Document V5Xqq48x8n1xkmm59D9zyBZK

DownloadRandom document
rSRiPsTaT6295, T-6889.1, T6316.4 AR226- 190 3M MEDICAL DEPARTMENT, CORPORATE TOXICOLOGY Title: Inter-Species ComparisonofMechanisms Fluorochemical Toxicity following Intraperitoneal dosing of perfluorooctanesulfonate (PFOS, T-6295) or ammonium perfluorooctanoate (APFO, T-6889) in Rats and Guinea Pigs and oral dosing of N-ethyl perfluorooctanesulfonamido ethanol (N-EtFOSE, T-6316) in Rats. Final Report Date: May 25, 2004 Study Numbers. T-6295.8, T-6889.1, 6316.4 `Strategic Toxicology Study Number: DT15-A Sponsor: Study Location: 3M Specialty Chemicals Division 3M Center, Building 236 Saint Paul MN 55133-3220 3M Strategic Alternative Toxicology Laboratory 3M Center, Building 270-SB-181 Saint Paul, MN 55133-3220 Study Director: Andrew M. Seacat Ph.D., DABT Toxicology Specialist 3M Medical Dept. Corporate Toxicology and Regulatory Services 3M Center Building 220-2E-02 Study Toxicologist: Deanna Luebker M.S Senior Toxicologist 3M Medical Dept. Corporate Toxicology and Regulatory Services In-Life Start Dates In-Life End Dates In-Life Start Dates In-Life End Dates In-Life Start Date In-Life End Date Part A: Part A: Part B: Part B: Part C: Part C: 10/23/1997 and 11/17/1997 11/04/1997 and 12/1/1997 02/10/1998 and 03/11/1998 03/10/1998 and 03/13/1997 09/16/1998 09/18/1998 CONTAIN NO CBI 1 S DSRTPITTS-A6295.8, T6889.1, T6316.4 `ToafCbontlenets Part A: Procefdoruarsienglse intraperitonealdosingof PFOS(1.6295)and APFO(T-6389)inmaeratsand. Fn: rons or olloawiniglneig. 3 Tonos ofEOS JECtION OFPFOS A 140 1639 4056. ry i ed ol id sos ssc is REPa3rS0Ct0DPIrUSoCcUeHSdSuIrOeSNsvfo1rhepaticperoxisomalgene inductionfollowingoral dosiengofsN-EWs FOSEein rs ts. 6 ] PaRretsuAltRess:RulatssoPnarttheA.Toxicityofs PFOSam nd APm FOin ae 1 and-- Guinea-- pgs ----o --elr] ? Liversamplessubmittedfor L-F ABPanalysis fromratsand guineapigs estedinPatA. J ParRtEBS:RUeSsuRlAtIsSoPfTAiBme-Coc urseofPFOn Stoxicityatn twodosesin maleand femaleratsan incapigs. -... PResulaCt:s:RreGsutltus pOiirgasldnPosaitenBgoaf ratsWith20T/KE N-EIFOSE rrr 10 PtA. HStOPBOIORYREPOTL........ someones 12 T"aTbalblee21. PPaarrttAA.. SSumumamrymooffaTTooxrxiicciyittyyooffPPFFOOSS aannddAAPPFFOOiinnmmaallee guinearat. pigs......................1143 ``TTaTabablbellS34ee.. PPPaaarrrtttBBBL..iSSvuuemmr1mm0aaBrroyydooyffBBWooeiddgyyhWWtTeei2igg1hh0tt8ss1i0nn RGautisn,eaMFPeaiatgnsss.,a.M.ne.d.a.nS.ts.dvaDrneovdsiSsatetdeirDonenevsnisaeteieonnes........--..................111765 FiFgiugruer2e:1:PPaartt BB::FMeamlaelReaRtaBtoBdoydWyeWiegihgtVhtsVTSiTmei.e........_.__.__._.__.__.__." .ooooorT mroerreg re 13 FFiigguurr34ee::PPaarttBB::FMeamlaelGeuGiuninaePaiPgiBgoBdoydWyeiWgehigthVtSV3 Fig4:uParteB:MaleGuineaPigBodyWeight VsTime. THTiIme.e..........c.erereroes 2200 __._.........oooeermroerrorrnn 2] AADpPpEeDnGdEiI1Xxl.PD artAE : TV 1o0thxO OPIfiOPIN FOcORSOLainr dtAPFyeO dsis vnidSdUmuMyal Daher 2223 ApPpPAaerTntEdBiA.x:IGIn.ivUiPdaIuarPlBtNI:RaETEtimoRteacTGBR.oHNuWGirOtUhTPsFOWeiSt.hPIRnOGSI.VA.cU.esleDatao ..ovson vecere ee272257 PaPsrttBB..LMiavleerrWteLWi/goBWBhodty0WeSigUhtIatoRinImalYeacndf.emarleorasrcoembienedodstea SeASnanaelysnis PartB.FemalraetLiverweight summary... TT 3208 PaPrartBt..KFiedmnaelyerWateLWiBtgoWBhroadttyioWeSiugmmhatrrya.t.io.in male and female ats combineddata,SAS analyst. PorBt. GUAPIE: INGVGUA DBAs omnes 3368 PPartaBB..KGriudinnteeayPWiegigLihvterto B0oBdoydyWWeiegihgthrttRiaotiinomSaulienaanrdyfemaleguineaSiUgts.siSeAsSat.n.a.l.y.s.iorsr.r.. Appendix IV.Part COraldosiwnitgh N-iE nrtsF .IndVO iduslSstE . ers 4319 3 2 DSRTPITSTA-62958, 6889.1, T6316.4 Introduction pTehreoxriesseoamraclhpprroelsiefnertaetdioinn tinhirsatrse,pobrutt wnaotsndeecsesisganreiltyoienlguuciidnaetaeptihgesmoercphrainmiastems(,s)bythsaotmineit3iaMte ffluunocrtoicohnoemfilciavlesr.fTahttey raecsiedabricnhdoibnjgecptriovteesinwse(rLe-toFAdeBtPe)rmiinnbeoitfthhraetsflaunodrogcuhienmeiacaplisgsdaisnrduipftsoth,eto a`lwtheartLex-tFenAt.BPThleeveilnstearnmde/doiratfeunocbtjieocntaliivteys awnedrethtaotiintviesstthiegadtiesrtuhpethiyopnootfhfeastitsytahcaitdFpCroccoemsspionugnds gleuaidnienagptiogshiwgihlelrrleesvpeolnsodfdiufnfaesresnotcliya.teFdulrotnhgercohbajienctfaitvteysawceirdes tino tihnevecsyttiogpalteasamn,dacnodmtphaarterathseand mflouloercouclhaermimceaclhsa;npiesrmfslouofrpoeocrtoaxniessoumlefopnraotleif(ePraFtOiSo,n in rats and guinea T-6295), N-cthyl pigs. Three 6pe8r8f9l)uworeoroectteasnteesdulinfotnhiasmisdtoudeythtahnatolwe(rNe-EeXiFthOeSrEp,reTv-i6o3u1s6l)y aknndowpenr(fSlouohrloeoncituasneofatale.(1A9P9F4;O, T- Steoshtleednwiuassetthaalt.th1e9s9e3)flourosruoscpheecmtiecdaltsowcoauulsedpienrdouxciespoemreoxpriosloimfeerpartoiloinfienratthieonraitn. Tthheerhay,pboutthensoits tpheerogxuiisneoamepipgr,olainfdertahteiodnati a tshuepproar,tbeudttnhoatt thyhpeogtuheisniesa.piTghweeerfefepcrteosfenttheedseincoanmpaobsutnrdacstoannd pionsvtesetripgrateosresntuesdinagt tthheesSeocfileutoyroocfhTeomxiiccaloslohgayvemaelestoinsgubisne2q0ue0n1tl(yWaslhloawceneptear.ox2i0s0o1)m.e Other p1r9o9l9i;feYraatnigonetwailt.h2s0o02m;eoBfetrhtehisaeucmoemapnodunWdalsliancvei2v0o0i2n).ratsoror in-vitro (Maloney and Waxman Lin-vFesAtBiPgasteistohleaetfefdefctroofmtcheorsteainfrlautosraonchdemgiucianlesaopnigtshedobsienddiinngthoecfaurfrleuonrtesscteundtylywelrabeeulesdedprtoobe to Lpu-bLlFiAshBePd.elTsheewhdeerteei(lNeadbmbeetfheoldds,19r9e8s;ulLtsucabnkdecroenfcallu.si2o0n0s2o)f,tahned aLr-eFoAnBlyPbarniaelfylysemsewnetrieoned in the results and discussion sectionofthis report. rGoudiennetas bpiegcsaumsae,ylsiekrevheuamsanbest,ttehseuyrarroegarteesimsotadnetltsofpoerrhouxmisaonmeripsrkoalisfseersastmioenn.t Hthoawnedvoero,thtehre pmeorloecxuilsaormeanpdrobliiofcrhaetmoirscailn mgeencehraanliasnmdsftohratthdeifpfeerrfelnutioartoestuhleforneasmpiodnesseoifn ptahretsiecuslpaerciisesuntcolear. Therefore, the specific aimsofthis study were to: 1. Cthheasreacctoemripzoeutnhdesperoxisomal enzyme and fatty acid binding proteins response in the liver to 2. iPnedrifcoartematnoxeixciptlyantaetstisonsufcohr aasnysethreumspcelciineiscadlicfhfeemreinsctersyiannrdetospolnivseerhtiostthoelsoegcytohmaptoumnadys. 3. Cpoerrrfelluaotreosaunlyfoonbasmeirdveesdaanldtetrhaetiironmseotfatbohleitaebso.ve functions to iver and serum levels of Methods w"Trhiistesntudpyr,ot(oDcTo-l1d5aAte)dw9a/s18c/o1n9d9u7cttehdatinhatdhrbeeeesnegampepnrtosv,epdarbtystAh,eB3ManidnsCtiutuntdieonraal abnriomaadllyuse 3 DSRrPITSTA-62958, T-6889., T63164 `ccoommmpiatrteeteh(e 3toMxiIciAtCy UanCd Apneiromxailsoumsealappprloilicfaetriaotnio#n2i0n88m)a.leParrattsAacnodnsmiaslteedguoinafeastpuidgys ddeossiegdnevdiato uinntdrearpeprairttonBe,alwh(iipc.h) cionnjseictsitoendwoitfahdPoFseO-SreosrpAonPsFeOa.ndTthiemer-escuolutrssoeffPoarrtthAe olbesdetrovefduretfhfeercetsstoifng PreFsuOlStsoinfbpoatrhtsmAalaenadndB fleemdatloetrhaetscoanncdlugsuiionneathpaitgLsp.dodsoesdinvgiawianstrnaoptertihteonbeeaslt(rioput.eionjfection. The aEdtmFinOiSsEtraintiPoanr,ttCherefore an exploratory oral dosing procedure in rats was performed with N- Test Materials structur`eTsohefTe-ancuhmobfertsh,ecchoemmpiocaulndnsamtehsat,waebbrreetveisatteidonisn tuhsiesdsftourdythaerseegsiavmepnlebse,loawn.dTthheecchuermreinctally accepted abbreviations and the ones generally used in thi report for each compound are in bold: 1. Vehicle control (2% Tween 80). 2. T-6295: Perfluorooctane sulfonic acid, potassium salt (perfluorooctanesulfonate), PFOS, FC-95, Formula: Cf ,$0,- K', MW = 538.1 g/mole). 3. TC-i6F8i8S9C:OONH,'A,mMmoWni=u4m31p.e1rfgl/umoorloeo)c.tanoate (PFOA, APFO, FC-143, Formula: 4. PTe6r3fl1u6o:rooctanNeeseutlhfyolnpaemrifdlouoetrhoyolctaalnceohsoul)l,foNn-aEmiXdFoOeStEh,anEolFO(SarEr,oFwoRrmaunlgae:N-Ethyl CIFRSONCIHICH,CH:OH, MW = 571.06). 5. LWaybeotrhat-o1r4i6e4s,3L(eWxYen,aM, WKS.=W3y2e3t.h7-91g4/6m4o3l)(wWaYs)o,bwtaaisnaedddefdrotmoCDhTeImSsAynasScpioesnicteive control dose group for hepatic peroxisome proliferation. `FTohrempurloatoCcfo,l SstOaNteHdCt;h#at;T)-w6o8u68l3d, Nb-ecttehsytledp,ehrofwlueovreoro,ctTa-n6e8s6u8lwfaosnanmoitdete(sFtXe-d1i2n,DSTu1l5f-uAr.amide TM), Procedures Part A: Proceduresfora single intraperitoneal dosing of PFOS (T-6295) and APFO (T-6889) in Fboertwpeaertn A1,50a atontdal2o5f01grammalsewreartes apnurdc1h3asmeadlefrgouminCehaarpliegss,R6i-ve8rw.eTehkrseeitnoagfeouarnmdawleeriagthsiongr w`geueinkeaafptiegrsarpreirvatlreaatt3mMen,tagnriomuaplswweerereusaeddm.inFiosltleorweidntgraenatamdeanpttsabtiyoninpterrapieordiotfonneoatl (leisps,thinajnecotnieon, 4 SDRIPTSTA-62958, T-6889.1, T-6316.4 ahtouerquLiDmo5l0arfdorosAePsFtOha.t were less than 40%ofthe rat oral LD 50 for PFOS or the rat ip. 24- ``wmTeahrteeerreicaawllecarutel3as2toelmdubtMiolibiteny 2tpor%tohbTelwehemiegsnh-iens8t0codaronnsdeoiutlshifanotrgctoahuedlodcsobemevpdooelulunimdveser.oedTf5hatemrleLefs/osKrtegh,awndeo4rse0es%ouosfefde.tahcTehhLeteDsdto5s0es Ffroresehacsholtuetsitomnasteofreiaslt. sTuhbsetsaenlceecstwioenroeftphreespeardeodsfeorleevaeclhs idsodsiisngc.ussTehdefdurotsheergrinoutphse aprnodtofcionlal. numberofanimals in each dose group were as follows: 1. g2Cuo%inntTrewoaelepigngr-so8.u0pE.sa.cITnhhaaedndivimteiahoilnc,ilnaetcnhoeontvtreroheliacgtlrmeeoncutopnctcoronontlsriogslrtogeudrpoourpf2eccemoinavsleiedsrtaaetdssoinfagnltdewtoihp.rmeaeilnmejaelrcaett.ison etfhfaetcrtescoefitvhede nveohtircelaetcmoennttrowleroen ithneclsuudbetdleinentdhpeositnutdsoyftogechneeckinfdourcatinoynpprloannonuendcfeodr tahnids stthuednyo. Ttrheeatbmieonltocgoincatlroalnrdatcsliwneircaelccohmebmiinsetdr.y data from the vehicle control group 2. cPoFnOcSen.tratioAn =s1in7g.l4emipg.PinFjOeSct/imonLo)fw3a2smgiMvePnFatOaSvionl2u%meTowefeSnm-L8/0K(gfi(nfailnal dose ~ 3. A87P.F1O5.mg/KAg)stinog:letoitpa.l itnhjreecetmioanloefra3t2smanMd fAoPurFmOaline2gu%inTewaepeing-s.80 (final concentration 70 mg/Kg) 10 =13.8 a total mfogurAmPaFlOe/rmatLs)awndasthgrieveemnaaltea gvuoilneuamepiogsf5. mL/Kg (final dose ~ 4. 5tWo2yt.ae4lt5hfom-u1gr4/m6ma4Ll3eW(raYtWs)awAYnadss)tihgnrige.vleeenmiaatl.eaignvujoielncuteimaoenpioogsff|.WmYL/inKgco(rfninoaill d(foinsa~lec5o2n.c3enmtgra/tKigo)n =to a 0Efxa3m5p0lgefdoorstehecagluciunleataipoingotrhis3c2ammeM10P:F(O0S.3i5p.kga)t(S0.m0U0/5KLgi,kga)s(s5u3m8i.n1gga/nmoalv)e(r0a.g0e32weight mol/L) = 30.1 mg/guinea pig,or approximately 86 mg/Kg PFOS. drAoelsclioanrngdi,emdaatil2ms4mweehdroiueartoseblasynepdrrivdoeardiltfyoortdhmeoorsreitanafglt,ietrdyafiaolrnydtthhseeirdgeunarsfoatfteitr,oonxaoinfcdittahtyendseutcruridonyp.gsytBh.eodFforysltwleofiwogiuhnrtghsotwuherersfeiarfstter seianxcdprioivsfiuidcrueeadlbalnyydiCnuOpmt,etoaanbfdooulgrirctoiscmsaegnseestchrorvooepursgnyihgpohuettr,ftoahrnemdienud-rlioifnneeepaihntahdserefoedcfaetyshwe1e2srtoeurdcdyoa,lyltehc1et4eadpn.oismtAa-ndliosmswae.elrsOewrhegorauensed bftiiosorscmuhaeelsmd(ielcihavyeldr,eankaainlddynseisysu,.bmtSieesttctetesidoanfnsodor fphailsnitcvoreleroagksii)cdaanlneaydn,uatrleiysnsteeessaanbdnyfdelcipgaehnstcwmreiecrarseoswscetoropreye.dplfaSrcooemzdeeninlait1v0e-r98s%0wbeuCrfeff.ourred `pBmelerotfoaubdsoelsdiatmwepifltoehrsmgwaltueitroeenracalondlledehtcyotdeemdoaanntidtnoesrcurbfomopristcyehdbaynfgoheresahriitsnptubolnloocgotiducracelhteaomniasaltynrsayil.syzbeyoerlteectsrtoncommipcoruosncdo,py. 5 9 SDRITSTA-629538, T-6889.1, T:6316.4 Part B: uinea pPigrsocfeodlulreoswifnoargasiTnigmlee-iCpo.uirnsjeeoctfioPnoFfOSPF(OTS62a9t5t)wotodxoisceist.y in male and female rats and cBhaosseednofnorthseamrepslueltasnoaflPyaserstwAe(rdeismcoudsisfieeddb.eAlotwi)mtehceoduorssees,ofd3o,se6vo1l2uamneds,2a8nddaythsewtaismecopnoidnutcsted tpoigmsetarseuarteedpweirtohxeiistohmeer p1r6olmigf/erKagtioorn i1n0d0ucmtgi/onKginPtFhOeSl.iver of male and female rats and guinea A`gutionteaalopfigs2,26r-a8swaenedks20inguaigneeaanpdigwse,ig12himnaglebeatnwdee1n0f1e5m0aalnedr2at5s,0agnrdam1s0 wmearleepaunrdch1a0sfeedmfarleom C`ahnairmlaelsswReirveera.dmFionlilsotweirnegdatnreaadtampetnattsiobnypienrtiroadpoefrintoontealles(sitph)aninojneectiwoene.k afte arrival at 3M, dEoisghetgrraotuspasnwdeeriegh1t6gmuign/cKagpiPgFsO(S4/saenxd) w10e0remtgr/eKatgedPFinOeSa.chTfoluloimriotcthheemivcoalludmoeseoftgrhoeupL.p.The osiinnjmgeclteoiioilnpt,.haeinn1j0aec0dtdmiiognnog/fm1t.L5hsemuis1p02e0%nmsTigow/nemoeLfnPP8FF0OOaSSndwsuacsrspeaemtnaisdnigeobnaynwdeaimssuslgosilivvoeinnngaitn2aa00gvolmlagusmtPeiFsosOfuSe1 gimrniL0n/.d5eKrgm.Lt,Ao the 100 mg/Kg dmogs/eKggrdouops.eOgnreouapniamnailmaplesr, andat sexper aspveocliuesmepoefr 0f.l1uo6rmocLh/eKmigctaol the animals dose group in the were 16 sacrifoincdaeyds 3, 6, 12 and 28 post-dose. Tomngwe/oKvaeghnidicomlaselescgoprneotrruopsleaxannipimemaralsslp,eeaacnicedhsaartte&0c.ev1io6vlemudLmt/ehoKegfv,vehociolcrulremeescoponotnf1rdoilmnLg(/2tK5og%t,hcecoo1r6rnrmoefgsl/pioKnngd2i%dnogTstewoegtrehoneup81.00)0.,One animal per sex per species per dose group were sacrificed on days 3, 6, 12 and 28 post-dose. Ta wsiongmlaeliep.raitnsjreectcieoinveodfaWY100asmagp/osmiLtivseuscpoenntsrioolngorfouWp.YOanteaofvtohleumpeosoitfIivemLco/nKtrgoltoraftosr raectoetiavled mdogs/emoLr 1s0u0spmegns/iKognoWfYW.YThaetaotvhoelrumpoeosifti0v.e1c6onmtLr/olKgrafrecaoetiovtreadladionsgeloefi1p6. mingj/eKctgiodnoosefagr1o0u0p WY. The positive control group rats were sacrificed on day 3 post-dose. ParCt inrats. Procedures for hepatic peroxisomal gene induction following oral dosing of N-EtFOSE oEftaFdOmSin"EiTshitnerrPaeatsriutolnCt,.sotThfhepreeafptousrrepAaonsaeenwxdapBslorltaeodtgoteronyetorhraeatlceodsnoacsmliupnslgieopsnrfotochreaptdeuirrpoe.xdiionssroiamntasglwwgaaessnnepeoirnfdtouhrcemteibodenswtaisrtsohauNytse- sEitnWulFdiyOveSwr,Eitafhnodr30tf0owropNd p-mEtNawF-aOEsStycEFhOmoSesstEeabnthoaalstiatcenauasnineaildtyisalliissvecirrneelefifnveiecnrtgasdnaodnseds.eirnTudhmiu.scedAdospdeaolswmeaiotsfoyb2la0sCemodgoA/nKogax/idddiaaeytsaeNryo (adRcietefitv.air3tyyMsitnMudleiydviwecraaoslvceDarelpactu4.l-aTwt-ee6d3e1tk6o.pb1e)er.iaopdTphrinroxewiehmimacathleeltyhrea2t3asvmweegrra/geKegd/Nods-aeEydtfFwoiOrtShtEh2ec0soemncgso/unmKdpgt/wideoaenykoiNnf-ttEhhteeFOstSuEdy for two days. A 4 mg/mL. suspensionofN-ECFOSE in 2% Tween 80 was prepared ina glass 6 10 DSRITSAT-6295.8, T-6889.1, T-6316.4 tciosnssueecgurtiinvdeedraayns.d dTewlioverraetds wtoertheedroastesdbywiotrhalthgeavvaehgieclate acodnotrsoel,vo2l%umTewoee5fnm80La/tKagdfoosretvwoolume poosftS-mdoLs/e.KgLifvoerrtswwoecroenwseeciugthievdeadnadysc.huTnhkesoanfilmiavlesr wweerreeefurtohzaenniiznedliaqnuiddnneictrroopgseinetdhoennpduatyi3n pceonltyrpirfoupgyatlieonnefvriaolms,bplloaocdedcoollnedctreydibcye ahneadrttphuenncsttuorreeadtatn-e8c0.r.opSseyraunmdwstaosreodbiaati-n8e0d bTyhe ~2g liver samples induction to: that were flash frozen in liquid nitrogen were sent on dry ice for analysisof gene. PKreonfdeaslslorB,.DWeapltloafceB,iPohc.hDe.miDs.tAryBaTn.d Molecular Biology Schoolof Medicine 10 University Drive Duluth, MN 55812-2496 Results and Discussion PartA_Resultsonthe Toxicity ofPEOS andAPFOinrats and guinea pigs. RIn eatss, tuRhaelrtestPwaesrret:Ano statistically significant body weight ratios were increased following tcrheaantgmeesntinwibtohdyallwetihgehet.coLmipvoeurnwdesi,g ht and liverparticularly to- APFO; however, these changes were not statistically significant (Table 1; Append 1). `dTehteecsteironuomfc4li5nimcagl/cdhLemiinsrtartys atrneaaltyesdiswirtehvePaFleOdS.thaGtlcuhcoolessetweraosl swiagsnifliocwaenrtleyd tloowbeerleodwitnhreatlsimit of tcrheeamtiesdtwriytphaPraFmOeStearsndofWrYat.s NtoreasttaetdiswtiitchallAyPsFiOgn.ificant changes occurred in the clinical TTRh4e8h4is5to7lRo4gi8c4al7 raensdulTtsRf4o3r37)ousthoofwfeodurmaractrsotsrceoaptiedc im.pa.swsietsoh f5w2hmigt/eKsgpotWsYon(tAhneilmiavlernsuumrbfeacres covered in subchronic tghriansncualromtiasssuweeraendnoetveidd.ence of mononuclear infiltration. Multifocal microscopic eTnhlearhgiesdtolliovgeircsalarnedsuklitdsnfeoyrs.ratMsatcrreoatsecdopi.ipc. wlietshioAnsPoFfOmo(tatnliemdalblnaucmkbseprosts7oRn04o8n5e1-li5v3e)r wsehroewed ngortaendul(o7mRaO4o8n51t)h.e lMiivcerrossucrofpaiccea.lly, this animal had 2 padofscar tissue with an imbedded. kTriehpdeanierhy.i,stAoolrllopgoaintccharelerarrsea.tssu,lisnfcolrudoinnegrathetcroenatterdolwigtrhouPpFrOatSs,(h7aRd0n4o83si8g)nisfhiocwaentdcshiagnnsgoefprlievseerntdainmaligveer, 7 I SRDPITTS-A62953, T-6889.,T:6316.4 Results: GuineapigsPartA Oovneerngiugihntefaoplilgow(iAnngitmraelatnmuemntb.erNo7Gt0i2s5su3e)stwheartewcaosllterceatteeddfwriotmht1ha0t0amngi/maKlgaAnPdFthOe diinietdial body dweeaitghhtis(u3n5k8nog)wonf,thbauttmanaiymahlavies nboeteninccolmudpeoduinndtrheeltaatebdl.esTohresagtuiistniecaalpiagnsaltyrseeast.edTwhiethcPauFsOeS.of hhaadd ssiiggnniiffiiccaannttllyy glroewaetrerwleiivgehrttogabiondsycowmeipgahrtedrattoiocsocntormopl.arTehdetogucionnteraopl.igs treated with APFO Odanmeaogfeforuepraigru.inNeoa psiiggnsitfriecaatnetdcwhiatnhge1s7.w4emreg/pKregseipn.t iPnFtOheSl(iv7eGr,02k2i5dn4e)y,shtoeswteed, soirgpnasoncfrleiavserof wanoyoofutthoeftohtrheeer gcuonitnreoalpgiugisneeaxapmiignse(d7mGi2c2r5o5sc&opi7cGa2l2l5y6()7wGe2r0e04netvherrouagnhal7yGz2e0d13a)n.d wTeirsesues from disposed of. Liver samples submittedfor L-FABP analysisfrom rats and guinea pigs treated in Part A. iCseorltaatiinolniovfelrisvaemrpflaetstyfarcoidm bcionntdrionlgapnrodtPeiFnOaSt tthreeaUtneidrvaertssiatnyodfgSuainneaFrpaingcsiwsceore(Aunsiemdfaolsrthe P7GF0O2S00r4a-t)c.onTtrhoelggouailnoefatphieg,L7FGA0B2P00s5tu-dPyFwOaSsgtuoinaesasepsisg,th7eRe0f4f8e4c4to-cfoFntCrsoolnraLt-aFnAdB7PR0f4u8nc4t8i-on as edviamleutahtyeldambiyntohneaapbtihlaitlyeonfetshulepfhlounoyr)es-ceunntdefactatnyoaiccidacainda(loDgAuUeD1A1 )- (t5o-bind to L-FABP isolated `fmraomxirmatusmabnidndgiunignecaappaicgisttyroefatLed-aFnAdBPnotfrtormeaPteFdOwSitthrePaFteOdSraitns vwiivtoh.ouRtesaunltisncsrheoawseedinaKdde.crTehaseed `complete methods `Nabbefeld 1998). and the results ofthose analyses are reported elsewhere (Lucbker ef al. 2002; o`fTsheohmiesatonliomgiaclasl r1e2suolrtso14fdlaiyvesradftaemratgreeawtimtenhtewviitdhenWcYeo,fsAcPaFrOt,isasnude/oonr PthFeOsSurlfeadceuosfttohceonlsiivedresr nthoattntehceesdsoasreisl,ydtohseebveostlummoedse,lroourtetohfe aodbmjiencitisvtersaotfiotnhaensdtutdhye. tiFumretphoeirnatnsaclhyosseeson fftorispsauretsAfowrere: taobtoarltoerdgaanndicPfaluroBtrinwea,selpelcatnrnoend.microscopy, or peroxisome proliferation from part A were: Part B: Results of Time-Course ofPFOS toxicity a two doses in male and female rats and guinea pigs, Results: Rats Part B mAlalinrtaatisnterdeabteoddywiwtehiegihtthserth1a6t wmegr/eKgsiiogrht1l0y0lemsgs/tKhganPcFonOtSroglavianleudeswe(iTgahbtlefo3l,lFoiwgiunrgesdo1sianngda2n).d tSrteataitsetdicaanldancoanltyrsoels,obfubtohdayd wveeriyghltitstluegpgoewsteerdbtehcaatutsheeroeftwheere[noow Nsig(nsitfaiticsatnitcsdinfoftersehnocwens)b.etLwieveern (wAeipgphetnsdiwxer3e).iTnhcreealisveedritnobbootdhymwaeliegahtndrafteiomsalien rraattss wtreeraetesdigwniitfhic1a0nt0lymgi/ncKrgeadsoesdeignrcooumpbsined 5 2 DSRTPITSTA-6295., T-6889.1, T3164 mvaallueesan(dTafbelmea5l,eAlpivpeerntdoibxo3d).y Twehieghftemraalteioravtasluheasdfmroormetohfea1n00inmcgre/aKsge dinoslievgerrotoupbovderysuwseicgohnttrol roabtsieorsvtahtainondiatd ntehecrmoaplseyriantss.oHmyepeorftthroephhiygahnddowsheigtreopuipgrmaetnst(aAtpiponenwdeirxe3n)o.tKeiddbnyeygrwoesisghts and kidney to BW ratios were not significantly affected in ras (Appendix 3). Results: Guinea pigs Part B tPhFaOnSmawlaesgmuoinreeatpoixgisc.toThgrueineoefatpihgestfhoaurnfreamtsa,laengduianpepaarpeingtsl,yamnodroenteomxiacletogfueimnaelaepigguitnreeaatpeidgs w1i2t%hof10i0tsmgin/itKigalPbFodOySwie.pi.gdhitebdoyndady 62aaondfytwhaesshtuumdya.neTlhyecruetmhaaniinziendgofnemdaalye6g.uiAlnleaotphiegrlgosutinea ptihgrsouggahionuetdtwheeifgihmteacnodurmsaein(tTaaibnleed4b,oFdiyguwreei4g)hTtshtehagtuwienreea spliigghktildyrleoywteorbtohdayn cwoenitgrhotlrvaatliuoessfrom amlgl /anKigmaPlFs,OSmail.ep.s(aAnpdpefnedmialxeIsIIc)o.mbined, were significantly increased by treatment with 100 Ftheemafalcet tghuaitnteharpeiegosutinofpfarotuircuflaermawleeregufionuenadptiogsbediveedrywistehnisnittihveeftiorsPt F24OShotuorxsicaitfye,redvoisdienngcewditbhya p1i0g0lmosgt/wKegigdhotseuopftoPdFaOyS 6ipno2st5-%docseo.mIonilcoanntdra7st5,%onTeweouetno8ff0oaunrdmtahleeregmuainienainpgigfedmiaeldeagftueirnaea ri.epm.adionsiengof31m0a0lemgg/uKingedaopsiegsofsuPrFvOivSedinan2d5g%aicnoemd woieligahntd f7o5l%loTwiwnegetnre8a0tmaetntt.hat dose, and the `tTohteheadombisneisrtvreadtitoonxoicfittyhoef1P0F0OmSg/tKogguPiFnOeaSpdiogssedmoisxededinwipatrht2B5.%Noconrenofoitlhmeamyalheavgeuiconnetarpiibgusted dmiLe/dKfgo,llwohweirnegaispo.naedmmianliestarnadtitohnreoef faem1a0l0emggu/inKega PpiFgOsSdideodswehien n2%theTwseaemen d8o0saetwaavsodleulmieveorefd biny2or5a%l gcaovmagoeiltoatbaevmoolruemetooxifcItmhLa/n Kwgh.eTnhdeerleiviseraepdrienceadneanqtufeoorusdesloilvuetriyono.fTPhFeOuSseionfccoommoiolil "iTnhtehreatdo2s4ehporuerpaorraatliLonD-h5as0pfroervPioFuOslSyilnead 2to0:a8c0laecaertdoinfef:erceoncme oiinltshuesopreanlsiLoDn w50aosfdePtFeOrmSiniendrattos. bsues2p5e1nsmigon/wkags(Ddeeatneremfianl.ed1t9o78b)e. 1I.n2c5on-t2r.a5stg,/tkgh(rGaatborriaellL1D9-765)0. foNroPdFeOatShsionragnraoqsuseloeussions were aobqsueerovuesds4us8pheonusrisonasfotefrPdFosOiSng(mGaolldeeantnhdafleemfaalle, rats with a single 1979). Thus, the oral use ogafavamgiextduorseeooff2255%0 mg/kg com ociolntirniabnutaeqduteootuhsesoubsspeernvseidoninocfre2a%sedTtwoexeicnit8y0oafsPtFhOeSvehtoicglueitnoeadepliigvserwhPeFnOScommapyarheadveto an 2% `Tween 80 vehicle alone. Conclusions for Part B Ifnitnrdaipnegrsitionntehails asdtmuidnyislterdattoiotnheofdePcFisOiSonltehdattoitp.hedfoosrimnagtiwoansonfostcathretaipspsruoeporniattheerloiuvtere.oTfhe tadhmeisneicsotrmaptoiuonn,dsa.nd that subsequent studies should be conducted following oral administration of 5 13 SBRrPanT2958, Tas, Tastes PartC:Results Oraldosingof ratswith 20mg/KgN-EWFOSE. `There was no apparent effectoftreatment on body weight or liver weight (Appendix IV). No signs oftoxicity or liver effects were apparent by gross observations at necropsy. The rats used `dawtear.eoTfhdeiflfievrerenstpeagceismeannsdwienirteialanbaoldyyzewdeifgohrtisn,dtuhcetrieofnoroef,mstRatNisAticfsorwepreeronxoitspoemrefoprromleidfeorantitohnese specific genes. There was no apparent indicationofgene induction by N-EtFOSE by Northern Blot analysis, however the total mRNA was partially degraded in all samples, therefore, a quantitative analysisofthe results was not performed. Further analysisofthese samples was aborted, and the tissues were disposed of. Conclusions `Standard toxicity testsofserum clinical chemistry and microscopic examinationofthe liver oefbfteacitnseodfiPn FPaOrStsaAnodfAtPhiFsOstthuadny indicated that male gui were male rats. In Part nea B, pigs three were more out of four sensitive to the female guinea toxic: pigs `and one out of four male guinea pigs died overnight, and the remaining female guinea pig was sacrificed on day 6 due to excessive weight loss, following i.p treatment with 100 mg/Kg PFOS. In contrast, noneofthe male or female rats died following 2100 mg/Kg i.p. dose of PFOS. `These data showed that toxicityrelative to rats. the guinea pigs, The findings in females in ths study lpeadrttoicutlhaer,cownecrleusvieornytsheantsiinttirvaepteoriPtFonOeSa.l dosing was not the appropriate conducted following oral admin routeofadministration, and that istrationofthese compounds to subsequent st test the stated udies should hypotheses. be An initial oral dose study with 20 mg/Kg N-EtFOSE in malerats showednoapparent effectsby gross observations therefore the doses were considered to be low as there were no apparent liver effects, and the gene induction studies were aborted. Therefore, Oral dosing and higher doses of N-EtFOSE were deemed necessary for future experiments. 0 1" DSRTPITSTA62958, T6889.1, T6316. Signatures Prepared by: Conds JY). Seat Andrew M. Scacat, Ph.D., DABT. `Toxicology Speciali&st Study Director 5/25/2004 Due i" 1s SDRTITSTA6295, T-6889., T-6316.4 Part A. Histopathology Report. Elden Rats Lamprecht 3M Lab Animal Research Services: sRu4bs8ta4nce has bMeaecnrdoisscsooplivcedmlaesasviinmgbaedfdoeadmyinmlaitvreirxsoufrpfraocteceoivnearnedd mionntohinnucslcaerarticseslules.. Its The interfaceofthe mass and liver consistsoffoamy mononuclear cells. t7iRss4u8e.47Its substaMnaccerohsapsobpeiecnmdaissssoplrvoetdruldeianvginfgraomfoliavmeyr smuartfraicxeofcporveorteedinbyantdhimnolnaoyneurcolfesacrarcells. "The interfaceof the mass and liver consistof foamy mononuclear cells, R485] A padofscar tissue with an imbedded granuloma on the liver surface. 7R4837 Multifocal microscopic subehronic granulomas are present in liver. `7mRil4d8p3e8riportalPvaarciueotallatpiloenuroafhoefpaitveorcyitsemsariskerdesleyntth.icSkeonmeed dweigtrherdeaptaiiornotifsshuee.patAocgyetneersamliazyedbe present. All other rats had no significant change present in liver, kidney or pancreas. Guinea pigs f7oGa0m2y25a4pp-eAarmaanccreoswciotphicp.orpeacdoonftegnrtsanbuelionmgadtiosussolivnefdlalmemavaitnigo.npTrheesemnattroinx wthheicsuhrrfaecmea.inIsthisasa b`cyoamnpoisnecdroeafsimnognloyntuhcilckealrayceerlolfs,scsaomretiosfsuweh.icShcaarrteiessnugeoringteedrfoarcevsacwuiotlhattehde.liTvehreppaardenicshcyomvae.red No change in liver parenchyma. A second smaller pad is present on another locationof the liver. 7G2255 & 7G2256 - never analyzed and disposed of. 7G2004 - 7G2013 - No significant changes were present in the liver, kidney, testes or pancreas. 2 16 ee DSRTPITSTA-6295., T-6880.1, T-6316.4 Tables: Table 1. Part A. Summary ofToxicity of PFOS and APFO in male rats one Tres ee ow] | TTT 1T 1TT TTT proightgain lverwt@ -- Tvl al al ws wed velwr ved ed ms wd rrr rr Tlsal esol val sna] sss]sal vssel soso] sa rau] 1 I~ 1T--711 | zo ood wel ool evelvs velsoof vive]oss ed bmg 1 asol ozo aad oolelsnlowl tose suloro] er |ex orlew oa ooloa owl toad] sau]oz 1007] |ewoe wo a eof asdwo oer] slsose]sd stun | sol ord worl orl ood]or ees diolselel eu Tel ad el sa sed wl oo sao wel uml eed run Teil od el sof ood wlssl soo ef 12s eed) oT no oolval Natmmol Taalviel so seaelsd seal ail word aaa veel sor 2a ssa 7] ooo] ead] vl isi ose] von) feemmonTtos ond es] 17 rnd ssltooolod vialoe ead feemmo 1 ol sod wl sol ord wo os] oor] ses]se or] 21.. TNhAelNiomtitaopfplDiectabelcetionfor Cholesterol (CHOL)was 45mg/L. * Significantly different from control values by Students T-est 1 17 Co SDRTPITsTA.2958, T6599, T3164 [ezpaoraumenteTsrablieo2. sPa|rtvAcg. oSum1nm5ad0ry|ofavTgoxi[ci5Ttw0yeroeosfo| PFmOsSfaongd AaP[5Fr0O oibnic1 maleJguuignea pwi[g5e0eTmiomoJ| EE SD -------- l[ over 1 ooowwal vel mdr sl i] r eed wlr nlm LI rrr fJoeroasmmparaa 1|11ve0ro o22sd_swesllovoll snadd ssrro oosu]] ssaesild sereoloouss] ssmer]d fompe I soo oe er onl sud eelox] foALuuemugta 1|ssieoenr orrara]lssnmaa]lssoorsa]] soorrd] smoesr]ssassss]] JsT atroonn i 1 esln soeifdssrello ssreol] sooodd essreo zsooon]] [JhLeotmrumnol T1ooomlosmanifl sanoeaolssoaso]] sovned]szssuoodls2m0es]] JJkeerm-mmomiotit-- ToT se o oseed sss oxn]svaeeo ll ssodd a7m7on0]ooomo]] lestur Toulwel es sal ved eel sos 2T NaTNort sofpDeateccion oCho(ClODe)wats5rmpll + Sinan dfffomcconnrol vablyeudeens' st eed coloul md esosod]soredr] raomes]] saeedd saodd wmellswoeull usdod 0s0oe]]sooeon{]rsoawsesl sourro|r sraa.lssoowmn TJseoowwool"ssopwer|] ond oloul urd w 13 DSRTPITSTA-6295., T-6889.1, T-6316.4 `Table 3. Part B. SummaryofBody Weights in Rats, Means and Std Deviations. [Do(vmegP/kFg)O.S|[PosBta-Dyose[lWieanBodyWeighSia Dv] [L Feo T7ET35AC 1 Two 03] [ [ emTE e12 2C |w7a[I1z]] [ LE CT OF E J wsm [60[4|] CE 0 [FI TeTv 773] [ LS ET TF e J 2%m 7012) [Fo15 7] ws Harri] Fetath Ewze r 2 [ [ C F 2s |o 22%mo n [w9a[[27]] [Cont 5][m0Fore] [ [C c 1722s To o -- 3as% n m |Rwaa[[7i]] we 2a fa) rd [[ 5]mz 17] [ TW w srw |i[2 [vw [es]Fora] aLL we 7 [we| F [ r Tm e ee 35o |e zi [2] [ CmC T 7e 5[o W2Ra n | 1s W|[0] [Cont 72 Ft] Ov 7 |e a5 w n i] 15 19 SDRTPITSTA-62958, T-6889.1, T-6316.4 ``GTeanbdleerDd.osPeaPrFtOSBD.aSyuPmomstaorsyeoMfeaBnoBdWy W(e9)iSgihdDtesvi.n NGuinea Pigs, Means and Std Deviations. (me) FFoo CCoonntt 31 w NR wNAO2 FFEo Ccoonntt 26 s 0 wNa 21 FFE osCont 21 BBNa 4 FFo os 63 wuws nA 31 FFo oo. 22 wwa Mx 12 FE o w 13 sNRs N8A 04 Foo Foo 6 12 wm M1 MoM 0 MFo ocoont 21 Mmw om7 o2 MMoo CCoonntt 53 2RNA0 20 Mo Cont Mo cont s2m mM11 M[o--e 31 mwoNa MMooes 5 aaiss 2ou5 23 M Mo0 s 1 0 21 ww 7 a MM11000 53 m 3 mNa 1 2 MM1100 2 "NNM a 0 16 SDRTPisTA6205, T-6889., 63164 Table 5. Part B Liver to Body Weight ratios in rats EfeT n -- Tma Taa r T+. o--ofo-- or--] [f[1HB e ooesommosKaePFpOroSs--Tr RRatew[eMarro E T[--s8 TTooonsr--] --TTaSno o-- o r--r|] [iI Sian=iit--ca --die--fnt feoA m c---- onto--l val--Iu-- e--y--Dfun--ae i--sf t-- 1 o f---- o--ms -- | v SRDTEITSTA6205,T-6889., 63164 Figures Figure1:PartB: FemRaatl Boe dy Weight VsTime. `Time-Course of PFOStoxicity at two doses, 16 mg/Kg and 100mg/Kg. Female Rat BW Vs Time m30l0 po Ee wie et o ERS ts es RE ou oa DaysPostaose 1 22 SRBPrTisTa2958, T6855. T3164 Figure 2: Part B: Male Rat Body Weight Vs Time. `Time-CoofuPrFsOSe toxicityattwodoses, 16mg/Kgand 100 mg/Kg. Male Rat BWVs Time wE E beliE E raE n E m E e Ei dad =eo l s. ] IRC wee wm) ER ahR ha Ss] Ta su Daya posdoso om w SDRrTieT6295, T6091, T3164. Figure 3: Part B: Female Guinea Pig Body Weight Vs Time. `Time-Courseof PFOS toxicityattwo doses, 16 mg/Kgand 100 mg/Kg. Female Guinea Pig BW Vs Time w70o0 EERE smi Er RS eay en "E E Sr Ta mg ee r Ts 6 Days Postdon rom 24 oo SBRrTisTa2958, Tato,T64 Figure 4:Part B: Male GuiPingBeoday Weight Vs Time. Time-Courseof PFOS toxaittcwoidotsey s, 16mg/Kgand 100 mg/Kg. Male Guinea Pig BW Vs Time 7h0o0fr TCae Ts 5 ou om Oayspostaose n B 25 SDRrPITsT-A6295.8, T-6889.1, T6316 Appendix 1. Deviations to the Protocol: p1.igs perTthreeaptrmoetnotcoglrosutapt,eswitthhat5thterreeatwmoeunltdgrboeuFpisvfoermaatloetaanlodf5fi0ve rfaetmsaalnedra5t0s gaunidngeuainea pigs. IunsePdaratnAd,aotnoltyalmoafle15anmiamlaelrsawtseraendus1e3d.maTlhergeueinteoafpoiurgsawniemraelsuspeedr tirnPeaatrmteAnt.group were In Part used. B,atotalof 20 ratsand 20 guinea pigs, 10 males and 10 females per species were `Thos, in both partAs and B, atotal of 35 rats and 33 guinea pigs were used. 2. The protocol stated that N-ethyl perfluorooctane sulfonamide (FX-12) and NeTthheyslepetrwfoludoorsoeocgtraonuepssuwlefronearmeimdooveetdhafnorlom(FthCe-1p0r,otNo-coElt,FaOnSdE,a pTo-s6i3t1i6ve)cwoonutrlodl,bWeydeotshed-. 14643 (WY), a model persoxisome proliferators, was added as a dose group. 3. The protocol stated that all treatments would be administered in corn oil. PFOS (T-6295) and Wyeth-14643 (WY) AwPasFOadm(iTn-i6s8t8e9r)edweirne2a5d%micnoirsnteorile.d in 2% Tween 80. 4. The protocol stated that Dunnett's t-test would be performed on all data. Students ttest were performed instead where noted. 5. The Dosing protocolstated by oral gavage that was all treatments would performed inPartC. be given by ip. dosing. 2 I so Appendix IL_Part A: Toxicity of PFOS and APFO Individual and Summary Data -- Nh JWh vn rr pr ee fe e 3 v |--T--][T--7--CT--1 R 7850 2 fa pf T =oreo re|d s ci e e a e Fe se se beet |over@ | 125]159/232] 77] TT17 53 | Tire]des tes] 14) [Testis@) |[ 3.3] 3I 4] 20p 35 34] 04| ] 535 o 3 ail32 of rare Chemisty | Choimg/dl | 52] 63] a7[=7 540 52 45 Tas --------| Jas | NA | wa| [Camgidl 1115717] Tiel" 116] 01| ] os ia i tio og JAlbmg/dL. |INET LCT TM 7 EX SE 5 NX NY [BUNmo/dL| Rie 1315] 13]20 153 33]| tal i 7 1s] 153 14 tee ee ree ees JALKPUL 271326] STOL 1oo sol 451]250] 334] 80.9] |276] tral719]25] 300] aa 436] 200]337.0] se. too so]sro 53] [LOHUL 1 "335 7886] 556/301] 14d|] 277 367] 1 340] 334] 55) [Na+moll | aT 1a3l [emma toa Bel 148]Taz 12 roll aslol tan 53 aol teal vals] ss so ser [CREAmgl I" 080s [GSTULTsos Tos ofl oa oa os 04 | soloof|88 8 so oq oq [RIGmg/L| 70731120]361] 70]129]| 57 i758]773] 344] . SRDTPITSTA6205,T6889.1, 6316.4 RaFtadhata I (cont ROma? E 0 E 70 |EE NEE ] I 7[3| CTR le |] 1ol alcala] a] [Peroatm"etsr| an T 2s cT us] T a ovT ]vs ana]a-- sa|2-- sT s0] T ns ] rer Fo La] Le] 572% lutgan |sounss00|] ss |sa oo] sol sro! seo13a|]"=os5 sersu]s| sr0| ate soa]sto 11s]so 5005s] snoavs] [[vFtegarino3{|7206%0|] 51o0%6|( G2r5o6|] 3T4r4o|]2306%61|6042]|13906%]|1a8s6c|]a1o8e5]|2Tr5o6e| 2S0o5w|]3041]] Le | [ioney@| 00 ao a3o5s1o3or4|1o4a8s]|0a0o8lo0e0]|a5o7s]]o5ss2][3os4e]| aao3s]] a5o7s]]o0os]] [F Tests C | a6]30]r 54736( aa 0r s]a1]34] 35r 2]a7] 34]03] [[CCihmoalmrgGahle|mis5t3y0-- 7860 51 201761 0 805 72|]650 630|]6| 60] 530| G03]53] [[PCTraoomLspmmoagreall||| i0711152][] 1012110411]10121.141]]11042293[]]110211.671]001464]]]1o226r.1]]]1of12.i01]]]1o111i25]l]Tjoi0rs5]]T1u1i.ia4]]]o00o3s]]] [[mBOyNmaga||76410161310](7c6e0]l17510]]7e4s5]11o3s]]6710]]61230]]F6310]1T6ro6] 64b3]]z067]] [J[oAALCSUKTmPgUUiLLa| |{2e0ot6so|1817470054|tooabrsoo||]7a#6s1t05]]|82a85r04a|]e0e0ao]]]7sz6ai0o0|]18oi0ai]|721683004]]]2s2o40a50]] 31i1735610]]ier0ra]]] [LAOrHuUnL|| e 540 73o4s|]3e0e0l|a710]1Gsora]] ooof seeal| 273a3|]efeor|]22w0o5]7e17r]]r3o]] Loman | es si]ses sr[ss 2 ss]sie se seo]ss]oo] [CC REAamga-- TToooT] 0to4t1] fooTuLTso] eol so] 0ez5]1F04i10o0[r]F0iisco]]0ss4eT]s0e4]T0o6s]I 0a5]021] sol soloo so]so]80] a0] sol00] [+mseoy| orl vs]vse can sr eo vo sco os sn we]a (i=sisng a aleoncday1r4rate hertad n12 ET Tim ofdstecionfor Choles=t4ergoal 2 os Guinea Pig data [= Tef r [Parameter -- TT ---- G:SrewRE eSe Ts s]sl ww Bodywt (9) "7 387 37 ne www) [wigan g ||F 72 tee r 17.7] r 1721 0s a 731]E d64| 2e 07l ] ta as] sl 75] 34] Eb heal RE ( Ira] w61 T 35L T 141 1 02-- ] 10r ] osr T oe1 ] 18]1 111 ] 04] |ClinicalChemisty | |_| ------| Ti eer ee ee s g/d |ia] [iol talnls 2 8 7] sl #1] of 1] [Abngat[|221251 2a |Pmgdl 461 551a9] asTos|--oros 50] 05] 45] sel 33333] ar] 51] a7] 03] [Stumgd | 18] [Po aes| 27]267] assT 27s[sag 7a] tir] 30] izs] wo7[ ore] 340]264 250] 28a] so] = eeSER aro [LDHUL_777 71 Co | 770s | 783] B91 | 050] eo So 551 4s] 63] 149] 773] 765] 5} 95] 50] | 14s] 13611401404]1 [TmT9171 eof251 42] 50] 130] 43 tao] Taz] aa] 75] tai] 7] 53] 15] NH GYcr JeSTUL IT [TRIGmit|| i571 20 srs] 11 27s] 70] af oes] fos| | os] wl ea wa] im1] sol Teo] is] 55] ' DSRhOrTiaT2958, Taio,T2164 GGFauatnraacopnitg Sar 17 1% 1T 5 aso[1 [% | wlAg [so | w Ee el w I Gcw cllA & a [[ | Es [=] = [wieaan [ver 146 51] a6] si] 681 feo] i7o0l 76]12] ie2] 8| 0] so] =] tor| 184] 81] 18] |Kney(| @ 421 30] 38] 40]02] 41] [Tests@ [3.71 09 10] 10]oi| 0s] 1 TT 1 TT 11 1 a8]a6] 45] 04] 18] 08] 12] os] 11 [ChoimgidTl<45 T<a5 1 2] S2[NA | 55] a5] a5] 48] 5] | oi [Phosmoid1 l oT wel il a]ia 2] ] 11] o] 8161 of of oe] 8 8] | 7] [TBlLmgia1 t 0101 04] 01] 00) 01] 01] 01] 61] oo] | 231 22 26124 02] [BUNmgl|| a18sT a1s6] 511s]a18s][013]] 24] atro]] 23 2a] 24] 01] a5so]l1458]] 4i7s]] 032]] [SLUmgiaL Fiemme mofo nil izle] wl of [ALKPUL "1323200 ASTUL | es] 49 367]327] 39] 60 66] 20] 408] eel 260] 317] 328] 75] es] 3] 71] 0] | si ar ss1 si] 4f |sea] 21s] 2371 264| eo] a7] 250 20] ar] 38] 250] 212] 238] 16] 23] [Kemmon I | 7ta3a1l aai0f[oti]a7p7] ]osspfo ew men a TNANATThhaa]| doa] HopPqN o2| ofS [CREAmgL 030 043 10331 /006] o04] i TNA [NA | 03] 03] 033] 006] [ows] wl 3] 2f Hoos [TRIGmgr | 727 11] 783]740] 38] ni ior] 11] 12 11] 1] tas]Tie] ioe] a] [ing aly 7 7 -- A=sacificedonday i4ratherhaniz % 30 es (ULL) J Les [fazaeanat aesa nneb || Ha 4 1 L EL ssi a[LLL fh se LlLd ilLE lt i Bot nen ad|[1] Hm ; Eodld di e 521 A bn 1 +E TEE Peal gt 3 Le8y Dosepros Part B. Liver Weight to Body Weight ratio in male and female rats combined data. SAS analysis mm EN OO) | ous ~ PEN =aA SN S24 i ~NY oe " Ear " sswrosirara) Seudoesntst Co a Dunnetrs Rsquare SOunmemwaaryyaonoFva oasso7s MReRoaSonat'uMaoerfaeRAensSgqpuoanrseeErr B03oS5o0o7e7sd7 Observations (orSumWeis) Ed ESondueers DF2 AnaSulmofooyVlasSroaiiaunwoscees |Mem0SOa0u0a%r0e FRaerattoy 7" 0000S 0000089 Prooer Crow ocomiem Oooo oon LhoowrelMefoNruaOmnbeevrrayArsooorsMaresa)n Su00E0raTotr Coient 84 oQooso oQooourms Low S14NEMurmbrauersaensdaaSpeolMn Deeevdaienass ttiiomnastSe4oDfeevrovaSriuanEceresn iiea Cont 4B8 0oos0en0so ooo oooodomisoez oc0oao0sooersss OiictoMean(pesnMie)ansCompa0r0i0s0o0nT0si0o 0012280 012c2o8n0 Cioent 000011222285 000000000000 DDooovooerso Apts`Comfopreaach!prariusi0sn0gsSotdnentss AssDiHLSD 2106800 cont DITIS 1116/98 study 11600 Cont 0000D046t0E8S 0038 0000004810685 0008 000002039488 001143 (CoPmospiatriivsevoanlsuweisshhaocowntproiolclsusoifnmgeDaunnsnethat Mareetsihgonidficantly diferent. A1b0s0(2O4L2S25D5 000812080 C1o6nt 00.000020088617 dPiofseirteinvte.valuesshow paisofmeansthatare signfcanty 2 ois 16st ty Vo wi fon] =Part B. Male or oe rat LW/BW ratio summary ZEN APE Ny { AJA -- OW > = YHA ous = Ta we | wm J. CO =snsenrst Dunetrs. RnEwo Sreevsmeorne JYye. fa trenSos wo EFrEe%t sftoewre 0P%p A aVlEmEmmRsa, neTosewsne gncomawe Sao nvm pm pwr L 7gz J ST Tucm cEapnTge & i onan ow ii 5 rornsaeet p Sooms atomfecmnrrt oaccSoMn Eze 1 odmuemn agovmees sommen ooFrytenten[ y -- oioTrlH oar nopeal REI aorasSN).oo. Wh Jr Jwlw ololm ould 0 DTIS 11/16/98 study C1o6nt 00000080896 00001280681 0O0o1t8e8a1t P(CoomspaireisvoanlsuweisshhaocwopnatriorlsousfimnegaDnusnntehtattsarMeesitghndificant diferent. AbS(D2I7-0IL6)S0D2 Cont C1o0n0t is 00021612743 "00tads aPiofseirteinvte.values shaw paofmieasns that are significantly 31 DIIS 111698 study Part B. Female rat Liver weight summary a WG)ByDosePFOS= ImGKG) | SAA z3 wl = 7 A LNA]1 T -- NI NE 4MAh v\ Tw wohm,A n e [-- 00s SGruevmamy aoniroFryia | RRFSosqoulMreeaAngSquare Eror Mean ofResponse Baoaiat0dse0z2ae1st ar haanatons or SumWets) " prSoours OF2 AnaSulomfyoVlarsrSiomiaanrscmses MeaanSamare rFoRaniso 7 dss joes paw Cow : 2300 eer ager Liovedaan foNruOmnboevTra AerorMawean SiCEormomr oint P 4 jR oss i or Liow S14NEoorrabrreusrsanecs SpsoDMloeevadanetosntsSeGoDfeeyrovaSridancEeraan Toukm ems Gas Cbyont >i Torses crussr oomsenes OttsoMeantp eanM)eans Compar0i0so0nTos0o i E90 oteoi6 o1r7i4ca0os0nn0 Som G00 oto doses Aptas"Comfopreaach|prairiusi0sn0gsSotudnentss Ae0s(0iL5D 2302464a100 ome6 27o%o 2 36 DITIS 111698 study Co1nt oA2r7s2 224818445782 S2845w47702 `PoCsieovalwmuietshpsahcoowanptariiodrlrluosifinmg eDsuannnteohtsattnrMeetsshiogndificant diferent. As10(0D2L70S5D02 1644o1n5t. C1o8nt 2a5s01766s8 dPiofseirteinvte.valuesshow pairofmeansthatare significantly 3 an Part B. Female Ta rat LW/BW ratio Summary I~ [-- S go NLL A a oO) _ . os <> M \IY Ne TM | = stingTs T=A N w D Ss UareeFreevdosorors RENE etre i5 oisnu Semienn Suan oe on% S= f soarsw)or sgEIrmTSyNumemEumm,ty rsTmeoiesmaseems orwrarwem EIaI uyo[ T{rEomya smTumig b5Loo Sor rt1Tesoppodmts atoso(oAstmlorvresroSauesni & Poon ame DonreesPT owT e oe omlt oem oiom &. hwla soomme aomoehs Aonp%oComnptors rJco!"pow lsosstw osol omom " DTIS 11/16/98 smdy C1ont 0000001023717 0000180022 00.00m081072 `CoPmopsairtivseovnaslwuietshsahocwonptraoilsousfimngeaDnusntnheattsaMreetshiogdicanty diferent. 270)802 A1b0s0(OLSD 0.00C0o5n4t C1osnt 2"o0o0t0e7291 dPiofseirtehnte.values show pairsofmeans tht are signifcanty 35 oss -- Part B. Kidney Weight to Body Weight ratio in male and female rats combined data. SAS analysis. lmEL . o s DTIS 111696 study OSnuemwmaayryAonfovFta. RsRSqquuiarree Ad RoMooatnoefaRneSsqpuoanrseeEror `Observations (or Sum Wets) [01e09e12 0000000463158 2 NSooduerc!e OF Ana'SloufmyvoalsrSiqiaunascees 2 000000005 MeanS2qu5a%r8e 0F0Ra6t5o EnCmoowrl 17 00000000000605655 33u872e77 P0r93o6b0 LevelMeansfoNruOmnbeevrayAnovMaean Suro 10180 88 o0o0o0ss oooomz Cont 4 000250 000031 Std EMreraornussaensdapSodolDeedvieasttiiomnasteofrorvariance 1L1e0v0el Numbe5r onMesan 000S0usDteEv 8 000s 0000744 SWE0m0M00e1a8n. 000026 Cont 4 0004250 0000500 000025 D1i0M0eanfMeanMt]eans Compa0r0i0so0n00s0.00 000000108 0.00o01n2t5 C1o6nt 0000000001030 000.0000000103 00..000000010250 Alphas`Comparisons for eachpir us0in0gsStudent AbsOLSD 2.10t980100 18 Cont 11080 000000008855 000000008855 000000006677 cont 00067 000057 000052 CoPmospiatriivseovnaslwueisshhaocwonpolaousfiimngeaDsnusmnheattsarMeetsihgoidfcantydiferent. 237d1l72 As10(0OILSD 1s 000C0o7n8t "000078 cont "000104 aPioesrieinvte.valuesshow paisofmeans that are sigifcanty 37 1 e|saR m||a|n] C aTE[g11a1] pet| ||[inhode pot||[RH fLootdof[ [ |||pe a ersd T isessse.d fmeodf[LiHLIg nTA1)L1E enEE dd ld Agu inhwl(hsW Ln O 5 L0H " -- Pa B.Gr uint ea Pig Liver to Body Weight Ratio Summary Statistics: | INT<TETON TT *- CY | ao - > om | ERTPA mE OosrOSIgD 0s WnContal oon "3 DTIS 11/16/98 study OSunmemvaaryyAnofovFiet RReSqauuiarreeAd] RNoaotnoefaRnesSpqounasree Error Observations(orSum Wets) 0"008098255448 00000421468877 18 SMooudrecle Er3 or OF Analys'iSsoimfoVlaSrqiaunacrees MeanSqure FRaio 32 000000000080053088 00000000000053 P0r4o0b8o4F 1s 000008544 0000005 06723 LevelMeansfoNruOmnbeewray AnavaMean Si Emor 110s0 45 oooosmearsso ooooosoe Cont 4 oowrso ooor2e StdMEenaornusseansd pSoIolDeevdieasttiiomnasteofervariance L1e0v0el Number"coMezan oSouoDr2osve SidEm0M00e0a8n3 co1nt 34 o00oiu0E7r5s0 00000023437054 0o0g0o0t8e8s. DMeanii MeanMte]ans Comparison1s00 110 0000000003080 Cont 200015 00001S6 0000000101020 0001c5o0n0t 00000010102050 Aphaz`Comparisons fr eachparusi0n0gsStudents 216!087 Ab1s0(0DifHLSD 0010080 0001981 0.0o0n2t3 C1o8nt 0000000213 000000226196 000.00201368 CaPomspitaitveovnasluweisnshaocwpoacisoufnmseaBnns tehatt aHreersnoidficanty diferent. 2463|58 As10(0O-LSD 0.00413030 C1o6nt ""000000323883 dPiofseitrievnetvalues show pairsofmeathnatasre significant DTIS 11/16/98 study Part B. Kidney Weightto Body Weight ratio in male and female guinea pigs. SAS analysis cen8;Dosepros 00s. AAA N joo NL = =VO O ome -- A NN 10 " soars | Seooweest aergan ao 95 DITIS 111698 study O`nSeuwmmaayrAynoofvFat RRRsoqaoutrrMeeeaAnGSquare Error M`OebasenrvoaftRieonsspo(onrsSeum Wats) 05o2s0e0s4e87 00000004444837 15 NSooduels oF Analys'iSsuofmVoafrSiqaunwcees 2 000000338 MeaTnoSoabuoanrze FR8a5t6i3 CEmoorl 21 000000000000253763 4109985t0e77 0P0ro0b4>8F LevelMeansfoNruOmnbeevray AnovMaean 100 " ooss0 Somooo Co16nt 47 oooooioas o0oo0ootT 51d EMreoarnsusaensdaSptodoDleevdieatsitoinmsateof orvariance 10Le0vel 16 Number4 osMesan 0SouoD0esv0 SwEm00M0e0a2n5 7 0004s 000038 000014 Cont 4 0004250 000000 000025 DifMeariiHMeanMt]eans Comparison0s0 100 0000000 000C1o0n00t 0.00110176 CEoSnt 00"1001011 0000000001010 00..000000100070 Apha=`Comparisonsforeachpairusi0n0g sStudents Abs(DifLSD 217!882100 Cont 1 C1o0n0t ES 0000000038187 0000s2 0000000038187 00005 000000050025 000052 `CoPmopsiatriivseovnaslwuieshshaocwopntariolsuosfinmgeaDunnsntehtattsarMeestiogdifcantydiferent. 245dl055 Abs(DILSD 100 C1o0n0t 0000000027189 1s 0.000415 rPoseitnivtevasesshow paisofmeathnatasre signifcanty 2 DIS 11/1698sudy Appendix IV. Part C Oral dosing with N-E(FOSE in rats. Individual data. Animai# Gende 0 DoseN-EFOSE (damygs.Kgidafortwo Specie 5 BW a@ BW @(@ LW(LWB 9W Sadcaryipfoiscte dose [Necropsy [Date 89RO217 M Control R6 246 M Control R7 26 M Conrol Rat 3846388717.3 0.045 Rat 41634204201 0.048 Rat 45374612219 0.047 3 snes 3 ness 3 onese R027 M 20Rat 5237 539302 0056 3 oness 6R027 M 20Rat 48564884238 0049 3 ness 7BRo217 M 20Rst 4673 503238 0.047 3 ones 8 RNaottse,we20rmegd/oKsgeidsonawpopcroonsxecium3iv0ae0tdpapeymsl,iynSt1h1e6/d1i8e9t8,and 9/17/1998with20mg/kg/dayN- EIFOSE, then sacrificed on 9/13/1998. " DIS 111698 study References BSeulrftohniaatuem,ea,nJd,Na-nedthWya-lplaecref,luKo.roBo.c(t2a0n0e2s)u.lfPoenrfalmuiodrooeotchtaannoola;te,PePreorxfilusoormoeocPtroalnieferation aDnedenM,itWo.chPo.,ndJreisaslupB,iDog.eCn.e,nTeshiosm.pTsooxni,coG.l,oRgoymLietgt,ersG.1,2a9n,d23D,-P3.2.(1978). Fluorad FRleusoeraorcchheamnidcaDleSvuerlfoapctmaennttFCCo-r9p5oraactuitoen,orMaaltttoaxwiacint,yM(IL.DS0) study in rat. Intemational Gabriel, K. L. (1976). Acute oral toxicity inratsof T-13891. Biosearch, Inc., PGhoilldaednetlhpahli,a,E.PAI..Jessup, D. C., Geil, R. G., and Jefferson, N. D. (1979). Metabolism Study with FC-95 in rats International Research and Development Corporation, IMLnuatetebtrkaaewcrat,ino,Dn.sMoIJf., fHlaunosreonc,heKm.icJa,lsBawsist,hNr.atM.li,veBrutfeaathyoafcfi,dJ-.bLin,dianngdpSreoatceaitn,. AT.oxMi.co(l2o0g0y2)1.76, PM1a7P5lA-o8Rn5eg.ya,mEm.aKb.yasntdruWctauxramlalny,diDv.erJs.e(e1n99v9i)r.ontmreannts-aAlcctihveamtiicoanlosf. TPoPxiAcoRlaAlppplahnPadharmacol BN1ai6b1n,bdei2fn0e9g-l1dP3r,8o,tDe.in(.19I9n8)E.nvIinrvoenstmiegnattailonoHfeatlhthe,Epf.fe5c0t.sUonfiFvleurosirtoycaorfbMoinnsneosnotLai,veMriFnantetaypoAlciisd.- (S1o9h9l4e)n.iuEsf,feAc.tsKo.,fpAenrdfelrusosroono,ctKa.,noBieergasctiradned,poAt.e,nStppyedreovxoilsdo,m0e. paronldifDeeratPoirerirner,aJt.--Wo.n MSoohrlreinsiuhse,paA.toKm.a, 7Er8i0k0sCso1n,ceAl.l,M.a, raHtocgesltlrloinme,. CB.i,oKcihmilmaBnido,pMh.y,s aAncdtaDe1P2i1e3r,re6,3-J.74W.. (o1x9i9d3a)t.ioPnerafnlduoorthveorctaacntievsituilefsonkincoawcnidtios baepaoftfeenctteidndbuycepreorfoxpiesroomxeispormolailfefraatttoyrasciind mbeotuas-e WPlieavrleflr.laucPoehr,aorKo.mctaBacn.oelLsuuTclobfxkoiencrao,tleD1a2.,n1d9,02-B-3u(.tNe-nehtohfyfl,peJr.fLl.u,oarnodocSteaanceastu,lfAo.naMm.id(o2)0-0e1t)h.yl alcohol are: peroxisome proliferators in rats, but not guinea pigs. Toxicologist 60, 348 Abstract ID: 1657. Yang, Q. Xie, Y., Alexson, S. E., Nelson, B. D., and DePierre, J. W. (2002). Iinmvmoulnvoemmoednutloafttihoenpcearuosxeidsboymepperroolxifiesroamteorp-raocltiifveartaetdorrsecienpmtiocre.alBphiaocinhethmePharmacol 63, 1893-900. " 48