made upon consensusofthe XVI. ADDRESSES FOR ALL CORRESPONDENCE. correspAolnlddeonccuem,etnotbse, siunbcmluidtitnegdruenpodretrs,thaipspCroovnaslesn,tnOotridfeircasthiaolnls,bedisseanptpbryovcaelrt,iafinedd omtahielr, return orercteoipsturcehqauedsdtreeds,sehsanDduPdoelnitveorry,WoVvDerEniPghmtamyaidlesoirgbnyatceoiunriwerritsienrgv.ice to the following addresses Documents to be submitted to WVDEP should be sent to: `13W5V6DHeapnasrftomredntStorfeeEtnvironment! Protection Charleston, West Virginia 25301 AAtttteennttiioonn:: DAeremaAnndno SBteanatisn,caPsha.,D.Esq Phone No.: (304) 558-2508 `Documents to be submitted to WVDHHR-BPH should be sent to: BWuVrcaDuepfaorrtPmuebnltiocfHeHaelatlhth and Human Resources C8h1a5rlQeusatrorni,crWSetsrteeVti,rSguiintiea42158301 Attention: Phone No.: W(i3l0l4i)am55T8o-o2m9e81y, ManaofgSoeurrce Water Assessment Program Documents o be submitted to DuPont should be sent (0: WE.as1.hdiungPioonntWdoerNkesmours and Company P.O. Box 1217 Parkersburg, West Virginia 26102 Attention: Phone No.: P(a3ul04B)o8ss6e3r-t4305 and 14 000643 Ent6s208 MAHO00580  1 daorcNemous nd Company L1e0g0a7lMDaerpkaerttmSetneete,tSuite D-71 Wilmington, Delaware 19898 APthtoennteiNoon.: B(e3r02a)r7Jd7.4-Re5i4l4l5y, Esq. XVIL. AUTHORIZED SIGNATORIES/NON-ADMISSION. review t"hTihseCuonndseernstigOnredderreparnedsehnatvaetihvaesd sotpapotrtthunaitthyetyohaalvleowhafdorftulhlearncdoufnasireolp0pordtountihteystaome, and the"rTehfeoruenednetresritghniesdCodnosheenrtcbOyrdceornffirreemlythaatndthweiythhafvuleltkhneoawultehodrgietyoftiotesntteerrmisnaontdhicsonCdointisoennst. Order aNnedihthaevretthheetaeurtmhsoroiftythoisbCionndstehnetiOrredsepre,ctniovreepxaerctuy.tionthereof hall constitute an aadnmdidsesfieonnsebsytDhuatPomnatyobfeaanvyaialcbtloeroinfaannyyplreogcaeleldaibnilgitiyn.volDvuiPnognhtirexdppraersstlcys roesienrvveoslvaillngights @ oWVrDEeP"ThaPinsadCioWsnYsseDnlHtoHOwRrd(-eBrEPmHtayienbeanDsyiigonteehderinmactouenrterparts ind shalbeeffective upon signature Entered this_ day of 2001, by: WEST VIRGINIA DEPARTMENT OF ENVIRONMENTAL PROTECTION BY. WWeIsLtLVIiArgMinEi.aADeDpAaMrtSm,enDtoEfPUEnTvYirSonEmCenRtEaTl APrRoYtection C1h3a5r6leHsatnosn,foWredsSttrVeeitr.ginia 25301 Entered this___ day of 2001, by: 1s 000642 Eo165209 MAHO00581  `WEST VIRGINIA DIVISION OF HEALTH AND HUMAN RESOURCES - BUREAU FOR PUBLIC HEALTH BY: co DR. HENRY TAYLOR, COMMISSIONER `West Virginia Department ofHealth and HumanResources e i 000645  Attachment A C8 GROUNDWATER INVESTIGATION STEERING TEAM A teamof scientists shall be assembled to assess the presence and extent ofC8 in d`rWionrkkisngfawcialtietry,, agnrdoutnhdewLaotcearl,anLedtsaurr,faacnedwDartyerRautnanLdanadrsoiulns.d tThheeDGurPoounntdWwaastheirngton IBnPvHe,stiEgPatAioRneSgtieoenriInlg TaenadmDu(PGoInSt.T) sDhuaPllonitncslhuadlel sfcinedntitshtesGfIrSomT WviVaDaEn Pes,cWroVwDaHccHoRun-t as provided in Section VIIIofthe attached Consent Order ("the Consent Order"). aDnidsbtuhresDemuePnotnstfrreopmretsheinstaatcicvoeu,nAtnshdarlelwbeS. aHuatrhtoreinz,ed jointly by the WVDEP GIST leader, Athescehnedoduflethsiusmdmoacruimzeinntg. key GIST tasks, submittals, start and end dates is provided at GIST Member Organizations/Represcntatives/General Functions WVDEP David Watkins-Groundwater Protection- GIST team leader; escrow funds Y disbursGeemeonrtgeovDearsshieghrt-;adpvriosjoecrtamnadntaegcehnmiecnalt raenvdiecwoordination Dee Ann Staats, Ph.D. advisor EPA Region II Garth Conor-seience advisor Jack C. Hwang - Hydrogeologist RogerRheinhartEnvironmental Engineer DuPont pArnodjercetwmHaanratgeenm-PernitncainpdalcoPorrodjiencattiLoenaodefrf/iHeylddriongveeosltoiggiatsitotnecahctniivcitailesr;eveisecwr,ow funds disbursement oversight. WVDHHR-BPH Public HWeiallltihaamdvTiosoormeyManager, Source Water Assessment Program- Bureau for a - 000626 Ee wARO000SE3 o GIST Team Objectives and Efforts and sur`fTahceepwraitmearrymoobnjietcotriivnegofatnhdeiGnvIeSsTtigiasttiooneffaictciiveinttileysre3sviperwesacnrdibdeidrecitn groundwater the Consent OtredaemrdaencdisiinotnhismaAktitancghmteonwta.rdThmeeeGtIiSnTg witlhle utrielqiuzieraempehnatssedinapparnoaecfhficainedntemapnldoytirmapeildy `pmeasnfnoerrm.edUbnyleDsusPoonttheorrwitsseredpirreescetnetdatibvyest.he GIST, the tasks outlined below shall be groundwTahteerGIquSaTliwtiyllinissauned a afrionualndretphorei(sF)aciwliitthes,finadnidngsthaendexctoennctluosfiongsroruengdawradtienrg croenctoammmiennadtaitoinonins arengdaradrionugndthethneeeFdacifloirtiaens.y fuTrhteherGwIoSrTkfoirnaalctrieopnosrtthsathanlleefdurttohbere mtaakkeen 10 assure protection ofgroundwater quality and human health into the future. performTehdebtyasDkusPsocnttfaorntdh tbheelGoIwSaTndpuirnsutahnet CtoontsheenCtoOnrsdeenrt are the Order. mAdidniitmiounmalttaasskksstmoabey. be necessary identification, to assure the and receptor igdoeanltsifi(fcualtliogn]rooufndtwhaetGeIrSaTssaensdsmtehnet CaonndseCn8t Oirmdpearct,areplmuemle Those tasks shall be agreed upon by the GIST. Key Tasks of GIST @ rai Groundwater seand WeSureGroundmate Monin + OabLj-emctiilvee(sa:nCdopnodsusicbtlyad2isatnadnc3e-m-iplhea)serdadgiarloudnidstwaantceerorwedlilreacntdiownaatlelry ufsoecussuerdvediyswtiatnhcein + ofthe Washington Works and Local, Leter, and Summary: The phased approach fo the water and Dry Run Landfills.' groundwater well use survey will acelalsoew atchteivGiItiSesTitnodfiorceucstieofnfsorwthsearleonigmpeascttabslairsehendotC8priemsepnatctortrwahnesproertthpeartehawraeys and malilnoiwmatlhecGonIcSenTtrtaotmioenes., eDvaatluaarteesutlhtesdtaatbal,esanwdildlebteergmeinneerattheednienxtactoiumresleyomfaancntieorn.to `The GIST released. will determine when the final groundwater well use survey shall be an agreed-toDutPhiorndtpaargtrye,esa tgoropuenrdfworamt,erunudsecratnhdewseulplersvuirsvieoynoifdtenhteifGyiInSgTanadndsatmhprlouignhg atlhlegWraosuhnidnwgattoenr wWeolrlksswiftahciilnitay.1-Tmihleeprhaadsieusd oafptphreoatchhremealyanbdfeialsmesentdefodrtbhyabthoeveGIanSdT sohfoquuladliftiyelsdacmopnldiintgiopnosinrtesquwiirteh,ine.tgh,e lack ofsampling 1-mile radius. wells in the 1-mile radius, lack `measuring tShaemCpl8icnogncsehanltlrabteiopnerifnowramteerd.wiSthhouthledscpoencciefnictrpatiuonrsoopffCfoi8nsdfioenugndanind `groundwater wells exceed 1 ug/l within the I-mile radius, the GIST wil determine Jee ON a2 000647 eptesz1z MAHO00S84  wdihreetchteiorntoonelyx.panDrditnhkeinweglwlasteurrvweeylltso ath2at-mmielaesraudriuasb,oav3e-m| iulge/lrasdhiaulsl,boerrien-asasmppecliefdicat a frNeoqtuee:ncTyhteo bleevedletoefrm1 iunge/ld ibsyuttihleizGeIdSTin.this Consent Order for monitoring paudrjpuossetsaesodndleytaenrdminnoetdatshae bGeInScThminarfkurftohrerdaentceeormfintihnegtarsiksksaannddtohbijselcetvievlesmaseyt bfoerth in TitmhiisnAgt:taTchhmeeinntital well survey withina 1-mile radiusofthe Facilities will be `scuornvdeuyctaecdtiwviittiheisnw6i0l dbaeycsoofndtuhceteCdonosnena tscOhreddeurl'es tEoffbeectdievteerDmatien.edAbddyitthieonGaIlSTwe.ll Task B: Assessmentof Existing Groundwater and Surface Water Monitoring Data * Oabnjdecetixvets:oefnDCet8veilnodprainndkiingmpwalteemre,ngraoumnodnwitaotreirn,gpanldansutrhfaatcedewtaetremrininesantdheaprroeusnednctehe cWoamsphiilnagtiioonn oWfaolrlksavfaaiclialbitlyeagnrdouLnodcwaalt,erLeltsaurrtf,aacnedwaDtreyrRmuonnitLaonrdifnigllasnadnhdypdrroovgiedoeloagic + cShuamrmacatreyr:izaTthieonGdIaStaT fwoirlebaechftaacsikleidtyw,ietsh raenfleexcpteeddiitnedTaebvlaeluAa-tLionofexisting historical dcaotnatiannudinhgygdrrooguenodlwoagtiecrimnofnoirtmoartiinogn einndodaenyratdodpirtiioorniatlizientvheestiingiatitailonscaoctpievoitfiwesor(ek.gf,or pmroonviitdoerianllghwiesltloriincsatlaldlaattaioannsd) rheyqduriorgeedoluongdiecr ipnlfuomremaitdieontnifiitcmataiyon.havDeuProelnattesdhatlolthe Facilites. Taniamliyntgi:calWiatnhdinfa3ci0lidtayyhsyodfrotgheeocloomgpilceitnifoonromfatTiaosnktoA,dettheerGmIinSeTthweilscroepveioefwwaollrtkhefoCr8. sscrhoeudnudlweatfoerrtmhoonsietaocrtiivnigtiaesn.d addiistiaonntailciipnavteesdttihgaattiaons.umTmhaerGyoISfTallwihlilsttohreincaelstablish a Oirndfeorr'msateifofnecftoirvecadcahtef.acility willbe submitted to GIST within 60 days ofthe Consent Task C: Plume Identification/Groundwater Assessment + Ogbrjoeucntdiwvaet:eDreetxecmeiednientghe1 vuergtiocarlaasnddirheocrtiezdonbtyaltheextGeInStTo,fawnhiycahnmdaaylldCe8teirmmpiancetead Tiomwpearcttehdregsrhooulnddtwhaatner1 uagt/lL.etaTrhtisLatnadsfkilslhaalnldalistsoiimnpcalcutdeoanntahessOehsisomeRnitvoefr Can3d public + Swuatmemrarsyup:plTiheseaGlIoSngTtshhealrlivefirr.st review historical data and results ofTask A to dgertoeurnmdiwnaetearn palpuprmoepsricaotnetrsicboupteiongf{w0oorrk.witAhcttihveitpioetsensthioaulltdobfelporwiotroiwtairzdedotfof-asditderess rweacteeprtosrosu,rcwei.th emphasis on those arcas where groundwater is usedgs a drinking as 000648 Etes21s MAHO00585  `Upon completionofinvestigation activities, DuPont shall provide the GIST with p`mriegdriactitoend. groundwater flow and contaminant transport models to assess future plume + Tbpriyimoitrhniegt:iGzIeSUpTpl,ounmthereeiGdveIineStiwTfoifwcaialltlilocna.ovmapilleatbleeainnfionirtmiaaltieovnalaunadtioonnofscdahteadutloedetotebremdienteearnmdined othe`rThacetitviimtiiensgwoiftlhebeinointiaal spchhaesdeuolfe epsltuambeliidsenhbteiyfdictahteiGonI/SiTn.vesFtuirgtahteironinavcteisvtiitgiaetsoraynd abcetipveirtifeosrnmeeeddbeyd aDnudPoangtreoednatoscbhyetdhueleGIesStTabtloischaerdrybyoutthethGeIgSoTa.lsof the GIST shail M`Aondyelanidngall modeling performed pursuant to this attachment and the Consent Order sGhIaSlTl.use Groundwater Modeling System, or some other model as approved by the a 000849 Enisszis MAs000SES  TABLE A-1 [FT COMPILATIOONFWISTORICALBATAAND MONITORING FLAN a Dependentuponthe [+ A Tocation map. aivnafiolrambaitliiotnyo,fancertain | + historical deta summary| mwAaotnsieitrteosmruiapnppglsywehwloilwtsih,nirngesatihde1e-nlmtoiicalaletigroarndooiuufnsdatlwlhaetkFenarcoiwwleinltilgessr.aonudndpwuabtleirc dthoactuimneclnutdeesd: in areport | + Tsoapm-polfi-nggrloiufendowfatthesrimtaepasn.d Tshheousledsbheounlod lsepasnthtahne eynetairrley:: 17DuPont then these has only one maps should year's be for worthof data each quarter; for a given site, if DuPont has csaevnebraelaynenaurasl.worthof data for each site, then these maps + C8 concentration contour maps. These should span the ygeeinatvrielrnye.ssiatIemf,pDltuhiePnnogntlthifeehsoaefsmtoahnpelsysisothneoeaunlyddeasbrh'esofuwolrodrctbahechnoofqudlaaertstasertf,ohraifna tDhuePsoenmtaphasscsaenvebrealanyneuaarls. worthofdta fo each ste, then + All the C8 groundwater data that has bocn collected to dae. o T"Thheessee tdaabtlaesshsohuoludldbeusseubtmhietmteetdhionde,a"s<yx-"to,-rtoeaddestaibglneas.te all concentrations below the laboratory's minimum detection limit (not "ND" or some other abbreviation), and they + tushhneoaurlbedalsueosnetso"wpmhrgoy/v"iitdoeirst"uhunega/ab"bloeavsteothdgeaattuahn,eirtDuadPensodingstnuabtshimaoilntl. tdhoecument | A growndwater + monitoring plan for the| iCn8fosrammaptliionng. The samples should be taken From all the wells at the three landfil sites and from a select numberof Facilites which should | wells atthe Washingion Works plant, These sleet wells address, ataminimum: | | admarotenait/toibonrfeoirncmghaotpisroeonng.rbaTymhetbhefegriGenIqsuSebTnacsbycedfoofornesaetmhvpeallgiuranotgiusonhndaowlflahtbiees.rtorical - ! mDaotnethalnyd fqouratrhterflrystthferoeuarflmeorn.thAsnyfonlleowwiwneglltshereEqfufiercetdivfeor minotneigtroartiednginorepalcuhmseitei'dsegnriofuicnadtwiaotneprumropnoisetsorwiinlgl pberogram on a schedule agreed to by the GIST. as 000850 eoisszis MAHO000587  | | | + R'eWpVoDrtEoPfGRreosuulntds.watReerpoPrrtoignrgasmhoautltdhebefoqlulaorwteirnlgyaaddnrde1s0sthe GWrVouDnEdPwatDievrisPiroongorfamWater Resources C1h2a0r1leGsrteoenn,brWieesrtSVtirreegtinia 25311 Re: DuPonyCB monitoring Each report should include the following: (@) Asite location map. well loc(a6t)ioAns.site map showing the groundwater monitoring. () A top-of-groundwater map. (@) A C8 concentration map. (e) Groundwater elevation and well screen data where a(vfa)ilAablteabilnefooframlaltithoen hailsltoowrsi,caalbCbr8evsiaamtpiloinsngshdaotual.d Nnoote:be aunsedd"1p0pdme"sisghnoautledNnootDbeeteucstedc.oncentratiaonds the units "ppb" (@)CLahboiratnoryaansalysis shects. a6 000651 _ eoteszie MAHO00588 @ Humes Name Address: | : GROUNDWATER WELL USE SURVEY Phone: Best Time to Contact Owner: 1. DInooy,outohpanvoewonacndorrmeotruemwsautrevreyw.ell(Yse)son_t_hi_s properNtoy?_(I_t_n_eed not be in use curently.) County Water Well PemitNo. 2 Isthe well(s) curently circle one) used unused or filled in? @ eel ud brining ied Yes No 4. Isthis well(s) usedforother purposes? IFyes,pleasespecifyuses below: 5. Whats the approximate frequency ofuse? Circle One: Daily Weekly Monthly Summer 6 Dauclastused? 7. Isthereapumpinthewell? Yes No s8.ystem?IstheraYeecson_di_ti_oner, Nsooftener, chlorinator, filter, or other formof treatment for the If0, what is the formof treatment? B1 000652 Eoisszir MARO00SES @ 5 tein sy cer whorewater docs no fst as hough te csmentsyst? Yes No___ Ifyes,isit (circleone) inside or outside? 10. What year was the well constructed? 1. Please provide thefollowing information regtahewrelld(s)iifknnogwn: (cir one) A. Total Depth (feet below ground surface) 30-60 60-90 90-120 120 or more B. CasingType: PVC steel stone none other C. Well Construction: dug drilled openoruncased bedrock o D. Sercencd Interval (lengthin fect): 010 1020 2030 30-60 60ormore: E. WellDiameter inches): 06 612 224 24 ormore: B2 - 000658 Enteszis MAIH000590  Attachment C C8 ASSESSMENT OF TOXICITY TEAM health aAndttehaemoenfvsicireonntmiesntts ashsaslolcibaeteadssweitmhbleexdpotosuarsesetsosatmhemtoonxiicuimtypaenrdflruiosrkotoocthaunmoaatne "(TCe8a)mr)eslheaaslesinfcrloumdeDuscPioenntti'sstsafcirvoimieasc.adTemhieaC,8goAvsesremsesnmte,ntnoofn-TporxoifciittoyrTgaenaizmat(iConAsT, and iNnidxuosnt,rya.s TahreepCreAsTentTaetaivmeoaflsWoesshtallViirngcilnuidae'sthceitWizVenDs.EP Environmental Advocate, Pam contract`TwhiethWVanDoEn-Pp,roufiiltiozrignagnifzuantdisonf,rotmheaNnaetisocnraolwIancstciotuuntte ffournCdheedmbiycaDluPSotnutdi,esshall T(aNyIlCoSr),,Pfho.rDt.heTsheervNiIceCsSdeshsaclrlibseudbchoenrterianc.t PwoiitnhtoMfarcsohnatlalctUnfiovretrhseitNyI'sCSCesnhtaelrl bfeorJRaunral aM.nDd.Enavnidrohnismesnttafa.l HDer.alBtehcfkoerrsesrhavlilcefsamiinlriiasrkizceohmimmusneilcfawtiitohntphreotvoixdiecditbyoyfJCa8m,esthBeecwkoerrk, pinerrfisokrmceodmmbuyniTcEatRiAona.s dTehsecrNiIbeCdSheshraeliln,suabncdonattrtaecntd pwuibtlhitchmeeneotni-npgrsoftiotpsrcoievnitdiefiecxpertise coorngtaancitzaitsioJno,anToDxoilclaorlhoigdye,ExPche.Dl.lenTcheefoTrERRsAk sAhsalslespsrmoevnidte(sTeErvRiAc)eswihnotsoexipcooilnotgoyfand risk assessment. Work assignments, tasks, and deliverables are described below. CAT Team Member Organizations' Representatives'/ General Functions WVDEP Dec AnndiSstbauartss,emPehn.tD.ov-erSsciigehntc,eprAodjvecitsomra-ntaegaemmelenatdearn;descocorrodwinfautnidosn; toxicologyrisk assessment and communication; Pam Nixon - Environmental Advocate- advisor; NICs Jan Taylor, Ph.D. ~contractor administrative oversight; James Becker, M.D. (Marshall University) - consultant in risk communication; TERA (pointofcontact: assessment; Joan Dollarhide, Ph.D.)- consultant in toxicology/risk qualifcarons. ci 000654 Eotss219 MAHO00591 Dubont Gerald K~ernenveideyw,erDitroexcitcoorloogfy;ApepslcireodwTfouxnidcsodliosgbyuarnsedmHeenatltohv,erHsaisgkhte;ll Laboratory John Whysner, M.D. toxicology/risk assessment and communications; Paul Bossert ~ Washington Works Plant Manager - communications; The following membersof the CAT Team shall ct s reviewers or advisors. WV Department of Health and Human Resources - Bureau for Public Health (WVDHHR-BPH) WBairlblairaam TTaoyolmoe~ry ~DiMreacntaogre,rO,ffSiocueorcfeEWnavtierronAmsesnetsaslmeHneatlPtrhoSgerravmic-esad-viasdovri;sor; Local representative - advisor; Eavironmental Protection Agency (EPA) o RTeeagdigounarItlerPshi-lJaedoenlipfheri-aSeed - reviewer and advisor toxicology; SamuelaRsosteesnsbmeerngt,; Ph.D. ~ reviewer and advisor toxicology risk RGaorgtehrCRoeinnnhaor-tr--ardevviisoerwehrydarnodgeaodlvoigsyo;r Safe Drinking Water Act; Cincinnati - John Cicmanee, DVM - reviewer and advisor toxicology; Agency`AftolranTtoax-iJcoShunbWshteaenlceers,aPnhd.DD.i-seraesveieRweegrisatnrdya(dvAiTsSorDiRn)toxicology risk Philadelapshsieass-mLeonrta; Werner - coordinator for ATSDR; Non-CAT Team Efforts TeaOmthteorwielfifzoer.tsTahee cCuArrTenTtelyamunwdielrwcaoyorwdhiincathemaanyd pcroomdmuucneicianftoermcaltoisoenlyfwoirtthhethCesAeT - other efforts. These include: 1. Dupont's sic modelingof C8 emissions from the Washington Works plant; 2. WVDEP's air modeling ofC8 emissions from the Washinglon Works plant; c2 000655 Eots6220 MARO000SS2 @ r3egUaSrdEiPngACD8r,afttotHhaezaxrtdenAtssceosmspmleenttedwphriicohr tsoumthmearaiszseessstmheentavcaoinlatbelmepltaoxtiecdithyerienifno,rmation w4.itAhTCSBDiRn'dsriHnekailntghwCoanrsulftraotmiotnhethLautbeesctkimPautbelsitcheSerrivsikcteoDtihsetrciocmtmountihteyexatsesnotciated completed prior tothe assessment contemplated herein. 5. Existing C8 concentrations in Lubeck Public Service District da. U6.seGrSouurnvedywa(tsecre eCx8aAmnpalleyssuirsv(esyeeinGAItSaTcahcmtievnittieBs)daetstchribreedsiindeAntcteascihnmtehnetaAre)a oafndthWee3ll Jandsillsand the Washington Works lant. Tasks ofCAT Team in more"dTehteaitlasbkeslotwo.beTpheersfeortamsekdsbayretdheisCcuAsTseTdebaemloawewidtehsicnrihbeedcborniteefxlty oinfaTaSbeloepe1,oafnd Work for both Dr. Becker and for TERA as wll remmirineii, ie hose taTsakssknsecoefstshaeryCtAoTprTeepaarmesfhoarllanbdehoorlgdantihzeefdrsnttoputbhlriecempeheatsiensg.. PIhnasPeha|sienIcTl,uTdeEsRA hstuumdiaens;hdeealvtehl;oepvianlguPartoivnigesxiiosntailngReifnefroernmcaetiDoonserselaatnidveSctoreeecnoilonggiLcealvehlesalfotr;parnotdection of ccoonncdeuncttriantgioonnsetgoeSneerranliinsgk aLsesveelsss,mefnort tihnevotlhvrieenglcanodmfpialrsiasnodnstohfe Weaxspohsiunrgeton Works fPlianndti,ngasn.dPthhaeseLu1b1eickncPuudblsicthSoesrevitcaesksDisntercicets.sarTyEtRoAprsehpaalrleprfeopraarnedahroelpdorhteonsetchoenrd ppurbelsiecntmeedetiinntgh,e sTehceonrdsupulbsliocf mteheetCinSg,grounder analysis and risk asessment shall be TERA sNhaollcobmempuenrimciattteidonwibtehtowuetetnheDpuaprotnictipraetpiroensoenftDart.iveSstaatns.d NAIClS,inDfro.rmBaetcikoenrw,ilolr be fproovtidbeyd DtoupDor.ntBeshcaklelrbaensdenTtEiRnAtribpylicWaVteDtEoPDr;. tShtuasa,tsallfoirnffoorrmwaatridoinngcotnotDrri.buBteedck0erhaend TERA Phase I TASK A-L: First Public Mesing shall oc"cTuwroinpuPbhlaiscem1eeftorintghseaprurpaonsteicsiopaftiendtfroordutchiisngprtohjeecCt.ATThTeeaFimrsatnPduboltihcrMeisnvtoilnvged @ LpuaberciktsoPutbhleicpuSbelrivcicreeplDaeitsitnrgichtiswtaotreicraasluipnpfloyr;mniatnifmoonrmoeinngprtbheeviccoiutsiizceonesnocfaetnheftreniastuoieifnoCgnn8ssin efforts in the Groundwater C8 Analysis and Well Use Survey. In order to prepare for he cs 000656 etenzzt A000593  First Public Meeting, CAT Team members shall familiarize themselves with the available toxicological information concerning CS. A CAT Team meeting shall be held immediately prior to the first public meeting 10:(1) conduct a sit visit to the three landfills and the WashingtonWorksPlant, and sumounding residential areas; (2) discuss the toxicity ofC8 and other pertinent data; (3) p`mreeeptairneg.anFiangaelnlyd,atfhoerFtihrestpuPbulbilcicmeMeeteitnign;g(w4i)lcloboerdhienladteaannddpupbrleipcarqeuefsotritohnes paunbdlic `comments will be recorded by WVDEP. --_-- TABLE 1. TASKS OF CAT TEAM | | "OTbajsekctAi;veP:ub0liicnMfeoertmitnhgesl(otcawlocmietcizteinnsogfstahrceafnotilcliopwaitnegd:)(inMeeting#1) inten to perform | a groundwater well and 0 ask for their cuosoepesruartvieoynainndcaonnadluycstiisnfgorthCe8w;aitnetrenutsteosduervveeyl;opanSdcr(eiennMiencgtLienvgel#s2;) resultsof survey, chemical analysis, and risk assessment. Note thal an interim public `meeting may be required should six monthspass from the frst public meeting and the `CAT Team Final Report has not been issued. Primary Responsibility:Staats "Task B: DevelopmentofProvisional Reference Doses o Objective: 10 develop Provisional References Doses for C8 for the inhalation and iPnrigmeasrtyion (Reasnpdodnesribmialli,tiyf:poTssEiRblAe) roouf texpeosusre. Task C: Developmentof Screening Levels Based on Protectionof Human Health SObcjreecetniivneg:LteoveultsilifzoertCh8e Pinroaviir,siwoantaelr,Reafnedrseonicl.e DNoosteesatdoedteevremlionpathiuonmaofnthheealptohternitsika-lbased carcinogenicityof C8 will be conducted as well. Primary Responsibility: TERA oo Task D: Ecological Data Review | Objective: to review available information odetermine whether sufficient studies have | been performed and data have been collected to develop screening criteria for ccological |rePcreiptmoarrsy. Responsibility: TERA | Task E: Draft Report and Final Report OPbrjiemcatirvye:Res(p0opnrseisbeinltitayn:d TdiEscRuAss the resultsof the above tasks SPchraeseeniIIngTasLkevselsB,, aC,ndD,RiasnkdAEssDeesvsemlenotpmen ofProvisional Reference Doses and In Phase I, TERA shall conduct the toxicological and risk assessment activities. o TAEeRrAhashvailnlgcronesvuiletwewditthhetotxoixciocloolgoigsitcsalonintfhoerCmaAtTionTeraemga,rdasincgooCr8dipnraotveiddebdybDry.WSVtaDaEtsP,, regarding its proposed approach for this project. Following such consultation, TERA 000657 ce eoies2zz MAHO00594 o sphoaslslibdleev)elroouptePsroovfiesxipoonsaulrRee.feTrheennceTEDoRsAesshfaolrlCc8alcfuorlattheeSocrarle,eninihnaglaLteivoenl,safnodr dweatremra,lsioifl atinsdk aaisrsbeasssemdenotnitnhveolrvisikngfaccotmorpsartihseoynhoafveexepsotsiumarteedc.onTceEnRtrAatsihoanlsltpoeSrcfroeremnoinnge gLeenveerlaslfor tDihsettrhircteelwaantdefrilsluspaplnyd, tthhaetWfaoschusiensgioonncWurorrekntsrPilsakntt,o ahnudmathnehLeuabltehc,kiPnucblluidcinSgewrovrikceers and rleasniddeunstes,. suTrhfiasceriwskataesrseasnsdmgenrtousnhdalwlatienrcluusdee;:((21)) iiddeennttiiffiiccaattiioonnooffrerceeapstoonrasb;ly(3a)nticipated cidoemnptairfiicsaotnioonfofexepxopsousruerecopnactehnwtaryatsi;o(n4s)tiodaepntpirfoipcraitaitoenoSfcerexepnoisnugreLecvoenlcse.ntTraEtRioAnss;haalnld (5) gurioluznedwdaattaerobCt8aicnoendcfernormattihoenostihnerreesfifdoernttsidalisacnudsspeudblaibcovweellssu;chreassidaeinrtimaoldeglrionugn;dwater wCeolnlsuulsteatsiuornve(iyf;avtahielaUbSleE)P.A'TsEDRrAaftalHsaozsahraldl Arsesveiseswmeanvati;laabnlde AiTnfSoDrRma'tsioHnetaoltdhetermine wschreetehneirngsucfrfiitceireinatfsotrupdrioetsehctaivoenobfeeencopleorgfiocramlehdeaalntd,dpaatratihcauvlearbleyeanqucaotlilcecltifee.d toTdEeRveAlop sshuamlmlaprriezpaerset2hderdaafttaauntdilaizefidnaflrodmocoutmheerntcftfhoatts.disAcsustsheesttahseksroesfultthseofCAthTeirTeefafmoratsndanodther ievnivdoelnvte.dTphaersteiss'haplrlogbreesisn,clduadteadgianpsTEanRdA'rsesreeaprocrhtraescsoumgmgeensdtiaotnisonfosrmfaurythbeercroemseearch to elucidate the toxicityofCS. Phase Il Second PublicMeeting ofthe ef"fTohretspourfptohseeGoIftShTeaSnedcConAdTPTubelaimcsMeienctliundginigs 0C8prceosnecnetnttroatthieocnistiinzegnrroyutnhedwarteseurlts afsrsoemssrmeesnitd.entAiiarl mwoeldleslianngd rpeusbulilcs woefltlhsetehfefosrctrseoefniWngVlDevEePlsaannddDtuhpeognetnewrialllibsekdiscussed also. The WVDEP will address any futher actions that may be necessary. cs - 000658 Enteszzs MAHO00595  SJCAOMPEESOBFECWKOERR,KMF.OD.R Dr. Becker is a medical doctor speciianelnviirzonimenntagl health at the Marshall University SchoolofMedicine Center for Rural and Environmental Health. He wil be assisting the WVDEP in his specialty area of risk communication at the two anticipated public meetings. The specific tasks assigned to Dr. Becker are described below. Phase I Task A-1: First Public Meeting Dr Becker will assist in preparation for the first public meeting, and attend the meeting providing expertise in risk communication. He will familiarizehimselfwith the eavmapihlaasbiles toonxitchoeloegpiicdaelmidaotlao,giwchailcshtuwdiilcls.beNportoevitdheatdtthoehtiomxibcoyloWgVicDaElPd,atawiatlhrepaadrytihcauslar been summarized in the Draft Hazard Assessment prepared by USEPA. No literature search or document retrieval will be required. Specific sublasks required in Phase I to prepare for the first public meeting are described below: `Subtask 1 - Familiarization with toxicological data provided by WVDEP including but not limited to: o a. 8 compactdiscs of information provided to USEPA under TSCA by 3M Corp (note only a small portionof this information concerns C8); b. Draft Hazard Assessment document from USEPA; .d. AJoCuGmIalH aTrhtricelsehsoalnddLoitmhietrVianlfuorem(aTtLiVo)n.provided by WVDEP. `Subtask 2 ~ Attenad meting prior to the first public meeting to: a. conduct asite visit ofthe 3 landfills and the Washington Works Plant, and local residential arcas; b. discuss and prepare an agenda; c. discuss the toxicology and risks associated with C8 with the other CAT Team members. . Subtask 3 ~ Attend First Public Meeting Phase I Task A-2 Second Public Meeting Dr Becker will assist in preparation for the second public meeting, nd attend the meeting providing expertise in isk communication. The following sublasks will be required: `Sublask 1 ~ Familiarization with the toxicological and risk assessment report prepared by TERA; cs 000659 emteszze MAHO00596  bt 2 ted a mesorrto he scond pli mcg: a. discuss the toxicology and risks associated with C8 with the other CAT Team members; b. discuss and prepare an agenda. Subtask 3 - Attend Second Public Meeting Note that the second public meeting is assumed to be the final public meeting; however, resultsofdata collection may warrant additional public meetings and an expansion of the. Scope of Work 00066e c7 Ent6s225 MAI000597  SCOPE OF WORK FOR TERA TERA (Toxicology Excellence for Risk Assessment) is anon-profi organization that applies sound toxicological data o the isk assessment process to find common pgrroovuinddinbgetsweerveinceesnviinrtoonxmiecnotlaolg,yianndudsrtirsyk,aasnsdesgsomvenetm.meTnEtRgArouscpise.ntiTsEtsRwAillwiblel be developing risk factors and screening criteria; and conducting one general risk assessment for the 3 landfills, Lubeck Public Service District water supply and the Washington Works Plant. The specific asks assigned to TERA are described below. Phase Il Tasks B,C, D, and E: Development of Provisional Reference Doses and Screening Levels, and General Assessment of Risk Subtask | ~TERAstaffwil familiarize themselves with the toxicological data provided to by WVDEP. No literature search or document retrieval will be required. Toxicological data to be provided to TERA shall include but s not limited to the following: a. 8 compact discs of information provided to USEPA under TSCA by 3M Corp (note only a small portionof this information concerns C8); b. USEPA Draft Hazard Assessment for C8; o c. JDouuPomnatl.articles and other information submitted to WVDEP by Subtask 2 ~ TERAstafwill: a. diedveenltoifpyinalglRpeofsesribelnececrDitoiscaelstfooxrictohleoogriacla,lisnthuadliactsiosnu,itaanbdledefrormal (if possible) routes of exposure; b. outline methodology for developing said Reference Doses and for developing Screening Levels for air, water, and soil based on said sRuebftearseknc2e-2D;oses corresponding to cach critical study identified in c. tchoenivrefniendainmgeseitninsgubattatshke2T-2EaRnAdfa2c-ibl,itaynidncoCnisnuclitnnwaittih, COhAiTo,Tteoapmresent toxicologists as coordinated by Dr. Staats; d. finalize Reference Doses and Screening Levels based on recommendationsof the CAT Team toxicologisats coordinated by Dr. Staats Subtask 3 ~ TERA shall conduct one general risk assessment for the three slaunpdpflilylsbaasneddWoanschuirnrgetnotnisWkortko shuPmlaannt,haenaldtht.heTLhuibseicskkPausbsleiscsSmeernvticsehaDlilsitnriccltudwea:ter a) oidaenntiifvicaateisonovferseasonably anticipated land use, surface waterand cs 000661 Etesz2s MAHO00598  b)) iiddeennttiiffiiccaattiioonnooffreexcpeopstuorrse;pathways; 4) ) icdoemnptaifriicsaotinoonoffexepxopsousruerecocnocnecnetnrtaattiioonnss0; appropriate Screening Levels; TERA shall uilize the following data in th risk assessment process: ba)) aaiirr mmooddeelliinnggddaattaa ffrroomm DWuVPDonEtP;; 0)) wgartoeurnduwsaetdeartadaftraofmrtohmetWheelGlrUousnedSwuartveery;Well AnalyosfiCs8 for residential ) wdreilnlk;ing water data from Lubeck Public Service District well; 5) aefnfyecatvsaiflraobmleeAxpToSsuDrRe oHeaClBthinCopnusbullitcastuipopnltyhdatriansksiensgsewseprot.ential health sufficienStubitnafsokrm4at-ioTnEtRoAsusphpaolrltrtehveiedwevtheeleocpolmoegioncftalCda8ta SacnrdedeentienrgmLienveewlhefotrhperrotteecrteioins ofecological health @ comSmubetansk p5 o~ rTE(RGAnshaanlldcfomopirlesiaondnsdi)scwuhsiscthheshreosuelisfof2thedabopvreovtaisdkessainrtoiat summary of the following: 5b)) UDSEuPA'PsaiDorramfnotdHeatlzianr'gddaAstsas;essment ofC8; <0)) WgrVoDuEndPw'astearirdamtoadferloimngtdhaetGs;roundwater C8 Analysis and Well Use Survey of ) LAoTcSalDRResHiedaelntths,CoannsdulLtuabteicokn tPhuabtliacseSsesrevsicpeotDeinsttriiaclt;health effects rom exposure to C8 in public supply drinking water, if available for futuAreddrietsieoanraclhlyg,leTaEneRdAdsuhrailnlgitnhcilsupdreoicnestshethraetpowrotualndyfiunrstihgehrteslourcirdeacteomtmhentdoaxticiiotnysof Cc8a.rciAnlosgoe,niTcEitRyAofsCha8lli prroavsid0e ihunmtahnesr.eport of summary discussionof the relevance the 00066 co Eteszzr 1AH000599