Document R26yggb1O29pqLk1yKz4w8m4V

~ 33MM CCoommppaannyy SStt.. PPaauull,, MMiinnnneessoottaa - CL - = ---- FFlluuoorroocchheemmiiccaall ((FFCC)) DDaattaa AAsssseessssmmeenntt RReeppoorrtt 33MM CCoommppaannyy CCoottttaaggee GGrroovvee,, MMiinnnneessoottaa FFaacciilliittyy - AApprriill 22000066 . = 06P-~186-1 22009955..00000011 2095 33MMAA0011555511777788 FFLLUUOORROOCCHHEEMMIICCAALL ((FFCC)) DDAATTAA AASSSSEESSSSMMEENNTT RREEPPOORRTT FFOORR TTHHEE 33MM CCOOTTTTAAGGEE GGRROOVVEE,, MMNN FFAACCIILLIITTYY AApprriill 22000066 - PPrreoppaarreedd ffoorr 33MM CCoommppaannyy bbyy = WesWWtEECShSeTTsOOteNNr,SSPOOeLLnUUnTsTIyIOOlNvNaSSn,,iaIINN1CC9..380 West Chester, Pennsylvania 19380 WW..OO.. NNoo.. 0022118811..000022..001100..00000011 22009955..00000022 33MMAA0011555511777799 TTAABBLLEE OOFF CCOONNTTEENNTTSS - SeScetctiioonn PPaaggee . EESS EXECUTIVE SUMMARY wovcnvsmmsmmsssmmssssssssnssssnsissnnis ES FE EE| - 11 BACKOROUID orm 11.22 PURPOSEOF THEFLUOROCH(FEC)MICAL ASESMENT..1-2 PURPOSE OF THE FLUOROCHEMICAL (FC) ASSESSMENT ........ 1-2 - 2. EENNVVIIRROONNMMEENNTTAALL SETTING coon SETTING ...................................................................... 23--11 o 22.11 SISITTEEL LOCO ATIOC NAANNA DDDDET SECSRCIRPI TIPITONIO O..N....N ......................................n ........l ... 2-1 - 22.22 LLAANNDD UUSSEE AANNDD DDEEMMOOGGRARPAHPIHCICS.S -- .................................................... 2-1 22.33 TTOPOOGPRAOPHGYAARNNDDADDRARPIANIAHNGAE.YG.E...... smn ....................................................... 2-4 22.44 GGEEOOLLOOGGYY wooo mmm 355 .............................................................................................. 2-5 22.55 WWAATTEERR UUSSAAGGEE AANNDDHHYYDDRROOGGEEOOLLOOGGYY. i ......................................... 2-8 3. SSUUMMM MAARRYY OOFF FFIIEELLDD AACCTTIIVVIITTIIEESS rman 3-1 .........................: .................................. 3-1 = 33.11 DDESCE RIPTS IONOOC FFTTHHR EE GGRRI OOUUNNP DDWWAAT TTEERRAI ASSSSEEO SSSSMMEN ENNT.T .......................33--11 - 333.111.121 BBOUnaCsckikGtgIeroOGuUrnMo.duR..G.c .W..A..I..E..Er ..S..A..M..P..o .L..I..N..G...s ...........o..o.s o..r.o..m.o..n.r.e .m.r..o..r.m..e.s m..i.m..s.n..n......... 333--111 - 3.1.2 33O3.11n1.-222s.i121te GroMuoPMnndoiwntraiottroeorriinSnggadamWWneplduelliWlsnlas.gct...e.....r...tS.....u.....p.i...p....l....yo.......s .....n.........e .............W.p .e..l..l...s.........t...............a333:--514 313 W333..111..o222..332odSitbBPBeruuSouiadldimuiprcnlltgiiod1yn1n1g1i6a6nnTTdaagWpp a..t.e..r...S..u..p..p..l.y...W..p.e..l-- .l.s.r.........n............m...........--......... --33--56 - 33.22 DESCOR FTHIESP OILTASSIESSOMENNT. spond 3.1.3 Woodbury Site Sampling .......................................................... DESCR~TION OF THE SOIL ASSESSMENT .................................... 3-6 321 Background... - 33.-99 322 3.2.1 3.2.2 BD3Da2ecs2ekc1rgirpostuionncdoo.Df.f.rI.SS..o.oiA..iirl.l.Be.B.oa..opr..ri.Fi.nn.ot.gg.r.S.mS..iae.U.m.r.P.p.oH.El.Fi.n...Tg.n.a....r.......N.....e....u....t.....r......a.......l.....i.....z......a....o..tPr....ir....eto..w...n..n.........3.33---3111-1090 3222 3.2.2.1 3.2.2.2 3223 DDDDS221-AAArFrrcoeearaam-eFFFroooSrrrommmleieerdrrSsHSllBuFududTgmgaeePrDiDNitsiespupotosrsaaallilzAatriB eoan .P..X .i.t......... ) 33Area-.-.11. .173-17 - 3333..2222..2222..5434 DFDDiSr58-e--FTFFroaoorirrmnmmieneergrr WSWAaoacslistdtaeesD.DBi.uissmp.opPsoaitls.A..a.r.e.l.a..............A..r..e..a..................................33.3.--.1311-81878 3333..2222..2222..7656 FoBFBirurueimldeiTirrnlagWinId1iSa5niAgArsnAreegrtaae.a..e......P...w...o....n..a..d....A..ft....e....a..e...........r..................................e........t..........n..............33d3---i111D899 _ 323 333D..222..2e22..887 s coBfFBAroSaCurckmrkiBfgeaIrrcopOWeuUSnaModtsAitAeTlwCSirReaaSamt.sepo.rl..iPo.nn.o.g.on...d.o..A...r.e..a................................e......r......n.......... 33-2109 3P-2200 33 3D.E2.S3CRIPDTeIsOcrNipOtiFoTn HofESuSrfEaDceIMSEoiNl TSaAmNpDlinSg.U..R...F..A...C..E....W...A...T...E...R........ 3-20 3.3 ASSESSMENT... ammm--1 DESCRIPTION OF THE SEDIMENT AND SURFACE WATER ASSESSMENT ...................................................................................... 3-21 333.333.121 EMEIaSsSatIaSSnIsdPWPWeItRseIsttVaCCEoTovnevse.sdc ...........o ........c .........o ......s ..............m .............n ...3.. 23-251 3.3.2 Mississippi River .................................................................... 3-25 22009955..00000033 33MMAA0011555511778800 TTAABBLLEE OOFF CCOONNTTEENNTTSS ((CCoonnttiinnuueedd)) - 34 DESCOFR THEIMISSPISST IPPIIRIVO ER FN ISH 3.4 DESCRIPTION OF THE MISSISSIPPI RIVER FISH SAMPLING PROGRAM... nn 326 SAMPLING PROGRAM ...................................................................... 3-26 - 4. RESULTS OF THE FIELD ASSESSMENT. dl o RESULTS OF THE FIELD ASSESSMENT................................................... 4-1 41 SUMMARY OF THE ANALYTICAL DATA REDUCTION 4.1 SUMMARY OF THE ANALYTICAL DATA REDUCTION ~ PROCESS... rnd] PROCESS ................................................................................................ 4-1 42 GROUNDWATER... rnd 4.2 GROUNDWATER .................................................................................. 4-2 42.0 Groundwater Flevatios.d........ a2 4.2.1 Groundwater Elevations............................................................ 4-2 - 422 SuomfAnam lytica al Dratya... 42 4.2.2 Summary of Analytical Data .................................................... 4-2 423 LOI Wells - Groundwater Anaiyical Dar 49 4.2.3 LOI Wells - Groundwater Analytical Data .............................. 4-9 424 WOSOHCr DY ss 4-11 4.2.4 Woodbury Site ......................................................................... 4-11 - 44.33 SSOOIILL............................................................e..r...m....................................... 84-1155 431 DI Area ~Former HF Tar NeulrlizatiPoint vv 27 4.3.1 - 432 D2Arca FormerSludgeDisposal Atc..... 27 4.3.2 433 DS Area FormerSolds BUM PiL.......ooooonronn 28 4.3.3 434 D8Area FWoasimcDismposeal r AT... 428 4.3.4 435 FireTrainingAca... mre 429 4.3.5 436 Building 15 Area... a2 4.3.6 437 Former WastewPoandtAercra Cle 4.3.7 443.33.88 439 BUCKGIOUM...c.. oe a0 4.3.9 D 1 Area - Former HF Tar Neutralization Pit ......................... 4-27 D2 Area - Former Sludge Disposal Area ............................... 4-27 D5 Area Former Solids Bum Pit .......................................... 4-28 D8 Area Former Waste.Disposal Area ................................ 4-28 Fire Training Area................................................................... 4-29 Building 15 Area ..................................................................... 4-29 Former Wastewater Pond Area ............................................... 4-29 OOtthheerrSSiitteeAATEraesa.s.................c..o.s..s..m.m..m.m..s.s..m..m.m..m.r..m.s..e..m.e..s.s..s.s..s..s.s..m.n..s.............. 44--3300 Background ............................................................................. 4-30 44 SEDANIDSUMRFAECEWNATT ER vcr 31 4.4 SEDIMENT AND SURFACE WATER ............................................... 4-31 - 441 EastandWest COS. nd26 4.4.1 442 44444Mi44444ss21112i11322ssippiRSNSiuSSPuvreerfeDdaardEicciSememAeWWnenaatatnley.rtottoiecoarlmsDriotenaL ... IonlGaad44se4a43s006 4.4.2 East and West Coves ............................................................... 4-36 4.4.1.1 Sediment ............................................................ 4-36 4.4.1.2 Surface Water ..................................................... 4-36 4.4.1.3 NPDES Analytical Data ..................................... 4-36 Mississippi River .................................................................... 4-40 4.4.2.1 Sediment ............................................................ 4-40 4.4.2.2 Surface Water ..................................................... 4-40 45 MISSISSIPPI RIVER FISH. rma S41 4.5 MISSISSIPPI RIVER FISH................................................................... 4-41 = 5. RREEVVIIEEWW OOFF DDOOCCUUMMEENNTTAATTIIOONN OONN HHIISSTTOORRIICCAALL W WAASSTTEE DISPOSAL SITES vrei So DISPOSAL SITES ............................................................................................. 5-1 - $1 FILE REVIEW. core SY 5.1 FILE REVIEW.......... i .............................................................................. 5-1 52 INTEWITRH FAVCILIITY PEERSWONNSEL cc 53 5.2 INTERVIEWS WITH FACILITY PERSONNEL .................................. 5-3 - 6. DATA ASSESSMENT AND IDENTIFICATION OF DATA NEEDS.......6-1 DATA ASSESSMENT AND IDENTIFICATION OF DATA NEEDS......... 6-1 62 som i i 62 66..11 GGRROOUUNNDDWWAATTEERR ...........s...e...n..s.......s .....n.....r....."..............n.e.r..s.n.e.s..e.m.e.e..r.r.s.e.s..e.n.s....G. e6-]1 6.2 SOIL ......................................................................................................... 6-2 66..33 SS EDIE MEND TAANI NDDSSM UURRFFE AACCEEN WWAATT TEERR ..........repr......................................6. 64-4 EAFOLDERS,O-9~3m-cotlage grove~FC Data Assessment Report~Final.doc 22009955..00000044 33MMAA0011555511778811 TTAABBLLEE OOFF CCOONNTTEENNTTSS ((CCoonnttiinnuueedd)) - 66.44 MMIISSSSIISSSSIIPPPPII RRIIVVEERR FFIISSHH ..................................................................... 66-s5 - 7. RRACEETCCIOOOMMNMMcEiENmNDmDAmATsTIsIOOmNmNmSSsFFmOOnRRsmTTnHHsEEmFFmUUnTTnUUsRRmEEmmCCrOOmUUsRRmSSsEEmmOOmFFmmmsnmmndil ACTION .............................................................................................................. 7-1 FT --------| REFERENCE ..................................................................................................... 8-1 22009955..00000055 33MMAA0011555511778822 LLIISSTT OOFF AAPPPPEENNDDIICCEESS AAppppeennddiixx AA -- W Weellll EEvvaaccuuaattiioonn//SSaammpplliinngg FFoorrmms.s - AAppppeennddiixx BB -- SoSiolil BBoorriinn.ggLLooggss Appendix C - Annual Report for 2005 Collections under Special Permit No. 13031 Appendix C - Annual Report for 2005 Collections under Special Permit No. 13031 - AAppppeennddiixx DD-- AAnnaalylyitiiccaallDDaattaa PPaacckkaaggeess iv 22009955..00000066 33MMAA0011555511778833 prison) TU T stor LIST Om F FIGe URESuRes - Tite Title PPaaggee _ FIgE2-0 Figure 2-1 Sie Site LOSRON Location MaDe 22 Map .................................................................................... 2-2 FEE 22 Figure 2-2 SHE LAYOU cn 25 Site Layout .........................."..................................................................... 2-3 Figure 2:3 Generalized SrtigraphieCross Section AA"... 26 Figure 2-3 Generalized Stratigraphie Cross Section A-A'. ....................................... 2-6 - Figure 2:4 Cross Section A-A" Location 27 Figure 2-4 Cross Section A-A' Location ................................................................... 2-7 = Figure 2:5 Groundwater Elevations ~ March 2008. 10 Figure 2-5 Groundwater Elevations - March 2005 ............................. .................... 2-10 Figure 31 Figure 3-1 Well LOGON coerce Well Locations ......................................................................................... 3-2 Figure 32 Production Well Locations Woodbury SH. a7 Figure 3-2 Production Well Locations- Woodbury Site............................................ 3-7 Figure 33 Soil Boring and Surface Soil Sample Locations-May 2005 12 Figure 3-3 Soil Boring and Surface Soil Sample Locations - May 2005 ............... 3-12 Figure 3-4 Figure 3-4 Sediment and Surface Water Sample Loca-tAuiguostns 20S.. 324 Sediment and Surface Water Sample Locations - August 2005 ........... 3-24 - Figure 3-5 Fish Samp-lAUeSUsSt 200... 328 Figure 3-5 Fish Samples - August 2005 .................................................................. 3-28 - Figure rl Figure 4-1 Cro8S Cross Section Section B-B' B-B'. cr ................................................................................. 434-3 Figure 2 Cros SecBtB'iLOoGHnON ccc Figure 4-2 Cross Section B-B' Location ...............................................................i... 4-4 Figure 43 Average PFOA Detected in Groundwater- Merch indMay 2005......47 Figure 4-3 Average PFOA Detected in Groundwater - March and May 2005 ......... 4-7 - Figure 4-4 Average PROS Detected in Groundwater- Marchand May 2005... 4-8 Figure 4-4 Average PFOS Detected in Groundwater - March and May 2005 ......... 4-8 - Figure45 Average PFOADetcted inGroundwater ~ Merch, Api, May 2005 4-13 Figure 4-5 Average PFOA Detected in Groundwater - March, April, May 2005 .. 4-13 - Figure 4:6 Average PROS Deteted in Groundwater - March,Api May 205..414 Figure 4-6 Average PFOS Detected in Groundwater - March, April, May 2005 ... 4-14 Figure 47 Average PFOA DetieSoicls tMaey20d08. 425 Figure 4-7 Average PFOA Detected in Soils - May 2005 ...................................... 4-25 Figure48 AvPeOSrDetactegdinSoeils May2005.c.ccccc 26. Figure 4-8 Average PFOS Detected in Soils - May 2005 ....................................... 4-26 22009955..00000077 33MMAAO011555511778844 LLIISSTT OOFF FFIIGGUURREESS ((CCoonnttiinnuueedd)) ~ - FFiigguurree 44--99 AAvveerraaggee PPFFOOSS aanndd PPFFOOAA DDeetteecctteedd iinn SSuurrffaaccee W Waatteerr aanndd SSeedimdeintm---AeAuugnguuststt 22000055. mm----r33 ........................................................................ 4-33 FiFgiguurree 77--11 Schedulefor Schedule for thePhase the Phase 2 2 FC FC ASSESSED .cvvvnrennn Assessment .................. .............................. 7T--44 vi 22009955..00000088 33MMAA0011555511778855 LLIISSTT OOFF TTAABBLLEESS - TaTabbllee PPaaggee TTaabbllee EESS--1I SSuummmmararyy((bbyy MMedeidaia))oofftthheePPhhaassee 22 FFCCAASSsCsSeSssTmIEeNnt .......................c....c.c.c.r.... EESS-O9 TTaabbllee33--11 GGrourndwoateurSSaanmmppllidinnggSwSuummmamaratyry-OeOnns-irstitee WWeelllsl...s.................................33-33 TTaabbllee33--22 Sampling Sum~mWoaodrburyy Site Production Wells and Non-Contact Sampling Summary - Woodbury Site Production Wells and Non-Contact LL nnn 38 Process Water........................................................................................... 3-8 TTaabbllee3d-33 SSuummmmaarryyooffSSooiill BBoorriinnggss aanndd SSooiill Samples..... 313 Samples .......................................... 3-13 TTaabbllee33--44 SSumUmarymooffSmSuurrffaMacceeSSAooiill SrSAMaPmLEypSl.e.s. 322 ........................................................ 3-22 Table3-5 Table 3-5 FFiisshh WWhhoollee BBooddyyTTiissssuuee SSaammpplleess SS-- ......................................................... 3-29 - TTaabbllee33--66 FFisishh FFiilleett TTiissssuuee Samples... mmm 330 Samples ...................................................................... 3-30 - TTaabblleed4--11 SSuummmmaarryyooff FFCC CCoonncceenntrtraattiioonnss iinn 33MM CCoottttaaggee GGrroovvee GGrroouunnddwwaatteerr `SamSpalesm~- pMMaalrrccehhaansndd MMaayy 22000055 smn ............................................................. 4-5 - TTaabblleed4--22 SSuummmamryoaoffrLLOyOII AAnnalyaticallDDyaatttaa~-iJJuucnnee2a2000l033 t1o0 JJuunneg 2200005.5.........................4. -4-1100 - TTaabbllee4d-33 SSuummmmaarryyooffEFCC CCoonncceenntrtraattiioonnss iinn WWooooddbbuurryy SStitee GGrroouunnddwwaatteerr SSaammppllees--s- MMarcah, AAprpririll,,cMMaayhy22000,055.....................c..........................................d...e4l-122 TTaabbllee 44--44 SSuummmmaarryy ooff FFCC CCoonncceennttrraatitoinosininsn CCoottttaaggee GGrroovvee SSooiill SSaammppllees--s- N MMaayy 22000055 oe wmsmmmm--------_o ............................................................................................... 4-16 TTaabbllee 44--55 SSuummmmaarryy ooff TTOOCC CCoonncceenntrtraattiioonnss iinn SSooiill SSaammpplleess -~ MMaayy 220 05. 0. .5. ........... 44-2233 TTaabbllee 44--66 SSuummmmaarryyoOffSSiieevvee GGrraaiinn SSiizzee DDiissttrriibbuuttiioonn iinn SSooiill SSaammppllees--s- - MSayy I200B5 memos ............................................................................................... 4a-224 TTaabbllee 44--77 SSuummmamryaoofrfFFyCC CCoonncceenntrtraattiioonnss DDeetteecctteedd iinn SSeeddiimmeenntt SSaammplpelsesAuAguugusstt 22000055 swnmmmssmm------_2 ........................................................................................... 4-32 vii 22009955..00000099 33MMAA0011555511778866 presi LLIISSTT OOFF TTAABBLLEESS ((CCoonnttiinnuueedd)) - TTaabbllee4d-88 SSuummmmaarryyooff FFCC CCoonncceenntrtraattiioonnss iinn SSuurrffaaccee WWaatteerr SSaammpplleess AAuugguusstt 22000055 -------- ........................................................................................... 434 4-34 - TTaabbllee4d-99 SSuummmmaarryyooff FFiieelldd--MMeeaassuurreedd PPaarraammeetteerrss iinn SSuurrffaaccee WWaatteerr - `SSaAmMPpIleESs -+ AAUuUguSs!t 22000055 rr wnssmmdi3S .......................................................................... 4-35 . TTaabbllee 44--1100 SSuummmmaarryyooff NN-PPDDEESS AAnnaalylyttiiccaall DDaatta=a- 22000000--22000033 ..........c.r.....c..o.v..v..o.r..e..n....3.. 47-37 TTaabbllee 44--1111 SSuummmmaarryyooff NNPPDDEESS AAnnaalylyttiiccaall DDaattaa- 2~0200044..........c........o..v..o..v.v..e..v..r..o..n..e..n......34-838 TTaabbllee4--1122 SSumummarymooffaNNPPrDDEyESS AAnnaalylyttiiccaall DDaattaa -- 22000055................................................... 4-3399 - TTaabbllee 44--1133 CCOoMmPOpSoIsittee FFiisshh SSaAmMplPesI..E...S...................v....v...v...r...r...n...r...n...s...s...e...m...n...o...n....s....4. 4-242 - TTaabbllee4--1144 MMisisssiissssiippppii RRiivveerr -~ SSuummmmaarryy ooffW Whhoollee FFiisshh AAnnaallyyttiiccaall RReseuslutsl.t.s...............44--4433 ~ TTaabblleed4--1155 MMisisssiissssiippppii RRiivveerr - -- SSuummmmaarryyooffFfiisshh FFiilleett AAnnaallyyttiiccaall RReessuullttss ............. Fert 4-44 TTaabbllee 55--11 OOffFf-SSiittee WWaassttee DDiissppoossaall LLooccaattioinosns--- 33MM CCoottttaaggee GGrroovvee,, MMininnensoetsao..ta. ..... 5-2 5-2 - TTaabbllee 77--11 SSuummmmaarryy ((bbyy MMeeddiiaa))ooff tthheePPhhaassee 22 FFCC AASsSsEeSsSsMmIEeNntt cn .............................. 77--33 E:~FOLDEgS.O-9~3m-eottage grovcWC Dat~ Assessment Re0o~t~Final.doc viii 22009955..00001100 33MMAA0011555511778877 EESS.. EEXXEECCUUTTIIVVEE SSUUMMMMAARRYY TThhee 33MM CCoommppaannyy ((33MM)) CCoottttaaggee GGrroovvee,, MMiinnnneessoottaa ffaacciilliittyy hhaass bbeeeenn iinn ooppeerraattiioonn ssiinnccee _ 11994477.. TThhee ffaacciilliittyy ccuurrrreennttllyy mmaannuuffaaccttuurreess aa rraannggee ooff pprroodduuccttss,, ssoommee ooff wwhhiicchh iinncclluuddee aaddhheessiivvee pprroodduucctts,, ssppeecciiaallttyy ppaappeerr, iinndduussttrriiaall ppoollyymmeerrss,, aabbrraassiivveess,, aanndd rreefflleeccttiivvee rrooaadd _ ssiiggnn mmaatteerriiaallss aanndd aallssoo eennggaaggeess iinn rreesseeaarrcchh aanndd ddeevveellooppmmenetn.t. 33MM hhaass wwoorrkkeedd ccooooppeerraattiivveellyy wwiitthh tthhee M Miinnnneessoottaa PPoolllluuttiioonn CCoonnttrrooll AAggeennccyy ((MMPPCCAA)) ssiinnccee tthhee eeaarrllyy - 119988005s iinn aasssseessssiinngg aanndd aaddddrreessssiinngg tthhee ffaacciilliittyy''ss ppaasstt oonns-siittee wwaassttee ddiissppoossaall iissssuueess.. 33MM hhaass eexxpprreesssseedd iittss iinntteennttiioonn ttoo vvoolluunnttaarriillyy aasssseessss tthhee pprreesseennccee ooff fflluuoorreocchheemmiiccaallss - aassssoocciiaatteedd wwiitthh tthhee mmaannuuffaaccttuurriinngg ooppeerraattiioonnss aatt tthhee CCoottttaaggee GGrroovvee ffaacciilliittyy.. TThhee fulouroorocchheemmicicaallss ((FFCCss)) iinncclluuddee tthhee ffoolllloowwiinngg ccoommppoouunnddss:: PPeerrfflluuoorrooooccttaannooiicc aacciidd ((PPFFOOAA)) -- AAnn 88--ccaarrbboonn ((CC88)) ccaarrbbooxxyylalatete.. + Perfluorooctane Perfluorooctane ssuullffoonnaattee((PPFFOOSS))--AAnn 88--ccaarrbboonn ((CCS8))ssuulflfoonnaatete.. - PPeerrfflluuoorroohheexxaannee ssuullffoonnaattee ((PPFFHHSS)) -- AA 66--ccaarrbboonn ((CC66)) ssuullffoonnaattee.. PPeerrfflluuoorroobbuuttaannee ssuullffoonnaattee ((PPFFBBSS)) -~ AA 44--ccaarrbboonn ((CC44)) ssuullffoonnaattee.. IInn DDeecceemmbbeerr 22000044,, 33MM ssuubbmmiitttteedd ttoo tthhee MMPPCCAA tthhee FFaacciillittyy--wwiiddee FFlluuoorroocchheemmiiceaalI ((FFCC)) ~ IInnvveessttiiggaattiioonn WWoorrkk PPllaann ((FFCC WWoorrkk PPllaann)) ttoo aasssseessss tthheessee FFCCss aatt titss CCoottttaaggee GGrroovvee,, MMiinnnneessoottaa ppllaannt.t. TThhee MMPPCCAA aapppprroovveedd tthhee W Woorrkk PPllaann wwiitthh mmoodidfifiiccaattiioonnss iinn JJaannuuaarryy _ 22000055. FECC AASSSSEESSSSMMEENNTT AAccttiivviittieess ccoonndduucctteedd uunnddeerr tthhee FFCC W Woorrkk PPllaann wweerree iinniittiiaatteedd wwiitthhaa ffiillee rreevviieeww iinn JJaannuuaarryy - 22000055.. TThhiiss rreevviieeww wwaass ccoonndduucctteedd ttoo ccoolllleecctt iinnffoorrmmaattiioonn oonn tthhee hhiissttoorriicc 33MM CCooltltaaggee GGrroovvee ffaacciilliittyy wwaassttee ggeenneerraattiioonn,, wwaassttee ddiissppoossaall,, oorr ttrreeaattmmeenntt bbootthh oonns-siittee aanndd ooffffs-istitee.. - TThhee ffiieelldd aasssseessssmmeenntt ccoommmmeenncceedd iinn MMaarrcchh 22000055 aanndd wwaass ccoommpplleetteedd iinn AAuugguusstt 22000055.. IItt ccoonnssiisstteeddoofftthhee ffoolllloowwiinngg:: + GdGarrtoaouunanndddwwaagtrteeorrunaadnnwddatAAedrdddisitatimioopnnlaealsl AAwsesssreeesssscmmoelelnnettct--edIInnfrMMoamarrcc2hh1 aaennxddisMMtiaanygy m22o000n05i5,t,orffiiieenlldgd wGwderaeltollalvss,e,anssfdiaixcxiglppirtrroyoou.ddnuudOccwtntiieaootnnemrowwnseieatlsmlos,rp, ileaansnngddwwettelwwrleoo(cwwMoaWatltl-eeer6rc)tessduucppoppfurllloyydmwwnoee2tll1llbsseeaaxsttiasttmthihpneelge33dmMMdounCCcioottottttroaaingaggnee Grove facility. One monitoring well (MW-6) could not be sampled due to an E:WOLDERS.0-9k3m-cottage groveWC Data Assessment EE Re~rtWinal.doc esa ES-1 22009955..00001111 I3MMAA0011555511778888 oo(cbbassftterrtuueccrttiiiaoo)nnwiiannstthhceoewlwleeleclltlebbdooarrcfehthorolelge.r.anuAAlassraaammcpptlileevoaotfefdwwacatatererbroffnrro(ommGAtthChee)tttaarppeaaatttmBBellnddtgg.u.n1i11,166. (cafeteria) was collected after granular activated carbon (GAC) treatment unit. - A(AdWddodiotitidioobnnuaarlllylyy,S,ittthheee) ffaoonuudrrtpphuuemmcppoiimnnbggiwwneeeldlllssdiaasttctthhhaeergffeoorrfmmreeorrm33tMMhesWWeoowoeodldblbsuu,rrwyyhddiiicsshppoopssraaollvisiitdteee a (nnoWononcno-e-cocopodnenbtrtuaamrccyottnSpptirrhtooecc)feeoassrnsstdhwwrtaheateeteemrcroonffmootrrbhisttnhheieedn 33MdMaMisrccChChoao,trtgttAaaepggrfieerlo,GGmraroontvdvheeeMsefafaaywcciilel2iil0ttly0ys5,,,.wwweheArirtceehtsshpaaermmospvpalmildeeedde. _ otieienmmtceeee,n,tpitteohhrneempddooiinnssdccthhhaaalfrrsoggoreewthaffrrsreooemsmammttpohhlneeetdh33.sMMin CCMootattrtacagghee, AGGprrrooilvv,eeannndoonnM--ccaooynnt2taa0cc0tt5pp. rrooAccteetsshssewwsaaatmteerer retention pond also was sampled. i. SoiSnioslitlalAAlsessdseestsossmmdeeenpnttth-s-- rIInannMMgiaanyyg 22f00r00o55m,, 2tth5heetssoooi7ill0aafssessceetssssbmmeeelnnottwiingncrcloluuuddneeddd s11u66rfssaoocileil bb(footrriibnngggss)s abianonnrsdditangl1l1se11.d22 toccoodmmepppootshsisitteeranssoogiiillngssaafmmroppmlleess25ccootollllee7cc0tteefddeeaatttbe-5l-otfwt iignnrtteoerruvvnaadllsssuffrrrfooammce tt(hhfeet bssgoosiil)l borings. FFlioiffcttayyti((o55n00s))issnuurdrffraaaccieenassgooieillwassyaasmm,pplaleersesawwseewrrheeecrcooellllFeeCccttseeddweffrrroeommhattnwwdoolessdhh,aallallnoodwwoddteheepprtthhgssenaatetr22a55l - site locations. locations in drainageways, site locations. areas where FCs were handled, and other general + SSaesesddeiismmseemnnetnttaannwddaSSsuurrcffoaanccdeeuW Wctaeatdteera-r-t IInnthAAeuug3guuMsstt 22C00o00t55t,a, gaaesseeGddriimomevenentt aafnnacddilssiuutyrrffaacacenedwwaattteherer - MaMssiasismsespssilisssemsisipeppnpwitei rRRweiivavceseorr.l.lceocnTTtdewwdueecnnftteitydyom((a22tt00h))ethssceeeaddsiit3mmMeaennntdtCssowaaetmtmsaptgpleleecssoGvaaernnsoddvaennniidnnfaeetchisseluiutrryMffiaasccaseenisdwwsaiatptthepereir RsRcaioivlmveleprer.cl.etseSSdiiwfxxressroeeemddiictmmoheele0lnne-ttc1tsse0aadmmcpfpmrlloeedms,e,pccttoohhlleooiccneaatatetseretvddalawwniaidltthhlwossiecixxasttssiuuocnrrosffvaueuccspeeswtwaranaetdtaeemrrt,hsseaaadmmMjppalcileseesssn,i,ts,swwieapernpredei _ cddcoooollwwllneensccstttteerrdedeaaffmrmroomoomfftthtthhhreeeee0ff-ala1coc0icillaicitttmyiyoiindnnsepitthnhtheethiMMenictsiaessrssivistsasslaiipnpaptdpiwiloeRRcsiaivtvteiecorro.n.vseSSuseepddasitinrmmdeeaeunmnptts, tssaaradmemjapapmlcleeeonssfct,wwaeaecnrrhede - ccscuooorvvllfeeea..ccteeOOdnwnfaeertoessmruurrtffshazarccemeeeplwwloeaacttaeewtrriaosssnaasmmciponplllleethecewwtaeeasdasstccuoopallnslldteerccwetteeaeddmstffrcoroofomvmetsheeeaaaccnchhdasccutoopvvsecet.ro.evaemAAllsbsoouof,t, eooatnnchehee. ddsurrarafiianncaaeggeewwwaaayyteuurppsssitarsmeeapamlmeoofwfttahhsee wwceoessltltecccootevvdee wwuaapssstddrreryya..m of the east cove but the - Fish - In August 2005, fish sampling was performed at three reaches of the FMMdioissiwshsnsisiss-tssriIienppappmiAi.uRgRiAuivvsetetrro,2,ta0l0ooo5nnf,cef6i2suuhppfssisttsarrhemeawapmeml,ri,negooconnwlcelaescaatpddeejjdaarfccioeenrnncmttlueddt(io0nagtttht1hh1eerespepmllaaarlnentlat,,mchoueaastnnhddobfaootsnhnseee, - dw33o00ewrccenhhsapatnrnrneenpeaealmlrcc.eaadttAfffiirssthhoomtaaanntlhddoe f22c116ol2.bbllelfuuciesteghegidilwllslepssreuuecnnficfimiossehlhl.ne.scWWtfehodhorolcilnehecebblmuooidcddiayynlgooarr1n1affliilyslesmetesati.ilsslssmuuoeeusstahammbppallseesss, were prepared from the collected specimens for chemical analyses. - FiFcluirleereRRnteevveiimeepwwloaaynneddesIInnwtteeerrrveviieecwwosnsd--ucAAtefdfiilleteorreecvvoiilelewewctaanniddnfiionnrttemearrvtviiieoewnwssowwniittthhherreehttiiirsretedodriaacnnaddl - waste generation, waste disposal, or treatment both on-site and offsite. current employees were conducted to collect information on the historical waste generation, waste disposal, or treatment both on-site and off-site. AAllll ooff tthhee ssaammpplleess ccoolllleecctteedd uunnddeerr tthhiiss FFCC aasssseessssmmeenntt pprrooggrraamm wweerree ssuubbmmiitttteedd ttoo EExxyyggeenn RReesseeaarrcchh iinn SSttaattee CCoolllleeggee,, PPeennnnssyyllvvaanniiaa,, ffoorr aannaallyysseessooffPPFFOOAA,, PPFFOOSS,, PPFFHHSS,, aanndd PPFFBBSS.. = EESS-22 22009955..00001122 33MMAA0011555511778899 AA ssuubbsseett ooff tthhee ssooiill ssaammpplleess wweerree aallssoo sseelleecctteedd ffoorr ggrraaiinn ssiizzee ddiissttrriibbuuttiioonn aanndd ttoottaall oorrggaanniicc ccaarrbboonn ((TTOOCC)) aannaallyysseess.. "RESULTS OF THE FC ASSESSMENT AND DATA NEEDS RESULTS OF THE FC ASSESSMENT AND DATA NEEDS `The findings from the fl review relative to waste disposal locations uilized by the Tfahceiliftiynedinegssfurbommitttehde tfoiltehereMvPieCwAreilnaJtiuvnee t2o00w5.astTehidsisrpeovsiaelwlioncdaitciaotnesd uthtitli,zeodthebryththaen facility onsite, wtheerree swuebrmeitttherdeetoktehye oMffPsiCtAe ainreJausnweh2e0r0e5w.asTtheiss rweevrieewdisinpodsiecda.tedTthheast,eoitnhcelrutdheadn: - tohne-sfitoer,mtehrerOeakwdearleethdiresepokseayl soiftfe-s(iOteakadraelaes wSihte)retwheasWteosodwbeurerydiSsiptoe,seadn.d TthheesWeasinhcilnugdieodn: tChoeunfotrymLearndOfialkl.dalTehdeisOpaoksdaallseiteSi(OtaiksdbaelienSgitaes)s,etshseedWboyo3dbMuruyndSeirtea, arnedlattheed bWutassheipnagrtaotne - CWoorukntpylaLn.andTfhilel. WTohoedbOuarkydaSlieteSihtaesisbebeeningasaesssseessdedunbdyer3MtheuFndCerWoarreklaPtleadnbcuotvseerpeadrabtye wthoisrkDaptlaanA.ssTehsesmWenotodRebpuorryt.SitTehheaMs PbeCeAn aisssaedsdsreedssuinndgetrhtehWeaFsChiWngotroknPCloaunnctoyvLearneddfiblyl - tuhnidseDr attsa CAlsosseesdsmLaenndtsRilepPorrot.grTahme MPCA is addressing the Washington County Landfill under its Closed Landfill Program. - It eas found that the facility personnel interviews corroborated information from the file Irtewviaeswfoaunnddptrhoavtitdheedfaacddiliittyiopnearlsodremtaiells.inteArvienwews ciotrermobdoirsacteudssiendfodrumraitnigonthferompertshoennfielle rietveirevwiewasndwapsrotvhiedepodssaidbdlietieoxniasltednecteaialsn.d lAocanteown oitfeamfodrimsecrusosne-dsitdeusrilnugdgtehdeisppeorssaolnpnietl Ninoterdvoiceuwmsenwtaastitohne poofstshiibslepietxwiastsenecveidaenndt lionctahtionfloefeavfioermw earnodni-tsihtaessnluotdgbeeednispasosseaslsepdi.t. No documentation of this pit was evident in the file review and it has not been assessed. - `TThhiiss ffoorrmmeerr oonn--ssiittee sslluuddggee ddiissppoossaall ppiitt hhaass bbeeeenn ddeessiiggnnaatteedd aass DD99 ffoorr ffuuttuurree aasssseessssmmeenntt purposes. purposes. `Groundwater -The highest FC concentrations were detected in groundwater samples - Gfrroomumnodnwitaotreirn-gTwheellhsigMhWe-st1F2CdocwonngcreandtiraetnitonosfwtheereDSde--tecFtoerdmeinr SgorloitmdsdBwuatmerPistamArpelse,s MfrWom-1m4ondiotowrnignrgadwieelnlst MoWf -t1h2e dDewSng--radFioernmteorf tWhaesDte5 -DiFsopormsaelr SAorcliad,s Baundrn PMiWt-A1r0ea1, - MdoWwn-g1r4adideonwtnogfratdhieenDt Io--f tFhoermDer8 H-F FToarrmNeerutWralaiszteatiDonispPiots.al InArtehae,seanardeasM, WPF-1O0A1 cdoonwcenngtrraadtiieonntsroafngtheed Dr1om 1F5o0rm10er1,H86F3 pTpabr aNneduPtrFaOliSzatfiroonm P5i0t. 10I3n24thpepsbe. areas, PFOA concentrations ranged from 150 to 1,863 ppb and PFOS from 80 to 324 ppb. "The highest FC concentrations detected in groundwater samples collected fom pumping - TwehlelshiigeherstdFetCecctoendcaetntpruamtipoinnsgdewteelcltePdWi-n6gr(o1u5n5dpwpabtePrFsOaAm).plesPcWo-l6lecitseddofwrnogmrapduimenptinogf wtheellDsSwAerreead.eteGcrtoeudndawt aptuemrpeinlegvwaieolnl PdWata-6co(l1l5e5ctpedpbfrPoFmOtAhe).moPnWit-o6riisngdowwelnsgriandiMeanrt cohf the D8 Area. 2005showtha GtrohunindfwluaetencreeolfevtahteiopnudmaptiancgolwleecltsedisfrmoomstthseigmniofinciatnotriinngthwelclesntirnalMpalracnht a2r0e0a5asnhdowis rtheadtuctheed winiftlhueinnccereoasfitnhgedpiusmtapncinegrwoemllsthiiss mareoas.t significant in the central plant area and is reduced with increasing distance from this area. rm rtoert EAFOLDER.~.0-9~3~ccttag grovekI~C Data Assessor ReportWinal doe ES-3 22009955..00001133 33MMAA0011555511779900 pa WWiitthh rreessppeecctt ttoo ggrroouunnddwwaatteerr aatt tthhee 33MM CCootttaaggee GGrroovvee ffaacciilliittyy,, tthhee ffoolllloowwiinngg ddaattaa nneeeddss (additional information that will be useful fo assessment) have been identified: - (add+itioTnhael inffloermreavtiioenw thaantdwpielrlsboennueslefuilntfeorrvaiseswesssimndeincta)tehdavtehbaeetnheirdeenmtaifyiedb:e a former . Tssbllhuueddeggfeeilteddtiihrsseewppvowoisaseaeaswllteppeaiwintta,d,tnwwephrehirtisccrohhenanhthemaaleddnitnnntopoelttravnbbiteeeweeannnsdaaitnsshdsseeeicssDass2eteedddArpptrerheeaavvatiionotuhduseslwlryyie.l. lmbaTeTyhhriiebssfeeiirssarellfdoooccr0aamtteeaeddsr dbtthiheesetpwDoDes99eanlAAptrhirceteaah.w.asaGGsortreotowuubnanedtdeewwrnatatcrteheeararrtamqqcuuteaeanlrltiiittzpyyeldaaa.nnntddanmmdoovtvheeemmDeen2nttAiirnneatthhaeendaarrweeaailloofbfetthhreeefeDDr99redssllutuoddggaees - + dTdThihoseepwonsppagooltrtpeeaninttdtihiaaiaollsefntnmmohotteovbvDeee8emm,neenDcntsht,araaooncfftderDggiz2rreoodAuu.nnddrwwaatehteeraranotlootsbess,euunrrffaacccheearacwwteeartriez,re,d.ppaarrttiiccuullarrllyy downgradient of the DS, DS, and D2 Areas, has not been characterized. - OOfftthhee ffoouurr ppuummppiinngg wweelllls aatt tthhee WWooooddbbuurryy SSiittee,, ppuummppiinngg wweellll RRd4 ccoonnttaaiinneedd tthhee hhiigghheesstt FFCC ccoonncceennttrraattiioonnss ((1199..77--2233..33 ppppbb PPFFHHSS,, 55..7722--1111 ppppbb PPFFBBSS,, 22..7788--33..1122 ppppbb PPFFOOAA,, aanndd - 11..8833:-22..2299 ppppbb PPRFOOSS)).. AAtt ppuummppiinngg wweellllss RRI1 aanndd RR33,, ddeetteecctteedd ccoonncceennttrraattiioonnss ooff PPFFBBSS aanndd PPFFHHSS rraannggeedd ffrroomm 00..333377 ttoo 33..4477 ppppbb aanndd 11..0033 tto0 22..6611 ppppbb,, rreessppeeccttiivveellyy.. PPFFOOAAaanndd - PPFEOOSSwwerereeddeetteecctteedd iinn tthhessee wweelllsalat ccoonncceennttrraattiioonnss rraannggiinngg ffrroomm 00..115533 0to 22..3333 ppppbb aanndd 00.00556622 ttoo 00..114444 ppppbb,, rreessppeeccttiivveellyy.. NNoo FFCCss wweerree ddeetteecctteedd aatt ppuummppiinngg wweellll RR22. AAddddititiioonnaallllyy,, FFCCss wweerree ddeetteecctteedd iinn tthhee ppuummppiinngg wweellll ccoommbbiinneedd ddiisscchhaarrggee aatt ccoommppaarrsabbllee ccoonncceennttrraattiioonnss ttoo tthhee ddiisscchhaarrggee ffrroomm tthhee CCoottttaaggee GGrroovvee nnoonn--ccoonnttaacctt pprroocceessss wwaatteerr = rreetteennttiioonn ppoonndd.. TThhuuss,, tthhee ppuummppiinngg wweellllss aatt tthhee WWooooddbbuurryy SSiittee hhaavvee bbeeeenn cchhaarraacctteerriizzeedd and no further assessment ofthe Woodbury Site appears tobewarranted at this time. and no further assessment of the Woodbury Site appears to be warranted at this time. SSoolill -- TThhee hhiigghheesstt ccoonncceennttrraattiioonnss ooff FFCCss iinn ssooiillss wweerree ffoouunndd iintthhee DD22 aanndd DDI1 AArreeaass.. IInn _ tthhee DD22 -FFoomrnmeerr SSlluuddggee DDiissppoossaall AArreeaa,, tthhee hhiigghheesstt FFCC ccoonncceenntteraattiioonnss ((uupp t(o0 1122,,335500 ppppbb PPFFOOSS'a)) wweerree ffoouunndd iinn tthhee sslluuddggee.. LLoowweerr ccoonncceennttrraattiioonnss ((rraannggiinngg ffrroomm 44..3399 0to 779944 ppppbi _ PFOS) PFOS) were were ddeetteecctteedd iinntthhee uunnddeerrllyyiinngg nnaattiivvee ssooiill,, wwhhiicchh ooccccuurrss bbeellooww aapppprrooxxiimmaatteellyy 2200 t1o02255 fRtbbggs.s. - IInn tthhee DD11 ~- FFoorrmmeerr HHFF TTaarr NNeeuuttrraalliizzaattiioonn PPiitt AArreea,, tthhee hhiigghheesstt FFCC ccoonncceennttrraattiioonnss ((uupp ttoo 44,552200 ppppbb PPFFOOAA)) wweerree ddeetteecstteedd iinn tthhee 55 t1o0 3300 fftt bbegss ddeepptthh rraannggee iinn bboorriinnggss ccoonnssttrruucctteedd - jjuusstt oouuttssiiddee tthhee ssuussppeecctteedd llooccaattiioonn ooff tthhee ppiitt ssttrruuccttuurree aanndd ddeeccrreeaasseedd bbeellooww 3300 fft bbggss iinn tthhee nnaattiivvee ssooiillss r(raannggiinngg ffrroomm 553.39.9toto 337755 ppppbb)).. IInn tthhee DDS5 -~ FFoorrmmeerr SSoolliiddss BBuurmn PPiitt AArreesa,, ccoonncceennttraattiioonnssooffPPRFOOSS ((u5pp t(o0 22,,331100 ppppbb)) aanndd - PPFFOOAA ((uuppttoo 11,,337755 ppppbb)) wweerree ddeetteesctteedd iinn ssooiill ssaammpplleess oto aa ddeepptthhooff aapppprroosxiimmaatteellyy 1155 ft |MsDo ok OOH bi bid Ree Vi fdaof7s00 For reference, the Minnesota Department of Health (MDH) has established Soil Reference Values for industrial sites of 200,000 rma ugikg (ppb) PFOA and 40,000 ppb PFOS. E:~FOLDERS.0-9B ra- cottage grov:kFC Data A~scssmcnt RcponkFinal.doc ES-4 22009955..00001144 33MMAA0011555511779911 : gbgss iinn tthhee oonnee ssooiill bboorriinngg ccoonnssttrruucctteedd iinn tthhiiss aarreeaa.. LLoowweerr ccoonncceennttrraattiioonnss wweerree ddeetteecctteedd aatt lloowweerrddeepptthhss ((334.45.5 aanndd 4466..88ppppbb PPFFOOSSaanndd2211..88 aanndd4422..55ppppbb PPFFOOAA)).. IInn tthhee DDS8 ~- FFoorrmmeerr W Waassttee DDiissppoossaall AArreeaa,, ccoonncceennttrraattiioonnss ooff PPFFOOAA ((uupp ttoo 554433 ppppbb)) aanndd ~ PPFFOOSS ((uupp ttoo 998833 ppppbb)) wweerree ddeetteecctteedd iinn ssuubbssuurrffaaccee ssooiillss oto aa ddeepptthh ooff 1155 fftt bbggss aanndd aatt aa ssuurrffaaccee ssooiill ssaammppllee llooccaattiioonn ddoowwnnggrraaddiieennttoofftthhiiss aarreeaa. - AAtt tthhee FFiirree TTrraaiinniinngg AArrceaa,, PPFFOOSS wwaass ddeetteecctteedd aatt ccoonncceennttrraattiioonnss uupp ttoo 11,,882200 ppppbb pprriimmaarriillyy iinn sshhaallllooww ssooiillss ttoo aa ddeepptthh ooff5 Aft bbegss,, wwiitthh ssiiggnniiffiiccaannttllyy lloowweerr ccoonncceennttrraattiioonnss - ddeetteecctteedd aatt lloowweerr ddeepptthhs.s. - AAuttthhee BBuuiillddiinngg 1155 l(looccaattiioonnoofftthhee ffoorrmmeerr eelleeccttrroocchheemmiiccaall flluuoorriinnaattiioonn cceellllss)) AArreeaa,, PPFFOOSS wwaass ddeetteecctteedd aatt ccoonncceennttrraattiioonnss uupp ttoo $83333//990044((dduuppliliccaattee)) ppppbb iinn sshhaallllooww ssooiillss ((00--55 fftt bbggss)) - aanndd 11,,886655 ppppbb aatt aa ddeepptthh ooff 22001t0o2255 fftt bbggss.. AAtt tthhee FFoorrmmeerr WWaasstteewwaatteerr PPoonndd,, PPFFOOSS wwaass ddeetteecctteedd aatt aa ccoonncceennttrraattiioonn ooff 08055 ppppbb aatt aa ddeepptthh ooff 1155 ttoo 2200 fRt bbggss aanndd tthheerree wwaass nnoo - vviissuuaall eevviiddeenncceeofohfihsisttoorriic sslluuddggeess aatt tthhiiss bboorriinngg.. - SSuurrffaaccee ssooiill ssaammpplleess ((00--66 aanndd 66--2244 iinn bbegss)) ccoolllleecctteedd iinn tthhee vviicciinniittyy ooff bbuuiillddiinnggss wwhheerree FFCCss wweerree mmaannaaggeedd ((BBuuiillddiinnggss 77,, 1166,, aanndd 2255)) ggeenneerraallllyy iinnddiiccaatteedd hhiigghheerr ccoonncceennttrartaiotnisoonofsf _ FFCCss tthhaann ssaammpplleess ccoolllleecctteedd iinn tthhee vviicciinniittyy ooff bbuuiillddiinnggss wwhheerree FFCCss wwecrrec nnoott mmaannaaggeedd ((BBuuiillddiinnggss 2222,, 110022,, aanndd 111122)),, tthhee iinncciinneerraattoorr ccoommpplleexx,, aanndd tthhee DD66 -~ FFoorrmmeerr AAsshh DDiissppoossaall - AArreeaa. "TThhee ffoolllloowwiinngg ddaattaa nnceceddss hhaavvee bbeeeenn iiddeennttiiffiieedd ffoorr ssooiills aatt tthhee 33MMCoCtotttaaggee GGrroovvee ffaacciilliittyy:: DsDSi5e,-hFFaoosrrnmmoeetrrbSSeoeolnliidddssefBBiuunermnd wPPiiittthAArrreeeasa.p.ecTTthhitioss taahrreeeaah,,owrwihhzioiccnhhtaiilseaaxpptpepnrrtooxxaiinmmdaatcteoelnlyyce22ntaarccarrteeissoniinsn oOsofinfzleFFy,CChssoa..nseHHnioisbsttotoobrrireiineccgnrredwececaoofsirrnddelssdocddwaiidtdiethnndoorttiensssphhteohociwwts tssoappreteehccaieiffiiahccnodrlliiimzmsoiointitssltaoolsrraebbmxopoteulunnentdsdaaarnfridireeosscmoffnootcrrheittnshhtiirsbsaotaarirroieeanna.gs. - eOexxnhhliiybbiittoeendde ccoobnnoccreiennntgtrraawttiiaoosnnssoloofcfaFFteCCdss ppinrriimmthaarisriillyyaraaetat0 at0notod 1155sfofiitl bgs.samples bgs. from this boring - DwDSi8th--FrFeosorprmemceterrtoWWatahssetteehoDDriiiszsoppnootssaaallleAAxrtreeeaan..toDDfuuaeenyttooreaamcccaceiesnsssiniigsssswuuaeesss,t, etthhbiiussriaaarrlee,aawiihssinncoohtt wddeaefsfiinnneoedtd wpprrieethvviirooeuusssplleyycrrteetmmoootvhveeedd.h.orizontal extent of any remaining waste burial, which was not . DDa9s9scs--seFFdooormmrecerhrarSSallcuutddeggreiezeDDdiisasppnoodssawalil lPPibitte.. reTTfehhriirssednnteeoww2llsyythiidedeeDnnt9tiiffAiiereddeaaarreeaa hbaass nnoott bbeeeenn assessed or characterized and will be referred to as the D9 Area. err ES-5 22009955..00001155 33MMAA0011555511779922 SSeeddiimmeenntt-- FFCCss wweerree ddeetteecctteedd iinn sseeddiimmeenntt.. GGeenneerraallllyy,, uuppssttrreeaamm lleevveellss wweerree lleessss tthhaann downstream. downstream. PPFFOOAA sseeddiimmeenntt ccoonncceennttrraattiioonnss iinn tthhee ceaasstt ccoovvee ((1111.77 1to0 2288..77 ppppbb)) aarree ccoommppaarraabbllee ttoo tthhee - west cove (4.11 west cove (4.11 t0 387 ppb). to 38.7 ppb). PPFROOSS sseeddiimmeenntt ccoonncceennttrraattiioonnss iinn tthhee ceaasstt ccoovvee: ((2244.22 ttoo 226677 ppppbb)) aarree hhiigghheerr tthhaann aatt tthhee wweesstt ccoovvee ((1155.22 ttoo 9911..11 ppppbb)).. HHiigghheerr PPFFOOSS - concentrations were detected in the shallow sediments (0-10 em)of the east cove than in thedeepersedim(1e0-n20tams). concentrations were detected in the the deeper sediments (10-20 cm). shallow sediments (0-10 cm) of the east cove than in IInntthhee MMisisssiissssiippppii RRiivveerr,, aavveerraaggee sseeddiimmeenntt ccoonncceennttrraattiioonnss aatt ssaammppllee llooccaattiioonn RR11,, RR22,, aanndd N RR4 wweerree NNQQ oorr NNDD.. TThhee aavveerraaggee sseeddiimmeenntt ccoonncceennttrraattiioonnss ((88.2288 aanndd 1133.22 ppppbb,, rreessppeeccttiivveellyy)) ooff PPFFOOSS aanndd PPFFOOAA wweerree ddeetteectcetdeaadt ssaammppllee llooccaattiioonn RR33,, wwhhiicchh iiss aaddjjaacceenntt n t1o0 tthhee ooppeerraattiinngg ppllaanntt ppoorrttiioonnoofftthhee pprrooppeerrttyy.. SSuurrffaaccee W Waatteerr -- TThhee aavveerraaggee ccoonncceennttrraattiioonnss ooff FFCCss iinn tthhe eeaasstt ccoovvee wwaatteerr ssaammppllee wweerree - ggrreeaatteerr tthhaann tthhee ccoonncceennttrraattiioonnss ddeetteecctteedd iinn tthhee wweesstt ccoovvee wwaatteerr ssaammpplele.. IInn tthhee MMisisssiissssiippppii RRiivveerr,, PPFFOOAA aanndd PPFFOOSS ccoonncceennttrraattiioonnss wweerree NNDDoorr NNQQ aatt tthhee RRI1 tthhrroouugghh RRe4 ssaammpplliinngg llooccaattiioonnss.. TThhee oonnllyy qquuaannttiiffiiaabbllee ccoonncceennttrraattiioonnss ooffPPFFOOSS aanndd PPFFOOAA ((00..009988 ainndd 00..113322 ppppbb,, rreessppeeccttiivveellyy)) iinn tthhee wwaatteerr ssaammpplleess wweerree ddeetteecctteedd aatt ddoowwnnssitrzeeaamm llooccaattiioonn RRS5.. denied WWiitthh rreessppeecctt ttoo sseeddiimmeenntt aanndd ssuurrffaaccee wwaatteerr,, tthhee ffoolllloowwiinngg ddaattaa nneeeeddss hhaavvee bbeeeenn identified: - + Concentrations, if any, of FCs in groundwater entering th river (pore water) ate rCootnkcneonwtrna.tions, if any, of FCs in groundwater entering the river (pore water) are not known. - DisDrtiivrseitrrbiaburtueitinooonnt,,kiinffaoanwnyny,., ooff FFCCss iinn ssuurffaaccee wwaatteerrss aanndd sseeddiimmeenntt eexxtteennddiinngg aaccrroossss tthhee river are not known. FFiisshh -- TThhee aannaallyyttiiccaall rreessuullttss iinnddiiccaattee tthhaatt FFCCss hhaavvee bbeeeenn ddeetteecctteedd iinn ffiisshh ssaammpplleess ((wwhhoollee - bbooddyy aanndd ffiilleett)) ccoolllleecctteedd ffrroomm tthhrreeee rreeaacchheess ooff tthhee MMisisssiissssiippppii RRiivveerr iinn tthhee iimmmmeeddiiaattee vviicciinniittyyoofftthhee CCoottttaaggee GGrroovvee ffaacciilliittyy.. TThhee FFCCss wweerree ddeetteecctteedd iinn eeaacchhooff tthhee tthhrieee ssppeecciieess - ssaammpplleedd:: CChhaannnneell ccaattffiisshh,, BBlluueeggiillll ssunufishn,aanfnddSiSmmaslalllmmhoouu,tthh bbaassss.. mmr E:\FOLDERS 0-9~3m-eottage gro~e'd:C Data Assessment Rttmrt~Final doe ES-6 22009955..00001166 33MMAA0011555511779933 "The The ffoolllloowwiinngg ccoonncclluussiioonnss hhaavvee bbeeeenn iiddeennttiiffiieedd ffoorr M Misisssiissssiippppii RRiivveerr ffiisshh: + tTThhheeeMcciuusrsrrrseesnnittppdd:attaRaivsseetrt.rreepprreesseennttss oonnee lliimmiitteedd rroouunndd ooff ffiisshh ssaammpplliinngg ccoonndduucctteedd iinn the Mississippi River. - + MPPeePnnCddAiinn,ggfuaarnntaahlleyyrttiidcciaasllcuwwsosoirrokknsbbmeeaiinnyggbeppeewrraffroorrrammneetddedoornneltaaiddvddeiitttiooonnaaadllditffiiisoshhnalssaadmmaptpallecnsseedbbsyy. tthhee MPCA, further discussions may be warranted relative to additional data needs. RREECCOOMMMMEENNDDAATTIIOONNSS - SSuubbssttaannttiiaall cchhaarraacctteerriizzaattiioonn hhaass bbeeeenn ccoommpplleetteedd aatt tthhee 33MM CCoottttaaggee GGrroovvee ffaacciilliittyy aass ppaarrtt ooff tthhee wwoorrkk ccoonndduucctteedd iinn 22000055.. HHoowweveveerr,, ddaattaa nneeeeddss wweerree iiddeennttiiffiieedd aanndd sshhoouulldd bbee aaddddrreesssseedd iinn oorrddeerr ttoo ddeeffiinnee tthhee mmoosstt eeffffeeccttiivvee ppaatthh ffoorrwwaarrdd.. TThheessee aaddddiittiioonnaall ffiieelldd _ aaccttiivviittieess aarre pprreesseenntteedd iinn tthhee ffoollloowwiinngg rreeccoommmmenednadtaitoionns:s: Gromndwater Groundwater + BwBeaalsslees,dd ooifnn faaeccaccseiesbsslsieibbili(liibttayys,,ediinnssottaanllllpahytstooittcaaalll oocffontthshtrrereeaeinttotos ffiiavvneed. ggrarococuuennsddsvwacatoteenrrsimdmeoornanitititooorrniisnn)gg, 3 downgradioefnthte D2 and DS areas towardthe river, wells, if feasible (based on physical constraints and downgradient of the D2 and D5 areas toward the river. access .considerations), - + IFInnossrttamallellrSvt~ivouodttgooeDtthihrsreepeeosggarrloouuPnnitddww(aDat9teerrArmmeoaon)nitittooordriienntggenwwmeielnlllessgaarrrooouuunnndddattthheeerppqeeurraiilmmieteytteearrndoofffltthohwee dFiorercmtieorn.Sludge Disposal Pit (D9 Area) to determine groundwater quality and flow direction. r + cDDoeelffciicnnteeinhthgeewahhtyyeddrrralauuvllilicc accnaadppttduurrraeewaadnnoddwneeffdffaeetccatt foooffmppuuemxmippsitinninggg wmweoelnllilsstoPPriWWnSg5 waealnnldds.PPWWS6 bbyy collecting water level and drawdown data from existing monitoring wells. sSooiill - + 1DD0S525---FFfotombrmgmseerfroSSfouolltiihddessrBBcuuhammraPcPtiitetrAAizrreeeaat.heIInnessxtttaalellnltaaonnfaaFddCddiitiiioontnahllistthahrreeeea.ttoo ffiivvee ssooiill bboorriinnggss to 25 fl bgs to further characterize the extent of FCs in this area. . + rDDe88me-diaFFtooirrommneerrscWWiavasistteeesDDicissoppnoodssuaacllteAAdrrceaia.n. thRRiesevviireeewwa. iinnffoBorammsaeattdiioonnonoonna ppraasestvtisseuuwrrvvoeefyy taahnnidds - birinenemffonoerermdcmeiaaastttsiiiooaornnnyaafannocddtfiaavuccictctehieseesssrsiibdbcieilofliinittndyyeucccototnhensedsttrhraoaiirninintztssot,h,nitddsaeelttaeeerrrxemmtaei.innntee oiBiffaaaasgengedyoeoprhpoeyhnmsyaisiacincaiarlnlegvssuuiwerrawvvseetyyeowwbfouorutuihlaliddls abtethniesceloscsaatriyotno further define the horizontal extent of any remaining waste burial at this location. . + cDDhS9a.-raFFcotoemrrmniezerer tSShlleuueddxggteeenDDtiiossfppFooCssasall,PiPfiitat..nyII,nnsstitanaltlllhittswwaoorettaoo. ffoouurr ssooiill bboorriinnggss to 2255 fftt bbggss ttoo characterize the extent of FCs, if any, in this area. tora ES-7 22009955..00001177 33MMAA0011555511779944 PPoorree WWaateterr//SSuurrffaaccee WWaatteerr//SSeeddiimmeenntt - Collect pore water samples aCpopllreoctximpoartee2l5ywaltoecratisoanms pinletshe uuMssiiisnnsggissssihhpapalillloRowiwverhhaaanlndod-n-dgdrrtiivhveeennfaciwwleieltlyll shppooorieinnlttissne taaott aaspspersosxipmosastieblyle25grlooucnadtiwoantseirn dthiescMhairsgseiss(ihprpoiuRghivbeor'tatloonmgstehdeifmaecnitlistyasnhdorienltionethtoe assess possible groundwater discharge through bottom sediments and into the river. - = 2s2h00oreeeqqluiuanalelllbyyetssppwaaecceeenddthsseaamDmpSplliiAnnrggeallooaccnaadttiiotohnness eaaalslotonncggoveaa.pppprrCoooxxniidmmuaacttteellayyg44r,o00u00n00dwffatteoorff sfflhlooowwrennlieentteaabnenatlwyaseilestntyootdhsdeeefifDiinns8eeAtthhreeeammoaosnstdt etehfffefeecectatiisvvteecllooovcceaa.ttiioConnossnffdoourrcttthhaeessgeerossaaummnpdplwelesas.t.er - FMFiiWvv-ee 1llo4occaatottiiodoenntsseciitnnattnhhyee grrreeoaauccnhhdwbbaeetttwewreeeednnisctthhhaeergwwee.esstt ccoovvee aanndd mmoonnititoorriinngg wweellll MW-14 to detect any groundwater discharge. - CClooolclallteeiccottns:ppaaiirreedd ssuurrffaaccee wwaatteerri/sseeddiimmeenntt ssaammpplleess aatt. tthhee ffoolllloowwiinngg ssaammpplliinngg locations: - ~ PPoorree wwaatteerr ssaammpplliinngg llooccaattiioonnss ((2255 ssaammpplleess)).. - EEaassttaanndd wweesstt ccoovveess aanndd aassssoocciiaatteedd ddrraaiinnaaggeenwwaayyss ((uupptoto 66ssaammplpelse)s.). - RCCoeolalllceehcctt3/ss5uurraffraaeccaee(wwesaatttieemrratsseaamm1p0pl-lee1s5s aalloonngg_aa sampling ttrraannsseecctt nodes). aaccrroossss tthhee MMisisssiissssiippppii RRiivveerr iinn Reach 3/5 area (estimate 10-15 sampling nodes). FFiisshh//AAqquuaattiiec BBiioottaa - RDReeepvvaiierewtwmeppneetnnddoiifnnggHeM MalPPtChCAA(MffDiisHshh),ssaamamnppdlliinMniggnrrneecsssuuloltttss.a. DDDeipissaccruutssmssenwwtiiotthhf M MNPaPuCCrAAa,l, MMRieinsnnoneuesrsocotetasa D(MepDaNrtRm)enptlaonfsHfeoarltahdd(iMtiDonHal), fainshd sMaimnpnleisnogtainDtehpearrtmiveenrttoofdNetaetrumrailneRetshoeuprcatehs - (floVrIwDarNdR. ) plans for additional fish sampling in the river to determine the path forward. TTaabbllee EESS--11 pprroovviiddeess aa ssuummmmaarryy ooff tthhee rreeccoommmmeennddeedd PPhhaassee 22 FFCC aasssseessssmmeenntt,, wwhhiicchh - would be performed under the existing Icalth and Safety Plan (ASP) and FC Work would be performed under the existing ttealth and Safety Plan (HASP) and FC Work Plan. The results of the Phase 2 FC assessment wil be documented in the Phase 2 FC Plan. The results of the Phase 2 FC assessment will be documented in the Phase 2 FC DDaattaa AAsssseessssmmeenntt RReeppoorrtt. ES ES-8 22009955..00001188 33MMAA0011555511779955 - i5fExS 2f3l: 1)%:f5fs2E 2Ei3sf || &gEfY3 - 2iT:E 2 2 3 2a 4 24 203 2: - 5 sa HER 3I3 |R3|Ei:2 %2 Bi H58IE E 5E LIRR 282 % |. i 20e8 & . [EEE 38 3 BolEgE:E (eC 3% 28% =4 - SSEH|EdEEEs PfEf:E a1 S|Ez,FRIziE: 153 S 3 |BEi3, 23%] y - SFSE2 Ez|R5 3l3R8EEZi c[E Lsd fg SiiigdilEniaiiiliLeEd pillage 3 8 RB: EHEHaE:E si MHL IE @SE2EzSifHzEiCfEiSgzi5e] - zSzE|I8FIEE2SEe P| jE EEea5E0isxSc a3 a2p23i E diz af3 i E gEai Ei d sE) 5 iEn ii5e4idr yid icciEc - P| S |SpeEiisii iiifzpdl adoni izridc sfaia niildsl - FScioiEdiioigfielEa2aTsdesasideti yaisics alis andtoigiitniaggl] { :i TD IRE IE - T 5 T 1 SE o 4 sla a ls 2 z 58g [3% | mqF | i i : BL [32 = wth B58 [830 (Fs ls Is a 13 i 2005.0019 2095.0019 33MMAA0011555511779966 11.. IINNTTRROODDUUCCTTIIOONN 11.11 BBAACCKKGGRROOUUNNDD TThhee 33MM CCoommppaannyy ((33MM)) CCoottttaaggee GGrroovvee,, M Miinnnneessoottaa ffaacciilliittyy,, ffoorrmmeerrllyy tthhee 33MM CChheemmoloilittee a facility, facility, hhaass bbeeecnn iinn ooppeerraattiioonn ssiinnccee 11994477.. TThhee ffaacciilliittyy ccuurrrreennttllyy mmaannuufafaccttuurreess &a rraannggee ooff pprroodduuccttss ssoommee ooff wwhhiicchh iinncclluuddee aaddhheessiivvee pprroodduuccttss,, ssppeecciiaallttyy ppaappeerr,, iinndduussttrriiaall ppoollyymmeerrss,, ~ aabbrraassiivveess,, aanndd rreefflleeccttiivvee rrooaadd ssiiggnn mmaatteerriiaallss aanndd aallssoo eennggaaggeess iinn rreesseeaarrcchh aanndd development development ooffaa pprroopprriieettaarryy nnaattuurree. - 33MM eexxpprreesssseedd iittss iinntteennttiioonn ttoo vvoolluunnttaarriillyy aasssseessss tthhee pprreesseennccee ooff ffluuoorroocchheemmiiccaallss aassssoocciiaatteedd wwiitthh tthhee mmaannuuffuaccttuurriinngg ooppeerraattiioonnss aatt tthhee CCoottttaaggee GGrroovvee ffaacciilliityy.. TThhee - fulouroorocchheemmicicaallss ((FFCCSs)) iinncclluuddee tthhee ffoolllloowwiinngg ccoommppoouunnddss:: + Perfluorooctanoic Perfluorooctanoic aacciidd ((PPFFOOAA)-)- AAnn 88--ccaarrbboonn ((CC88)) ccaarrbboorxyyllaatte.. - Perflurooctane Perfluorooctane ssuullffoonnaattee ((PPFOFSO)--SAA)nn 88--ccaarbboonn ((CC88)) ssuullffoonnaattee. + Perflurohexane Perfluorohexane ssuullffoonnaattee ((PPFFHHSS)~)- AA 66--ccaarrbboonn ((CC66)) ssuullffoonnaattee.. - Perfluorobutane Perfluorobutane ssuullffoonnaattee ((PPFFBBSS)) A- A 4d--ccaarrbboonn ((CC44)) ssuullffoonnaattee. - IInn DDeecceemmbbeerr 22000044,, 33MM pprreeppaarreedd tthhee FFaacciillittyy--wwiiddee FFlluuoorroocchheemmiiccaall ((FFCC)) IInnvveessttiiggaattiioonn WWoorrkk PPllaann ((FECC W Woorrkk PPllaann)) ttoo aassssessss tthheessee FFCCss aat iittss CCoottttaaggee GGrroovvee,, MMiinnnneessoottaa ppllaanntt.. - TThhee WWoorrkk PPllaann pprreesseenntteedd aa ssyysstteemmaattiicc aapppprrooaacchh ttoo ccolllleesctt ddaattaa iinn vvaarriioouuss eennvviirroonnmmeennttaall mmeeddiiaa rreellaatteedd ttoo FFCC mmaannuuffaaccttuurriinngg ooppeerraattiioonnss.. ITnn aa lleetttteerr ttoo 33MM ddaatteedd JJaannuuaarryy 3311,, 2200005,, - tthhee MMPPCCAA aapppprroovveedd tthhee WWoorrkk PPllaann wwiitthh mmodoidfiifcicaattiioonnss.. - During During 22000055,, 33MM iimmpplleemmeenntteedd tthhee FFCCsisittee-rreellaatteedd iinnvveessttiiggaattiivvee pprrooggrraamm ooff titss CCoottttaaggee Grove, Grove, M Miinnnneessoottaa ffaacciilliittyy iinn aaccccoorrddaannccee wwiitthh tthhee MMPPCCAA-s-apppprroovveedd FFCC W Woorrkk PPllaann.. TThhiiss documents document is tthhee DDaattaa AAsssseessssmmeenntt RReeppoorrtt ffoorr tthhee ffaacciillitiyy--wwiiddee FFCC aasssseessssmmeenntt.. Iist iismipmoprotratanntt t0o nmoottee tthhaai ggrroouunnddwwaatteerr ssaammpplliinngg ffoorr FFCCss aatt ffoouurr mmoonniittoorriinngg wweellllss ((MMWW-- - 44,, MMWW-7-7,, MMWW-1-10011,, aanndd PPZZ--1144)) aanndd tthhee ttaapp aatt BBllddgg.. 111166 iiss ccoonndduucctteedd oonn aa sseemmiiaannnnuuaall bbaassiiss iinn aaccccoorrddaannccee wwiitthh I3MMP'ssLLeettteer ooff IInntteenntt ((LLOOI)) oto tthhe UUrniitteedd SSttaatteess EEnnvviirroonnmmeennttaall E:\FOLDERS,0-9\3m-cottage groveWC DataAssessment Report\Final.dee I1-I1 22009955..00002200 I3MMAA0011555511779977 PPrrootteeccttiioonn AAggeennccyy ((UU..SS.. EEPPAA)) ddaatteedd MMaarrcchh 1133,, 22000033.. TThhiiss ppeerriiooddiicc ssaammppllinigniigss reeppoorrtteedd ttoo tthhee UUS.S.. EEPPAA uunnddeerr tthhee LLOOII pprrooggrraamm.. TThhee ddaattaa ccoolllleecctteedd uunnddeerr tthhee LLOOII pprrooggrraamm the FC Work Plan. - ffrroomm 22000033 tthhrroouugghh 22000055aarreeiinncclluuddeedd iinn tthhiiss rreeppoorrtt ttoo ssuupppplleemmeenntt tthhee ddaattaa ccoolllleecctteedd turnaddeerr the FC Work Plan. AAddddititiioonnaallllyy,, wwaasstteewwaatteerr ttrreeaattmmeenntt ppllaanntt ((WWWWTTPP)) eefffflluueenntt ssaammpplliinngg ffoorr FFCCss wwaass = ccoonndduucctteedd oonn aa mmoonntthhllyy bbaassiiss iinn 22000033 aanndd 22000044 aanndd qquuaarrtteerrllyy iinn 22000055 iinn aaccccoorrddaannccee wwiitthh aa ffaacciilliittyy NNaattiioonnaall PPoolllluuttaanntt DDiisscchhaarrggee EElliimmiinnaattiioonn SSyysstteemm ((NNPPDDEESS)) ppeerrmmiitt aanndd tthhee LLOOTI pprrooggrraamm.. TThhiiss ssaammpplliinngg iis rreeppoorrtteedd ttoo tthhee M MPPCCAA aanndd UU..SS.. EEPPAA uunnddeerr tthhee NNPPDDEESS aanndd LLOOII pprrooggrraamms.s. TThhee ddaattaa ccoolllleecctteedd uunnddeerr tthhee LLOOII aanndd NNPPDDEESS pprrooggrraammss ffrroomm 22000033 tthhrroouugghh 22000055 aarre iinncclluuddeedd iinn tthhiiss rreeppoorrtt ttoo ssuupppplleemmeenntt tthhee ddaattaa ccoolllleecctteedd uunnddeerr tthhee FFCC N Work Plan Work Plan. _ 11.22 PPUURRPPOOSSEEOOFF TTHHEE FFLLUUOORROOCCHHEEMMIICCAALL ((FFCC)) AASSSSEESSSSMMEENNTT "TThhee ppuurrppoosseeoofftthhee FFCC aasssseessssmmeenntt iiss ttoo:: - + CCadhhjaaarrcaaeccnttteerMriiizzseesittshhseeipppprrieessReeinvneccree. ooff tthheessee FFCCss aatt tthhee ssiitte iinn vvaarriioouuss mmeeddiiaa aanndd iinn tthhee - + aIddejnatciefnyt tMhrisosuigshsipapiilRe irveevr.iew and interviews, historic offsite disposal locations oIofdfeffnaatcciiifllyiitttyyhwwroaaussgtteeh streams. a file review streams. and interviews, historic off-site disposal locations Prepare this Prepare this Data Assessment Data Assessment Report. Report. 11-22 22009955..00002211 I3MMAA0011555511779988 . 22.. EENNVVIIRROONNMMEENNTTAALL SSEETTTTIINNGG 22.41 SSIITTEE LLOOCCAATTIIOONN AANNDD DDEESSCCRRIIPPTTIIOONN - TThhee 33MM CCoottttaaggee GGrroovvee,, WWaasshhiinnggttoonn CCoouunnttyy,, MMiinnnneessoottaa ffaacciilliittyy iissllooccaatteedd aapppprrooxxiimmaatteellyy ttwwoo mmiilleess ssoouutthheeaassttooff tthhee CCiittyyooffCCoottttaaggee GGrroovvee ((sseeee FFiigguurree 22--11)) aanndd iiss aapppprrooxxiimmaatteellyy - 11770000 aaccrreess iinn ssiizzee.. TThhee iinndduussttrriiaall,, ddeevveellooppeedd ppoorrttiioonn ooff tthhee ssiittee iiss aapppprrooxxiimmaatteellyy 220000 aaccrreess,. BBoorrddeerriinngg tthhesisitteettootthheessoouutthh iiss tthhee MMisisssiissssiippppii RRiivveerr;; t0o tthhee wweesstt iiss ffaarrmmllaanndd aanndd ssoommee - rreessiiddeenncceess;; to tthhee nnoorrtthh iiss UU..SS.. HHiigghhwwaayy 6611 aanndd ffaarrmmllaanndd wwiitthh ssoommee rreessiiddeenncceess;; aanndd ttoo hthee ceaasstt aarree rreessiiddeennttiiaall aarreeaass,, aa ggoollffccoouurrssee,, wwooooddllaanndd,, aanndd ffaarrmmllaanndd.. "TThhee ppllaanntt ooppeerraattiioonnss aenndd ddeevveellooppeedd ppoorrttiioonn ooff tthhee ssiittee aarree llooccaatteedd oonn tthhee ssoouutthheerrnn ppaarrtt ooff _ tthhee pprrooppeerrttyy aaddjjaacceenntt ttoo tthhee rriivveerr aass sshhoowwnn iinn FFiigguurree 22--22.. TThheerree aarree ssoommee ggrroouunnddwwaatteerr m`omniotorningiaatnnddopprrrooddiuuccnttiioognn wweelllss oann tthhee nnoorrtthheerrnn ppoorrttiioonnoofftthheepproroppeerrttyy,, bbuutt nnoo iinndduussttrriiaall - oorr pprroodduuccttiioonn ooppeerraattiioonnss ooccccuurr tthheerree.. TThhee EEaagglleess PPooiinntt WWaasstteewwaatteerr TTrreeaattmmeenntt PPllaanntt (WWTP) is located along the Mississippi River westofthe developed partionofthe sit. (WWTP) is located along the Mississippi River west of the developed portion of the site. - IItt iiss ooppeerraatteedd bbyy tthhee M Meetrtrooppoolliittaann CCoouunncciill EEnnvviirroonnmmeennttaall SSeerrvviicceess ((MMCCEESS)).. AAddddititiioonnaallllyy,, tthheerreeiiss aa ppaarrcceell oonn tthhee iinntteerriioorr ppoorrttiioonn ooff tthhee pprrooppeerrttyy tthhaatt iiss oowwnneedd bbyy - CCooggeenntrtriixx,, wwhhiicchh ooppeerraatteess aa ccooggeenneerraattiioonn ppllaanntt.. TThhiis eelleeccttrriiccaall ppoowweerr ggeenncerraattiioonn ppllaanntt pprroovviiddeess sstteeaamm ttoo tthhee 33MM CCoottttaaggee GGrroovvee ffaacciilliittyy.. - "TThhee pprrooppeerrttyy iiss bbiisseecctteedd bbyy aa rraaiillrrooaadd rriigghhtt--ooff--wwaayy.. TThheerree iiss aaanaootthheerr rraaiillrrooaaddririgghhtt-ooff:- wwaayy aalloonngg tthhee bbaannkkoofftthhee MMisisssiissssiippppii RRiivveerr.. 22.22 LLAANNDD UUSSEE AANNDD DDEEMMOOGGRRAAPPHHIICCSS "TThhee 33MM CCoottttaaggee GGrroovvee ffaacciilliittyy iiss llooccaatteedd iinn WWaasshhiinnggitoonn CCoouunnttyy.. AAss iinnddiiccaatteedd iinn SSeeccttiioonn - 221.1,, tthhee aarreeaa iimmmmedediaiatteellyy ssuurmroouunnddiinngg tthhee ffaacciilliittyy iiss ccoommpprriisseedd pprreeddoommiinnaannttllyy ooff ffaarrmmllaanndd aanndd wseooooddilaanndd,, wwiitthh ssoommee rreessiiddeenncceess pprriimmaarriillyy ttoo tthhee wweesstt aanndd eeaasstt ooff tthhee - ffaacciilliittyy,, aanndd aawwasastteewwaatteerr ttrreeaattmmeenntt ppllaannt ((EEaagglleess PPooiinntt)) ttoo tthhee ssoouutthhwweesstt. ermine 2-I 22009955..00002222 I3MMAA0011555511779999 q. bol - |1 fo -- 5 i == ladle :7 Hat LORE A RPT WSO SY ie fe abe 2b ve 5s F ein n S )oe 77 24 wifi LEhiCtiaaf BAe A i wif Bti bolaesate,e PIA Pid YSN Cr 7, Rag iar pS Pl i io PAreA fa -- = aL NW R LN RN I A LY ES 7. HAF FA W 57/ ) o7, i0i P oposT t FA R oYgl 3 i PINNA Th Cl 2 ee Eel =z way WA0 al 2s g BE deli) gg LL 22009955..00002233 33MMAA0011555511880000 g ii foo ; bE ET * iblai |e 4i /* bo . 2 om Srjorae] AS St E [] HL H a J il Bre Ei I~ lg Peis = HE i 22009955..00002244 33MMAA0011555511880011 - presen IInn rreecceenntt yyeeaarrss,, WWaasshhiinnggttoonn CCoouunnttyy hhaass eexxppeerriieenncceedd ssiiggnniiffiiccaanntt eeccoonnoommiicc aanndd ppooppuullaattiioonn ggrroowwthth.. TThhee ccoonnttiinnuueedd eexxppaannssiioonn ooff tthhee TTwwiinn CCiittiieess mmeettrrooppoolliittaann aarreeaa hhaass ccaauusseedd aa - sspprreeaadd ooff ddeevveellooppeedd aarreeaass iinn tthhee cciittiieess ooff CCoottttaaggee GGrroovvee,, WWooooddbbuurryy,, aanndd OOaakkddaallee.. CCoottttaaggee GGrroovvee iiss tthhee nneeaarreesstt cciittyy too tthhee 33MM ppllaanntt aapppprrooxxiimmaatteellyy 22 mmiilleess ttoo tthhee nnoorrtthhwweesstt. WWooooddbbuurryy aanndd OOaakkddaallee aarree aapppprrooxxiimmaatteellyy 77 aanndd 1100 mmiilleess rnoorrtthh ooff tthhee CCiittyy ooff CCoottttaaggee GGrroovvee,, rreessppeeccttiivveellyy.. WWhhiillee mmuucchh ooff WWaasshhiinnggttoonn CCoouunnttyy hhaass rreetaiinneedd iittss rruurraall aattmmoosspphheerree,, tthhee ccoouunnttyy - ccoommpprriisseess vvaarriioouuss aarreeaass ccoonnssiissttiinngg ooff ffaarrmmllaanndd,, wwooooddllaannddss,, rreessiiddeennttiiaall nneeiigghhbboorrhhooooddss,, aanndd ooffffiiccee aanndd rreettaaiill ccoommpplleexxeess aalloonngg IInntteerrssttaattee 9944 nneeaarr WWooooddbbuurryy aanndd OOaakkddaallee ((22000044,, - w~www..ccoo.wwaasshhiinnggitoonn, rmann.. uuss)).. - 22.33 TTOOPPOOGGRRAAPPHHYY AANNDD DDRRAAIINNAAGGEE TThhee 33MM CCoottttaaggee GGrroovvee pprrooppeerrttyy iiss llooccaaiteedd oonn aa ffllaatt ttoo ggeennttllyy uunndduullaattiinngg bblluuffff = oovveerrllooookkiinngg tthhee mmaaiinn cchhaannnneell ooff tthhee MMisisssiissssiippppii RRiivveerr.. RReleilieeff oovveerr mmoosstt ooff tthhee pprrooppeerrttyy iiss oonnllyy oonn tthhee oorrddeerr ooff tteennss ooff ffeeeett,, rraannggiinngg iinn eelleevvaattiioonn ffrroomm &a hhiigghh ooff 882222 ffeeeett aabboovvee = m`meeaannssceaa lleevveell ((mmssll)) oonn tthhee nnoorrtthheerrnn ppoorritiioonn tfoo 778800 ffeeeett mmss!l oonn tthhee ssoouutthheerrnn ppoorrttiioonn aatt tthhee eeddggeeoofftthhee bblluuffff.. AAss sshhoowwnn iinn FFiigguurree 22--11,, tthhee ssoouutthheemrnn ppoorrttiioonn ooff tthhee ssiittee hhaass bbeeeenn ddeeeeppllyy iinncciisseedd bbyy - ssttrreeaammss aanndd ddrraaiinnaaggee bbootthh ecaasstt aanndd wweesstt ooff tthhee ppllaanntt ooppeerraattiioonnss aarreeaa,, aanndd aalloonngg tthhee MMisissississsipippip.i RRiivveerr,, rreelliieeff iiss qquuiittee sstieeeepp wwiitthh llaanndd ssuurrffaaccee eelleevvaattiioonnss rraannggiinngg ffrroomm - aapppprrooxxiimmaatteellyy 778800 ffeeeett mmssll aatt tthhee ttoopp ooff tthhee bblluuffff ttoo aapppprrooxxiimmaatteellyy 770000 ffeeeett mmssll aatt tthhee rriivveerrbbaannkk.. TThhee wweesstteerrnn ddrraaiinnaaggeewwaayy tteerrmmiinnaatteessaattaaccoovvee ((wweesstt ccoovvee)),, wwhhiicchh lfloowwss t(o0 tthhee - MMisisssiissssiippppii RRiivveerr.. TThhee eeaasstteerrnn ddrraaiinnaaggeewwaayy oorriiggiinnaatteess ffrroomm aa ppoonndd nnoorrtthh ooff UUS.S.. HHiigghhwwaayy 6611,, aanndd ffoolllloowwss aa ssoouutthheerrllyy ddiirreeccttiioonn uunntiil iitt aapppprrooaacchheess tthhee ppllaanntt ooppeerraattiioonnss - area where it receives the NPDES-permitted discharges from the plants wastewater area where it receives the NPDES-permitted discharges from the plant's wastewater ttrreeaattmmeenntt aanndd ccoooolliinngg wwaatteerr ssyysstteemm.. TThhee ddrraaiinnaaggeewwaayy tteerrmmiinnaatteess aatt aa ccoovvee ((ecaasstt cGoovvee)),, = wwhhiicchh ddrraaiinnss ttoo tthhee MMisisssiissssiippppii RRiivveerr.. rm---------- 22-44 22009955..00002255 33MMAA0011555511880022 - WE 22.44 GGEEOOLLOOGGYY _ AAss sshhoowwnn oonn ccrroossss sseeccttiioonn AA--AA"' ((FFiigguurree 22--33)),, tthhee 33MM CCoottttaaggee GGrroovvee ffaacciilliittyy iiss ddiirreeccttllyy uunnddeerrllaaiinn bbyy ffiillll mmaateterriiaall aanndd uunnccoonnssooliliddaatteedd. ggllaaciioo-fflluuvviiaall ddeeppoossiittss ooff pprroobbaabbllee - `Quaternary Quaternary aaggee.. TThhee llooccaattiioonnooff tthhee ccrroossss sseeccttiioonn iiss sshhoowwnn iinn FFiigguurree 22--44,. IInn tthhee nnoorrtthheernm ppoorrttiioonnooff tthhee pprrooppeerrttyy,, uunnccoonnssoolliiddaatteedd ddeeppoossiittss rraannggee ffxroomm aa ffeeww ffeeeett 0to aa ffeew tteennss ooff - ffeeeett iinn tthhiicckknneessss,, aarree ddrryy,, aanndd aarree uunniimmppoorrttaanntt aass ppootteennttiiaall ssoouurrcceessooff wwaatteerr ssuuppppllyy.. TThhee uunnccoonnssoolliiddaatteedd ddeeppoossiittss iinnccrreeaassee iinn tthhiicckknneessss ffrroomm nnoorrtthh ttoo ssoouutthh aaccrroossss tthhee ssiittee aanndd aarree ~ over over 100 100 feet feet thick thick near near the the Mississippi Mississippi RRiivveerr wwhheerree aabbuurriieedd bbeeddrroocckk vvaalllleeyy eexxiissttss. TThhee bboorriinngg ffoorr mmoonniittoorriinngg wweellll M MWW--1111 eennccoouunntteerreedd ttaalluuss ssllooppee mmaateterriiaallss aatt - aapppprrooxxiimmaatteellyy 113355 ffeeett bbeellooww ggrroouunndd ssuurrffaaccee ((bbggss)) ((ddrriillll ccuuttttiinnggss wweerree iiddeennttiiffiieedd aass `OOnneeoottaa DDoolloommititee)) aanndd ddrriilllleedd iinttoo tthhee JJoorrddaann SSaannddssttoonnee aatt aa ddeepptthh ooff 116688 ffeecett bbegss.. TThhuuss,, - South of the paleo-bluff, unconsolidated. glacio-fluvial materials exceed 135 feet in south of the paleo-bluff, unconsolidated glacio-fluvial materials exceed 135 feet in _ tthhiicckknneessss,, aanndd aatt lleeaasstt llooccaallllyy,, bbeeccoommee iimmppoorrttaanntt ssoouurrcceessooffggrroouunnddwwaatteerr ssuuppppllyy.. AAnn eerroossiioonnaall uunnccoonnffoorrmmiittyy lliieess bbeettwweeeenn tthhee bbaasseeoofftthhee uunnccoonnssoolliiddaatteedd ddeeppoossiittss aanndd tthhee. - bbeeddrroocckk bbeenneeaatthh tthhee ffaacciilliittyy.. TThhee yyoouunnggeesstt bbeeddrroocckk iinn ssuubbecrroopp aatt tthhee ffaacciilliittyy iiss tthhee `SShhaakkooppeeee aanndd OOnneeoottaa DDoolloommiitteess ooff tthhee PPrraaiirriiee dduu CChhiieenn GGrroouupp ((eeaarrllyy OOrrddoovviiceiiaann aaggee)).. = IInnssppeeccttiioonn ooff wweellll ccoommpplelettiioonn llooggss ffoorr mmoonnititoorriinngg aanndd pprroodduuccttiioonn wweellllss aalt tthhee ffaacciilliittyy iinnddiiccaatteess tthhaatt tthheessee. ffoorrmmaattiioonnss uunnddeerrlliiee mmuucchh ooff tthhee nnoorrtthheernm ppoorrttiioonn ooff tthhee pprrooppeerrttyy,, = tthhrroouugghh tthhee cceennttrraall ppllaanntt aarreeaa ssoouutthh ttoo aappaalleeoo--bblluuffff ((tthhee bboouunnddaarryy ooff tthhee bbuurriieedd bbeeddrroocckk valley) as shown in Figure 2-3. The bedrock surface closely mimics the present-day valley) as shown in Figure 2-3. The bedrock surface closely mimics the present-day - ttooppooggrraapphhyy aanndd tthhee cclliifffflliinneeoofftthhee bbeeddrroocckk ppaalleeoo--bblluuffff aappppeeaarrss ttoo bbee llooccaatteedd ppaarraalllleell ttoo tthhee M Misisssiissssiippppii RRiivveerr. Underlying the Shakopee and Oncota Formations is the Jordan Sandstone. Several Underlying the Shakopee and Oneota Formations is the Jordan Sandstone. Several - pprroodduuccttiioonn wweellllss aatt tthhee ssiittee ttaapp tthhiiss ffoorrmmaattiioonn ffoorr wwaatteerr ssuuppppllyy.. TThhee SStt.. LLaawwrreennccee FFoomrmataitioonn ((aa ccoonnffiinniinngg llaayyerer--- sshhaallee uunniit)) iiss pprreesseenntt aott tthhe bbaassee ooff tthhee JJoorrddaann SSaannddssttoonnee,, - aapppprrooxxiimmaatteellyy 220000 ffeeeett bbeellooww tthhee cceennttrraall ppoorrttiioonnoofftthhee ssiittee.. m---- E:~FOLDERS.0-9~3m-ottag grovekFC Data A~sessn~nt geportkFinaL doe 22-55 22009955..00002266 33MMAA0011555511880033 2HH - 3: N _ " baF nae l E a s: CFyhomN a n hv ai | (2 - Pewmee |B _ a iN FF ol INE oe I a (2 [ Ertiln CEN (2 Ee - Sole Bodh a - sF a hE oaN l m 4 eh 0 i 5E[E3 - =3 b PEEr o e o TTt bin nbn |g o _ TYEE La |B Wise EE S ca m i elCot (883 - Bema aon mil18 IH EEE 5 - aap by PJEEERstRR ERA ERR R 8 8 8 2 P-- 8 BR 8 8 3 8 8 8% 8 - I i 2s 22009955..00002277 33MMAA0011555511880044 == ii a 4 f (a (oN ERPrR es MLA moa. JJii [ 3 BL i Re i> e + [I "EEE Bs 2 4 in Hi | i 22009955..00002288 33MMAA00115555118805 - 22.55 WATER USAGE AND HYDROGEOLOGY WATER USAGE AND HYDROGEOLOGY _ Al ste production and menitoring wells are completed i the upper waterbearing ASaltl isgiatephpircodwuicttisoan thand smitoe,nitTohriengupwpeerllswaatreer-cboemsrpilnegteudritins cthoensiusppoefr twheatSehr-abkeoapreinsg- OstnreaotitgaraDpohliocmiutneitss, aJtorthdeansiStea.ndsTthonee,upapnedr uwnactoenrs-obleiadraintgedudneiptossictos.nsisDtuoefttohetheShparkeosepnecee- oOfneothtae Dpoalloemo-itbelsf,f,Jordthaen SJaonrddsatnoneS,aanndsdtuonneconasnodlidaStheadkedpepeoes-iOtsn.coDtaue Dtooltohmeiptreessenacree _ hoyfdrathuelicaplalleyo-cbolnunfefc, tetdhe toJotrhdeanuncSoannsdosltiodnaetedanddepoSsihtaskonpeeaer-OtnheeotMaissDisosliopmpiiteRsivaer.e hLiytderraautulircealilnydiccaotnenseWcatetd tthoe utnhdeerulnyicnognsSotl.idLaatuerdendceepoSstiatsleniesanrotthceonMsiidsesrisesdipapni aRquiivfeerr. _ bLuitterraattuhreer inadiccoantfeisnithngat utnhiet ubnedcearulysiengit Sht.asLaluorwencveertSichaallepiesnmneoatbclointsyidteoregdroanunadqwuaitfeerr but rather (Lindholm, a e tcaol,nf1in9i7n4g). unit because it has low vertical permeability to groundwater (Lindholm, et al., 1974). - "There are six production wells (PW-1 through PW-6) that supply wate for industria and Tsahneirtearayrepusirxpopsreosduacttitohne wfaeclillsit(yP.W-T1hethrsoiuxghprPodWuc-6ti)otnhawteslulpspwlyerweatienrstfaolrleinddduusrtriinagl atnhde - spaenriitoadry19p4u7rptoose1s970a.t thWeelflasciPliWty-.1 Tthhreousgixh PprWo-d4ucatrioendwieells iwneorethienJstoarldleadn Sdaunrdisntgonteh.e pWeerlilosd P1W9-47S toan1d97P0W.-6WserlelscPoWmp-l1etthedrouagthiePlWy -i4n atrheedurnilcloendsoinltiodattheedJdoerpdoasnitSsannedasrtonthee. - Mississippi Rive Wells PW-5 and PW-6 are completed entirely in the unconsolidated deposits near the Mississippi River. - "TThhee ggrroouunnddwwaatteerr ffroomm ffoouurr ooff tthhee pprroodduuccttiioonn wweelllls ((PPWW--22 through through PW-S) PW-5) is is blended blended on on a a continuous basis in a water supply distribution system for various sit needs, including - pcroondtuincutoiouns banadsissainnitaatiwona.ter Bsoutptplelyd dwiastterirbuotriownatseyrstreemstfeodr bvyarigoruasnusliatre anceteidvsa,teidnccluardbinogn p(rGoAdCu)ctioisn saunpdplsiaenditaftoirond.rinBkointgtl.ed wTahteerroermawiantienrgtrtewatoedprboydugcrtainounlawrealcltsivaarteeduciairzbeodn - (iGndAeCpe)ndiesntsluyppolniead pfeorrioddiricnkbiansgis. foTrhietrweimdaeinifnigr ptwrootecptrioodnuc(tPioWn-1)wealnlsd anroen-cuotinltizaecdt cinodoelipnegndfeontrlytohinteaipnceirnioerdaitcorba(sPiWs-6f)o.r sAitlel-wgridoeunfdirseetperrotuescetidonfor(PpWro-d1u)ctainodn pnroonc-ceosnstsacist - ctroeoaltiendgafotretuhseesaitte tihnecionne-sraittoerw(aPsWte-w6a)t. erAtllregartomuenndtwfactielrtyu,sepdrifoorr tpoaronduNcPtiDonESprpoecremsisteis cids tdriesactheadrgaefte0r utshee act athse eond-sritaenwaagseteawyat(ecrasttrecaotmvee)ntlefaadciilnigty,toprtihoer MtoisasnisNsiPpDpiESRi-vpeerr.miTtthede - donisscihtaerggertoouthnedeearsteorbntidnraeidnafgoerwnaoyn-(ceoansttaccotvceo)alleiandginigs stouptphleemMeinstseisdsibpypigRroivuenrd.vaTtheer ofnro-smitethegr3ouMndWwooatdebruorbytaSinieedlofocartnedonn-ocrotnhtoafctthceoopllianngt iwshsiucphpilsemcoennvteedyebdytogrtohuenfdwlatyer - bfryomuntdheerg3rMouWndoopidpbiunrgy. SiOtencloecautteidlinzoedrthfoorfctohoelipnlga,nttwhehincohn-iscocnotnacvteyceodoltointghewafatceilitiys bdiyscuhnadregregdrotuonadn poinp-isnigte. coOolnicneguwtailtiezredpofnodr cporioolrinog, ptehremintotned-codinstachcatrcgoeotlointghewcaatesrteirs ddrisacihnaarggeenwdeytowahneorni-stisteccoomobliinngedwwaittehr tphoenwdasptreiowartteorpterrematimtteendt ddiisscchhaarrggee. to the eastern drainageway where it is combined with the wastewater treatment discharge. mmm 2a-g8 22009955..00002290 33MMAA0011555511880066 ERE T`Twwoo aaddddiittiioonnaall wweellllss ((PPWW--77 aanndd PPWW--88)) aarree uusseedd ffoorr wwaatteerr ssuuppppllyy oonn aannaass nneeeeddeedd bbaassiiss.. PW-7 is located at the Trep Rang and PW-S is located adjacent to a guard house a the - PplWan-t7enistrlaonccae,ted at the Trap Range and PW-8 is located adjacent to a guard house at the plant entrance. _ TThheerree aarree aallssoo eeiigghhtt ggrroouunnddwwaatteerr mmoonniittoorriinngg wweellllss ((MMWW--11 tthhrroouugghh MMWW--88)) tthhaatt wweerree iinnssttaalllleedd dduurriinngg aa 33MM ssttuuddyy bbeettwweeeenn 11997744 aanndd 11997755 iinn oorrddeerr ftoo mmaaiinnttaaiinn aann oonnggooiinngg ~ rreeccoorrdd ooff ggrroouunnddwwaatteerr lleevveellss.. MMoonnititoorr wweellll PPZZ--1144 wwaass ssuubbsseeqquueennttllyy aaddddeedd ffoorr tthhiiss aaccttiivviittyy.. AA nniinntthh mmoonniittoorr wweellll ((MMWW--99)) wwaass iinnssttaalllleedd oonn tthhee wweesstt ssiiddee ooff tthhee ppllaanntt ttoo _ m`moonniittoorr ggrroouunnddwwaatteerr ccoonnddiittiioonnss aa:t tthhee ffoorrmmeerr ccooaall ssttoorraaggee ppiillee aarreeaa llooccaatteedd nnoortthh ooff tthhee iinncciinneerraattoorr ffaacciilliittyy.. AAnn oolldd pprroodduuccttiioonn wweellll wwaass ddiissccoovveerreedd iinn 11998811 oonn tthhee ecaasstt ssiiddee ooff - tthhee ppllaanntt nneeaarr tthhee wwaasstteewwaatteerr ttrreeaattmmeenntt ffaacciilliittyy aanndd wwaass rreeddeessiiggnnaatteedd aass mmoonniittoorr wweellll MMWW-1-010.. DDuurriinngg tthhee 11998800ss,, mmoonniittoorriinngg wweellllss MMWW--1111 tthhrroouugghh MMWW--1166 wweerree iinnssttaalllleedd ttoo - mmoonniittoorr sseevveerraall ppaasstt wwaassttee ddiissppoossaall aarreeaass aanndd aaana aanmaminoonniiuumm ssuullffaattee rreelleeaassee nneeaarr tthhee WWWWTPT.P. IInn tthhee llaattee 11999900ss mmoonnititoorriinngg wweellllss MMWW-1-177,, MMWW-1-188,, aanndd MMWW--1199 wweerree - iinnssttaalllleedd ttoo mmoonniittoorr ggrroouunnddwwaatteerr ccoonnddiittiioonnssaat tthhee cclloosseedd aasshh//sslluuddggee llaannddffiillll ssoouutthh ooff tthhee iinncciinneerraattoorr.. MMoonnititoorriinngg wweellllss MMWW--110011 aanndd MMWW--110022 wweerree iinnssttaalllleedd iinn 22000022 aattaa ffoorrmmeerr - ddiissppoossaall aarrecaa ((DDI1 AArrceaa)) ttoo aasssseessss tthhee aarrecaa ssoouutthheeaasstt ooff tthhee pprroodduuccttiioonn aarreeaa.. FFiigguurree 22--44 sshhoowwss tthhee llooccaattiioonnss ooff tthhee mmoonniittoorriinngg aanndd pprroodduuccttiioonn wweellllss wwhhiicchh aarree kknnoowwnn ttoo eexxiisstt aatt - tthhee ffaacciilliittyy.. _ GGrroouunnddwwaatteerr eelleevvaattiioonn ddaaitaa iinnddiiccaattee aa nnaattuurreall ssoouutthheerrllyy ggrroouunnddwwaatteerr ggrraaddiieenntt ttoowwaarrdd tthhee MMisisssiissssiippppii RRiivveerr ffrroomm tthhee 33MM pprrooppeerrttyy.. FFiigguurree 22--55 ddeeppiiccttss tthhee ccoonnffiigguurraattiioonn ooff tthhee N wwaatteerr ttaabbllee ssuurrffaaccee aatt tthhee ppllaanntt iinn MMaarrcchh 22000055.. GGrroouunnddwwaatteerr lleevveellss hhaavvee bbeeeenn mmeeaassuurreedd and contoured several times and the wate table surface configurations have remained and contoured several times and the water table surface configurations have remained _ rerlealattiivveellyyccoonnsisisstteenntt. PPuummppiinngg ooff tthhee pprroodduuccttiioonn wweelllls,, wwhhiicchh ccoommmmeenncceedd iinn 11994477,, hhaass ddeepprreesssseedd tthhee - ggrroouunnddwwaatteerr ttaabbllee bbeellooww tthhee aaccttiivvee ppoorrttiioonn ooff tthhee ppllaanntt pprrooppeerrttyy wwiitthh hhyyddrraauulliicc ggrraaddiieennttss ddiirreecctteedd ttoowwaarrddss tthhee pprroodduuccttiioonn wweellllss.. sommes met 2 2-9 22009955..00003300 33MMAA0011555511880077 I BER 2 | | BN 1 3 hal Li z h o 3 o!h Sy 1 LA >. hd ow Sa 1 EEE li TIE 4 =a By | BT d I Eo PR yw ; Es Pl EY 2 y ET En iy : Bas =0S 8I Ly aN Aa A iP = i YO Cem | J | [-- |e ei sig o:r W;EE oo | FI~GURE Lee EERE peor En GROUNDWATER ELEVATIONS ~,~dkRCH 2005 3M COTTAGE GROVE, MN FACILITY 33MMAA0011555511880088 22009955..00003311 33.. SSUUMMMMAARRYY OOFF FFIIEELLDD AACCTTIIVVIITTIIEESS The FC assessment fed activites were conducted in accordance with the FC Work Plan _ Tanhde FHCealatsshesasnmdenStaffieetlyd aPcltaivniti(eHsAwSePr)e c(oAnpdpuecntdeidxinBactcoordthaencFe CwitWhotrhke FPClanW).orkFPilealnd parnodceHdueraeltsh waenrde cSoanfseitsytePntlanwit(Hh AMSPPC) A(AspitpeencdhaixracBtertiozatthieonFaCndWsaomrkpliPnlagn)g.uidFaniecled _ pArnoyceddeuvrieastiwonesrefrcoomnstihsetenFtCwWiothrkMPPlCaAn aseiteidcehntairfaicetderiinzattihonfoalnldowsianmg psleicntgiongsuiodfantcies. ADantya dAesvsieastsiomnesntfrRoemportht.e FC Work Plan are identified in the . following sections of this Data Assessment Report. 34 DESCRIPTION OF THE GROUNDWATER ASSESSMENT 3.1 DESCRIPTION OF THE GROUNDWATER ASSESSMENT - 33..14.14 BBaacckkggrroouunndd - "TThhee FFCC WWoorrkk PPllaann ssppeecciiffiieedd tthhaatt groundwater groundwater sampling sampling would would be be conducted conducted at at all all 22. 22 active mentoring wells, six production and two water supply wels at the 3M Cottage - Garcotivvee fmeolnitto,riansgwewlellls,tshiextpaproadtutchteionBladngd1t1w6ocawfeateterira.supApddlyitwoenlalslya,t sthae m3MplCoifotftnaoguger G3rMovWeofoadcibliutyr,yasdiwspeolslaals tshiteeta(pWoaot dthbeuBryldgSit1e1)6 pcuamfeptierniga. wAeldld,ititohnealclyo,mbsaimnepdlindgisocfhaforguer - 3fMromWthoeosdebwuerlylsd,iaspnostahlesdiitesc(hWarogoedfbruormy tShieten)onp-ucmonptiancgt wpreolclse,ssthweatcoemrbetinenetdiodnispcohnadrgaet ftrhoem3MtheCsoetwtaeglels,Graonvdethfeacdiliistcyhawrogueldfrobme ctohnednuocnt-ecdoonntacatmpornotchelssy wbaastiesr freortetnhtrioeenmpoornddhsa.t = t"hTehe3WMooCdobtutargye SGirtoevies foawcinleitdy wbyou3ldMbeancdonisduacptperdoxoinmaatemloyntfhivlye bmaisliess fnoorrtthhreoefmthoent3hsM. CTohtetaWgeooGdrbouvrye Sfaitceiliitsy.ownWeadtbery 3isMpaunmdpeisdapfprroomximthaeteflyoufrivpermodiulcetsiroinortwhelolfsthaet 3tMhe = Cottage Grove Woodbury Site tfharcoiuligtyh. an Wunadteerrgrisoupnudmpippeedlinferotmo tthhee3fMouCrotptraogdeuGcrtioovne wplealnlts faotr uthsee W25onoodnb-ucroyntSaictte tphrroocuegssh awnateurn.derOgnrocuendthpriopueglihnethteo tphlaent3,MthCeowttaatgeerGisrodviescphlaanrtgefdor0usea - arestennotnio-cnopnotnadc.t process water. Once through the plant, the water is discharged to a retention pond. - 33.41.22 On-site Groundwater Sampling On-site Groundwater Sampling Groundwater sampling was conducted at the 3M Cottage Grove facility from March 11 GthrroouungdhwMaaterrcsham17p,lin2g00w5asancdonodnucMteadyat16th,e230M05.CoFttiagguereGr3o-1ve sfhaociwlsitythferomgroMunadrcwhat1e1r tmhornoiutgohriMngawrcelhl 1a7n,d2p0r0o5duacntdiononweMllayloc1a6t,io2n0s05at. thFeigfuacrieli3ty-1ansdhoTwasbltehe3-g1ropurensdewntastear mgroonuintdowriantgerwelsl aamnpdlipnrgoduscutmiomnarwy.ell Water locations Water levels were recorded onto. well at the facility and Table 3-1 presents a levels were recorded onto well _ egvroaucnuadtwiaotnesrampslaimnpglinfgormssumfomr aerayc.h of the monitoring wells. A copy of the well eevvaaccuuaattiioonn//ssaammpplliinngg ffoorrmmsssfoprroveiacdhedoinf AthpepemndoinxitAo.rinAgftwerelmles.asuArincgowpayteorfletvheels,wtehlel _ ewvealcluwaetiroenp/suarmgpeldinagnfdosrmamspilsepdroinvisdcecdorindaAncpepweintdhixthAe.MAPfCteAr-maepapsurrionvgFewCdatWerorlekvePllsa, nthe wells were purged and sampled in accordance with the MPCA-approved FC Work Plan. [---- 313-1 22009955..00003322 33MMAA0011555511880099 side i i = ii Higa | Ao e ep a JV LE 3 A * Rl o ie"5hi je 3 ; 5 i ,` | -- g di i vA + i ||3i is | IN | |1 |i | ii 22009955..00003333 33MMAA0011555511881100 SM Cottage Grove, MN Facility TTaabbllee 33--11 GGrroouunnddwwaatteerr SSaammpplliinngg SSuummmmaarry--y- OOnn-s-siittee W Welelllss 3M Cottage Grove, MN Facility RB sumpiing | Dweap|| SDe"eSrrpe VFoolrugemse Sampling Tomer | (ben | ee | due rl | Location Well Depth (ft bgs) Measured Well Depth (ft toc) Depth to Water (ft toc) Well Diameter (in) Volume Purged (gal) Pump Rate= (gpm) Date Sampled [wrToo |oa[on [ss|. Toews MW-1b 200 92.64 67.71 6 585 03/16/05 - [mwMWa-2b [ww 1 121112 092 [[90269207.0005[[8"5o80o5.d9110| | 66 6 | | 88-a- DD0ryy| | |owT0o3ia/r1si5ei/i0os5s | MW-3 210 196.75 99.40 6 440 03/16/05 mMwWa-4"b 220000T131333.200 [os1028.2s5 | 66 |a4s 25 |- T0o3/a1i6e/0o5s [mwMW s-5 1212010 220088.7m0 ["s5i1.s577I 66 | e6o9s5 | [o0w3/1e6/s05 ] - [owes [ow[om[by |e|N[-foen] MW-6b 219 103.20 Dry~ 6 NS 03/16/05 [mw MW-7 Tia146 | w14a0o.224a[55550.077 [66 | 553755 | To0w3n/1e6/0s5| mMwWa-8c" 17711973511721742.455 e6s5.a45s| 66 | 449900 | - [0055/17166/0055 - [vwMs W-9 Toa 104 [or10e7.9s5 [4T7a.r1a7s | a4 | 112200 | -- T03o/a1n5/s0s5 [waMWe -10 T7232377 172244115.500 [79933.7733 | 88 |Tu1,1s82a| 0[30/3166/00s5 M MWW-1-l1l [202000 T181866.600 [021092.090[4 4 t1e65s | 0[3o/1w2a/0s5 - [mwMaW-s 12 Tia141 To141s .03 [799536.633 [4 4 1353.5 -bDyIy | - | 0o3a/n15s/i0s5 [mwMaW-s 13 134 134 T341304.000 [T9o2.0a3 | 4 | 9977 |- lo0v3/1e2/s05] [mwMaW-e14 Tes64 [50509.000 [26268.855 | 44 [2424D- Dyry | [030/3166/00s5 [TwMwWa-1s5 77118866 | i1s8e6.s54a[T0966.0088 | 4 | 91922 | [003/31122/0055 = [waMWe -16 | h1w40o w1i41i.10 [e3973.788 | @4 Tie1s03 | - lo0w3/1e2/s05| |mMwWa-1r7 Ti 112 1i1i1a4.3366[75752.288 | 44 1 7788 |- |030/315s/e0s5 [wiMWs -18 To92 Toa93.20 e6090.077 [44 | s5o0 | T03o/w1i5s/0o5s - MMWW-1-109" | 112200 [1210200.000 "2532.333 | @4 TT1100 -- DDryy | - Tos05n/1e6/n05s] MMWW -I-0110_1_ | 1I0000| 110011.9900 |o9a4g.877 | 22 | 335.5 | T030/31122/0055 MMwWa-1o0z2 |9966 | o9d4.e67r |e9t1.e97r| 22 | 11s.5 | [o0w3/1e2/s05] - [pz PZ,-14 Too 100 Te1n87.n 71 [ea642.266 | 22 1 2725 .5 | Tow03n/1s5w/0s5| [rw o we iaw |si [fons] PW-1 205 NA 76* 14 8,100 729 03/14/05 wer a er [ew [eon] PW-2 202 NA 81' 20 6,000 749 03/14/05 - [wa [oa [wa [or| | now|oa fw PW-3 224 NA 96* " 24 11,320 924 03/14/05 mw [or[a[mas [so fon] PW-4 275 NA 112~ 24 12,255 817 03/14/05 [ws [iso[a[sos |se| [ona] PW-5 150 NA 30~ 36 21,000 1481 03/14/05 - [pws [so[or[om|r|se [mas PW-6 143 HA 31~ 20 57t 576 03/14/05 [wr sa[aw [nfs] PW-7 200 NA 75c 4 250 10 05/16/05 [ws[or[wa[or| [aw[3 [wn] PW-8 208 NA 108~ 4 219 2 03/14/05 - [Egmersy 1-1 [Tw| Towns] Bldg 116 Tap - 30 03/14/05 fA ire et e Ee A,TO --. ~Pumping rates were provided by the facility based on 200~ measurements. t'Measured depths are significantly shallower than previously recorded total depths suggesting borehole collapse. At MW-6, a sample could not be collected. - SH ett we mi, Peervo emt res eo 20. ,Wells contained dedicated pumps that were inoperative. Pumps were removed and samples were collected May 16, 2005. IT dWell was dry due to obstruction in borehole. No sample collected. rama Tncpt stresses ,Water depths are from historic records. fWell pump runs continuously. As a result, only a small volume of water was purged through sampling port. NA - Not available. - Not applicable. hsTeopm. ft bgs - Feet below ground surface. renee fl toc - Feet below top of casing. in - inches. = eis gal - gallons. ence. gpm - gallons per minute. teri 3 3-3 22009955..00003344 33MMAA0011555511881111 - D`urD ingtuthheer mmeaei sasuurn reemmegennttooff wwaatteerr lleevveellss,, iitt wwaass nnootteedd tthhaatt ssoommee oofftthheeddeeeepp bbeeddrroocckk wweellllss exhibited shallower total depths than originally recorded. It is believed that the exhibited shallower total depths than originally recorded. It is believed that the - ddiiffffeerreennccee iinn ddeepptthh iiss dduuee ttoo bboorreehhoollee ccoollllaappssee wwiitthhiinn tthhee JJoorrddaann SSaannddssttoonnee.. GGrroouunnddwwaatteerr ppuurrggiinngg vvoolluummeess aatt tthheessee llooccaattiioonnss wweerree ccaallccuullaatteedd bbaasseedd oonn tthhee oorriiggiinnaall - wweellll ddeepptthhss.. IInn ssoommee iinnssttaanncceess,, tthhee wweellllss wweerree ddrryy ((MMWW--6)),oo,r eexxhhiibbiitteedd llooww vvoolluummeess ooff wwaatteerr aacccceessssiibbllee ffoorr ppuurrggiinngg,, rreessuullttiinngg iinn tthhee wweellll ppuurrggiinngg ddrryy bbeeffoorree tthhee ccaallccuullaatteedd Vvoolluummee wwaass oobbttaaiinneedd.. TThhiiss wwaass nnootteedd oonn tthhee wweelll eevvaaccuuaattiioonn//ssaammpplliinngg ffoorrmm aanndd ssaammpplleess wweerree ccoolllleecctteedd wwhheerree ppoossssiibbllee.. DDuurriinngg tthhee MMaarrcchh 22000055 ggrroouunnddwwaatteerr ssaammpplliinngg eevveenntt,, ffoouurr wweellllss ccoouulldd nnoott bbee ssaammpplleedd,, - iinncclluuddiinngg MMWW-6-6,, MMWW-8-8,, MMWW-1-199,, aanndd PPWW-7-7.. MMoonintitoorriinngg wweellll MMWW--66 wwaass ddrryy aanndd aa ssaammppllee ccoouulldd nnoott bbee ccoolllleecctteedd.. AA ttoottaall ddeepptthh wwaass mmeeaassuurreedd aatt 110033..22 feet feet below below top-of- top-0f- - ccaassiinngg ((TTOOCC)) wwhhiillee tthhee pprreevviioouussllyy rreeccoorrddeedd toottaall wweellll ddeepptthh ffoorr MMWW--66 wwaass 221199 ffeeeett bbeellooww TTOOCC.. Two monitoring wells, MW- and MW-19, contained dedicated pumps that were rot Two monitoring wells, MW-8 and MW-19, contained dedicated pumps that were not ~ ooppeerraattiioonnaall aatt tthhee ttiimmeeooffssaammplpilningg.. SSaammpplliinngg aatt tthheessee llooccaattiioonnss wwaass ppoossttppoonneedd uunnttiill tthhee pumps could be removed in early May 2005 and groundwater samples were collected on pumps could be removed in early May 2005 and groundwater samples were collected on - MMaayy 1166,, 22000055.. PPrroodduuccttiioonn wweellll PPWW--77 wwaass nnoott ssaammpplleedd iinn MMaarrcchh dduuee ttoo ffrroozzeenn ppiippeess.. SSaammpplliinngg aait tthhiiss - wweellll wwaass ppoossttppoonneedd uunnttiill MMaayy ttoo aallllooww tthhee ppiippeess ttoo tthhaaww aanndd PPWW--77 wwaass ssaammpplleedd oonn MMaayy 1166,,22000055.. AAllll ggrroouunnddwwaatteerr ssaammpplleess wweerree ssuubbmmiitttteedd tfoo EExxyyggeenn RReesseeaarrcchh iinn SSttaattee CCoolllleeggee,, - PPeennnnssyyllvvaanniiaa ffoorr FFCC aannaallyysseess,, wwhhiicchh iinncclluuddee PPFFOOAA,, PPFFOOSS,, PPFFBBSS,, aanndd PPFFHHSS.. - 33.11..22.11 MMoonniittoorriinngg WWeellllss _ IInn aaccccoorrddaannccee wwiitthh tthhee FFCC WWoorrkk PPllaann,, mmoonniittoorriinngg wweellllss wweerree ppuurrggeedd aa mmiinniimmuumm ooffttrhreeee wweellll vvoolluummeess oorr uunniti!l tthheeyy ppuurrggeedd ddrryy bbeeffoorree ssaammpplliinngg wwaass ccoonndduucctteedd.. TTeemmpeprearattuurree,, ~ ssppeecciiffiicc ccoonndduuctcitivviittyy,, aanndd ppHH wweerree mmeeaassuurreedd dduurriinngg tthhee ppuurrggiinngg pprroocceessss ssoo tthhaatt rreepprreesseennttaattiivvee ggrroouunnddwwaatteerr ssaammpplleess ccoouulldd bbee ccoolllleecctteedd aafftterr tthhessee ppaarraammeetteerrss ssttaabbiilliizzeedd.. ~ TThhiiss ddaattaa wwaass rreeccoorrddeedd oonn tthhee wweellll cevvaaccuuaattiioonn!/ssaammpplliinngg ffoorrmmss.. FFoolllloowwiinngg ppuurrggiinngg,, tthhee Cramtoneters 33-44 22009955..00003355 I3MMAA0011555511881122 wi - wweellllss wweerree aalllloowweedd ttoo ssttaabbiilliizzee ttoo mmiinniimmiizzee tthhee ssuussppeennddeedd ppaarrttiiccuullaattee iinn tthhee ssaammppllee mmeeddiaia.. GGrroouunnddwwaatteerr ssaammpplleess wweere ccoolllleecctteedd uussiinngg ddiissppoossaabbllee ppoollyyeetthhyylleennee bbaalileerrss aanndd promptly sealed, labeled, and placed into ice chest cooled to approximately 4 degrees - ppoouurreedd iinnttoo pprreecclleeaannecdd ccoonnttaaiinneerrss pprroovviiddeedd bbyy tthhee llaabboorraattoorryy.. TThhee ccoonnttaaiinneerrss wweerree promptly sealed,, labeled, and placed into ice chests cooled to approximately 4 degrees - CCeellssiiuuss ((''CC)).. TThhee ssaammppllee iinnffoorrmmaattiioonn wwaass eenntteerreedd oonnttoo aa CChhaaiinn--ooff--CCuussttooddyy ((CCOOCC)) tthhaatt _ aaccccoommppaanniieedd tthhee ssaammpplleess ttoo tthhee llaabboorraattoorryy.. 33..11..22..22 PPrroodduuccttiioonn aanndd WWaatteerr SSuuppppllyy WWeellllss Due to the necessity in maintaining the operation of the production well, actual water - Dleuveelstocothueldnmeoctesbseityreicnormdeadi.ntaAinsinagrtehsuelto,pdeartaatiownasofabtihzeinperdodfurcotmionthewefallcsi,liatcytrueaglawrdaitnegr levels could not be recorded. As a result, data was obtained from the facility regarding aavveerraaggee ffllooww rraatteess ffoorr eeaacchhoofftthhee pprroodduuccttiioonn wwelellsls.. IInnffoorrmmaattiioonn wwaass aallssoo ggaatthheerreedd oonn tthhee - well construction and the frequency of use. Based on this informaion, purge volumes wel~ construction and the frequency of use. Based on this information, purge volumes were calculated. were calculated. _ not necessary to purge this well. However, 2 groundwater sample was collcted after - SSiinnccee pprroodduuccttiioonn wweellll PPW W--66 wwaass ooppeerraattiinngg ccoonnttiinnuuoouussllyy aatt tthhee ttiimmee ooff ssaammpplliinngg,, iitt wwaass not necessary to purge this well. However, a groundwater sample was collected after aalllloowwiinngg ssuuffffiicciieenntt ppuurrggiinngg ttoo 'cclleeaarr tthhee ssaammppllee lliinnee.. TThhee rreemmaaiinniinngg pprroodduuccttiioonn aanndd wwaatteerr 2 ssuuppppllyy wweellllss wweerree bbeeiinngg ooppeerraatteedd iinntteerrmmiitttteennttllyy aatt tthhee ttiimmee ooff ssaammpplliinngg.. TThheessee wweellllss were turned on manually and kept in operation until the calculated three well volumes were turned on manually and kept in operation until the calculated three well volumes -- wweerree ppuurrggeedd.. SSoommee ooff tthhee wweellllss ((PPW W--11,, PPWW--22,, PPW W--33,, PPWW--55,, aanndd PPWW--88)) wweerree constructed with flow meters allowing direct measurement of the flow. Other wells (PW- - 4coannsdtruPcWt-ed7)wditihd fnlootwhmaveetefrlsoawllmoewteirnsg. For directtmheesae,suwreelml evnotloufmtehsewfelorwe.meOatshuerrewdebllasse(PdWon- 4thaenadvePrWag-e7)fldoidw ndoattahparvoevfildoewd mbyettehres.fcFiolrittyheasned, wleenlgltvhoolufmtiemsewpeurregemd.easAursedumbmaaserdyoonf = the the average flow flow ate data data and provided by the purged volumes facility and is presented liennTgatbhloef3-t1im. e purged. A summary of the flow rate data and purged volumes is presented in Table 3-1. GGrroouunnddwwaatteerr ssaammpplleess ffrroomm eeaacchh oofftthhee pprroodduuccttiioonn aanndd wwaatteerr ssuuppppllyy wweellllss wweerree ccoolllleecctteedd = ddiirreeccttllyy ffrroomm ssaammpplliinngg ppoorrttss wwiitthhiinn tthhee ppuummpp hhoouusseess.. TThhee vvaallvveess wweerree ttuurnneedd oonn,, wwaatteerr was allowed to flow sufficiently to clear the lines, and then the water was poured into was allowed to flow sufficiently to clear the lines, and then the water was poured into - pprreecclleeaanneedd ccoonnttaaiinneerrss pprroovviiddeedd bbyy tthhee llaabboorraattoorryy.. TThhee ccoonnttaaiinneerrss wweerree pprroommppttllyy sseeaalleedd,, _ llaabbeelleedd,, aanndd ppllaacceedd iinnttoo iiccee cchheessttss ccoooolleedd ttoo aapppprrooxxiimmaatteellyy 44 `CC.. TThhee ssaammppllee iinnffoorrmmaattiioonn wwaass eenntteerreedd oonnttoo aa CCOOCC t.thhaatt aaccccoommppaanniieedd tthhee ssaammpplleess ttoo tthhee llaabboorraattoorryy.. a et E3FOLDERS 0.g~3m~itage grove\FC Data Assessment Rep~l~Final.dcc 33-55 22009955..00003366 33MMAA0011555511881133 - 33..11..22.33 BBuuiillddiinngg 111166 TTaapp - "TThhee wwaatertaatetthhriiss llooccaattiioonn iiss trreeaatteedd wwiitthh aa ggrraannuullaarr aaccttiivvaatteedd ccaarrbboonn ((GGAACC)) ffiilltteerr pprrioirottroo uussee aatt tthhee ttaapp.. TThhiiss iisstthhee oonnllyy bbuuiilddiinngg oonn tthhee CCoottttaaggee GGrroovvee ffaacciilliittyy tthhaatt uuttiilliziezse ttrreeaatteedd - well water for potable water purposes. All other buildings are supplied with bottled well water for. potable water purpose~. All other buildings are ~upplied with bottled wwaatteerr. One water sample was collected from a water (ap at the Building 116 cafeteria. The One water sample was collected from a water tap at the Building 116 cafeteria, The _ sample was collected downstream of the carbon fiter fiom a faucet at the cafeteria sample was collected downstream of the carbon filter from a faucet at the cafeteria Kitchen sink where previous samples had been collected. Prior to sampling, the faucet kitchen sink where previous samples had been collected. Prior to sampling, the faneet ~ wwaass ttuurnneedd oonn aanndd aalllloowweedd ttoo ppuurrggee ffoorr 1155 mmiinnuutteess.. TThhee eessttiimmaatteedd ppuurrggee rraattee wwaass ttwwoo gallons per minute (gpm). Following purging, the sample was collected directly into gallons per minute (gpm). Following purging, the sample was collected directly into ~ precleaned containers provided by the laboratory. The containers were promptly sealed, precleaned containers provided by the laboratory. The containers were promptly sealed, lbaebleeledd,, aanndd ppllaacceedd iinnttoo iiccee cchheessttss ccoooolleedd ttoo aapppprrooxxiimmaatteellyy 44 CC.. TThhee ssaammppllee iinnffoorrmmaattiioonn - was enteredonto a COCthataccompanied the samples 0the laboratory. was entered onto a COC that accompanied the samples to the laboratory. ~ 334.1..33 WWooodobdbuurryySSiittee SSaammpplliinngg GGrroouunnddwwaatteerr ssaammpplleess wweerree ccoolllleecctteedd ffrroomm eeaacchh ooff tthhee ffoouurr W Wooooddbbuurryy SSiittee pprroodduuccttiioonn - wweellllss,, tthhee ccoommbbiinneedd ddiisscchhaarrggee ffrroomm tthhee wweelllls,, aanndd tthhee ddiisscchhaarrggee ffrroomm tthhee nnoonn--ccoonnttaacctt pprroocceessss wwaatteerr rreetteennttiioonn ppoonndd oonn MMaarrcchh 1144,, AApprriill 55,, aanndd MMaayy 1122,, 2200005.. FFiigguurree 33--22 sshhoowwss - the production well locations at the Woodbury Site. A sampling summary i presented in the production, well locations at the Woodbury Site. A sampling summary is presented in - TTaabbllee 33:-22.. DDuuee ttoo tthhee nneecceessssiittyy iinn mmaaiinnttaaiinniinngg tthhee ooppeerraattiioonn ooff tthhe ffoouurr WWooooddbbuurryy SSiittee pprroodduuccttiioonn - wweellllss,, aaccttuuaall wwaatteerr lleevveellss ccoouulldd nnoott bbee rreeccoorrddeedd.. SSiinnccee tthhee pprroodduuccttiioonn wweellllss ooppeerraattee ccoonnttiinnuuoouussllyy,, iitt wwaass nnoott nneecceessssaarryy ttoo ppuurrggee tthhrreeee wweellll vvoolluummeess. Cramster 33-66 22009955..00003377 33MMAA0011555511881144 (oo - ta rman Northeast A{4-S2e5, Area Pb - o~ 7 - NO STON RR11 ie 1!f I! o\ I ./ Iramad =~ /Former( / Main lon Dispossl - EK Area TN \ NE - RS RRe4 = Ze - !. iqa ~ ' R2 LLEeGcEeNnoD PurprgWollossion ~ Pumpin9 Well Location | peat i 0 200 500 Scale in Feet - meee 05P-0915-9 - FFIIGGUURREE33--22 PRODUCTION WELL LOCATIONS PRODUCTION WELL LOCATIONS WOODBURYSITE WOODBURY SITE 33-77 22009955..00003388 33MMAA0011555511881155 - "TTaabbllee 33--22 SSaammpplliinngg SSuummmmaarryy --- WWooooddbbuurryy SSiittee PPrroodduuccttiioonn W Welelllss aanndd NNoonn--CCoonnttaacctt Process Water Volume Pump - waamsem |# |wt] arenes ono Samplin~ Location Woodbury Site R1 Purged T(~ani) Ratea =| r Datee s Samc plede] 884 03/14/05, 04/5/05, & 05/12/05 Woodbury Site R2 141 03/14/05, 04/5/05, & 05/12/05 [wS eS en | [vr | msaliumwmees _ W Wooooddbbuurryy SSiittee RR33 [> | & 487 | 00337/11447/0055,, 0044/55/7005,5&&, 0055//1122//0055 Woodbury Site R4 1,537 03/14/05, 04/5/05, & 05/12/05 Woodbury Site Combined Discharge at BIdg 56 03/14/05, 04/5/05, & 05/12/05 S A EEE E r E armrest. DDiisscchhaarrggeeffrroommRReteetennttiioonn PPoonndd o0 T 1 O033//11441/0055,, 00441/5//0035,, && 30/5/11220/505. aPumping rates were provided by ~;he facility based on 2004 measurements. bWell pump runs continuously. Az a result, only a small volume of water was purged through sampling port. - Not applicable. SR 3-8 22009955..00003399 33MMAA0011555511881166 - GGrroouunnddwwaatteerr ssaammpplleess ffrroomm eeaacchh ooff tthhee pprroodduuccttiioonn wweellllss wweerree ccoolllleecctteedd ddiirreeccttllyy ffrroomm ssaammpplliinngg ppoorrttss wwiitthhiinn tthhee ppuummpp hhoouusseess.. TThhee vvaallvveess wweerree ttuarmneedd oonn,, wwaatteerr wwaass aalllloowweedd - ttoo ffllooww ssuuffffiicciieennttllyy ttoo cclleeaarr aanndd ppuurrggee tthhee lliinneess,, aanndd tthheenn tthhee wwaatteerr wwaass ppoouurreedd iinnttoo pprreecclleeaannecdd ccoonnttaaiinneerrss pprroovviiddeeddbbyy tthhee llaabboorraattoorryy.. TThhee ccoonnttaaiinneerrss wweerree pprroommppltllyy sseeaalleedd,, - lalabbeelleedd,, aanndd ppllaacceedd iinntoo iiccee cchheesstss ccoooolleedd ttoo aapppprrooxxiimmaatteellyy 44 CC.. TThhee ssaammppllee iinnffoorrmmaattiioonn wWaass eenntteerreedd oonnttoo aa CCOOCC tthhaatt aaccccoommppaanniieedd tthhee ssaammpplleess ttoo tthhee llaabboorraattoorryy.. T`Thhee ccoommbbiinneedd ddiisscchhaarrggee ffrroomm tthhee WWooooddbbuurryy SSiittee pprroodduuccttiioonn wweellllss wwaass ssaammpplleedd ddiirreeccttllyy - ffrroomm tthhee nnoonn--ccoonnttaacctt pprroocceessss wwaatteerr ssuuppppllyy liinnee tthhaati eenntteerrss tthhee 33MM CCoottttaaggee GGrroovvee ffaacciilliittyy aatt BBuuiillddiinngg 5566.. AA ssaammpplliinngg ppoorrtt oonn tthhee ssuuppppllyy lliinnee wwaass ooppeenneedd aanndd aalllloowweedd ttoo ppuurrggee. - ssuuffffiicciieennttllyy ttoo cclleeaarr tthhee lliinnee.. TThhee ssaammppllee wwaass ccoolllleecctteedd ddiirreeccttllyy ffrroomm tthhee ppoorrtt iinnttoo pprreecclleeaanneedd ccoonnttaaiinneerrss pprroovviiddeeddbbyy tthhee llaabboorraattoorryy.. TThhee ccoonnttaaiinneerrss wweerree pprroommppttllyy sseeaalleedd,, ~ blaebleeledd,, aanndd ppllaacceedd iinntfo iiccee cchheesstts ccoooolleedd ttoo aapppprrooxxiimmaatteellyy 44CC.. TThhee ssaammppllee iinnffoorrmmaattiioonn wwaass eenntteerreeddoonnttoo aa CCOOCC tthhaatt aaccccoommppaanniieedd tthheessaammpplleessttoo tthhee llaabboorraattoorryy.. "The non-contact process water was sampled after it had been through the plant. The The non-contact process water was sampled after it had been through the plant. The - water is discharged into an open retention pond. The sample was collected from an water is discharged into an open retention pond. The sample was collected from an eessttaabblliisshheedd mmoonniittoorriinngg ppooiinntt llooccaatteedd aatt tthhee ddiisscchhaarrggee ffoorr tthhee ppoonndd.. TThhee ssaammppllee wwaass - collected by Towerinag disposable polyethylene baile into the discharge flow to collect collected by lowering a disposable polyethylene bailer into the discharge flow to collect the water sample. The water was poured info precleancd containers provided by the the water sample. The water was poured into precleaned containers provided by the - laboratory. The containers were promptly sealed, labeled, and placed into ice chests claoboolreadtotroy.apTprhoexicmoanttealiyne4rs Cw. ereThperosmampptllye sienafleodr,maltaiboenlewda, sanednteprlaecdeodntinotoa iCceOCchethsatst cooled to approximately 4 "C. The sample information was entered onto a COC that - accompanied the samples to the laboratory accompanied the samples to the laboratory. AAllll wwaatteerr ssaammpplleess wweerree ssuubbmmiitttteedd ttoo EExxyyggeenn RReesseeaarrcchh iinn SSttaattee CCoolllleeggee,, PPeennnnssyyllvvaanniiaa ffoorr FFCC aannaallyys~eess.. - 33..22 DDEESSCCRRIIPPTTIIOONN OOFF TTHHEE SSOOIILL AASSSSEESSSSMMEENNTT - 332.2..11 BBaacckkggrroouunndd - BBaasseedd uuppoonn a a rreevviieeww ooff tthhee hhiissttoorriiccaall aaccttiivviittieess ccoonndduucctteedd at at the the plan, plant, tthhee ffooccuuss ooff tthhee ssooiill ssaammpplliinngg pprrooggrraamm wwaass tthhee kknnoowwnn aanndd ppootteennttiiaall FFCC mmaannaaggeemmeenntt aarreeaas ((pprroodduuccttiioonn,, rato mane 33-99 22009955..00004400 I3MMAA0011555511881177 - ffiirree ttrraaiinniinngg,, eettcc)..). AAddddititiioonnaallllyy,, ssooiill ssaammpplleess wweerree ccoolllleecctteedd iinn ootthheerr aarreeaassooff tthhee ppllaanntt ttoo ggaaiinn aann oovveerraallll uunnddeerrssttaannddiinngg ooftfthhee FFCC ddiissttrriibbuuttiioonn iinn ssooiillss oonn aa ppllaanntt--wwiiddee bbaassiiss.. IInn aaccccoorrddaannccee wwiitthh tthhee FFCC WWoorrkk PPllaann aanndd MMPPCCA-Ar-ereqquueesstteedd WWoorrkk PPllaann mmoodidfifiiccaattiioonnss,, - tthhee ffoolllloowwiinngg aarreeaass aatt tthhee 33MM CCoottitaagges GGrroovvee,, MMiinnnneessoottaa ffacciilliittyy wweerre aasssseesssseedd tthhrroouugghh tthhee ccoolllleeccttiioonn ooffssuubbssuurrffaaccee osoiill ssaammpplleess ffrroomm ssaoiill bboorriinnggss aanndd//oorr ssuurrffaaccee ssooiill ssaammppleless:: DDI1 Former - Former HHFF TTaarr NNeeuutrtraalliizzaattiioonn PPiitt _ DD22 -FoFrormmeerr SSlluuddggee DDiissppoossaall AArrceaa DDS5 Former - Former SSoolliiddss BBuurmn PPiitt AArreeaa DDB8 ~-FFoorrmmeerr WWaassttee DDiissppoossaall AArreeaa - FiFriree TTrraaiinniinngg AArreeaa BBuuiikldliinngg 1155 AArreeaa " FoFromrmeerr WWaasstteewwaatteerr PPoonndd AArrceaa x DD66 -- F FormoerAAr sshhDDimsisppoosesaallAArrrceaa IncincratorComplex GeInnceirnaerlatPolraCntoAmrpelaex BaBGcaekcngkergrarooluuPnnladdnAAt rAreeraaessa((vviicciinniittyyooffmmoonnititoorr wweellllss MMWW--55 aanndd MMWW-7-7)) AAllll ssooiill ssaammpplleess wweerree aannaallyyzzeedd ffoorr FFCCss aanndd aa ssuubbsseett ooff tthheessee ssaammpplleess wwaass aannaallyyzzeedd ffoorr ~ ssiieevvee ((ggrraaiinn ssiizzee)) aanndd ttoottaall oorrggaanniicc ccaarrbboonn ((TTOOCC),). _ 33..222.22 DDeessccrriippttiioonn ooff SSooiill BBoorriinngg SSaammpplliinngg FFrroomm MMaayy 1155 t1o0 MMaayy 2266,, 22000055,, aattoottaall ooff 1166 ssooiill bboorriinnggss wweerree iinnssttaalllleedd aatt tthhee 33MM ffaacciilliittyy - uussiinngg hhoollllooww--sstteemm aauuggeerr ddirillliinngg tteecchhnniiqquueess.. AA ttoottaall ooff 111166 ccoommppoossiittee ssooiill ssaammpplleess wweerree ccoolllleecctteedd ffrroomm 55--fft iinntteerrvvaallss uussiinngg sspplliitt--ssppoooonn ssaammpplleerrss ccoonnttiinnuuoouussllyy ttoo. bboorriinngg - tteerrmmiinnaattiioonn ffoorr ddeessccrriippttiivvee llooggggiinngg aanndd aannaallyyttiiccaall tteessttiinngg.. TThhee ssooiill wwaass llooggggeedd bbyy aann eexxppeerriieenncceedd ggeeoollooggiisstt nnoottiinngg ccoolloorr,, tteexxttuurree,, mmooiissttuurree ccoonntteennt,, aanndd aannyy ooddoorrss oorr = ddiissccoolloorraattiioonn.. TThhee ssooiill ssaammpplleess wweerree aallssoo ssccrreeeenneedd uussiinngg aann oorrggaanniicc vvaappoorr mmeetteerr ((OOVVMM)). VOVMM rreeaaddiinnggss wweerree rreeccoorrddeedd oonn tthhee ssooiill bboorriinngg llooggss.. AAfftteerr ddeessccrriippttiivvee llooggggiinngg,, ssooiill ssaammpplleess wweerree ccoolllleecctteedd ffrroomm eeaacchh ffivvee--ffoooott iinntteerrvvaall,, ppllaacceedd - iinn aa ssttaaiinnlleessss sstteeeell bboowwll,, aanndd bblleennddeedd uunnttiill hhoommoogegneinzizeedd.. TThhee ccoommppoossiitteedd ssooiill wwaass ppllaacceedd iinnttoo pprreecclleeaanneedd ccoonnttaaiinneerrss pprroovviiddeedd bbyy tthhee llaabboorraattoorryy.. TThhee ccoonnttaaiinneerrss wweerree ~ pprroommppltlyy sseeaalleedd,, llaabbeelleedd,, aanndd ppllaacceedd iinnttoo iiccee cchheessttss ccoooolleedd ttoo aapppprrooxxiimmaatteellyy 44 CC.. TThhee Chos0nsn ome cas 33-1100 22009955..00004411 I3MMAA0011555511881188 - ssaammppllee iinnffoorrmmaattiioonn wwaass eenntteerreedd oonnttoo aa CCOOCC tthhaatt aaccccoommppaanniieedd tthhee ssaammpplleess ttoo tthhee llaabboorraattoorryy.. IInn aaccccoorrddaannccee wwiitthh tthhee FFCC WWoorrkk PPllaann,, dduupplliiccaattee mmeeddiiaa ssaammpplleess aanndd rriinnssaattee - bbllaannkk ssaammpplleess wweerree ccoolllleecctteedd aass ssppeecciiffiieedd iinn tthhee ssaammpplliinngg pprroottooccooll. - SSooiill ssaammpplleess wweerree ssuubbmmitittteedd ttoo EExxyyggeenn RReesseeaarrcchh iinn SSttaattee CCoolllleeggee,, PPeennnnssyyllvvaanniiaa ffoorr FFCC aannaallyysseess.. TTwweellvvee ssaammpplleess wweerree aallssoo sseelleecctteedd ffoorr ggrraaiinn ssiizzee ddiissttriibbuuttiioonn aanndd TTOOCC - aannaallyysseess.. TThhee ssaammpplleess ffoorr ggrraaiinn ssiizzee ddiissttrriibbuuttiioonn wweerree ssuubbmmiittteedd ttoo TTuussccaalloooossaa TTeessttiinngg LLaabboorraattoorryy iinn DDeeccaattuurr,, AAllaabbaammaa.. TThhee TTOOCC ssaammpplleess wweerree ssuubbmmiitttteedd ttoo SSeevveermn TTrreenntt - LLaabboorraattoorriieess,, IInncc.. ((SSTTLL)) iinn UUnniivveerrssiittyy PPaarkk,, ITlilinnoosi.s. - FFiigguurree 33--33 sshhoowwss tthhee ssooiill bboorriinngg llooccaattiioonnss.. TTaabbllee 33--33 pprreesseennttss aa ssuummmmaarryy ooff ssooiill bboorriinnggss aannddaa lliissttiinnggooffssooiill ssaammpplleess ccoolllleecctteedd ffoorr llaabboorraattoorryy tteessttiinngg.. AAccooppyyoofftthhee bboorriinngg llooggss iiss ~ pprroovviiddeedd iinn AAppppeennddiixx BB.. _ 33..22..22..11 DD11 AArreeaa - FFoorrmmeerr HHFF TTaarr NNeeuutrtraalliizzaattiioonn PPiitt BBaacckkggrroouunndd -- FFrroomm aapppprrooxxiimmaatteellyy 11996600 ttoo 11996633,, hhyyddrroofflluuoorriicc aacciidd ((IH-IEF)) ttaarrss wweerree - ccoolllleecctteedd aatt tthhee ssiitet aanndd ddiissppoosseedd ooffff-ssiittee aatt tthhee 33MM WWooooddbbuurryy SSiittee.. WWhheenn ddiissppoossaalloofftthhee wwaassttee ttaarss wwaass ddiissccoonnttiinnuueedd aatt tthhee WWooooddbbuurryy SSiittee,, tthheeyy wweerree ddiissppoosseedd oonn--ssiittee iinn tthhee - ddeessiiggnnaatteedd DDI1 AArreeaa ~- FFoorrmmeerr HHFF NNeeuutrtraalliizzaattiioonn PPiitt.. AAss sshhoowwnn iinn FFiigguurree 33.-33,, tthhee DDI1 AArreeaa iiss llooccaatteedd iinn tthhee ssoouutthheeaasstteerrnn ccoommeerroofftthhee 33MM pprrooppeerrttyy.. IItt hhaass bbeeeenn ffiilllleedd aanndd = ccoovveerreedd.. IInnffoorrmmaattiioonn ccoolllleecctteedd dduurriinngg pprreevviioouuss aasssseessssmmeennttss iinnddiiccaattees tthhaatt tthhee DD11 AArreeaa wwaass ccoonnssttrruucctteedd aass 2a ccoonnccrreettee bbaassiinn oorr ppiitt aanndd tthhee bbaassiinn oorr ppiitt wwaass uusseedd ttoo nneeuuitrraalliizzeeHHEF - tatarrss wwiitthh lliimmee.. TThhee hhiissttoorriicc iinnffoorrmmaattiioonn iinnddiiccaatteess tthhaatt ttaarrss wweerree ttaakkeennttootthhee ppiitt iinn ddrruummss aanndd tthheenn tthhee ddrruumm ccoonntteennttss wweerree dduummppeedd iinnttoo tthhee ppiitt.. LLiimmee wwaass ppllaacceedd iinnttoo tthhee ppiitt ffiirrsstt, - ffoolllloowweedd bbyy tthheewwaasstteetatarr,, tthheenn ffoolllloowweedd bbyy mmoorree lliimmee.. AA ccllaammsshheellll wwaass uusseedd ttoo mmiixx tthhee Tliimmee wwiitthh tthheewwaassttee mmataetreiraialsls.. IItt iisbebleilieevveedd tthhaatt tthhee DDI1 AArreeaa wwaass ooppeerraatteedd ffrroomm tthhee mmiidd - 11996600Ss ttootthhee ceaarrllyy 11997700ss wwhheenniitt wwaasscclolsedoaannsddccoeovveerdreeddwwitithh llooccaall ssooiill.s. sonstmma 31 3-11 22009955..00004422 33MMAA0011555511881199 = oma fs i NT il . i 3 f iy f= yes Si Lg i= ay lm 2 Ee ji bell pl a | rk wi wA ee]p 41 Bi) ie al Ha ~) 1hik i 2095.0043 3MA01551820 `TTaabbllee 33--33 SS3uuMmmCmmoatartryayogoeffSGSoroioilvl eBB,oorMriinNnggssFaaacnniddlitSSyooiill SSaammpplleess 3M Cottage Grove~ MN Facility Soil DeTTpoottthaallof - LBBoocoSarrotiiinilnoggn|| AsAAsrerseesaamooeffnt || DBBe(ofotprrbtiihgnnggof SSaamm(pfptlleebeDDs)eepptthh . Location Assessment (ft bgs) CCCGGGM MVNNNSSSBBBSCCCaDmDDIpI1OOl0eN10I0D0000000S00000 || 005--5510 (rt bgs) ior D101 |hNFoeoerumtmrearlHizeHaFFtiToranTra}r 25 | cCGGMMNNSSBBCCDIDO10I10001000500 CCGGMMNN SSBBCC DDI1O0L1 D0 B0010I000 51{1-010--01155 | 10-15 (duplicate) - Pit CCCCGGGGMMMMN-NNNSSBSSBBBCCCCDIDDDO111000L1110D0000BI021S005O100000 |21110505--22125500 (duplicate) - Former HF Tar CCGGVMINNSSBBCCDDI100210000020000* CCGGMMN-NSBSBCCDID012020000005000 | 020[-5-0-55-1205 DD110022 PFNi|NtoeerumutlreairlzizaHatFtiiooTnna|r 2255 |CCCCGGGGMMM MNNNNSSSSBBBBCCCCDDIIDD001100222200000010010105500000 | 511[-15010---0121505 - Pit CCGGMMNNSSBBCCDID010220002010500 CCGGMMNNSSBBCCDDI10032 0000020000 | | 2021-0055.--222505 = CCCCGGGGMMMMN-NNNSSSSBBBBCCCCDDIDDI011000333300000000010050050000 || 5051---0511-0015 CCGGMMNNSSBBCCDDI100330000115000 | 1105-:1250 - CCCCGGGGM MMMNNNNSSSSBBBBCCCCDDDDII11O003333 D0D00BB02O1005I100S5O0 | (11125550---22225000 ((dduupplliiccaattee)) DI03 | NFFeoourrtmmreaelrrizHHatFFioTTnaarr 70 |CCCCGGGGM M MMNNNNSSSSBBBBCCCCDDDDII11O30030330000020032250050000 22[[203550---23335s00 - D103 PitNeutralization Pit 70 CCCCGGGGVMM MINNNNSSSSBBBBCCCCDDIDDIO11000333300000004033305050000*% || 34335050---43445500 - CCGGM MNNSSBBCCDDI1O033 0000445000 CCGGVMINNSSBBCCDDI100330005040500 | 444[55050----45555005 CCCCGGGGMM MM-NNNNSSSSBBBBCCCCDDDDII11OO003333 00000000565550050000* || 56550505-:--56665050 - _ CGMN CGMN CGMN SBCDI0300650 SBC D103 0 0600 SBC D103 0 0650 | 666505---677500 erases meme E:~FOLDERS.0-9~3r~ogage grcve~FC Data Asse~sme~ Repod\Final doc 33-1133 22009955..00004444 33MMAA0011555511882211 Soit De"TpToottthaallof - BoSroiinl g | Areaof | DBeoprtihngof Sample Depth LBocoartinigon| Location AAssAsseerssesasmmoeefnntt | (ftbBoring (ft bgs) CGVN SBSCamDppIleOI0D0000 [05 ft by Sample Depth (ft bgs) - CCCCGGGGMMMMNNNNSSSSBBBBCCCCDIDDDIO11000H4440D000E000005005000050 || 5505--1151000 (duplicate) - CCCCGGGMMMGNNNSMSSBBBCCCDNDIDDI011SO00444S00D0B00B101150C0000005%"0 || 5-10 (duplicate) 1105-:1250 10-15 ' rr CCCCGGGGMMMMNNNNSSSSBBBBCCCCDDIDDIO11000H4400000022002150050000 | 2[2125050---22235050 - pos D104 | Former HF Tar Lryome Mtn Neutralization | 770 |CCCCGGOGMMMMNNNNSSSSBBBBCCCCDDIDDIO1100OS4400000030032305500000 | [23335050.--33345050 - Pit CCCCGGGGMMMMNNNNSSSSBBBBCCCCDDDDII11O0O0S4400000000443450500000% || 44430505-.--44455050 CCCCGGGGMMMMNNNNSSSSABBBCCCCDDDDI11IO00SS440D0D0BB0540005440055*00 || 44455550----55550005 (dduuplpiliccaattee)) - CCCCGGGGMMMMNNNNSSSSBBBBCCCCDIDDDIO11O00SS4400000060055505050000 || 65550055:.--56665050 - CCCCGGGGMMMMNNNN SSSSBBBBCCCC DDDDI2110000414400000605000066_005_000| 666[0505-.-5-677500 CCCCGGGGMMMMNNNNSSSSBBBBCCCCDDDD222200001111 00000000010050050000 || 0551:--0511-0015 - bao |Fomer Siudge| | CCCCGGGGMM MMNNNNSSSSBBBBCCCCD2DDD202200011110D0D0BB011500001100000 || 11110005-:--11125550 (duplicate) (duplicate) - D201 Disposal Former Disposal ArcaSludge Area 45 CCCCGGGGM MMMNNNNSSSSBBBBCCCC DDDD222200001111 00000000222105050000* || 22210055.:--22235500 CCCCGGGGMM MMNNNNSSSSBBBBCCCCDDDD222200001111 00000000332305500000 || 23330550.---33345050 = I CCCCGGGGM MMMNNNN SSSSBBBBCCCC DDDD22220000111200000000403400500000 | 44[30005-.5--444550 CCCCGGGGMMM MNNNNSSSSBBBBCCCCDD22DD002200222200000001000050050000 || 5051---0511-0015 -_ CCCCGGGGMMM MNNNNSSSSBBBBCCCCDD22DD002200222200000012001150050000 || 21115050:--21225500 Day |pomer SE D202 Former Sludge Disposal Area 55Og |CCCCGGGGMM MMNNNNSSSSBBBBCCCCD2DDD2022000222200000020032250050000+ | 22(30205:5--23335500 _ CCCCGGGGM MMMNNNN SSSSBBBBCCCC DDDD2222000022220D000B003335005300050 || 3350::3450 3355--4400 duplicate) - _ 1 CCCCGGGGMMM MNNNNSSSSBBBBCCCCDD22DD002200222200D000B33040500003050 || 44430505-:--44455500 (duplicate) CGMN SBC D202 0 0450 45-50 arersiraepurs---- 314 3-14 22009955..00004455 33MMAA0011555511882222 Soil I DeTTpootttahallof | . LBBoocoSarrotiiininloggn|| AsAAsrereseasamooeffnt || DBB(efootprrtbiihgnnsggof Sample ID SSaammpptlhleeesDD)eepptthh - Location Assessment (ft bgs) CCCGGGMMMNNNSSSBBBCSCCaDm2DDp022l003e330ID00000000500000 | 03 (ft bgs) | 05--510 CCCCGGGGMMMMNNNNSSSBSBBBCCCCDD2DD2022000333300000010010150500000 | 51-01-(315 | 1105-2150 - Yon Sind CCCGGGMMMNNN SBCD20300200 SBC D203 0 0150 SBC D203 0 0200 | 2025 15-20 20-25 D203 FDionrpmonearlSAlurdgye Disposal Area 5O CCCGGGMMMNNNSSBSBBCCCD2DD02200333000002032505000 || 223550:-333500 - CCCCGGGGMMMMNNNN SSSSBBBBCCCCDDDD222200003333 D0D00BB033500033000000 || 33330005-.--33345550 ((dduupplliiccaattee)) " CCCCGGGGMMMMNNNN SSSSBBBBCCCCDDDD222200003333000000400453400_50_000| | 44430505----44455500 F---- `CCCCGGGGMMMMNNNN SSSSBBBBCCCCFDFFTTT2AAA0O3O01110 0000004050000050000 || 4005-5-551-500 - FrTaA0o1 [4 J Fire Training ree Area 25 CCCCGGGGMMMMNNNNSSSSBBBBCCCCFFTFFTTTAAAAOO001111 00000000110105500000 || 5111-0501-.-0112550 2 `CCCCGGGGMMMMNNNN SSSSBBBBCCCCFFFFTTTTAAAA0O00211100000000021200500000 | | 20210055.--222505 Frag | Fire Training 5 |CCCCGGGOMMMMNNNNSSSSBBBBCCCCFFFFTTTTAAAAQ000222200000000100005050000 || 0551---05111005 - FTA02 Area Fire Training Area 25 `CCCCGGGGMMMM-NNNN SSSSBBBBCCCC FFFFTTTTAAAAQQ002222 D0D00BB011050011000000 || 11110005:---11215505 ((dduupplliiccaattee)) - CCCCGGGGMMMMNNNN SSBBCCFFTTAA00220000210500* SSBBCC FFTTAA0032 0000020000 |2105-2250 | 20-05-25 a Fra0s | FFfiiirrreee]TTrraaiinniinngg CCCCGGGGMMMMNNNN SSSSBBBBCCCC FFFFTTTTAAAAG000333300000000010050050000 || 5051---0511-0015 FTA03 Area 25 CCCCGGGGMMMMNNNNSSSSBBBBCCCCFTFFFTTTAAAAG000333300000010021150050000 _|| 21110055.--21225050 F CCCCGGGGMMMMNNNN SSSSBBBBCCCC WFW WTPPPAAAA0OOO3T1l00000000200005000000 || 0205--0-551-205 WPADL | FWaosrmteewrater CCCGGGMMMNNN SSSBBBCCC W W WPPPAAAO00I11 000000101050000 | 511-001--01155 - WPA01 os Wastewater Pond Area 25 `CCCGGGMMMNNN SSSBBBCCC W WWPPPAAAO0!11 0DD0BB15000110000|| 111005-:-112550 ((dduupplliiccaattee)) - CCCCGGGGMMMMNNNNSSBSSBBBCCCCBIW W WSPPPOAAAIO00I1100000000002210005000"_|| 2021-0505--222550 2 BBuiildningg 1155 25 |CCCCGGGGMMMMNNNNSSBSSBBBCCCCBBIBBIS11SO55O00IL110000000010000S050000 | 055[--1-5101-0015 - B1501 Area 25 CCCCGGGGMMMMNNNNSBSSSBBCBCCCBIBBBSI11O55S00OL11L00000000I211S0050000 || 21115050:--21225500 CGMN SBC B1501 0 0200 20-25 Cruceserm een 33-1155 22009955..00004466 I3MMAA0011555511882233 soit DeTTpootuthatlot LBoBcooSarrotiiinilnoggn|| _AsAAsrrceesmaaeoonftf_| | DBBe(oo1prtrthiihnnggof Location Assessment (ft bgs) p Sample ID SSaammpEplrlbeee Depth Depth (ft bgs) CCGGMMNN SSBBCC DD550011 00 00000000 00--55 - CCOOMNN SSBBCC DD330011 000005500+ | [155.1200 sor [fomerse | as |cownsscosoroono [101s - | __ |comnseCpsotoooo [2025 D501 Former Solids Bum Pit (DS) CGMN SBC D501 0 0050 5-10 25 CGMN SBCDS01 0 0100 10-15 CGMN SBC D501 0 0150" 15-20 CGMN SBC D501 0 0200 20-25 COMN SBC DOT 0000003 CGMN SBC D801 0 0000 0-5 ~ Fomer Waste CGMN SBC DSI 00050 |5.10 Former Waste CGMN SBC D801 0 0050* 5-10 DSOL | Dispos Ars | 25 |COMNSBCDSOIOOIO | 10-15 D801 Disposal Area ((DD88)) 25 CGMN SBC DS01 0 0100 C'CGGMMNN SSBBCC DD880011 0000115500 10-15 1155--2200 COMN SBC DOL 00200 | 205 CGMN SBC D801 0 0200 20-25 -- COMN SBC BRGO1 00000 [05 CGMN SBC BKG01 0 0000" 0-5 CGMN SBCBKGO1 00030 [5-10 CGMN SBC BKG01 0 0050 5-10 aor |nBeaercMksTon CCGOMMNN SSBBCC BBKKGGOO1 0D0B1001000|| 1100-1155 @uplicate BKG01 Background near MW-7 25 CGMN SBC BKG01 0 0100 10-15 CGMN SBC BKG01 DB 0100 10-15 (duplicate) 'CCGGMMNNSSBBCC BBKKGGO011 00 00115500 1155--2200 . CMN SBC BKGo1 00200 _| 20.25 CGMN SBC BKG01 0 0200 20-25 CMN SBC BKGO2 1000005 CGMN SBC BKG02 0 0000 0-5 - skoop n|eaBrekNeWmnSa |; C[CCOOcOMMoNIIuNNN sSSSBeBBCCCCBBBBKKKKGGGGo000222200D0000Bm210050000100|| 2[1[T10005-24.1125550 Guplicate) BKG02 Background near MW-5 'CCGGMMNN SSBBCC BBKKGG0022 0000005500 | 55--1100 CGMN SBC BKG02 0 0100 10-15 25 CGMN SBC BKG02 DB 0100 10-15 (duplicate) CGMN SBC BKG02 0 0150 15-20 CGMN SBC BKG02 0 0200 20-25 Teo elow ow re ft bgs - feet below ground surface erm orgie ron (TOC) aye * Sample submitted for gram size and total organic carbon (TOC) analyses. ssn pos-------- 3163-16 22009955..00004477 33MMAA0011555511882244 Ee SoISioilnlBBoosrriinntgg inastalllatlionaaanndtdSSaiammplopilinnngg--FFoouurrssooiill bboorriinnggss ((DD110011,, DD110022,, DD110033,,aanndd DD110044)) wweerree aaddvvaanncceedd iinn tthhee aarreeaaoofftthhee FFoorrmmeerr HHFF TTaarr NNeeuuttrraalliizzaattiioonn PPitt aass sshhoowwnn iinn FFiigguurree 33-- - 33.. SSooiill bboorriinnggss DDI100]1 aanndd DD110022 wweerree aaddvvaanncceedd ttoo aa ddeepptthh ooff 2255 ffeeeett bbeellooww ggrroouunndd ssuurrffaaccee ((f1t bbsg)s.). SSooiill bboorriinnggss DDI1O0S3 aanndd DDI1O044,, llooccaatteedd oonn tthhee ssoouutthh ((pprreessuummeedd ddoowwnnggraraddiieenntt)) ssiiddeeoofftthhee ffoorrmmeerr ppiitt, wweerree aaddvvaanncceedd ttooaa ddeepptthhooff 7700 fft bbggss.. - 33..22.22.22 DD22 AArreeaa -- FFoorrmmeerr SSlluuddggeeDDisisppoossaallAArreeaa - BBaacckkggrroouunndd -- AAffteerr rreeppllaacceemmeenntt ooff tthhee oorriiggiinnaall wwaasstteewwaatteerr ttrreeaattmmeenntt ppoonndd aanndd ccoonnssttrruuccttiioonn ooff nneeww wwaasstteewwaatteerr itrrecaattmmeenntt ppoonnddss iinn tthhee ecaarrllyy 11996600ss,, sslluuddggee ddiissppoossaall - ooccccuurrreedd iinn tthhee ddeessiiggnnaatteedd DD22 -~ FFoorrmmeerr SSlluuddgged DDiissppoossaall ~AArcrae.a. AAss sshhoowwnn iinn FFiigguurree 33.-33,, tthhee DD22 AArreeaa iiss llooccaatteedd ttoo tthhee wweessttoof faanndd aaddjjaacceenntt tto tthhee DD11 AArreeaa.. HHiissttoorriicc iinnffoorrmmaattiioonn - iinnddiiccaatteedd tthhaatt sslluuddggee oorr ddrreeddggiinnggss wweerree rreemmoovveedd ffrroomm aa ppoonndd aafflteerr tthheeyy wweerree aalllloowweedd ttoo ddrryy oouutt aanndd tthheenn ddiissppoosseedd iinn tthhee DD22 AArreeaa.. TThhiiss ssiittee wwaass colloosseedd aanndd ccoovveerreedd ssoommeettiimmee = bbeettwweeeenn 11997733 aanndd 11997755.. VViissuuaall iinnssppeeccttiioonn ooff tthhee ssiittee iinnddiiccaatteess tthhaatt iitt iiss aa mmaann--mmaaddee ttooppooggrraapphhiiccaallllyy hhiigghh aarreeaa aapppprrooxxiimmaatteelyl4y4 aaccrreess iinn ssiizzee.. SISooiilnlBBoorsirinntgg IanstlallaltionaaanntddSSiaammpolpilinnngg -- TThhrreeee ssooiill bboorriinnggss ((DD220011,, DD220022,, aanndd DD220033)) wweerree - aaddvvaanncceedd wwiitthhiinn tthhee ffoooottpprriinnttooftf hthee DD22 -~ FFoorrmmeerr SSlluuddggee DDiissppoossaall AArreeaa ttoo aasssseessss tthhee sludge thickness and the underlying native soil. The soil borings were advanced to - dsleupdtghesotfh4ic4knesbsegsa(nDd20th1e),u5n0derblygisng(Dn2a0t2i)v,e asnodil.50 Tbheesso(iDl2b03o)rings were advanced to depths of 44 ft bgs (D201), 50 ft bgs (D202), and 50 ft bgs (D203). . 33..22.22.33 DD55-- FFoorrmmeerr SSoolliiddss BBuurrnn PPiitt BBaacckkggrroouunndd -- TThhee ddeessiiggnnaatteedd DDS5 AArreeaa --- FFoorrmmeerr SSoolliiddss BBuurmn PPiitt AArreeaa wwaass llooccaatteedd ttoo tthhee - southeastof Building 34anddirecly west of the current wastewater treatment operations. sBouiulthdeiansgt3o4f Bhausildsiinncge3b4eeanndddeimroelcitlsyhewdesatnodfrtheemocvuerrdenatnwd atshteewDSateArrtereaahtmasenbteeonpecroavtieornesd. Building 34 has since been demolished and removed and the D5 Area has been covered wwiitthh 33 ttoo77 ffeeeett ooffffiillll.. HHiissttoorriicc iinnffoorrmmaattiioonn iinnddiciactead tthhaattththiiss aarreeaa wwaass uusseedd ffoorr bbuurrnniinngg oorrggaanniicc ssoolliidd wwaasstteess aanndd ddiissppoossaall ooff iinnoorrggaanniicc ssoolliidd wwaasstteess ggeenneerraatteedd ffrroomm ppllaanntt pprroodduuccttiioonn ooppeerraattiioonnss.. SSkkiimmmmiinnggss ooff sslluuddggee ffrroomm tthhee oorriiggiinnaall wwaasstteewwaatteerr ppoonndd wweerree rreeppoorrtteeddllyy ppllaacceedd iinn tthhiiss aarreeaa.. BBuumrniinngg ooff tthhee ssoolliiddss wwaass ffuueelleedd bbyy lliimmiitteedd aaddddiittiioonnss ooff wwaassttee ssoollvveenntsts.. TThheerree aarree nnooww nnoo vviissuuaall ggrroouunndd ssuurrffaaccee iinnddiiccaattiioonnss oofftthhee bboouunnddaarriieess ooff tthhiiss sstitee.. airsBrien 33-1177 22009955..00004488 I3MMAA0011555511882255 SSooiill BBoorriinngg IInnssttaallllaattiioonn aanndd SSaammpplliinn~g -- AA ssooiill bboorriinngg ((DDS5O011)) wwaass aaddvvaanncceedd ttoo aa ddeepptthh ooff 2255 0It bbggss iinn tthhee aarreeaa ffoorrmmeerrllyy uusseedd ttoo bbuurmn ssoolliidd wwaasstteess,, wwhhiicchh wweerree ggeenneerraatteedd oonn--ssiittee.. `TThhee aarreeaa iiss ccuurrreennttllyy ccoovveerreedd wwiitthh ggrraavveell aanndd uusseedd ffoorr ppaarrkkiinngg ttrraaccttoorr ttrraaiilleerrss.. TThhee ssooiill bboorriinngg wwaass llooccaatteedd wwiitthhiinn tthhee pprreessuummeedd DDS5 aarrecaa bbaasseedd oonn hhiissttoorriicc pphhoottooggrraapphhss aanndd mmaappss ffoorr tthhee ffaacciilliittyy.. - 33..22.22.44 DD88-- FFoorrmmeerr WWaassttee DDiissppoossaall AArreeaa - BBaacckkggrroouunndd --TThhiiss iiss2a ffoorrmmeerr ccoonnssttrruuccttiioonn ddeebbrriiss aanndd ddaammaaggeeddcocnotnatianinererdidsisppoosasall aarreeaa iiss llooccaatteedd iimmmmedeidaiatteellyy nnoorrtthh ooff tthhee ppuummpphhoouussee ffoorr PPW W--66 iinn aa sstteeeepp rraavviinnee.. AAnn IInntteerriimm - Remedial Measure (IRM) was conducted with MPCA approval at the DS Area during, Remedial Measure (IRM) was conducted with MPCA approval at the D8 Area during NNoovveemmbbeerr 11998855.. AApppprrooxxiimmaatteellyy 220000 ddaammaaggeedd ccoonnttaaiinneerrss aanndd ccoonnttaaiinneerr ffrraaggmmeennttss wweerree - rreemmoovveedd aanndd ddiissppoosseedd ooffffs-istitee.. DDuuee oto tthhee eexxttrreemmee sstteeeepp ssllooppeess aatt tthhee DDS8 AArreeaa aanndd tthhee lTooww lleevveell ooff oorrggaanniiccss eennccoouunntteerreedd,, tthhee M MPPCCAA aanndd 33MM aaggrreeeedd tthhaatt ssoommee ooff tthhee - iinnaacccceessssiibbllee ccoonnttaaiinneerrss ccoouulldd bbee ccoovveerreedd aanndd lleefft iinn ppllaaccee.. SSuurrffaaccee mmaannaaggeemmeenntt aaccttiivviittiieess were conducted as part of the IRM. These included brush clearing and construction of were conducted as part of the IRM. These included brush clearing and construction of ~ aacccceessss rrooaaddwwaayyss pprriioorr ttoo eexxccaavvaattiioonn,, ccoovveerriinngg wwiitthh ssoolil,, rreeggrraaddiinngg,, aanndd sseeeeddiinngg aafftteerr eexxccaavvaatitioonn.. TThheeaarreeaa iissnnoowwccoommplpelettellyy rreevveeggettaatteedd. Soil Boring Installation and Sampling - Soil Boring Installation and Sampling - SSooiill bboorriinngg DD880011 wwaass aaddvvaanncceedd iimmmmedeidaiatteellyy - ddoowwnnggraraddiieenntt ooff tthhee DD88 -- FFoorrmmeerr WWaassttee DDiissppoossaall AArreeaa 0to aa ddeepptthhooff2255 ft bggss.. AAcccceessss ttoo tthhiiss aarrecaa iiss vveerryy rreessttrriicctteedd dduuee ttoo tthhee sstteeeepp tteerrrraaiinn aanndd tthhee bboorriinngg wwaass llooccaatteedd aat tthhee bbaassee - oofftthhee ssllooppee iinn tthhee rraavviinnee ddoowwnnggraraddiieennttooff tthhee DD--88 AArreeaa.. i. 33..22.22.55 FFiirree TTrraaiinniinngg AArreeaa BBaacckkggrroouunndd -- AAss sshhoowwnn iinn FFiigguurree 33.-33,, tthhee FFiirree TTrraaiinniinngg AArreeaa iis llooccaatteedd oonn tthhee wweesstteermn ppoorrttiioonn ooff ppllaanntt ooppeerraattiioonnss.. TThhee aarreeaa wwaass uuttiilliizzeedd aass ceaarrllyy aass 11996688 ttoo tteesstt ffiirer ffiigghhttiinngg ffooaammss.. TThhee ffiirre ffiigghhttiinngg ffooaammss aarree pprroopprriieettaarryy 33MM pprroodduuccttss tthhaatt ccoonnttaaiinn FFCC.s. VVaarriioouuss ssttrruuccttuurreess wweerree uusseedd ffoorr ttrraaiinniinngg aanndd wwaassttee ccoonnttaaiinnmmeenntt iinn tthiiss aarreeaa.. OOrriiggiinnaallllyy,, shallow pans were used for seling fires. In 1970, an underground storage tank (UST) shallow pans were used for setting fires. In 1970, an underground storage tank (UST) rreepplliiccaa wwaass ccoonnssttrruucctteedd ffoorr ttrraaiinniinngg ttoo ccoonnttaaiinn ffiirreess aatt UUSSTT ssiitteess.. BBaasseedd oonn hhiissttoorriicc iinnffoorrmmaattiioonn,, pprriioorr ttoo 11997711,, mmuucchh ooff tthhee rreessiidduuaallss aanndd lliiqquuiiddss ffrroomm tthhee ffiirreeffiigghhttiinngg Craton oto meeets E:\FOLDERS ~-9~3rn.co[tage orove~CC Data Assessmer~l Repor~\F~n~ doc 33-1188 22009955..00004499 I3MMAA0011555511882266 exercises exercises discharged discharged to to area area drainages drainages and and then then to to th the ddrraaiinnaaggeewwaayy llooccaatteedd wweesstt ooff tthhiiss area, In 1972, 3 UST was constructed to collst lids and wastes from the pass. The area. In 1972, a UST was constructed to collect fluids and wastes from the pans. The - ttaannkk ccoonntteennttss wweerree rreemmoovveedd qquuaarrtteerrllyy aanndd hhaauulleedd ttoo tthhee oonn--ssiittee wwaasstteewwaatteerr ttrreeaattmmeenntt plant. plant. Tn 1981, 3M constructed lined pond in the Fiee Training Area to collect uids from the - In 1981, 3M fire fighting accotnisvtirtuecst.ed Aaclcinuemdulpaotnedd ifnluthidesFwiroeulTdraibneinpguAmpreeadtoincfoollaecttafnlkueirdstrfruocmk atnhde fdiriesfcighhtainrgogtaehcdteivoint-iessi.te Awacsctuemwautleartetdrefalutmidesntwpoanutl.d be pumped into a tanker truck and discharged to the on-site wastewater treatment plant. Soil Boring Installation and Sampling - Thee borings (FTAOI, FTA, and FTAO3) wSeorileBaodrvianngceIdnsitanlltahteiovnicainnidtySoafmtphlinFgir-e TTrhaireneinbgoArtinegaso(nFTthAe0s1o,uFthTwAes0t2,poarntdioFnoTfAt0h3e) wfaceirleitay.dvaDnuceedtoinththeeprveicsiennictey ooffatheneFwlirye-cTornasitnrinugctAedrecaonotnaithnmeesnotupthownde,sttpheorstoioiln boofitnhge. - facility. locations Dwueeretoatdhjeusptreedsefnrcoemofthaosneewilnyd-iccoantesdtruicntetdhecoFnCtainWmoernkt pPloannd. , thTehseoial dbjousritnegd cloactaitioonnss p~rvoevreideaddjtuhsetesdamfreomareatlhocsoeverinadgeic.ateAdl itnhrtheeboFrCingWs owerkrePaladnv.ancTedheaadjduesptetdh i. of25 bs. locations provided the same areal coverage. All three borings were advanced to a depth of 25 ft bgs. n 33.22.22.66 BBuuiillddiinngg 1155 AArreeaa BBaacckkggrroouunndd - - BBuuiillddiinngg 1155 iiss tthhee llooccaattiioonn ooff eelleeccttrroocchheemmiiccaall fuorination fluorination (EC) (ECF) cells cells - uusseedd iin FFCC pprroodduuccttiioonn.. - Soil Boring Installation and Samplin-g One soil boring (B1501) was advanced southeast oSfoiBluBioldriinngg In15stailnlatthioenpalnandtSaarmeapltinogev- aOlunaetsopoiltebnotriianlg i(mBp1a5c0t1t)owtahseasdovilanfcreodmsopausthteFasCt - omafnBaugieldmienngt 1i5n itnhitshearepal.antTahreealotocateivoanluwaates psoetleencttieadl dimowpnagcrtatdoietnhte osofilthferobmuilpdaisntgFaCs mshaonwangeimn eFnigtuirne t3h-3i.s aTrheae. soTilhbeorlioncgatwioans wadavsansceleedctteodaddeopwngorfad2i5enfbt so.f the building as shown in Figure 3-3. The soil boring was advanced to a depth of 25 ft bgs. 3.227 Former Wastewater Pond Area 3.2.2. 7 Former Wastewater Pond Area . Backeroun-d Wastewater treatment has occurreda the facility since operations began in Background 1947. The o-riWgianasltewwaastteerwtraetaetrmpenotndhaswaosccluorcraetdedat itnhet hfaecialrietya sainscte oofpeBruaitliodnisngbe2g6ana nind S1o9u4t7h. ofThBeuilodriignigna4l1 waansdtewwaasteorpeproantdedwuansilloccoantseidruicntithoneofartehae eapsrtesoenftBduaiyldiwnagst2e6waatnedr south of Building 41 and was operated until construction of the present day wastewater ttrreeaattmmeenntt ssyysstteemm iinn tthhee eeaarrllyy 11996600ss.. SSkkiimmmmiinnggss ooff sslluuddggee ffrroomm tthhee oorriiggiinnaall ppoonndd wweerree rreeppoorrtteeddllyy ddiissppoosseedd oonns-siittee iinn tthhee ddeessiiggnnaatteedd DDS5 --- FFoorrmmeerr SSoolliiddss BBuumm PPiit AArreeaa. erste-- 33-1199 22009955..00005500 33MMAA0011555511882277 SSooiill BBoorriinngg IInnssttaallllaattiioonn aanndd SSaammpplliingn-g- OOnnee ssooiill bboorriinngg ((WWPPAAO011)) wwaass aaddvvaanncceedd t1o0 aa ddeepptthh ooff 2255 fftt bbggss wwiitthhiinn aann aasspphhaalltt ppaarrkkiinngg aarreeaa ecaasstt ooff BBuuiillddiinngg 2266 aanndd ssoouutthh ooff BBuuiillddiinngg 4411 aatt tthhee ssiittee ooff tthhee oorriiggiinnaall wwaasstteewwaatteerr ttrreeaattmmeenntt ppoonndd.. TThhiiss wwaass ccoonnffiirrmmeedd tthhrroouugghh tthhee rreevviieewwooffhhiissttoorriicc pphhoottooggrraapphhssoofftthhee ffaacciilliittyy.. 33..22.22.88 BBaacckkggrroouunndd AArreeaass Soil Boring Installation and Sampling - Two soil borings were advanced in areas having - Soil Boring Installation and no history of plant activity Sampling - Two soil north of the facility borings to serve were advanced as background in areas control hpoaivntins.g n`Tohehbisotroirnygsowfeprlaenatdavcatnivceitdy andojratchenotfttohmeonfaictiolritiyngtoweslelrsveMWas-b7ac(ksiglrobuonrdincgoBnKtrGoOlIp)oainntsd. The borings were advanced adjacent to monitoring wells MW-7 (soil boring BKG01) and - M MW WS-5 ((ssooiill bboorriinngg BBKKGGO022)).. - 323 Descriptionof Surface Soil Sampling 3.2.3 Description of Surface Soil Sampling IInn MMaayy 22000055,, 5500 ssooiill ssaammpplleess wweerree ccoolllleecctteedd aat 2255 llooccaattiioonnss (10 (0 to 6" 6" and and 6 6 to to 24" 24" bes bgs at at eeaacchh llooccaattiioonn)) aaccrroossss tthhee ssiittee.. TThheessee llooccaattiioonnss wweerree ccoonncceennttrraatteedd in in known known or or potential potential aarreeaass wwhheerree FFCCss wweerree hhaannddlleedd bbuutt aallssoo were were distributed distributed ata at a lesser lesser frequency frequency over over general general aaccttiivvee ppllaanntt aarreeaass aanndd bbaacckkggrroouunndd llooccaattiioonnss t(o0 pprroovviiddee a a plant-wide plant-wide understanding understanding of of the the ~ ooccccuurrrreennccee ooff FFCCss iinn ssuurrffaaccee ssooiillss.. SSuurrffaaccee ssooiill ssaammppileess wweerree ffiieelldd--lJooccaatteedd bbaasseedd oonn tthhee ffoolllloowwiinngg ccrriitteerriiaa:: - SarSemacmpenlptleedillsootccuaartbtiiaoonnncsse,wwfeeirlrleeingbb,iiaaossreegddrattdooiwwngaa.rrdd aarreeaass tthhaatt Gdidd nnoott show show any any evidence evidence of of recent disturbance, filling, or grading. - SaaScmatmpivlpitleieesllooacctaatttihioeonnsssiteww,eesrrueechbbiiaaassseeaddrctatosowwiaamrrmddedaairraeetaaesslyooffadmmjoaoscsettntlliik(k0eelldyyisiipmmosppaaalccttloffcrraotomimonppsaaossrtt N wwaicitttihhviiinntieddsrraaaiintnaatghgeee ssswwitaeal,leesssuddcoohwwnangsgrararadediaiesennittmoomff effodorirmamteeerlryppooattdeejnnattciieaanlltFFtCCo mdaisnpaogseaml elnotcaatiroenass. management areas. or Historic photographs and aerial photographs slso were used to position surface sample Historic photographs and aerial photographs also were used to position surface sample locations appropriately. locations appropriately. TTwwoo ssaammpplleess wweerree ccoolllleecctteedd ffrroomm eeaacchh ssuurrffaaccee ssooiill ssaammpplliinngg location. location. The first sample The first sample was collected from surface grade to a depth of approximately six inches. In areas of was collected from surface grade to a depth of approximately six inches. In areas of ggrraavveell oorr aasspphhaalltt,, tthhee ssaammppllee wwaass ccoolllleecctteedd iimmmmedeidaiatteellyy bbeellooww tthhee ggrraavveell llaayyeerr.. SSooiill from six to 24 inches in depth was collected using stainless steel bucket augers. For each. from six to 24 inches in depth was collected using stainless steel bucket augers. For each N ssaammpplliinngg iinntteerrvvaall,, ssooiill wwaass ppllaacceedd iinnttoo aa cclleeaann ssttaaiinnlleessss sstteeeell bbooww!l ffoorr hhoommoogegneinzizaattiioonn.. [-- 33-2200 22009955..00005511 33MMAA0011555511882288 OOnnccee bblleennddeedd,, tthhee ssooiill wwaass ppllaacceedd iinnttoo pprreecclleeaanneedd ccoonnttaaiinneerrss pprroovviiddeedd bbyy tthhee llaabboorraattoorryy.. TThhee ccoonnttaaiinneerrss wweerree pprroommpptllyy ssceaalleedd,, llaabbeelleedd,, aanndd ppllaacceedd iinnttoo iiccee cchheessttss ccoooolleedd ttoo - aapppprrooxxiimmaatteleyl4y4 CC.. TThhee ssaammppllee iinnffoorrmmaattiioonn wwaass eenntteerreedd oonnttoo aa CCOOCC tthhaatt aaccccoommppaarniieedd the samples to the laboratory. In accordance with the FC Work Plan, duplicate media the samples to the laboratory. In accordance with the FC Work Plan, duplicate media - ssaammpplleess aanndd rriinnssaattee bbllaannkk ssaammpplleess wweerree aallssoo ccoolllleecctteedd aass ppaarrtt oofftthhee ssaammpplliinngg pprroottooccooll. `TTaabbllee 33--44 pprreesseennttss aassuummmmaarryyooff tthhee ssuurrffaaccee ssooiill ssaammpplliinngg aaccttiivviittiieess. = 33..33 ADDESESSSCECRSRISIPPMTTEIIONONNT OOFF TTHHEE SSEEDDIIMMEENNTT AANNDD SSUURRFFAACCEE WWAATTEERR ASSESSMENT ~ IInn aaccccoorrddaannccee wwiitthh tthhee FFCC W Woorrkk PPllaann aanndd MMPPCCA-Ar-ereqquueesstteedd W Woorrkk PPllaann mmoodidfifiiccaattiioonnss,, W `WEESSTTOONN ccoonndduucctteedd sseeddiimmeenntt aanndd ssuurrffaaccee wwaatteerr ssaammpplliinngg aatt tthhee eeaasstt aanndd wweesstt ccoovveess aanndd _ the Mississippi River during the week of August $, 2005 the Mississippi River during the week of August 8, 2005. N 33..33.41 EEaassttaanndd WWeesstt CCoovveess OOnn AAuuggausstt 1100,, 22000055,, W WEESSTTOONN ccoolllleecctteedd ssiixx sseeddiimmeenntt aanndd ttwwoo ssuurrffaaccee wwaatteerr sSaammpplleess ffrroomm tthhee ceaasstt aanndd wweesstt ccoovveess.. TThhee ssaammpplliinngg llooccaattiioonnss ((EECC--11 tthhrroouugghh EECC--33 aatt tthhee ecaasstt cove and WC-1 through WC-3at the west cove) are shown in Figure 3-4. cove and WC-1 through WC-3 at the west cove) are shown in Figure 3-4. OOnn AAuugguusstt 1122,, 22000055,, iinn aaccccoorrddaannccee wwiitthh tthhee FFCC W Woorrkk PPllaann,, W WEESSTTOONN ccoolllleecctteedd aa - sediment and a surface water sample at a location (EU-1) in the upsiream drainageway to sediment and a surface water sample at a location (EU-1) in the upstream drainageway to the cast cove anda sediment sampleatalocation (WU-1) in the upstream drainageway to the east cove and a sediment sample at a location (WU-1) in the upstream drainageway to the west cove. A surface water sample could not be collected in the west cove the west cove. A surface water sample could not be cellected in the west cove drainageway since there was no water present. The upsiream cove sampling locations are - dsrhaoinwangienwFaiygusrienc3e-4t.here was no water present. The upstream cove sampling locations are shown in Figure 3-4. ~ Atcach of the three sampling locations in the cast and west covaseedisme,nt sample was At each of the three sampling locations in the east and west coves, a sediment sample was collected from the 0 -10 cm and 10 20 cm depth intervals using a polycarbonate tube. collected from the 0 -10 cm and 10 - 20 cm depth intervals using a polycarbonate tube a sampler. In the upstream drainageways, the sediment sample was collected from th0e sampler. In the upstream drainageways, the sediment sample was collected from the 0 - 1100 ecmm ddeepptthh iinntteerrvveal.l. SSeeddiimmeenntt ssaammpplleess wweerree hhoommooggeenniizzeedd iinn mmeettaall ttrraayyss wwiitthh ddiissppoossaabbllee ppoollyyeetthhyylleennee lliinneerrss aanndd ppllaacceedd iinnttoo pprree--cclleeaanneedd llaabboorraattoorryy--ssuupppplliieedd bboottttlleess,, sseeaalleedd aanndd llaabbeelleedd,. [Lr ---- 33-2211 22009955..00005522 33MMAA0011555511882299 `TTaabbllee 333--M44 CSSouutmmtmamgaearrGyyrooofvfeSS,uurrMffaaNcceeFaSScooiiilllitSSyaammpplleess 3M Cottage Grove, MN Facility Sample Depth | Depth DaVrea |E sitepescrpion Sampler O nba) {| Sample Description Area Site Description Sample ID (in b~s~ Sample Description - Former Tar Former HF Tar CGMN SS D101 0 0000 Nevin D1 Neutralization CGMN SS D101 0 0005 0-6 Black silty sand 6~24 Black silty sand Pi [CGMONS S[63S0 [DDIuDpIlDoB] Pit CGMN SS D101 DB 0005 6-24 Duplicate - CGIvIN SS H Formy er Sludge CGIvl-N SS DD22= 0011 00 00000050 06--= 624 SSiillttyy ssaanndd wwii= tthh bbllaacckk oorrggaanniiccss DipsArcs D2 Disposal Area CGMN SS D202 0 0000 0-6 Black silty sand - [CGM SSDate 000s 6.37]Dk brownsitysind CGIvfN SS D202 0 0005 6-24 Dk brown silty sand [COMNSSDSOI00000 |0:6 | Backsity snd CGMN SS D501 0 0000 0-6 Black silty sand _ fom sais -- |COMNSSDS01000-- 05 | 624 | nero Dk brown silty sand with green Former Solids CGMN SS D501 0 0005 6-24 layer (unknown) Dumfases |COMNSSDEZO000 [06 | Dlxksitysasd D5 Burn Pit Area CGMN SS D502 0 0000 0-6 Black silty sand COSSDM20N0 | 624 | Brown aitysand CGMN SS D502 0 0005 6-24 Brown silty sand - | CCGGMMNN SSSS DD5500330000000000. 'CGMN SS D3030 0005 100-66 6:24 BlBalacckk ssaanndd CGMN SS D503 0 0005 6-24 Brown sand fom pAn, LCOMNSSDOT00000 {06 Blaesiysid Former Ash CGMN SS D601 0 0000 0-6 Black silty sand N [COMNSSDEOT0000S |621 [Blokstysand | D6 Disposal Area CGM-N SS D601 0 0005 6-24 Black silty sand DIPRIATS Gov SS part DBwas 62 |Duphese| CGMN SS D601 DB 0005 6-24 Duplicate oo ||ToSmelr Wian C[oCOnMsNSSpDtMoInOoUsM T|o0s:t |g Dhakavin| D8 Former Waste CGMN SS D801 0 0000 0-6 Black gravelly sand oumebyend| Disposal Area 'CCGGMMNNSSSSFDTSA0011000000005 0 CGMN SS FTA01 0 0000 |06-2-4 6| 0-6 BGBllraaacvkceslksliyillttsyyassnaadnndd_ fen [CoCmnrO sSsSFFTTUAaDmTo0N 0o00n5 f|5o2s3 |Bblrocwknscilayyoenysd--isi || FFTTAA Area | COMNSSF[6T24A|DO upliIoweDBOOS| CGMN SS FTA01 0 13005 6-24 Fire Training Area CGMN SS FTA01 DB 0005 6-24 CGMN SS FTA02 0 13000 0-6 Brown clayey silty sand Duplicate Black silty sand - [COM wos N[62S1 S BrowF nsityT ssnd A0| CGMN SS FTA02 0 0005 6-24 Brown silty sand ee Incinerator Complex - IC01 EoubesE stof pe oe |r| = socuothmepalsetxof CGMN SS 1001 0.0000 Brownsandy gravel complex CGMN SS IC01 0 0000 0-6 Brown sandy gravel TCOsou | IC01 southeast - IC 1C0o2fscooumtphlweexst |C CGM'NG SSSS1IM 0C002100N 00000005 066-24 `DBlaarckkbsraonwdyn gragrvaveellly sand IC02 southwest CGMN SS IC02 0 0000 0-6 Black sandy gravel of complex CGMN SS IC02 0 0005 6-24 Dark brown sandy gravel IC03 northwest CGMN SS IC03 13 0000 0-6 Brown sandy gravel - Grant CoBtumoidricnaygs15of|[|CCCOaMuOOnNS5MSM5B1I2SN0NT[ 1Z00S00S0000S00SB[[[I060:I266C4e S[O|D|DOBBauls8ackkc1bbksrrs0oloiww0yynnsssasn0ie nyt0ddyssi0d0nd. 0005||| General Fn Ar pat [C[COOMCMNNSGSSSBBiMIeo6tZN00000S000 S[|B6002..561IS|||DDBaaEarrckkkbb2soriowwyn0nssiinttdy0ysaenn0dd 05| Plant Area of complex IC04 northeast of complex CGMN SS IC03 0 0005 CGM-N SS IC04 0 0000 CGMN SS IC04 13 0005 Building 15 Building 16 CGMN SS B1501 0 0000 CGMN SS B1501 0 0005 CGMN SS B1502 0 0000 CGMN SS B1502 0 0005 CGMN SS B1601 0 0000 CGMN SS B 1601 0 0005 CGMN SS B1602 0 0000 6-24 Reddish brown gravelly sand 0-6 Black silty sand 6-24 Black silty sand 0-6 Dark brown silty sand 6-24 Black silty sand 0-6 Dark brown silty sand 6-24 Black silty sand 0-6 Dark brown silty sand 6-24 Black silty sand 0-6 Dark brown silty sand | nn[[CBCC OO2UNN2o SSS022s 101D0Bs0000s06 [06[526214 _||eBDrieopwend E gelsred Building 22 CGMN SS B1602 0 0005 CGMN SS B2201 0 0000 CGMN SS B2201 0 0005 CGMN SS B2201 DB 0005 6-24 0-6 6 24 6-24 Black silty sand Brown sandy gravel Brown sandy gravel to silty sand Duplicate a a E:\FOLOERS.O-9~3rn-cOIlag~ grove~FC Data Assessment Reporl\Final doc 23-222 22009955..00005533 33MMAA0011555511883300 Sample Deplh Area - | buiamgts [CONSENTED [oEe omemigms| General - Plat Area BBuulldiirng3?g0 ||`CCCOMGNMG SSSSSBB2DM 62O0T1L000N 00000000550 |[066:24BBBrrrooowwnwnsnendgyvgeellyressvennldd Plant Area Site Description Building 25 Building 26/ Building 7 Sample ID CGMN SS B2501 0 0000 CGMN SS B2501 0 0005 CGMN SS B2601 0 0000 CGMN SS B2601 0 0005 (in Sample Description 0-6 Brown sandy gravel 6 -24 Brown gravelly sand 0-6 Brown sandy gravel 6-24 Brown gravelly sand CGMN SS B6801 0 0000 0-6 Brown sandy gravel `COMNSSBEI Db00 [0[:6 Duplcse| Building 68 CGMN SS B6801 DB 0000 0-6 Duplicate - [Comnss1p62a3 sDhockruiyomndvies| CGMN SS B6801 0 0005 6-24 Black silty sand `CGMNSSBI0Z01 00000 |0:6|Black iy sand Buildi8ng 102 CGMN SS B10201 0 0000 " CGMCNSGSSSBM B11002N 20011 00000000S5 0-6 Black silty sand |66-:2424|DDararkkbbrroowwnnsislilttyy ssaanndd_ a ` CGMC NSSSSG BB1l1122M 0011000N 0000000 |00-6-6|BBlalacckksislilttyy ssaanndd - id Building 112 " CGMC NSSSSG BB1l1122M 0011000N 0000055 |662-244 |BBllacak csilkty ssanid ltysand| Bickground |COMN SSBRGOL00000 06 | Blackaiysmnd | Background CGMN SS BKG01 0 0000 0-6 Black silty sand py 1 BKG Sample- - Nonbews |CMNSSBKGOL00005 | 624 | Black sy sana Northeast CGMN SS BKG01 0 0005 6-24 Black silty sand evgro and ie in bgs - Inches below ground surface asim 33-223 22009955..00005544 33MMAA0011555511883311 --_-- es | | I Ho: a: : ea IE boi +| it | y | AE | i || `a | BgHE } ATR. dl BL || Bee 2 AC2ha 3 i3 2 a ~ 18 4 oaHi . Hii il +4ii | | | i I |Ei : : IBBo } 1 ` i. | d a . i 22009955..00005555 33MMAA0011555511883322 ey - OOnnee ssuurrffaaccee wwaatteerr ssaammppllee wwaass ccoolllleecctteedd aatt eeaacchh ccoovvee aanndd ccoo--llooccaatteedd wwiitthhaa sseeddiimmeenntt ssaammppllee ((llooccaattiioonnss EECC--11 aanndd WWC-C1-)1.). TThhee wwaatteerr ddeepptthh aatt bbootth ooff tthhee llooccaattiioonnss wwaass lleessss - tthhaann 1100 ffeeeett iinn ddeepptthh.. TThheerreeffoorree,, iinn aaccccoorrddaannccee wwiitthh tthhee WWoorrkk PPllaann,, eeaacchh ssuurrffaaccee wwaatteerr ssaammppllee wwaass ccoolllleecctteedd iinnttoo aa ppoollyyvviinnyyll cchhlloorriiddee ((PPVVCC)) nniisskkiinn bboottttllee iinn tthhee ccoovveess aatt - aapppprrooxxiimmaatteellyy 00..66 tthhee ttoottaall wwaatteerr ddeepptthh.. TThhee ssuurrffaaccee wwaatteerr ssaammppllee ffrroomm tthhee eeaasstt ccoovvee uuppssttrreeaamm ddrraaiinnaaggeewwaayy wwaass ccoolllleecctteedd iinnttoo aa pprree--eclleeaanneedd uunnssppiikkeedd ssaammppllee bboottltele.. AAlliiqquuoottss - oofftthhee wwaatteerr ssaammpplleess wweerree ttrraannssffeerrrreedd iinnttoo aapppprroopprriiaattee ssppiikkeedd llaabboorraattoorryy--ssuupppplliieedd bboottttlleess,, sseeaalleedd aanndd llaabbeelleedd.. AA YYSSII mmeetteerr wwaass uusseedd ttoo mmeeaassuurree aanndd rreeccoorrdd tthhee ffoollloowwiinngg ssuurrffaaccee - `wwaatteerr ssaammppllee ppaarraammeetteerrss iinn tthhee ffiieelldd:: tteemmppeerraattuurree,, ccoonndduuctcitivviittyy,, ddiissssoollvveedd ooxxyyggeenn ((DDOO)),, PpHH,, ooxxiiddaattiioonn--reedduuccttiioonn ppootteennttiiaall ((OORRPP)),, aanndd ttuurrbbiiddiittyy.. AA hhaanndd--hheelldd GGlloobbaall PPoossiittiioonniinngg SSyysstteemm ((GGPPSS)) uunniitt wwaass uusseedd ttoo rreeccoorrdd ppoossiittiioonnaall ddaattaa.. - The sediment and surface water samples were placed into ice chests cooled to The sediment and surface water samples were placed into ice chests cooled to aapppprrooxxiimmaatteellyy 44CC.. SSaammppllee iinnffoorrmmaattiioonn wwaass eenntteerreedd oonnttoo aa CCOOCC tthhaatt aaccccoommppaanniieedd tthhee - ssaammpplleess oto tthhee llaabboorraattoorryy.. TThhee ssaammpplleess wweerree ssuubbmmitittteedd ttoo EExxyyggeenn RReesseeaarrcchh LLaabboorraattoorryy in State College, Pennsylvania for FC analyses. in State College, Pennsylvania for FC analyses. 33.33.22 MMiissssiissssiippppii RRiivveerr OOnn AAuugguusstt 99,, 22000055,, W WEESSTTOONN llaauunncchheedd aa bbooaatt iinnttoo tthhee MMisisssiissssiippppii RRiivveerr t1o0 ccoolllleecctt - sseeddiimmeenntt aanndd ssuurrffaaccee wwaatteerr ssaammpplleess iinn aaccccoorrddaannccee wwiitthh tthhee FFCC WWoorrkk PPllaann.. AAllssoo,, oonnee aaddddiittiioonnaall ddoowwnnssttrreeaamm llooccaattiioonn ttoo tthhoossee pprreesseenntteedd iinn tthhee FFCC W Woorrkk PPllaann wwaass ssaammppleledd.. - "TThhee ssaammpplliinngg llooccaattiioonnss ((RR11 tthhrroouugghh RR66))aarreesshhoowwnn iinn FFiigguurree 33--44. AAtteeaacchh ssaammpplliinngg llooccaattiioonn iinn tthhee M Misisssiissssiippppii RRiivveerr,, a sseeddiimmeenntt ssaammppllee wwaass ccoolllleecctteedd ffrroomm - thetop the top 1100ccmmooffsseeddiimmeenntt uusisngaiappnoonngaarr ssaammpplelerr.. TThhee ssaammppllee wwaass hhoommooggeenniizzeedd iinnmmetetaall ttrraayyss wwiitthh ddiissppoossaabbllee ppllaassttiicc lliinneerrss aanndd ppllaacceedd iinnttoo. pprree--cclleeaannecdd llaabboorraattoorryy--ssuupppplliieedd - bboottttlleess aanndd llaabbeelleedd.. - FFoorr tthhee ccoolllleeccttiioonn ooff ssuurrffaaccee wwaatteerr ssaammpplleess,, tthhee ddeepptthhooffwwaatteerr aatt eeaacchh llooccaattiioonn wwaass mmeeaassuurreedd uussiinngg aa ddeepptthh ffiinnddeerr.. AAtt llooccaattiioonnss 1Rt22,, RR33,, RR4,, RRSS,, EECC--11 aanndd WWCC--11 tthhee wwaatteerr - ddeepptthh wwaass lleessss tthhaann 1100 ffeecett iinn ddeepptthh.. TThheerreeffoorree,, iinn aaccccoorrddaannccee wwiitthh tthhee WWoorrkk PPllaann,, ceaacchh ssuurrffaaccee wwaatteerr ssaammppllee wwaass ccoolllleecctteedd iinnttoo aa PPVVCC nniisskkiinn bboottttllee aatt aapppprrooxxiimmaatteellyy 00..66 tthhee Cramsumeme vectra mtn 33-2255 22009955..00005566 I3MMAA0011555511883333 puss - ttoottaall wwaatteerr ddeepptthh.. AAtt llooccaattiioonnss RRI1 aanndd RR66 tthhee wwaatteerr ddeepptthh wwaass ggrreeaatteerr tthhaann 1100 ffeeeett.. TThheerreeffoorree,, iinn aaccccoorrddaannccee wwiitthh tthhee WWoorrkk PPlnan,, tthhee wwaatteerr ssaammppllee aatt tthheessee llooccaattiioonnss wwaass - `ccoommppoossiitteedd ffrroomm ddiissccrreettee ssaammpplleess ccoolllleecctteedd aatt aapppprrooxxiimmaatteellyy 00..22 aanndd 00..88 tthhee ttoottaall wwaatteerr ddeepptthh.. AAlliiqquuoottss ooff eeaacchh wwaatteerr ssaammppllee wweerree ttrraannssffeerrrreedd iinnttoo aapppprroopprriiaattee ssppiikkeedd llaabboorraattooryy-- - ssuupppplliieedd bboottttlleess,, sseeaalleedd aanndd llaabbeelleedd.. AA YYSSII mmeetteerr wwaass uusseedd ttoo mmeeaassuurree aanndd rreeccoorrdd tthhee ffoolllloowwiinngg ssuurrffaaccee wwaatteerr ssaammppllee ppaarraammeetteerrss iinn tthhee ffiieeldd:: tteemmppeerraattuurree,, ccoonndduuctcitivviittyy,, DDOO,, - pPHH,, OORRPP,, aanndd ttuurrbbiiddiittyy.. BBuuooyy mmaarrkkeerrss wweerree ppllaacceedd aatt tthhee ssaammpplliinngg llooccaattiioonnss,, aanndd aa n hhaanndd--hheelldd GGPPSSuunniittwwaass llaatteerruusesdttooerreeccodorrdd ppoossiittiioonnaall ddaattaa.. - 33..44 DPDERESSOCCGRRRIIAPPTTMIIOONN OOFF TTHHEE MMIISSSSIISSSSIIPPPPII RRIIVVEERR FFIISSHH SSAAMMPPLLIINNGG PROGRAM _ CCoolllleeccttiioonnss ooff ffiisshh wweerree ppeerrffoorrmmeedd iinn tthhee MMisisssiissssiippppii RRiivveerr iinn tthhee vviicciinniittyy ooff CCoottitaaggee GGrroovvee,, MMiinnnneessoottaa uunnddeerr tthhee sscciieennttiiffiicc ccoolllleeccttiioonn ppeerrmmiitt ((SSCCPP)) SSppeecciiaall PPeerrmmiitt NNoo.. 1133003311 _ iissssuueedd bbyy tthhee MMiinnnneessoottaa DDeeppaarrttmmeenntt ooff NNaattuurraall RReessoouurrcceess FFiisshh MMaannaaggeemmeenntt SSeeccttiioonn ooff tthhee DDiivviissiioonn ooff FFiisshh aanndd WWililddiliifee.. PPrriioorr ttoo tthhee ccoolllleeccttiioonn eoffffoorrtt, tthhee AArreeaa FFiisshheerriiecss _ MMaannaaggeerr aanndd tthhee RReeggiioonnaall FFiisshheerriieess MMaannaaggeerr wweerree nnoottiiffiieedd ooff tthhee ppeennddiinngg ssaammpplliinngg aaccttiivviittiieess. NNoo tthhrreeaatteenneedd oorr eennddaannggeerreedd ssppeecciieess wweerree eennccoouunntteerreedd aanndd aalll ccoolllleeccttiioonnss wweerree - ppeerrffoorrmmeedd iinn aaccccoorrddaannccee wwiitthh tthhee SSCCPP ccoonnddititiioonnss.. AA ccoolllleeccttiioonn aaccttiivviittiieess rreeppoorrtt wwaass ssuubbmmiitttteedd ttoo MMDDNNRR oonn JJaannuuaarryy 3300,, 22000066 iinn aaccccoorrddaannccee wwiitthh tthhee rreeqquuiirreemmeennttss ooff tthhee - SSCCPP.. AA ccooppyyoofftthhiiss rreeppoorrtt isspprroovviiddeedd iinn AAppppeennddixiCCx.. FFiisshh ccoolllleeccttiioonnss wweerree ppeerrffoorrmmeedd bbeettwweeeenn AAuuggiusstt ,8, 22000055 aanndd AAuugguusstt 1122,, 22000055 aatt tthhrreeee - rreeaacchheess nneeaarr tthhee 33MM CCoottttaaggee GGrroovvee ffaacciilliittyy.. SSppeecciimmeennss wweerree ccoolllleecctteedd ooff ssmmaallllmmoouutthh bbaassss ((MMiicerroopptteerruuss ddool!oommiieeuu)),, cchhaannnneell ccaattffiisshh ((Ileettaalluurruuss ppuunncettaattuuss)) aanndd bbiluueeggiilll ssuunnffiisshh ((LLeeppoormmiss mmaacerorocheihniirus)s.). WWhhiillee ssuuffffiicciieenntt cchhaannnneell ccaattffiisshh s~ppeeceiimmeennss wweerree ccaappttuurreedd ttoo mmeeeett tthhee nnuummeerriicc ttaarrggeettsoofftthhee FFCC WWoorrkk PPllaann,, ssmmaallllmmoouutthh bbaassss wweerree nnoolt aass aabbuunnddaanntt aanndd tthhoossee ccaappttuurreedd wweerree uusseedd ffoorr ffiilleett tsisusuee ssaammpplleess.. BBlluueeggililll ssuunnffiisshh wweerree mmoorree aabbuunnddaanntt tthhaann ssmmaallllmmoouutthh bbaassssiinn tthhee rreeaacchheess ssaammpplleedd aanndd wweerree ccoolllleecctteedd ttoo aauuggmmeenntt tthhee - ssmmaallllmmoouutthh bbaassss ssaammppleless.. BBlluueeggiillll ssuunnffiisshh wweerree uusseedd iinn lliieuuooffssmmalalllmmoouutthh bbaassss ffoorr tthhee ~ wwhhoollee bbooddyy ssaammpplleess ffrioomm aalll tthhreeee ssaammpplliinngg rreeaacchheess.. WWihlilee tthhee ttaarrggeett ooff$5 ssmmaallllmmoouutthh bbaassss ssaammpplleess wweerree ccoolllleecctteedd ffoorr ffiilleett tiissssuuee aannaallyysseess ffrroomm tthhee uuppssttrreeaamm rreeaacchh ((RReeaacchh 11)),, _ oonnllyy tthhrreeee ssmmaallllmmoouutthh bbaassss ffiilleett ssaammpplleess wweerree ccoolllleecctteedd ffrroomm tthhee ootthheerr ttwwoo ssaammpplliinngg [-- 33-2266 22009955..00005577 I3MMAA0011555511883344 - rreeaacchheess.. AAss aa rreessuulltt,, ttwwoo bblluueeggiillll ssuunnffiisshh ffiilleett ssaammpplleess wweerree ccoolllleecctteedd ffrroomm eeaacchh ooff tthhee ththrreeeessaammplpilinngg rreeaacchheessttooaallllooww ffoorr ccoommppaarriissoonnssooffaannaalylyttiiccaall rreessuullttss.. `SSaammppllee ccoolllleeccttiioonn ggeeaarr iinncclluuddeedd eelleeccttrrooffiisshhiinngg ffoorr ssmmaallllmmoouutthh bbaassss aanndd bblluueeggiillll ssuunnffiisshh - aanndd trroottlliinniinngg ffoorr ccaattffiisshh.. NNoonn--ttaarrggeet ssppecciicess wweerree rleelaesaesedd.. AA ttoottaall ooff 6622 ffiisshh wweerree collected including 11 smallmouth bass, 30 channel catfish and 21 bluegill sunfish. collected including 11 smallmouth bass, 30 channel catfish and 21 bluegill sunfish. - `WWhhoollee bbooddyy oorr ffiilleett ttiissssuuee ssaammpplleess wweerree pprreeppaarreedd ff~roomm tthhee ccoolllleecctteedd ssppeecciimmeennss ffoorr cchheemmiiccaall aannaallyysseess,, pprreesseerrvveedd bbyy ffrreeeezziinngg wwiitthh ddrryy iiccee,, aanndd sshhiippppeedd ttoo tthhee EExxyyggeenn = RReesseeaarrcchh iinn SSttaattee CCoolllleeggee,, PPeennnnssyyllvvaanniiaa ffoorr FFCC aannaallyysseess.. SSaammppllee iiddeennttiiffiiccaattiioonn ccooddeess aarree of the form CGMN-FO1-xxxxxx-050812 with the following conventions for location, of the form CGMN-F01-xxxxxx-050812 with the following conventions for location, - speciesand sample type inthe --xxxxxx- sting: species and sample type in the -xxxxxx- string: - . `FFiirrsstt cchhaarraacctteerr iinnddiiccaatteess tthhee ssaammpplliinngg rreeaacchh ((11,, 33 oorr 55)).. - `MD = smallmouth bass and LM = bluegill sunfish. . SSeeccoonnddaanndd tthhiirrdd cchhaarraacctteerrssiinnddicicaatteetthhee ssppeecciieess wwhheerree IIPP ==cchhaannnneell ccaattffiisshh,, MD = smallmouth bass and LM = bluegill sunfish. - `whole body tissue. . FFoouurrtthh cchhaarraacctteerr iinnddiiccaatteess tthhee ssaammppllee ttyyppee wwhheerree FF == ffiilleett ttiissssuuee aanndd WW == whole body tissue. . LLaasstt cchhaarraacctteerr((ss)) iinnddiiccaattee eeiitthheerr ssaammppllee nnuummbbeerr wwiitthhiinn aa llooccaattiioonn,, ssppeecciieess - aanndd ssaammppllee ttyyppee ((0011 -- 0055)) oorr aa ccoommppoossiittee ssaammppllee ((CC)).. FFoorr eexxaammppllee,, tthhee ssaammppllee ddeessiiggnnaatteedd CCGGMMN-NF-OFI01--33I1PI~WWO40.40-.0-005500881122 iiss tthhee ffoouurrtthh cchhaannnneell - ccaattffiisshh wwhhoollee bbooddyy ttiissssuuee ssaammppllee frroomm RReeaacchh 33 aanndd CCGGMMN-NF-FO011--S5MMDDFCF-C0--0-005500881122 iiss tthhee RReeaacchh 55 ssmmaallllmmoouutthh bbaasss ffilleet ttiissssuuee ccoommppoossiittee ssaammppllee.. FFiigguurree 33--55 sshhoowwss tthhee ccoolllleeccttiioonn llooccaattiioonnss aanndd tthhee ssaammppllee IIDDss.. TTaabbuullaatteedd mmoorrpphhoommetertriicc - ddaattaa oonn tthhee ffiisshh wwhhoollee bbooddyy aanndd ffiilleett ttiissssuuee ssaammpplleess aarree pprroovviiddeedd iinn TTaabblleess 33-55 aanndd 33-66,, rreessppeeccttiivveellyy.. [ET -- 33-2277 22009955..00005588 33MMAA0011555511883355 i gan Hit i I oi PRS i || is 11e 1 bad | | | < if| . Lh g HHH i i TH HITE ME || = | | | 3 | Bails5 3 Te i gi i i[1 |2 :d a oi 3 il ' ssa || HHH Ta iE rH = Hiidiili ul 0 [8 | ow i| EE -------- |" 22009955..00005599 33MMAA0011555511883366 $Bl 28u8c8s5tseecsn3sys BFeeHnBsReEiszceosnsys $$35z8i%i8fzeocnasaqyl 3 3 3 - - reszgsscsy fsnagerasss feassgszass 3 i 5 iitannaaianaaanaan: tasaateaate = %25|8[(35eszecessnssadii2tc% dii25tFensup onss 0 $8R938202RA CENARRYIEINNCCURANESNEL - 2 2255 3||3%2F8 i82f33 t33H 23 - ca2 ||s cfesscesssas| oLEEEaEEssE|-=E5558885555] - 2E[sSa5EarEeaEsCzCeaEsdRaiRiiRiiRiyRditsEeEasCnsEasrasanciiaiiiiFliH iEtaCesCzn:eir-sr7la%icEiiEiiEl] - IEEE EEE Eoo~E ~ iEE IERIEEEE FiiiiziEeis) J7icoi3dscel 3i9i9437add 2o2bZi2i2e2o2e2n2e2|| "ZE2222%i2f3z0ipzei0ze| 3"2228i%328z%zzEzezE 22009955..00006600 33MMAA0011555511883377 - 1fossasre i f1ranks zfssexy| f2 38s%y i - 2 g 2 - f:f3 yaz3emseeessss| SFeomreessn 2 ZFeezzi:eesal 33 Z$3o3zERsEe :3 =- 3 22HsEERPBERRENREYEIEiEcFBERERLEEYRSissERFaRnEEEs RS3~HEcFEERFAEH ~ oa4f [iife iie i1H: iBzE 2Eos 2252 |[i$f5susce:nsasssss| j3hreennyevse|s SjiEensaescess 9j5Pessey g s ~ 2$ E[Es32 EgHd i3 5233 i CE ersisres 2razgee Sevnged oo - : GBi2ieicicicicsisy BEfiioey dgEeic3daalg Hifed DEo8o8i0osigy Clifled spREaR0iaEads Chrnrr g O00000~-- 35535524 35iiss 8033s ssi) $EigEsy gif seid sEifil - 23233893 233273 e322 e233%3 3 - P5e3e7o7p3r3e3s3 "gsRp3r%e7ed s"acgoparsa "Eipieieipc of g2SeiegsegsegiRe:Rsyl [33Z33i33z42i3 ie2io3fk3z3ez2r EzE2iCz2eEg:Tl B 8383888 38333 3333F 8888Y 3 22009955..00006611 33MMAA0011555511883388 55338 388383 i - iegsRsisy| fizagsy ~ iI &3 lsieE i=cF 8 5 - EE IH - 2go33s J[[BEaeEs|, i iz5 A _ stTz i[ssE8g88s ijsracass gEEz He3 = 2E| 55i55g5 a5e5a6i8d8 dHHIN HH ESEES 5 8666685] ESSE 3656668 aizidd aiiiid SEEEEE SEEEEE AL3E3E2R2E3 FER2E2E2R9 Z 3Z 8Z 8Z 88~ 383333 22009955..00006622 53 33MMAA0011555511883399 WE - 4. RREESSUULLTTSS OOFF TTHHEE FFIIEELLDD AASSSSEESSSSMMEENNTT = - 44.41 SSUUMMMMAARRYY OOFF TTHHEE AANNAALLYYTTIICCAALL DDAATTAA RREEDDUUCCTTIIOONN PPRROOCCEESSSS - AAnnaalylyttiiccaall ddaattaa ffoorr FFCCss hhaavvee bbeeeenn rreeppoorrtteedd iinn IInntteerriimm RReeppaorrttss ffrroomm tthhee EExxyyggeenn aanndd tthhee 33MM llaabboorraattoorriieess.. IInn iinnssttaanncceess wwhheerree qquuaalliittyy ccoonnttrrooll ((QQCC)) ddaattaa oonn ssppiikkee oorr ssuurrrrooggaattee ssppiikkee. - rreeccoovveerriieess aassssoocciiaatteedd wwiitthh aa ssaammppllee eexxcceeeedd tthhee 7700 t1o0 112200%% rraannggee ooff aacccceeppttaannccee ffoorr aann aaccccuurraaccyy ooff ++//-- 3300%%,, QQCC ddaattaa wweerree rreevviieewweedd aanndd tthhee aaccccuurraaccyy aasssseesssseedd oonn aa ssaammppllee bbyy - ssaammppllee bbaassiiss ((ii.ce.. ++//-- 4400 %%,, ++//-- 5500%%,, oorr ++//-- 6600%%).). FFoorr ddaattaa oouuttssiiddee aann aasssseesssseedd aaccccuurraaccyy ooff++//-- 6600%% oorr wwhheerree tthhee eennddooggeennoouuss ccoonncceennttrraattiioonnssooff tthhee aannaallyyttee iinn 8a mmeeddiiuumm wweerree oovveerr . three three times times greater greater than than the the highest highest ssppiikkee ccoonncceennttrraattiioonn,, tthhee ddaattaa aarree nnoott rreeppoorrtteedd ((NNR-R).). AAddddititiioonnaall aannaallyyttiiccaall wwoorrkk,, iinncclluuddiinngg mmeetthhoodd ddeevveellooppmmeenntt,, iiss iinn pprrooggrreessss bbyy 33MM iinn aann - aatttteemmpptt t1o0 rreessoollvvee tthheessee QQCC iissssuueess aanndd pprroovviiddee qquuaannttiittaattiivvee rreessuullttss ffoorr tthheessee ssaammpplleess. OOtthheerr ddaattaa rreeppoorrtteedd wwiitthh nnoonn--nnuummereiriccaall vvaalluueess iinncclluuddee rreessuullttss tthhaatt aarree aassssiiggnneedd NNQQ ((nnoott - qquuaannttiiffiieedd)) bbeeccaauussee tthheeyy aarree bbeellooww tthhee LLiimmiitt ooff QQuuaantnitittaattiioonn ((LLOOQQ)) aanndd rreessuullttss tthhaatt aarree aassssiiggnneedd NNDD ((nnoott ddeetteecctteedd)) bbeeccaauussee tthhee aannaallyyttee wwaass nnoott ddeetteecctteedd aattoorr aabboovvee tthhee LLiimmiitt ooff - DDeetteeccttiioonn ((LLOODD).). = IInn aaddddiittiioonn ttoo eeaacchh pprriimmaarryy ssaammppllee aannaallyyssiiss,, aa rreepplliiccaattee ssaammppllee aannaallyyssiiss wwaass ppeerrffoorrmmeedd.. IInn aaqquueeoouuss mmeeddiiaa, aa ffiieelldd dduupplliiccaattee ssaammppllee aannaallyyssiiss wwaass aallssoo ppeerrffoorrmmeedd iinn aaddddiittiioonn t(o0 tthhee _ pprriimmaarryy aanndd rreepplliiccaattee aannaallyysseess ffoorr ceaacchh ssaammppllee.. TThhee pprriimmaarryy,, rreepplliiccaattee aanndd,, wwhheerree available, duplicate results were reduced to a single value in order to simplify reporting. available, duplicate results were reduced to a single value in order to simplify reporting. _ "TThhee ddaattaa rreedduuccttiioonn pprroocceessss ccoonnssiisstteedd ooff ccaallccuullaattiinngg tthhee aavveerraaggee ccoonncceennttrraattiioonn ((aarriitthhmmeetiticc: mmeeaann)) ffoorr sseettss ccoommpprriisseeddooff nnuummeerriicc vvaalluueess.. IInn iinnssttaanncceess wwiitthh mmiixxeedd nnuummeerriicc vvaalluueess aanndd - nnoonn--nnuummeerriicc vvaalluueess ((NNDD oorr NNQQ)),, tthhee nnuummeerriic vvaalluueess wweerree ccaarrrriieedd tthhrroouugghh ttoo rreepprreesseennt.t themedia concentrations. For those limited seis composedofND and NQ values, the NQ the media concentrations. For those limited sets composed of ND and NQ values, the NQ - vVaalluueess wweerree ccaarrrriieedd tthhrroouugghh ttoo rreepprreesseenntt tthheemmeeddiiaacocnocnecnetnrtartaitioonnss.. IItt sshhoouulldd bbee nnootteedd tthhaatt tthhee ddaattaa rreedduuccttiioonn ccoonnvveennttiioonn ddeessccrriibbeedd aabboovvee iiss ccoonnsseerrvvaattiivvee aanndd mmaayy rreessuulltt iinn - oovveerreessttiimmaattiioonnooffaaccttuuaall ccoonncceennttrraattiioonnss. cramsamemppets aan a1 E:\FCLDERS.0-9,3rn.~o~lage grove~F Oa~a P~sessmenl Rsport~Flna~ dOC 4-1 22009955..00006633 33MMAA0011555511884400 44..22 GGRROOUUNNDDWWAATTEERR ~ 44..22..1i GGrroouunnddwwaatteerr EElleevvaattiioonnss As summarized in Subsection 2.5, groundwater elevation data collected 2t the 3M As summarized in Subsection 2.5, groundwater elevation data collected at the 3M - Cottage Grove facility in March of 2005 (Figure 2-5) indicate a southerly groundwater Cottage Grove facility in March of 2005 (Figure 2-5) indicate a southerly groundwater ggrraaddiieenntt ttoowwaarrdd tthhee M Misisssiissssiippppii RRiivveerr ~frroomm tthhee 33MM pprrooppeerrttyy.. PPuummppiinnggoofftthhee pprroodduuccttiioonn - wweelllls iinnfflluueenncceess wwaatteerr lleevveellss mmsostt ssiiggnniiffiiccaannttllyy iinn tthhee cceennttrraall ppaarttoofftthhee ppllaanntt aarreeaa aanndd iiss rreedduucceedd wwiitthh iinnccrreeaassiinngg ddiissttaanncceess frroomm tthhiiss aarreeaa.. TIhhee eexxtteenntt ooff ppuummppiinngg iinnfflluueennccee,, aass iinnddiiccaatteedd bbyy ddrraawwddoowwnn iinn mmoonniittoorriinngg wweellsls,, iiss -- rreepprreesseenntteedd oonn ccrroossss sseeccttiioonn BB--BB"' ((FFiigguurree 44--11).). TThhee ccrroossss sseeccttiioonn iiss ddrraawwnn iinn aann eeaasstt-- west diretion along the Mississippi River (Figure 4-2). As indicated on Figure 4-1, a - wdeepsrtesdsiireocntiionnthaelownagtetrheabMleisissisaspippparieRntivienr t(Fhigaurereao4f-2th)e. pAusmpinidnigcawteeldlsonPWF-ig5uraend4-P1W, -a depression in the water table is apparent in the area of the pumping wells PW-5 and PW- 66 aanndd eexxtteennddss iinn aann eeaassttwwaarrdd ddiirreeccttiioonn 0to MMWW-1-166.. BBeeyyoonndd M MWW--1166 iinn aann eeaasstteerrllyy - ddiirreeccttiioonn,, tthhee ddrraawwddoowwnn iinnfflluueennccee dduuee ttoo ppuummppiinngg iiss nnoott ccoonnffiirrmmeedd.. - 44..22..22 SSuummmmaarryy ooff AAnnaalylyttiiccaall DDaattaa T"Thhee ggrroouunnddwwaatteerr aannaallyyttiiccaall ddaattaa ffoor tthhee CCoottttaaggee GGrroovvee ffaacciilliittyy wweelllss aarree ssuummmmarariizzeedd iinn . TTaabbllee 44--11.. FFiigguurreess 44-22 aanndd 44--33 ddeeppiicctt PPFFOOAA aanndd PPFFOOSS ggrroouunnddwwaatteerr ccoonncceenntrtraattiioonnss,, respectively, adjacent to the wells in which they were detected. A copy of the respectively, adjacent to the wells in which they were detected. A copy of the `ggrroouunnddwwaatteerr aannaallyyttiiccaall ddaattaa ppaacckkaaggee ((wwiitthhoouutt aappppeennddiicceess)) iiss pprroovviiddeedd iinn AAppppeennddiixx DD.. - tItiiss iimmppoorrttaanntt ttoo nnoottee tthhaat,, aass aapppprroovveeddbbyytthhee M MPPCCAA,, aaccooppyy ooff aalllloofftthhee aannaallyyttiiccaall ddaattaa ppaacckkaaggeess ((ffoorr ssaammpplleess ccoollllecctteedd uunnddeerr hsthis ddaattaa aasssseessssmmeenntt pprrooggrraamm)) hhaavvee bbeeeenn pprroovviiddeedd - iinn AAppppeennddiixx DD wwiitthhoouutt tthheeiirr aappppeennddiicceess dduuce ttoo tthheeiirr llaarrggee ssiizzee aanndd ttoo ffaacciilliittaattee ppaappeerr rreedduuccttiioonn.. TThhee ddaattea ppaacckkaaggeess iinncclluuddiinngg aappppeennddiicceess warree oonn ffiillee wwiitthh W WEESSTTOONN aanndd ccaann bbee - pprroovviiddeedd uuppoonn request. request. -- DDuuee ttoo tthhee QQCC iissssuueess aass ddiissccuusssseedd iinn SSeeccttiioonn 44..11,, tthhee aannaallyyttiiccaall rreessuullttss ffoorr PPFFBBSS,, PPFFHHSS aanndd PPFFOOAA aarree NNRR ffoorr tthhee ggrroouunnddwwaatteerr ssaammppllee ffrroomm wweellll MMWW-1-919.. AAddddititiioonnaall aannaallyyttiiccaall - wwoorrkk iiss bbeeiinngg ppeerrffoorrmmeedd iinn aann eeffffoorrtt ttoo pprroovviiddee qquuaanntitittaattiivvee aannaallyyttiiccaall rreessuullttss ffoorr tthhee M MWW--1199 ssaammppllee aanndd,, iiff ssuuccccesessfuslf, wuwilli,lll bbee rreeppoorrtteedd wwhheenn aavvaaiillaabbllee.. J-- E:\FOLDERS 0-9~3rn-cottage orove~FC Data Asse~menl Reporl~Final d0c 44-22 22009955..00006644 33MMAA0011555511884411 ah _ J _& |af - s Jf TEH$iHd i E i1s|it . : w(aEnReI EE3 Bk | 8pr _ { ge | 82 - i 3 _ 2 \ i2 g 2 _ | _ : i3 . i \ - - | ~ i] [JI JCR ii I - (FEEREIRERiRsERiEisiEcii 44-33 22009955..00006655 33MMAA00115555118842 i LE Syi [aE | [1 wSeo a. g I n jell -_ 5 bs |: Il TRE i NN I Him | SlBt HE Th Ea mL I] pm ad by I aE d,m Ne a i-- ERG Np I a Ene A a. | Se Sma a Ca ee Ij Ro) PEL I TT SS ga. : | i 1| 1 Lg te % = aiSs 5 <4]Ci rp.i I a" | | | I |. rn I 8 osava ET 5 a rniciare eis Fee~ rans | MccrooTsTssAGEeGRcOsVtaEyMLiNocPoaAtCinIoTnY | 22009955..00006666 33MMAA001155551188443 - _ WpE_"R Table 4-1 rN Summary of FC Concentrations. in Cottage Grove Groundwater Samples - March and May 2005 TEE HE Well ID PFBS Average PFHS Average PFOS Average PFOA Average (ppb, ug,!,L,) (ppb, ug/L) (ppb, ug/L) (ppb, uglL) -- [BEES MW-1 0.076 0.058 0.686 1.14 - MWM-W2-2 00..005500 00..005833 NNOD 11.6677 Loz MW-3 0.394 0.352 0.199 8.24 - MWMW--44 1155.44 22.1133 00..116688 99..8833 : orm MW-5 NQ NQ O. 150 0,749 Zorn MW-7 0.051 ND 0.129 0,282 : Zink MW-8 0.0567 0.171 0,549 0.882 nooo MW-9 0.129 0.358 0.266 0,963 = MMWW--1100 1166.55 00..3388,66 22.1155 22.2222 LoTETE MW-11 13.0 1.96 11.1 70.7 - MWM-W1-122 118800 a438.8 119988 11886633 : moron MW-13 1.45 1.87 16.5 19.0 monn MW-14 603 29.6 79.;~ 957 : moron MW-15 1.94 0.537 11.7 6.48 moni MW-16 13.4 1.83 33.8 21.5 = MMWW--1177 00..440022 00..448877 00..660077 11..8800 moro MW-18 0.354 0.980 0.877 2.57 - MMWW--1139 NNRR NNRR 00..00559977 NNRR nmmw oonrnomnia MW-101 26.8 1583 324 150 MW-102 38.5 87.6 49.8 163 PZ-14 0.372 0.518 0.566 2.38 4-5 22009955..00006677 3MMAA00115555118844 - Table 4-1 `SSu`umGmrmmoaaurnryydwooafftFFeCrCSCCaoomnnpcTlceaeenbnstlt-reraaM4tt-tai1oornncsshIInnanCCdoottMttaaaggyee2GG0rr0oo5vvee. Groundwater Samples - March and May 2005 = [poeoans)T prs[ooApvtarr5oosge3||oAo1pvroovs)onoe|) Well ID PFBS Average (ppb, ug/L) PFHS Average (ppb, ug/L) PFOS Average (ppb, ug/L) PFOA Average (ppb, ug/L) wt ome omer oa am PW-1 0.524 0.167 0.462 3.34 - nz ous oz ome ao PW-2 na Na wm ose PW-3 0.248 NQ 0.172 ND 0.662 ND 4.01 0.592 Pra PW-4 ome ow 0.118 0.157 wim ND 1.22 _ pws 22 1s am me PW-5 2.22 1.88 4.33 14.6 ws wo am me 1s PW-6 - wr WN moa PW-7 ws Na Nw osm PW-8 = brCuem N00 0 wo B116 (Cafeteria) 47.9 ND NQ ND 4.76 ND ND ND 32.9 ND ND ND 155 0.317 0.613 ND - NO =Noel atctv 02255. ND = Not detected at or above 0.025 ag/L. NG = Notuna eased concernbtvsen 0.025 ol. NQ = Not quantifiable = Measured concentration between 0.025 ug/L nd a Lit of unset (OC)wh 0050. and the Limit of Quantitation (LOQ), which is 0.050 ugfL. 3 Nabe ct orsoDavr contsions NQ value is not factored into the average concentrations. NR = Notaorto coutoconre ssei NR = Not reported due to quality control issues. as 22009955..00006688 33MMAA0011555511884455 EE an ar cmEEE | AH : . 5 ml a LIARR S || Lo sdef ll Nl i|l) Ea (PE Ei ON he i| ! i ol A i di I {iti 177 saciid ' 3MMAA0011555511884466 22009955..00006699 tPr sZ4% rvan 1, Ailsy ; [ , LE SIA & || | al BE. i { mpBBEpo.Em EL a i IE A | > aGNadi TlJil | | ER i J | | | | H, HH o| u lal " |h-i-ii8 22009955..00007700 33MMAA0011555511884477 - presen] _ Ittiiss iimmppoorrttaanntt tto nnoottee tthhaatt FFCCss wweerree nnoott ddeetteecctteedd iinn tthhee wwaatteerr ssaammpplleess ccoolllleecctteedd ffrroomm tthhee wwaatteerr ffaauucceett iinn tthhee BBuuiillddiinngg 111166 ccaaffeetteerriiaa.. W Waatteerr ffrroomm tthhiiss ffaauucceett hhaass bbeeeenn pprree--ttrreeaatteedd _ wwiitthhaa ggrraannuullaarr aaccttiivvaatteedd ccaarrbboonn ssyysstteemm ffoorr rreemmoovvaallooffFFCCss.. TThhee rreemmaaiinniinngg aannaallyyitiiccaall ddaattaa iinnddiiccaattee tthhaatt FFCCss hhaavvee bbeeeenn ddeetteecctteedd iinn ggrroouunnddwwaatteerr - pprriimmaarriillyy aatt aanndd nneeaarr aarreeaass wwhheerree hhiissttoorriicc ddiissppoossaall hhaadd ooccccuurrrreedd ((ii.e,., DDS5 ~- tthhee FFoorrmmeerr SoSloiliddssBBuumrn PPiitt AArreeaa,, DDS8 -- aa FFoorrmmeerr WWaassttee DDiissppoossaall AArreeaa,, aanndd DDI1 - tthhee FFoorrmmeerrHHFF TTaarr - NNeeuutrtraalliizzaattiioonn PPiitt)) wwiitthh mmuucchh lloowweerr ccoonncceennttrraattiioonnss ddeetteecctteedd wwiitthh iinnccrreeaassiinngg ddiissttaannccee ffrroomm tthhee ddiissppoossaall aarreeaass.. TThhee hhiigghheesstt ttoottaall ccoonncceennttrraattiioonn ooff FFCCss wwaass ddeetteecctteedd iinn tthhee - ggrroouunnddwwaatteerr ssaammpplleeffrroommmmonointiotorriinngg wweellll MMWW-1-122,, wwhhiicchh iiss llooccaatteedd ddoowwnnggrraaddiieennttofoftthhee wweesstteermn ppoorrttiioonn ooff DDS5 -- tthhee FFoorrmmeerr SSoolliiddss BBuumm PPiitt AArrceaa.. TThhee aavveerraaggee PPFFOOAA - ccoonncceennttrraattiioonn wwaass 11,,886633 gpg//LL ((ppppbb))aannddtthhee aavveerraaggee PPFFOOSS ccoonncceennttrraattiioonn wwaass 119988 ppppbb.. - `WWeellllss MMYWW--1144 aanndd PPWW--G6 aarree llooccaatteedd ddoowwnnggrraaddiiecnntooffDD88 -- FFoorrmmeerr WWaassttee DDiissppoossaall AArrceaa. AAtt mmoonnititoorriinngg wweellll MMWW--1144 aanndd pprroodduuccttiioonn wweellll PPWW-.6, tthhee aavveerraaggee PPFFOOAA ccoonncceennttrraattiioonnss - ddeetteecctteedd iinn ggrroouunnddwwaatteerr wweerree 996677 aanndd 115555 ppppbb,, rreessppeeccttiivveellyy,, aanndd tthhee aavveerraaggee PPFFOOSS ccoonncceennttrraattiioonnss wweerree 7799..33 aanndd 3322.99 ppppbb,, rreessppeeccttiivveellyy.. TThhee hhiigghheesstt ssiittee--wwiiddee aavveerraaggee B PDFEBBSS ccoonncceennttrraattiioonn ((660033 ppppbb))iinn ggrroouunnddwwaatteerr ssaammpplleess wwaass ddeetteecctteedd aatt MMWW-1-41,4. ~ MMoonintitoorriinngg wweellllss MMWW-1-10011 aanndd MMWW--110022 aarre llooccaatteedd oonn tthhe ssoouutthh aanndd nnoorrtthh ssiiddeeooffDD11 -- FFoorrmmeerr HHFF TTaarr NNeeuuttrraalliizzaattiioonn PPiit, rreessppeeccttiivveellyy.. AAtt mmoonniittoorriinngg wweellllss MMWW-1-10011 aanndd MMWW-- - 110022,, tthhee aavveerraaggee PPFFOOAA ccoenncceennttrraattiioonnss ddeetteecctteedd iinn ggrroouunnddwwaatteerr wweerree 115500 aanndd 116633 ppppbb,, rreessppeeccttiivveellyy,, aanndd tthhee aavveerraaggee PPFFOOSS ccoonncceennttrraattiioonnss wweerree 332244 aanndd 4499..88 ppppbb,, rreessppeeccttiivveellyy. = TThhee PPFFOOSS ccoonncceennttrraattiioonn aatt MMWW-1-10011 wwaass tthhee hhiigghheesstt ssiittee--wwiiddee aavveerraaggee PPFFOOSS ccoonncceennttrraattiioonn ddeetteecctteedd iinn aalll tthhee ggrroouunnddwwaatteerr ssaammppleless.. AAllssoo,, tthhee hhiigghheesstt ssiittee--wwiiddee - aavveerraaggee PPFFHHSS ccoonncceennttrraattiioonn ((11,,558833 ppppbb))iinn ggrroouunnddwwaatteerr ssaammpplleess wwaass ddeetteecctteedd aatt MMWW-- 110011, . 44.22..33 LLOOII WWeellllss -- GGrroouunnddwwaatteerr AAnnaalylyttiiccaall DDaattaa - The groundwater analytical data collected under the LOI program generally was The groundwater analytical data collected under the LOI program generally was consistent with theFC concentrations detected inthe groundwater samples collected from consistent with the FC concentrations detected in the groundwater samples collected from - tthhee ssaammee llooccaattiioonnss,, ii..e..., M MWW-4-4,, M MWW-7-7,, MMWW-1-10011,, PPZZ--1144,, aanndd BBllddgg.. 111166 ttaapp ((ccaaffeetteerriiaa)),, iinn M Maarrcchh aanndd MMaayy 22000055 FFCC aasssseessssmmeenntt.. AA ssuummmmaarryyoofftthhee LLOOTI aannaallyyttiiccaall ddaattaa rreessuullttss ffrroomm - samples samples collected collected from from June June 22000033ttoo JJuunnee 220010355 iiss pprroovviiddeedd iinn TTaabbllee 44--22.. IItt iiss F-- a9 22009955..00007711 I3MMAA0011555511884488 TTaabbllee 44:-22 SSuum mmmaarryy ooff LLOOII AAnnaallyyttiiccaall DDaattaa -- JJuunnee 22000033 tthhrroouugghh JJuunnee 22000055 |LLooccaattiioonn [PrTPvoFeOrsaSgAAe|| APvPreFreBaSsge||PAvPeeFrHasSge|PrPFoOsS |PAvPreFroOaAAge| Date ppb, ug/L)| Average (ppb, ug/L) (ppb, uglL)| Average (ppb, uglL) po, ug'L| Average (ppb, ug/L) (ppb, uglL)| Average (ppb, ug/L) ppb. uglL) Average (ppb, ug/L) JJnMawWw-a-s4 - IJnMMnwW W-s--444 JMaWwa-4 MW-4 02e61!s50/o03s3 nNNDDD 255.555117 727.313115 o55a.00r00s 811090.922 12s50//9i120g91//4n00]a34 NNNNDDDD 2777.85.4417 2552..54759859 0333,9.49473335 8.99 1N6A716.7 69/2219/0054 NNDa 73.2617 222.48 031.9332 oNsA 6/21/05 NA 3.27 2.2 0,132 9.87 - [MwwWw-r-77 - MW-7 wwerr MW-7 wr MW-7 MW-7 02661/550/00333 NNNDDD 1so50z//o12a91nn//s00e3|4 NNNNDDDD 29/1209/s0]4 NNDA 6/21/05 NA NNNoDD nNNoDD NNNDDD 000.333311044 NNNNDDDD NNNNDDoO NNNNDQaD 0,330 oNeAr 0,367 NNDD. ND NOND ND NDND ND 0212NA 0,242 - MavwwW..-111000111 - IIvMMwwW W---111100001111 MIwW.-110011 MW-101 106625/1500/303)3] NNNDDD 111996.343 s11a12s2s3 221222440 111353866 105so1/1z12o1990t/0e00s]34 NNNNDDDD 16.4 2a8923.8 98983389885 215118283808 221N353A36 e205 9/29/04 6121/05 NaND NA 20242.9 20.2 1410999 1410 235253 235 148NA 146 ~ lpp3zzZ11-1444 lpPP=zzZZ1-1-114044 = lp3zZ1-144 PZ-14 10e62/s51o/00s33 NNwDDo 1as50z//o12i91oo//s00s]43 NNNNDDDO 62105] 9/29/04 6/21/05 naND NA 111.200822 111.7887s5 0oo.6ss7se6 444.08s18 1121.656.2001855 1.77 115851.53 0000..88887272362 4.06 4N7A84.76 022.51 0.236 oa 1.55 0.414 osts 0.873 0.514 170NA 1.70 - [[DoDiiisssttrrirbbbuuutttiiiooonnn LLLooooooppp SSSeeammmpplplelee: | 106e2/s51/o00s33 o0.N0o5G2m5 0116.771006 0114.88422s 929,434404 226774.939 [[DDDDiiiissssttttrrrriibbiibbuuuuttttiiiioooonnnn LLLLoooooooopppp SSSSaaaammmmpppplllleeee || 1ss50/r//1122o091ii1/0000a434|| 00.0N06N6Q3Q322 0011.26.66013356 0111.4.08848554 2737..19312502 6.43 2nsN23.5 - lei. 116 Tep Distribution Loop Bldg. 116 Tap Sample e105] 9/29/04 6/21/05 NANQ NA ND0.205 ND ND1.08 ND ND.3.95 ND NDNA ND Source: LOIanalyticaldota wasobtainedfom3M and summarizeind tis table. Source: LOI analytical data was obtained from 3M and summarized in this table. = PFOSA= Petucrccanssonamide PFOSA = Perfluorooctanesulfonamide 0 ocatt orshoe ve0.02t 5 uo. ND = Not detected at or above 0.025 ug/L. 0 =ocua =Masur concent btwn 025UL 30 NQ = Not quantifiable = Measured concentration is between 0.025 ug/L and the = Limtol uantston OQ), which D050UGA. NQvi fs otfckriedho Limit of Quantitation (LOQ), which is 0.050 ug/L. NQ value is not factored into the sero concansains. average concentrations. N=Notanafeor hsscompeuns. NA = Not analyzed for this compound, EOLOERS0.9mioge FoWIFG Ova Assosment Reger E:\FOLDERS.0-9\3m-cottage grove\FC Data Assessment Repod\ T2oL0k03 42 +10 Tbl4_2_LOIData.xls, 4-2 22009955..00007722 33MMAA0011555511884499 - WE _ iimmppoorrttaanntt ttoo nnoottee tthhaatt tthhee LLOOII ""ddiissttrriibbuuttiioonn lloooopp"" ssaammpplleess,, wwhhiicchh aaree wwaatteerr ssaummpplleess ccoolllleecctteedd aatt BBllddgg.. 111166 ffrroomm JJuunnee 22000033 ttoo SSeepptteemmbbeerr 22000044,, iinnddiiccaatte tthhee pprreesseennccee ooff FFCCss.. - DDuurriinngg tthiiss tiimmee ppeerriioodd,, bbootttlleedd wwaatteerr wwaass ssuupppplliieedd ttoo BBllddgg.. 111166 ffoorr ddrriinnkkiinngg.. NNoo FFCCss wweerree ddeetteecctteedd iinn tthhee LLOOTI ssaammppllee ccoolllleecctteedd ffrroomm tthhee BBllddgg.. 111166 ttapp iinn JJuunnee 22000055.. TThhiiss iiss - ccoonnssiisstteenntt wwiitthh tthhee MMaarrcchh 22000055 FFCC aasssseessssmmeenntt rreessuullttss aanndd rreefflleeccttss tthhee ffaacctt tthhaatt aa GGAACC uunnitt hhaadd bbeeeenn iinnssttaalllleedd aatt BBllddgg.. 11166 ((ccaaffeetteerriiaa)) ttoo rreemmoovvee FFCCssffrroommtthhee wwaatteerr pprrioirottroo uussee.. 44..22.44 WWooooddbbuurryy SSiittee - "The The March, March, April, April, and and May May 22000055 ggrroouunnddwwaatteerr aannaallyyttiiccaall ddaattaa ffoorr tthhee WWooooddbbuurryy SSiittee ppuummppiinngg wweellllss aanndd ccoommbbiinneedd ddiisscchhaarrggee,, aass wweellllaas tthhee ddiisscchhaarrggee ffrroomm tthhee nnoonn--ccoonnttaacctt - pprroocceessss wwaatteerr rreetteennttiioonn ppoonndd aatt tthhee CCooltttaaggee GGrroovvee ffaacciilliittyy,, aarree ssuummmmarariizzeedd iinn TTaabbllee 44--33.. .FFiigguurreess 44--55 aanndd 44~-66 ddeeppiicctt PPFFOOAA aanndd PPFFOOSS ggrroouunnddwwaatteerr ccoonncceenntrtraattiioonnss,, rreessppeeccttiivveellyy,, - aaddjjaacceenntt ttoo tthhee wweellllss iinn wwhhiicchh tthheeyy wweerree ddeetteecctteedd.. AA ccooppyy ooff tthhee ggrroouunnddwwaatteerr aanndd ccoommbbiinneedd nnoonn--ccoonnttaacctt ccoooolliinngg wwaatteerr aannaallyyttiiccaall ddaattaa ppaacckkaaggee ((wwiitthhoouutt aappppeennddiicceess)) iiss - pprroovviiddeedd iinn AAppppeennddiixx DD.. _ TThhee ddaattaa iinnddiiccaattee tthhaatt ffoorr tthhee FFCCss aannaallyyzzeedd,, PPFFHHSS aanndd PPFFBBSS wweerree pprreesseenntt aalt hhiigghheerr ccoonncceennttrraattiioonnss iinn tthhee wwaatteerr ssaammpplleess wwiitthh lloowweerr ccoonncceennttraattiioonnss ooff PPFFOOAA aanndd PPFFOOSS _ ddeetteecctteedd.. TThhee ddeetteecctteedd aavveerraaggee PPFFHHSS ccoonncceennttrraattiioonnss rraannggeedd ffrroomm 11..0033 ttoo 2233..33 ppppbb aanndd tthhee ddeetteecctteedd aavveerraaggee PPFFBBSS ccoonncceennttrraattiioonnss rraannggeedd ffrroomm 00..333377 ttoo 1111 ppppbb.. TThhee ddeetteecctteedd - aavveerraaggee PPFFOOAA ccoonncceennttrraattiioonnss rraannggeedd ffrroomm 00..115533 t(o0 33..1122 ppppbb aanndd tthhee ddeetteecctteedd aavveerraaggee PPFFOOSS ccoonncceennttrraattiioonnss rraannggeedd ffrroomm 00..00556622 ttoo 22..2299 ppppbb.. TThhee wwaatteerr ssaemmpplleess ccoonnttaianiinngitthnhege - hhiigghheesstt ccoonncceennttrraattiioonnss ooff FFCCss wweerree ccoolllleecctteedd ffrroomm W Wooooddbbuurryy SSiitteeppuummppiinnggwwelelll RRd4.. IIttiiss iimmppoorrttaanntt 0to nnoottee tthhaatt nnoo FFCCss wweerree ddeetteecctteedd iinn aannyy ssaammpplliinngg rroouunndd iinn ggrroouunnddvwaatteerr - ssaammpplleess ccoolllleecctteedd ffrroomm W Wooooddbbuurryy SSiittee ppuummppiinngg wweellll RR22.. FFiinnaallllyy,, FFCC ccoonncceennttrraattiioonnss iin tthhee ccoommbbiinneedd ddiisscchhaarrggee ffrroomm tthhee W Wooooddbbuurryy SSiittee ppuummppiinngg - wells were consistent with concentrations in the discharge from the non-contact process a w`wealtlse wreetreentcioonnspiostnedntatwtihteh concentrations Cottage Grove in the discharge from the non-contact facifloirtalyl tree sampling rounds. process water retention pond at the Cottage Grove facility for all three sampling rounds. mms emer +1 4-11 22009955..00007733 I3MMAA0011555511885500 - `Summary of FCs in Woodbury Site GrTToaaubbnlldeew44a-33ter Samples - March, April, May 2005 Summary of FCs in Woodbury Site Groundwater Samples - March, April, May 2005 -- SaRmopulnidn_g| (pb pob. ug) (pb. ug) (ppb. uo Well ID Sampling Round PFBS Average (ppb, ug/L) PFHS Average (ppb, ug/L) PFOS Average {ppb, ug/L) PFOA Average (ppb, ug/L) R1 1 sar 261 oes 232 1 3.47 2.61 0,069 2.32 = R1 2 2 10 245 002 23 1.90 2.45 0,062 2.33 R1 3 3 181.83 231 oo 22s 2.31 0.0562 2,26 R2 11 NNN ND ND ND ND ND R2 2 NNN ND 2 ND ND ND ND _ R2 33 NnwD NN ND ND NNDD RrR3 I 1 oa 0.478 1m1.17 ome 0,109 01s 0.153 RRe3 22 ows 120 om4 016 0.366 1.20 0.144 0.186 - RRs3 3 om 0.337 11.0033 0o.o09m4s5 01s 0.159 - R4 1 1 no11.0 1199.77 22.2299 22.8822 R4 22 66.22a4 0420.4 220 2.20 312 3.12 = R4 33 55.7722 2323.3 1m1.83 2m2.78 ~ own CWM 1 1 8s6.09 1100.33 11.2233 1%1.96 oCwWnM 22 77.2286 ms11.6 121.20 212.18 own CWM 3 351 103 ost 189 3 3.51 10.3 0.916 1.99 - wCWoD 1 1 se5.62 s8.a4r7 1m1.34 33.18 _ wo 2 7a es 12m 261 CWD 2 7,34 9.61 1.28 2.61 oCWwpD 3 40 Tr 13 32 3 3.40 7.76 1.38 3,22 RNN1DD===RocNNoootvtdadretyeevcotleltdaatoeorr aacbboovveet00..00e2255uudgg/L. - (RC1M=MR=eCcoomvbeirynwedelldischarge om Woodbury pumping wells ``SCCaCW WmWpMDDli===nNgNCooonRnmco-oubcnnointdnea:tdac1c-dtcics1ooc4l1oh0lani5nrg,gg2e-wwfa4ratotemer6r W ddii1soscc0hh0daabrrug5gree5yf1r,rpoo2ummm035prreitntaegnnwttiooennllsppoonndd at at Cotage Cottage Grove Grove Sampling Round: 1 - 3/14/05, 2- 4/5/05, 3 - 5t12105 - an 4-12 22009955..00007744 33MMAA0011555511885511 - ed) o -- EE E TorN en {4A T mrdomne{r Combined Discharge Ifrom Woodbury) (ppb) I 1 - 1.96 2-2.18 | 3 - 1.99 Retention Pond Discharge (at Cottage Grove) (ppb) 1 -3.18 2-2.61 3 - 3.22 Northeast ,~ Disposal ~ ~ l Area /" 1 Ir ob - iy 231-l32a3%32 / PEAIn, W, h\\ - A i [I osIN eC) - 3 rmR3.oo(ppomb)n|| [[mreeeu|| = I1ro8me,d=7n702 \ Cam liom]| - 0.153 2 - 0.186 | a 1 rT AE Municipal J I==5 3 - 0,159 3 / 0" - 3 I] 2oo| i R2 (ppb) - ire I i] [wee I _ A J peltk| ~ LEGEND 6~PPuumpmingpWWeelilll LLonoccaatgtiioonn ampere i 0 200 500 ~ Scale in Feet ~ - y - L [Fa|merscmoutro R4 (ppb) a rom th 09 aoPrONCorns I - 2.82 13| boro henprokCoser 2- 3.12 5370|I neron a POR Cri 3 I 2.78 | Pumping Welt ID Round 1 (March 2005) Average PFOA Concentratior Round 2 (April 2005) Average PFOA Concentration Round 3 (May 2005) Average PFOA Concentration ppb = ug/L 05P-Og15-4 Foun +5 FIGURE 4-5 - AVERAGE PFOA DETECTED IN GROUNDWATER - MARCH, APRIL,MAY 2005 AVERAGE PFOA DETECTED IN GROUNDWATER - MARCH, APRIL, MAY 2005 WOODBURY Se WOODBURY SITE +134-13 22009955..00007755 33MMAA0011555511885522 - bi d) mo - pr _ neten3rond | {aA | .S Combined Discharge domes oth|| weotistimmom| {~" (from Woodbury) (ppb) = Tim Ta 1 - 1.23 `a 22 .- 11.230 Hr oi 3 - 0.92 Retention Pond Discharge (at Cottage Grove) (ppb) 21 .- 11.2384 2 - 1.28 3- 1.38 1//~Noorrtiheeanstt Disposal Area i [fiom| ~~ - b 321.-000.00086m89 7 EEAmfN \\ - a Ir 1 o. MN o \ - Si mG| PrRBaEEmaT er EE] 2-014 [| Ct { - Municipal - L --s & 5" - H 3 [W ] = 4 9 LThEo p= R2 (ppb) i 1 ~ND | 2-ND I I3." I LEGEND - I meat ~)PPuumpmingpWWeleilll LLonoccaatitgioonn 0=a 200 500 I~ '1" - i - L Scale in Feet -'I- [Fam| nevi o | R4 (ppb) | ee Ave prn os cont 1 - 2.29 35%| Fz 2 wa p08Coan 2 - 2.20 558| n =a 20a 09Avra 10i 3 Corral 3 - 1.83 Pumping Well ID Round 1 (March 2005) Average PFOS Concentration Round 2 (April 2005) Average PFOS Concentration Round 3 (May, 2005) Average PFOS Concentration ppb = ug/L as 05P-0915-3 FFIIGGUURREE44--66. - AVERAGE PFOS DETECTED IN GROUNDWATER ~ ARCH, APRIL, MAY 2005 AVERAGE PFOS DETECTED IN GROUNDWATER - MARCH, APRIL, MAY 2005 WOODBURYSITE WOODBURY SITE on4-14 22009955..00007766 33MMAAO011555511885533 - 44.33 SsOoIL TThhee aannaallyyttiiccaall rreeSsuultss ddaattaa ffoorr tthhee CCoottttaaggee GGrroovvee ssooill ssaammpplleess aarree ssuummmmarariizzeedd iinn TTaabblleess 44--44,, 44--55,, aanndd 44--66 wwhhiicchh ccoonnttaaiinn tthhee FFCC,, TTOOCC,, aanndd ssiieevvee ggrraaiinn ssiizzee ddiissttrriibbuuttiioonn ddaattaa,, rreessppeeccttiivveellyy.. FFiigguurreess 44-77 aanndd 44--83 ddeeppiicctt PPFFOOAA aanndd PPFFOOSS ssooiill ccoonncceenntrtraattiioonnss,, rreessppeeccttiivveellyy.. AA ccooppyyoofftthhee ggrroouunnddwwaatteerr aannaallyyttiiccaall ddaattaa ppaacckkaaggee ((wwiitthhoouutt aappppeennddiicceess)) iiss _ pprroovviiddeedd iinn AAppppeennddiixx DD.. DDuuce ttoo qquuaalliittyy ccoonnttrrooll iissssuueess ddiissccuusssseedd iinn SSeeccttiioonn 44..11,, qquuaannttiittaattiivvee rreessuulltss ffoorr cceerrttaaiinn = ssaammpplleess ccoouulldd nnoott bbee rreeppoorrtteedd aanndd aarree ffllaaggggeedd NNRR iinn tthhee ttaabblleess aanndd ffiigguurreess.. AAddddititiioonnaall aannaallyyttiiccaall wwoorrkk iiss bbeeiinngg ppeerrffoorrmmeedd bbyy 33MM iinn aann eeffffoorrtt ttoo pprroovviiddee qquuaannttiittaattiivvee aannaallyyttiiccaall - rreessuullttss ffoorr tthheessee ssaamnipplless aanndd,, iiff ssuucccceessssffuull,, wwiillllbbee rreeppoorrtteedd wwhheenn aavvaaiillaabbllee.. - `SSuurrffaaccee SSooilil SSaammpplleess -- PPFROOSS aanndd PPFFOOAA wweerree ffoouunndd aatt ccoonncceennttrraattiioonnss ggrreeaatteerr tthhaann tthhee ddeetteeccttiioonn lliimmiitt aatt aallll llooccaattiioonnss ssaammpplleedd.. CCoonncceenntrtraattiioonnss ooff PPFFOOSS rraannggeedd ffrroomm 11..1199 ttoo - 11,,882200 nngg//gg ((ppppbb)) iinn ssuurrffaaccee ssooiillss ((00-66" bbgss)) aanndd ffrroomm 11..4477 ttoo 11,,662255 ppppbb iinn tthhee sshhaallllooww ssuubbssuurrffaaccee ((66--2244" bbegss)) ssooiillss.. CCoonncceenntrtraattiioonnss ooff PPFFOOAA rraannggeedd ffrroomm 00..990022 ttoo 116644 ppppbb iinn - ssuurrffaaccee ssooiillss.aanndd ffrroomm 00..661188 ttoo 7755..99 ppppbb iinn tthhee sshhaallllooww ssuubbssuurrffaaccee ssooiills.. IInn ccoonnttrraasstt,, PPFFBBSS ccoonncceennttrraattiioonnss rraannggeedd ffrroomm nnoonn--ddeetteecctt ((NN-DD;; << 00.2.2 ppppbb wweett wweeiigghhtt)) iinn 1122 ooff tthhee 2255 llooccaattiioonnss ttoo aa mmaaxxiimmuumm ooff 55..9988 ppppbb iinn ssuurrffaaccee ssooiill ssaammpplleess.. IInn tthhee sshhaallllooww _ ssuubbssuurrffaaccee ((66--2244"" bbegss)) ssooiill ssaammpplleess,, PPFFBBSS rraannggeedd ffrroomm NNDD ((1166 llooccaattiioonnss)) ttoo aammaasxiimmuumm fof 111..88 ppppbb.. CCoonncceenntrtraattiioonnss ooff PPFFHHSS iinn ssuurrffaaccee ssooiillss aanndd sshhaallllooww ssuubbssuurrffaaccee ssooiillss rraannggeedd _ ffrroomm NNDD ((66 llooccaattiioonnss)) ttoo 228811 ppppbb aanndd NNDD ((77 llooccaattiioonnss)) ttoo 4433..22 ppppbb,, rreessppeeccttiivveellyy.. SSooiillBBo6rriinngg SSaammpplleess -- PPFFOOSS aanndd PPFFOOAA wweerree ffoouunndd aatt ccoonncceennttrraattiioonnss rraannggiinngg ffrroomm NNDD - 10112,350 to 12,350 ppppbb aanndd ffrroomm NNDD ttoo 1100,,990000 ppppbb,, rreessppeeccttiivveellyy.. TThhee hhiigghheesstt ccoonncceennttrraattiioonnss ooff PFOS PFOS and and PPFFOOAA iinn ssuubbssuurrffaaccee ssooiillss wweerree pprreesseenntt iinn tthhee DD22 aanndd DDI1 AArreeaass.: = CCoonncceenntrtraattiioonnssooff PPFFBBSS aanndd PPFFHHSS iinn tthhee osoiill bboorriinngg ssaammpplleess rraannggeedd ffrroomm NNDD ttoo 2222 ppppbb ((hhiigghheesstt aatt tthhee FFiirree TTrraaiinniinngg AArreeaa iinn FFTTAA 0033)) aanndd ffrroomm NNDD ttoo 11,,555500 ppppbb ((hhiigghheesstt aatt tthhee - DD22 AArreeaa iinn DD220033)),, rreessppeeccttiivveellyy.. - T"Thhee ffoolllloowwiinngg sseeccttiioonnss pprroovviiddee aa ddiissccuussssiioonnoofftthhee rreessuullttss ooftf thhee ssooiill aasssseessssmmeenntt oonn aann aarreeaa--bbyy--aarreeaa bbaassiiss.. Craton etme 415 4-15 22009955..00007777 33MMAA0011555511885544 - [Ee - Hl Hie ABE pnM asa Sd E alta e Ee efo ; 0 g S13] 2] 3 |3|2]2|< 58 i - :0 RRR REILEEING i - EEE | ~- z0 \ : BeER3 eenseennnsdainna AtSE en { g ~ lee celle eel ee ] 22009955..00007788 33MMAA0011555511885565 -: ERE TE lm tdaAAAGA Bee CA ~ 3 elf [a eles] - ple 21819 8 BLE2 i i1 | 2 i : pm en 2 Bl8lelalelelolololl 22009955..00007799 33MMAA0011555511885566 iq OlO :zz zz CA - B[HeT pg 8 Ese sadhana 7z zz ZlZ ilaAAEANY zz ZlZ 5 afefelalolalele] ofl * 83 Se : | -- i 3 % - 1 - 1 33 3: :z i ! i Bethel it tne I - fee | S28 HEE did i ll i 22009955..00008800 3MMAA00115555118857 ~:CAlo | A rH gH ) 3 - i 3 8] I[8/8{8[=la|] lg] 2 - : 8 | - ; - | | - pa Zao inaie Bslelsles : {3(::,(:; - a lBla(ola 3(a(5((el(a(aRl1(0alBl6ae4e(-Il-a' f(e~I-~ae-R4| mmm OOC _ 38882 3B ooIR RR RRR ERR oo BIRR EE RIA AIRE i 22009955..00008811 33MMAA0011555511885588 BN FT229 hihi |e CH ZZ BI3 ] ee 0 - - i 2 3 2 i i or j - ele il0si0gisle~)lelfe gennnatans o 0 ~ 0~1o 0~ 0o 0 | hein ri i Bo 66 6601666 && FE mm - py | zz~Izzz 22009955..00008822 33MMAA0011555511885599 - SE Lulelalsle - L33508 Hela 53 1 3 N 30 cole nlslaelsolok ZZ c lelefolaleele 2 2 z2 8 8 i - ii i ~ ! - i l2fElels o o els o 2 1 0 o o o : ee ~ SEEgReE ReEEEREBEE oESte~ionRoEbeEEsad|ie| i|aHnEi8indBydi {i i| ~ S BERRe ARR RR RRR i 00IO 2005.0083 2095.0083 3MMAA0011555511886600 SC i [nh Jollee| [i i : i 2358 lle] 3 1 zzz I 1 1 | Fa 3 IB 1s 2 1 5 | 43 5% = |_| ] ) HH 3 Hoi i IH it i | Hid Elle] 8523 pyhi i 1fil0 5 zzz Bl fisiisy 20950084 2095.0084 i ii ! | | | 33MMAA0011555511886611 TTaabbllee 44-55 SSuummmmaarryy ooff TTOOCC CCoonncceennttrraattiioonnss iinn ~ 33MM CCoottttaaggee GGrroovvee SSooiill SSaammpplleess -- MMaayy 22000055 ~ SSaaImmnptplelreevDDaelepptthh ToC Sample ID SSaammplpe leLoLcoactaitioonn (toes) Interval (ft bgs) | (mong) TOC (mglkg) - [CC[oCGMGMNM-NN5--SBSCBB-CCD-1DD0710301.10-00-:-060322500000 Di Area 0D114Ar0e3a SEOT0T | 2025 30 sSBeDi10s1 | 2305-4205 230800 [CCaGMMN-N5-SBBCC-D-D110033.-00.-00355000 C(CGGMMNN--S5BBCCD-D10140.30-0.-00150000 DD11 AArceaa DD11 AArreeaa ssSSBB8eop0Dii11o000ss33 || 5350-54s0 5100-1555 2232440%00 - (CCOGMMN.N5-SBCB.CD-1D0140.40-0.-00415000 [CCGGMMNN--5SBBCC-D-D210014.-00--00240500 D0DD1112AAAAvrreeeeaaan ssSSsBBeopDD2i110o001s44|| 4a2150s0--s251o505 1333411500000 C(CGaMMNN--S5BBCC-DD520011.-00.-00210500 - [cCaGmMN-N5-S8CB.C0-8D0510-10-0.-00015500 00DD8525 AAAArrrreeeeaaaa sSeBpoDs2o0t1 SssBpDg5o0r1 | | 211s0551--2220005 901400 3919000 [|CCCcGGGaMMMmNnNN-.--5sSS8aBBcCCC---8FDB1r1S5a500c011z1-.-0-000-.0.-000011510005000 OutsicDe8BAurledaing 15 OFuitesidTreaiBnuiinldginArgea1,5 SsBBiDs8o0t1 | 150-41105 sSeBFt1a500z1[ 1105-2105 351 3O00 55730O0 - [|CCCcGGaaMMMnNNN---sSSSBaBBCcCC---WFeWPxTPsAAAoO0r102--1-00-00.-.0-000101150550000| FFoorrmmeerrFBWW ireaeascTstktroegawwirnaoaitntuegenrrAdPProeonandd AAvreeaa S[sS5BsBBBW WFKP'PIAG'AADo00T|21| 1110555.--%222000 353827260000000 CGMN-SBC-BKG01-0-0000 Background SB BKG01 0-5 86O - ((11))SS0e0eFFiigguurreo33:-33ffoorr ssaammpplloe aannddarareeaalolocactaitoionnss.. ons aman pee mn E:~FOLDERS.0-9~3m-cottage gfove~C Data Assessment RepOr~Tat4._5._TOC.xls,4-5 44-223 22009955..00008855 33MMAA0011555511886622 :] I[FEroEwmTs) ] Jiang - gg [BHiEssE ar -< iih n pe . if a ' - HH 228833883, _ 213 $i snistned)d | 1iis - li : ih _ Ps ad i 2 iii AERA - a | Hit, - ETHEL ii shi ooooooNom~m P[R iEHee 22009955..0000881~6 : | i ! i| || 33MMAA0011555511886633 g T 0 fi Br a T bel Jni] 1|e IL = 7 Esl CEBrLEEMRGiiAm i[lii :3 Pa4d |: nl ite NEr Jy g : 5. R|EYB.ad] "fA Ne i A TNS e neCeAil Rvpaeol ye) | E A negAi | BiE fq. . p3_E7dh | Aa HWEo] | fd e E fog Te FIER dpe B Ulp2e { - 22009955..00008877 33MMAA0011555511886644 = :T Tis . I] i ified = a Sa i iE po Eo l npe e21a { ii al omteilelm)ii Mo 7 al fea LR EP Fig) o : CE Ea EIS i Bor I desl | Bio Zim | Fgh 8. ein en| f ir i % 5 PI el 0 gL | ah ACrenoWaBY eEele 8| EH ge 2209955..000088 3MMAA001155551188665 - ro - 44.33..11 DD11 AArreeaa -- FFoorrmmeerr HHFF TTaarr NNeeuutrtraalliizzaattiioonn PPiitt _ SSooiill DDeessccrriippttiioonn - TThhee ssooiill bboorriinngg llooggss ffoor tthhee DDI1 aarreeaa iinnddiiccaattee tthhaatt tthhe ssooiill ccoonnssiissttss ooff pprreeddoommiinnaannttllyy ooff fliigghhtt yyeellllooww bbrroowwnn ssiillttyy mmeeddiiuumm.- ftoo ccooaarrssee--ggrraaiinneedd ssaanndd.. W WEESSTTOONN _ ddiidd nnoott oobbsseerrvvee aannyy ddiissccoolloorraattiioonn oorr ooddoorrss., AAnnaallyyttiiccaall DDaattaa -- IInn tthhee DD11 FFoorrmmeerr IH-IFF TTaarr NNeeuutrtraalliizzaattiioonn PPiitt AArreeaa,, tthhee hhiigghheesstt FFCC - ccoonncceennttrraattiioonnss wweerree ddeetteecctteedd iinn tthhee ttwwoo s~ooiill bboorriinnggss oonn tthhee pprreessuummeedd ddoowwnngrgaraddieienntt// ssoouutthh ssiiddeeooff tthhiiss aarreeaa ((DD110033 aanndd DD110044)) iinn tthhee 55 t0o 3300 f1l bbggss ddeepptthh rraannggee aanndd ddeeccrreeaasseedd - bbeellooww 3300 fAt bbggss iinn tthhee nnaattiivvee ssooiillss.. PPFFOOAA wwaass ddeetteecctteedd aatt hhiigghheerr ccoonncceennttrraattiioonnss tthhaann PPFFOOSS iinn tthheessee bboorriinnggss wwiitthh ccoonncceennttrraattiioonnss rraannggiinngg ffrroomm 1122..77 0to 44,,552200 ppppbb rreellaattiivvee t(o0 tthhee - PPFFOOSS ccoonncceennttrraattiioonnss tthhaatt rraannggeedd ffrroomm 6688..66 ttoo 992233 ppppbb.. = 44.33..22 DD22 AArreeaa -- FFoorrmmeerr SSlluuddggee DDiissppoossaall AArreeaa - SSooiillDDesecsrcirpiptitioonn -~ OObbsseerrvvaattiioonn oofsfosoiill ssaammpplleess ffrroomm tthhe bboririnnggss iinnddiiccaatteedd tthhe pprreesseennccee ooff flilll G(ii.e.., sslhuuddggee mmaateterriiaall)) aassssoocciiaatteedd wwiitthh tthhee DD22 AArreeaa ttoo aapppprrooxxiimmaatteellyy 2222 ttoo 2299 ft bbygss.. - "TThhee ffiilll ccoonnssiisstteedd ooff yyeellllooww bbrroowwnn ttoo aolliivvee ttoo ddaarrkk ggrraayy ppoooorrllyy ssoorrtteedd ssiilttyy ssaanndd wwiitthh vvaarryyiinngg aammoouunnttss ooff oorrggaanniicc mmaateterriiaall aanndd ppaaiinntt cchhiippss.. TThhee ffiillll wwaass llooccaallllyy ssttaaiinneedd ddaarrkk - ggrraayyttoo bbllaacckk.. AAtt ssooiill bboorriinngg DD220033,, leleevvaatteedd OOVVMM rreeaaddiinnggss wweerree rreeccoorrddeedd iinn tthhee ifillll wwiitthh tthhee mmaaxxiimmuumm rreeaaddiinngg ooccccuurrriinngg aatt 11661to 1188 fft bbggss.. OOVVMM rreeaaddiinnggss wweerree nnoott ddeetteecctteedd iinn - ssooiill bbeellooww tthhee ffiillll mmaateterriiaall.. TThhee uunnddeerrllyyiinngg sgooiill ccoonnssiissttss pprreeddoommiinnaannttllyy ooff yyeelllloowwiisshh bbrroowwnn ttoo oolliivvee bbrroowwnn ssiillttyy mmeeddiiuumm- ttoo ccooaarrssee--ggrraaiinneedd ssaanndd.. SSooiill aatt DD220033 wwaass ttyyppiiccaallllyy - lliigghhtt ggrraayy ttoo oolliivvee ssaanndd.. RReessiidduuaall ggllaacciiaall oouuttwwaasshh ggrraavveellss wweerree oobbsseerrvveedd llooccaallllyy.. AAnnaalylyttiiccaall DDaattaa -- TThhee hhiigghheesstt FFCC ccoonncceennttrraattiioonnss iinn ssooiill ssaammpplleess wweerree ddeetteecctteedd iinn tthhee DD22 - FFoorrmmeerr SSlluuddggee DDiissppoossaall AArreeaa.. TThhee mmaaxxiimmuumm ccoonncceennttrraattiioonnss ooff PPFFOOSS ((1122,335500 ppppbb)),, ~ PPFFOOAA ((1100,,990000 ppppbb)),, aanndd PPFFHHSS ((11,,555500 ppppbb)) wweerre ddeetteecctteedd aatt ssooiill bboorriinnggss DD220022,, DD220033,, aanndd DD220033,, rreessppeeccttiivveellyy.. IInn tthhiiss aarreesa,, tthhee hhiigghheerr FFCC ccoonncceennttrraattiioonnss ooccccuurr iinn tthhee 00 ttoo 2255 fft _ bbgss ssaammpplleess,, wwhhiicchh iiss wwiitthhiinn tthhee sslluuddggee mmataeterriiaall.. AAdddidtitiioonnaallllyy,, iinn ecaacchh ooff tthhee DD22 AArreeaa Ssooiill bboorriinnggss ((DD220011,, DD220022,, aanndd DD220033)),, PPFFOOSS ggeenneerraallllyy iiss ffoouunndd aatt hhiigghheerr ccoonncceennttrraattiioonnss _ tthhaann PPFFOOAA iinn tthhee 00 t1o0 2255 fft bbggss ssaammppleless.. PPFFOOSS wwaass ddeetteecctteedd wwiitthh ccoonncceennttrraattiioonnss ooff 11,,119955 aanndd 11,,662255 ppppbb iinn tthhee 00--66 iinn aanndd 66--2244 iinn bbggss ddeepptthh,, rreessppeeccttiivveellyy,, aatt ssuurrffaaccee ssooiill J-- 44-2277 22009955..00008899 I3MMAA0011555511886666 _ llooccaattiioonn DD220022.. PPFFOOAA ggeenneerraallllyy iis ffoouunndd aatt hhiigghheerr ccoonncceennttrraattiioonnss tthhaann PPFOOSSaatttthhee lloowweerr ddeepptthh iinntteerrvvaallss iinn tthhee nnaattiivvee ssooillss uunnddeerrllyyiinngg tthhee aarrecaa. 44.33.33 DDS5 AArreeaa -- FFoorrmmeerr SSoolliiddss BBuurrnn PPiitt - SSooiill DDeessccrriippttiioonn-- OObbsseerrvvaattiioonn ooff ssoiill ffrroomm tthhee oonnee bboorriinngg DDS5O011 ccoonnssttrruicctteedd iinn tthhee DDS5 AArreeaa iinnddiiccaatteedd tthhee pprreesseennccee ooffpprreeddoommininaannttllyy foilivvee bbrroowwnn ssiillttyy ccooaarrssee--ggrraaiinneedd ssaanndd ttoo ssiixx - fbtgbsgs.. SSooiillffrroomm ssiixx ttoo 1144 ftbbggss ccoonnssiissttssooffbbllaacckk ssiillttyy mmeeddiiuumm.-ggrraaiinneedd ssaanndd wwiitthh ssoommee. ggrraavveell,, aasshh aanndd cchhaarrccooala.l. SSooiill bbeellooww 1144 ffeeeett bbggss ccoonnssiissttsooffliligghhtt yyeelllloowwiisshh bbrroowwnn siilltyy - `medium-grained medium-grained ssaanndd ttoo bboorriinngg tteernmmiinnaattioonn aatt 2255 ffeecett bbggss.. WWEESSTTOONN ddiidd nnoott oobbsseerrvvee: aannyy ooddoorrss ffoorr tthhe eennttiirree bboorriinngg.. AAnnaalylystiiccaall DDaattaa-- TInn tthhee DDS5 AArreeaa ssooiill bboorriinngg DDS50O1,, hhiigghheerr ccoonncceennttrraattiioonnss ooff PPFFOOAA aanndd - PPFFOOSS ((229955 ttoo 11,,337755 ppppbb PPFOOAA aanndd 669933 ttoo 22,,331100 ppppbb PPFFOOSS)) ooccccuurrrreedd iinn tthhee 00 ttoo 1155 fftt bgs bgs ddeepptthh rraannggee aanndd ccoonncceennttrraattiioonnss ddrrooppppeedd ssiiggnniiffiiccaannttllyy ((lleessss tthhaann 5500 ppppbb)) aatt lToowweerr - ddeepptthhss.. TThhee ssuurrffaaccee ssooiill ssaammpplleess ddoowwnnggrraaddiieenntt ooff tthhiiss aarreeaa ccoonnttaaiinneedd lloowweerr ccoonncceennttrraattiioonnss eexxcceeppttffoorroonnee ssooill ssaammppllee ccoollllecctteedd aatt DDS5O022 iinntthhee 6ttoo 2244 iinn bbggss iinntteerrvvaall,, ~ w`whhiicchh ccoontnainteadaiattPnPFFeOOdSS ccoonncceennttrraattiioonn ooff441144ppppbb.. - 44..33..44 DD88 AArreeaa -- FFoorrmmeerr WWaassttee DDiissppoossaall AArreeaa Soil Soil Description Description ~ - Observation Observation ooff ssaoiill ffrroomm bboorriinngg DDB80II iinnddiiccaatteedd tthhee pprreesseennccee ooff pprreeddoommiinnaannttllyyooff ddaarrkk yyeelllloowwiisshh bbrroowwnn ccllaayyeeyy ssaannddyy ssiilltt ttoo aa ddeepptthh ooff 1144 ft bbegss.. BBlluiisshh n ggrraayy ccllaayyeeyy ssaannddyy ssiilltt 0to ssttrroonngg bbrroowwnn ssiillttyy ssaanndd wweerree oobbsseerrvveedd ffrroomm 1144 ttoo 1166 ffeecett bbegss ffoolllloowweedd bbyy oolliivvee ssiillttyy ffiinnee--ggrraaiinneedd ssaanndd aanndd lliigghhtt yyeelllloowwiisshh bbrroowwnn ssilltyy ssaanndd ttoo bboorriinngg _ tteerrmmiinnaattiioonn aatt 2255 ffeeeett bbggss.. W WEESSTTOONN ddiidd nnoott oobbsseerrvvee aannyy wwaassttee mmaateterriiaall,, ddiissccoolloorraattiioonn oorroododrosrs.. - AAnnaallyyttiiccaall DDaattaa -- CCoonncceenntrtraattiioonnss ooff PBFFOOSS aanndd PPFFOOAA ((115555 ttoo 554433 ppppbb PPFFOOAA aanndd 552288 ttoo 669944 ppppbb PPFFOOSS)) wweerree ddeetteecctteedd nin tthhee 001t0o 1155 fftt bbggss ddeepptthh reanngee aanndd ccoonncceennttrraattiioonnss ggrreeaatteerr - thhaann 110000 ppppbb wweerree ddeetteecctteedd ddoowwnn ttoo bbooriinngg tteerrmmiinnaattiioonn aatt 2255 fftt bbegss.. TThhee ssuurrffaaccee ssooill ssaammppllee ((DD8S0011)) iinn thhiiss aarreeaa ccoonnttaaiinneedd PPFFOOSS ccoonncceennttrraattiioonnssooff 552255 aanndd 998833ppppbbiinn tthhee 00--66 - iinn aanndd 66--2244 iinn bbgss ssuurrffaaccee ssooiill ssaammpplleess,, rreessppeeccttiivveellyy.. Cresent 428 4-28 22009955.00000900 33MMAAQ011555511886677 _ 44.33.55 FFiirree TTrraaiinniinngg AArreeaa SSoiolil DDeessccrriippttiioonn -~ OObbsseerrvvaattiioonn ooff ssooiil ffrroomm tthhee tthhrreeee bboorriinnggss iinnddiiccaatteedd tthhee pprreesseennccee ooff - pprreeddoommiinnaannttllyy lliigghhtt yyeelllloowwiisshh bbrroowwnn ssiillttyy ssaanndd ttoo ggrraavveellllyy ssiillttyy ssaanndd.. TThhee ssaanndd rraannggeedd ffrroomm ffiinnee--ggrraaiinneedd ttoo ccooaarrssee--ggrraaiinneedd.. GGllaacciiaall oouuttwwaasshh ggrraavveell wwaass llooccaallllyy aabbuunnddaanntt.. - W WEESSTTOONN ddiidd nnoott oobbsseerrvvee aannyy ddiissccoolloorraattiioonn oorr ooddoorrss.. - AnAanlayltyiticcaallDDaattaa -- IInn tthhiiss aarreeaa,, PPFFOOSS ccoonncceennttrraattiioonnss ooff 337788 aanndd 886633 ppppbb wweerree ffoouunndd iinn tthhee sshhaallllooww iinntteerrvvaallooff 00 ttoo 55 ffti bbggss ooff bboorriinnggss FFTTAAO022 aanndd FFTTAAO033 rreessppeeccttiivveellyy,, wwiitthh - ssiiggnniiffiiccaannttllyy lloowweerr ccoonncceennttrraattiioonnss ((rraannggiinngg ffrroomm 11..3355 ttoo 8822..22 ppppbb)) aatt lloowweerr ddeepptthh iinntteerrvvaalls.. IItt sshhoouulldd bbee nnootteedd tthhaatt tthhee aarreeaa aarroouunndd bboorriinngg FFTTAAO033 hhaass bbeeeenn ssuubbssttaannttiiaallllyy - aalltteerreedd wwiitthh tthhee ccoonnssttrruuccttiioonn ooff aa nneeww rruunn--ooffff ccoonnttrrooll bbaassiinn.. PPFFOOSS wwaass ddeetteecctteedd aatt ccoonncceennttrraattiioonnss ooff 11,,882200 aanndd 445500 ppppbb iinn tthhee ssuurrffaaccee ssooiill ssaammpplleess ((00--66 aanndd 66--2244 iinn bbggss,, - rreessppeeccttiivveellyy)) ccoolllleecctteedd aatt ssaammpplliinngg llooccaattiioonn FFTTAAC022,, wwhhiicchh iiss iinn aa ddrraaiinnaaggeewwaayy ffrroomm tthhee FFiirree TTrraaiinniinngg//CCoonnttrraaccttoorr YYaarrdd AArreeaa.. IItt wwaass aallssooffoouunnddtthhaatt aatt tthhee FFiirreeTTraraiinniinnggAArereaa,, tthhee +4 ddeetteecctteedd ccoonncceennttrraattiioonnssooff PPFFHHSS ggeenneerraallllyy wweerree ggrreeaatteerr tthhaann tthhee ddeetteecctteedd ccoonncceennttrraattiioonnss ooff PPFFOOAA.. 44..33.66 BBuuildiinlg1d155iAAnrreegaa SDSooeiillsDcersicrpipttiioon--n- OObbsseerrvvaattiioonn ooff ssooill ffrroomm tthhee bboorriinngg iinnddiiccaatteedd tthhee pprreesseenncceeooff aa ddaarrkk _ bbrroowwnn ssiillttyyssaannddttoo aaddeepptthh ooffaapppprrooxxiimmaatteelyly8 ffeeeett bbegss ffoolllloowweedd bbyy pprredeodmoimnainntlayanaltiliglghhytt yyeelllloowwiisshh bbrroowwnn ssiillttyy ssaanndd ttoo bboorriinngg tteermmniinnaattiioonn.. W WEESSTTOONN ddiidd nnoott oobbsseerrvvee aannyy ; ddiissccoolloorraattiioonn oorr ooddoorsrs.. AAnnalaylt~iiccaall DDaattaa -- AAtt tthhee BBuuiillddiinngg 1155 aarreeaa,, PPFFOOSS ccoonncceennttrraattiioonnss wweerree ddeetteecctteedd iinn ssooiill - bobroirinngg BBI1S50011aatttthheeshshalallloowwinintteerrvvaall ooff 001t0o 55 fft bbggss ((661199 ppppbb)) aanndd aatt aa ddeepptthh ooff 2200 t0o 2255 ft bbagss ((11;,886655 ppppbb)).. IItt hhaadd aallssoo bbeeeenn ddeetteecctteedd aatt ccoonncceennttrraattiioonnss ooff 883333//990044 ((dduupplliiccaattee)) aanndd 554422 ppppbb iinn tthhee ssuurrffaaccee ssooiill ssaammpplleess ((00--66"" aanndd 66-~2244"" bbggss,, rreessppeeccttiivveellyy)) ccoolllleecctteedd aatt ssaammpplliinngg llooccaattiioonn BB66S80011,, wwhhiicchh iiss aaddjjaacceenntt ttoo tthhe ssooiill bboorriinngg.. 44.33..77FoForrmmeerr WWaasstteewwaatteerr PPoonndd AArreeaa SSooiill DDeessccrriippttiioonn --- OObbsseerrvveattiioonnooffssooiill ffrroomm tthhee bboorriinngg iinnddiiccaatteess tthhee pprreesseennccee ooff aasspphhaalltt = aanndd ccrrausshheeddrroocckkttoo aaddeepptthhooffaapppprrooxxiimmaatteellyy oonnee ffoooott bbegss.. SSooiill ffrroomm oonnee ffoooott ttoo ssiixx ffeeeett Cranes taemmterin 429 22009955..00009911 I3MMAA0011555511886688 - bbggss ccoonnssiisstteedd oofbf lblaacckk ttoovveerryyddaarrkk ggrraayyiisshh ggrreeeenn ssiilttyy ttoo ccllaayyeeyy ssiillttyy ssaanndd.. SSaoiill bbeellooww aa ddeepptth ooff ssiixx ffeeett bbggss ccoonnssiisstteedd ooff oolliivvee bbrroowwnn ssilltyy ssaanndd ttoo 1166 ffeeeet bbggss ffoolllloowweeddbbyyvveerryy - adarrkk bblluuiisshh ggrraayy ssiillttyy ssaanndd wwiitthh aa ssttrroonngg ooddoorr ffrroomm 1166 ffeeett to bboorriinngg tteerrmmiinnaattiioonn aatt 2255 ft bbegss.. TThhee lloowweerr ssooiill hhoorriizzoonn eexxhhiibbiitteedd ssttreoonngg ooddoorrss aanndd OOVVMM rreeaaddiinnggss uupp ttoo 9900 uunniittss.. - NNoo ootthheerr iinnddiiccaattiioonnooffrreessiidduuee oorr wwaassttee mmataetreiraiallwwaass nnooitedd.. AAnnalyatilcalyDDatattiaa~-cPPaFFOOlSS wwaassddeteectedtaatt aaeccoonnccecnetnrttraattiiooennooffd$80055 ppppbb aattaa ddeepptthh ooff11551t0o 2200 1ft bbggss iinn ssooiill bboorriinngg WWPPAAOI0.1. TThhee ccoonncceennttrraattiioonnss ooff PPFFOOAA ddeetteecctteedd iinn tthiiss bboorriinngg wweerree Tloowweer,r. 438 Other Site Areas. 4.3.8 Other Site Areas IInncciinneerraattoorr CCoommpplleexx aanndd DD66 AArreeaa -- FFoouurr ssuurrffaaccee ssooiill ssaammpplliinngg ((00--66" aanndd 66--2244"" bbggss)) - locations locations (IC01, (IC01, 1ICC0022,, I1CC0033,, aanndd 1ICCO044)) wweerree ssiittuuaatteedd aarroouunndd tthhe iinncciinneerraattoorr ccoommpplleexx sanndd oonnee ((DD6O0I1)) wwaass ddoowwnnggrraaddiieenntt ooff tthhee DD66 --- FFoomrmneerr AAsshh DDiissppoossaall AArreeaa. TThhee - ccoonncceennttrraattiioonnss ooff PPFFOOSS ddeetteecctteedd iinn tthheessee aarreeaass rraannggeedd ffrroomm 11..1199 t(o0 4455..22 ppppbb.. TThhee ccoonncceennttrraattiioonnss ooffPPFFOOAArraannggeedd ffrroomm 11.,2233 ttoo 3311..00 ppppbb.. Non-FC Non-FC MMaannaaggeemmenetnt AArreeaass - - TThhrreeee ssuurrffaaccee ssooiill ssaammpplliinngg ((00--66"" aanndd 66--2244"" bbggss)) llooccaattiioonnss _ were were situated situated aarroouunndd BBuuiillddiinnggss 111122 0(B3I111220011)),, 110022 (0B31100220011)),, aanndd 2222 ((BB22220011)),, wwhhiicchh wweerree nnoott aassssoocciiaatteedd wwiitthh FFCC mmaannaaggeemmeenntt ooppeerraattiioonnss.. TThhee ccoonncceennttrraattiioonnss ooff PPFFOOSS _ ddeetteecctteedd iinn tthheessee aarreeaass rraannggeedd ffrroomm 22..1144 ttoo 7766..00 ppppbb.. TThhee ccoonncceennttrraattiioonnss ooff PPFFOOAA rraannggeedd ffrroomm 00..990022 0to77..6633ppbp.b. = FECC MMaannaaggeemmeenntt AArreeaa~-s- FFoouurr ssuurrffaaccee ssooiill ssaammpplliinngg llooccaattiioonnss ((00-6 6" aanndd66--2244""bbegss)) wweerree ssiittuuaatteedd aaddjjaacceenntt ttoo BBuuiillddiinnggss 1166 (0B311660011 aanndd BB11660022)),, 77 0(B322660011)),, aenndd 2255 ((BB22550011)),, wwhhiicchh - wweerree aassssoocciiaatteedd wwiitthh FFCC mmaannaaggeemmeenntt ooppeerraattiioonnss.. TThhee ccoonncceennttrraattiioonnss ooff PPFFOOSS ddeetteecctteedd iinn tthheessee aarreeaass rraannggeedd ffrroomm 22.7700 ttoo 449999 ppppb.. TThhee ccoonncceennttrraattiioonnss ooff PPFFOOAA rraannggeedd ffroomm = 11.77221to07755.99 ppppbb.. - 44.33.39 BBaacckkggrroouunndd - SoSiolil DDeessccrriippttiioonn -~ OObbsseerrvvaattiioonn ooff ssaoiill bboorriinngg BBKKGGO0!1 iinnddiiccaatteedd ssooiill ccoonnssiissttiinngg pprreeddoommiinnaannttllyy ooff lliigghhtt oolliivvee bbrroowwnn ssiillttyy ccoosarrssee--ggrraaiinneedd ssaanndd ttoo oolliivvee yyeellllooww ccllaayyeeyy ssiillttyy Crmsomam tc smerrere 430 4-30 22009955..00009022 33MMAA0011555511886699 _ `mmedeidumiu-gmra-ingerdsasaiannnddettdoo 2211 ffeeeett bbegss.. W Weeaatthheerreedd ddoloomiltewwoaassmeenncicoouuntntteerereedd aatt 2211 ffeecett bbegss wwiitthh aauuggeerr rreeffuussaall eennccoouunntteerreedd aatt 2222fefeeettbbggss.. - OObbsseerrvvaattiioonn ooff ssooiill bboorriinngg BBKKGGO022 iinnddiiccaatteedd 2a ddaarrkk rreeddddiisshh bbrroowwnn ssiillttyy ccooaarrssee--ggrraaiinneedd ssaanndd ttoo aapppprrooxxiimmaatteellyy ssiixx ftbbggss ffoolllloowweedd bbyy lliigghhtt oolliivvee bbrroowwnn ssiilttyy ssaanndd ttoo 223.35.5 fft bbggss.. = `TThhee ssooiill bbeeccoommeessgrgaravvelelllyyaatt 1188fftt bbegss.. AAuuggeerr rreeffuussaall wwaass eennccoouunntteerreedd aatt 2233..55 fftt bbggss aanndd ddoolloommiittee ccuuttttiinnggss.. W WEESSTTOONN ddiidd nnoott oobbsseerrvvee aannyy ddiissccoolloorraattiioonn oorr ooddoorrss aatt eeiitthheerr ooff tthhee = bboorriinnggss.. - AAnnaalylyttiiccaall DDaattaa -~ TThhee ccoonncceennttrraattiioonnss ooff PPFFOOSS ddeetteecctteedd iinn tthhee bbaacckkggrroouunndd aarreeaa ssooiill bboorriinnggss ((BBKKGGO0I1 aanndd BBKKGGO022)) rraannggeedd ffrioomm NNDD ttoo 11..9944 ppppbb.. IItt wwaass ddeetteecctteedd iinn tthhee - ssuurrffaaccee ssooiill ssaammppllee ((BBKKGGO0I1)) aatt ccoonncceennttrraattiioonnss ooff 1155..33 aanndd 88..1122 ppppbb aatt tthhee 00--66"" aanndd 66-- 2244"" bbggss ddeepptthh,, rreessppeeccttiivveellyy.. `TThhee ccoonncceennttrraattiioonnss ooff PPFFOOAA ddeetteecctteedd iinn tthhee bbaacckkggrroouunndd aarreeaa ssooiill bboorriinnggss rraannggeedd ffrroomm ~ NNQQ t0o 00..997777 ppppbb.. IItt wwaass ddeetteecctteedd iinn tthhee ssuurrffaaccee ssooiill ssaammppllee ((BBKKGGO011)) aatt ccoonncceennttrraattiioonnss ooff 33..3322.aanndd 33..4411 ppppbb aatt tthhee 00--66"" aanndd 66--2244"" bbggss ddeepptthh,, rreessppeeccttiivveellyy.. 44..44 SSEEDDIIMMEENNTTAANNDD SSUURRFFAACCEE WWAATTEERR ~ "TThhee sseeddiimmeenntt aannaallyyttiiccaall ddaattaa ffoorr tthhee CCoottttaaggee GGrroovvee ffaacciilliittyy aarree ssuummmmarariizzeedd iinn TTaabbllee 44--77.. FFiigguurree 44-99 ddeeppiiccttss tthhee aavveerraaggee PPFFOOSS//PPFFOOAA sseeddiimmeenntt ccoonncceennttrraattiioonnss aaddjjaacceenntt ftoo tthhee - llooccaattiioonnss wwhheerree tthheeyy wweerree ddeetteecctteedd.. AA ccooppyy ooff tthhee aannaallyyttiiccaall ddaattaa ppaacckkaaggee ((wwiitthhoouutt aappppeennddiicceess)) iiss pprroovviiddeedd iinn AAppppeennddiixx DD.. "TThhee ssuurrffaaccee wwaatteerr aannaallyyttiiccaall ddaattaaffoorr tthhee CCoottttaaggee GGrroovvee ffaacciilliittyy aarree ssuummmmarairizzeedd iinn TTaabbllee - 44-88 aanndd ffiieelldd-m-meeaassuurreedd ssuurrffaaccee wwaatteerr ssaammppllee ppaarraammeetteerrss aarree ssuummmmarariizzeedd iinn TTaabbllee 44.-99.. FFiigguurree 44--99 ddeeppiiccttss tthhee aavveerraaggee PPFFOOSS/iPPFFOOAA ssuurrffaaccee wwaatteerr ccoonncceennttrraattiioonnss aaddjjaacceenntt ttoo tthhee & llooccaattiioonnss wwhheerree tthheeyy wweerree ddeetteecctteedd.. AA ccooppyy ooff tthhee aannaallyyttiiccaall ddaattaa ppaacckkaaggee ((wwiitthhoouutt aappppeennddiicceess)) iiss pprroovviiddeedd iinn AAppppeennddiixx DD.. Crosses mean 44-3311 22009955..00009933 33MMAA0011555511887700 , it TTF - fs 2 EE] ese t - g |ghEf BloplEBrieel _ siis[Fsioza g:3 E lags? zsh 2 A ee spells] 1 - E32| Fpl | peg| 22H chlo bbls EE ~0~ b fo: - iEiis iio = Ts l= if - 3 1i 8 5 Es : il 3 - S OR gTR eps Signgf df - :: Te fdialdie = :a a EH EllEEEEE i hi hi a Sab aRRh E aa ] 3gst = 2E2E 2Z2~E~2ZE E2E2RE E2EE 2EE2EE 2SE2R) S$353838 | SBIBI3IRIBIRIRIRRIBBIIRIRIBIBIBIRN| <5 sg i z 22009955..00009944 33MMAA0011555511887711 3 oe fgeee)ck (1d 17 foe RL Hel : AkH bad od CEwr E:R y J] ii: : 5 Es. ar. i wo J 15 ax oa HE | IL. i | es | EE | 5 ] : | SC hi[| i# =|} soali pil - olfi i | CC | HhHe HliE] | B BLl| nl | 22009955..00009955 33MMAA0011555511887722 - <8] - 3 [2F[Hsd rnn cpt) : _ I [8 ZZ zz g _| SE| -I _ N - - zO. JRE hf i: 3 >Kilt i3 ii zo. zz 51838 #58 |. 29 g! f8 i meg Hfa l ar fod Ba0 L) fd eUJ B0eEl:: oogd $ id ERAN ki 0 0 ~0~0 | O0 lisse HL O0 SERRE ss zz Z O0 zz O0 z 22009955..00009966 i i i |i | } 33MMAA00115555118873 - [Te -| g 2E233klclebolln - 8 |sles | be 5 id i - 2Be. | I25l L oE[ 3 | 2azi[s HE 3| PriapREsE - BL Da aE 3 Elias S| EE - - a. 3 BaEEeLEsR] | IE _ tH 22009955..00009977 | | i || 3MMAA0011555511887744 ~ 44.44.41 EaEassttaanndd WWeesstt CCoovveess _ 44.441.1..11 SSeeddiimmeenntt "The average PFOS concentrations detected in sediment samples at the cst cove ranged - Tfihoemav2era4gteo P22F6O7Spcpobncaenndtraattitohneswdeestetctceodveintsheedyirmaenngtesdafmrpolmes 1a5t 2thteo c9a1s.t1cpovpeb.ranTgheed farvoemrag2e4.P2FtOoA26c7onpcepnbtaatnidonast dtehteecwteedstatcothvee etahsetycoravnegreadngferodmfro1m5.211t.o7 t9o1.218.p7ppbp. bTanhde average PFOA concentrations detected at the east cove ranged from 11.7 to 28.7 ppb and - aatt tthhee wweesstt ccoovvee tthheeyy rraannggeedd ffrroomm 44..1111 ttoo 3388..77 ppppbb.. NNoo ssiiggnniiffiiccaanntt ccoonncceennttrraattiioonn differences were found for PFOSor PFOA inthetwo sample depths a the westcoveand - for PFOA differences iwnetrhee two foundsfaomrpPlFeOdSepotrhsPFaOt Atheinctahset tcwooves.amHpolweedveeprt,hsaatttthhee weaessttccoovvee, atnhde fdoertePctFeOdAaveinratghee PtwFOoSsacmonpcleentdreaptithosnsawtetrheehiegahsterciovne.theH0o-w1e0vcerm, satamthpleeedaespttchovthea, nthien - dheetedceteedpearve1r0a-g2e0PcFmOSsacmopnlec.entrTahtieonuspswterreeamhisgehdeirmienntthaeve0r-e1g0e ccmoncseanmtpraletidoenpsthofthPaFnOiSn tahned PFOA deeper 1f0or-2t0hecmeasstamanpdle.weTsthecouvpestrderaaminasegdeiwmayesntwaevreeraaglel cinontcheentsraatmioenrsaongfePFwiOtSh - aavnedraPgFeOdAetefcotredthceonecaesnttraantdiownsefstocmov1e.d5r5a0in18a.9gpewpbay.s were all in the same range with average detected concentrations from 1.55 to 18.9 ppb. = 44.44.11.22 SSuurrffaaccee WWaatteerr - "The average concentration ofECs detected in the cast cove surface water sample were Tgrheeataevretrhaagne tchoenccoennctreantliorantoonfsFCdestedcetteedctiendtihne twheesteacsotvceovsaemspulref.aceThweatheirghseasmt pdleetewcteered - gavreeartaegrethcaonncethnetrcaotinocnesntirnattihoenseadsteteccotveed wienrtehe25w.3esat ncdov1e6.1sampppbl,e.resTpheectihvieglhye,stfodretPeFctOeSd aavnedraPgFeOAc.onceTnhterataivoenrsagine cthoenceeansttractoivoen woferPeF2O5A.3daentedct1e6d.1inppthbe, ruepssptercetaivmeslyur,ffuocrs PwFatOeSr - sanad PmFpOatAlt.hee Teahset cavoevreawgaesc0o.n0c7e7ntprpabti.onThoefrPeFmOaiAnidnegtecFtCedswienrteheNuQpisntrtehaims ssuurrffaaccee wwaatteerr ssaammppllee.atAthseurefaasctecowavteewrsaasm0p.l0e7w7apspnb.otTchoellreecmtaediniunpgsiFzCeasmwofertehNeQweisntthciosvesbuerfcaacuesweattheer ~ dsarmsipnlaeg.evAeasywurafascderwyaattetrhseatmipmleeowfassanmoplt icnogllected upstream of the west cove because ~he drainageway was dry at the time of sampling. ~ 44.441.1..33 NNPPDDEESS AAnnaallyyttiiccaall DDaattaa After treatment, wastewater is discharged into the ravine located east of the WWTP. - pAofntdesr,traetatamneNnPt,DwEaSstsetwataitoenr iidsendtiisfciheadrgasedSDi)nt0o1.theTrhaevirnaevilnoecaftleodwseaisnttootfhteheeasWt WcovTeP. pTohnedsN, PaDt EanSNFPCDEaSnalsytattiicoanl iddaetnatifcieoldleacsteSdDa0t01s.tatTiohne SraDvin0e01floswisnciento20t0h0e ehaasst cboeveen. - TsuhmemaNrPiDzeEdSinFTCablaensa4ly-t1ic0atlhrdoautgah c4o-1ll2e.cted at station SD 001 since 2000 has been summarized in Tables 4-10 through 4-12. J 436 4-36 22009955..00009088 33MMAAQ011555511887755 -~ - ~ _ = _ - - ~ -- Somble peta | pron| pres] PAIS FOS `SumomfNaPrDEySFCTTaaAbbnllaeel4y4t-11i00cal Data -20to020003 Summary of [Catbo |xySluifaonattes es| NPDE8 FC Analytical Data - 2000 to 2003 Carboxylates Sulfonates Sample pJaoennp-tMtaar0rcchh202200000000"1" [ T 1 15336T .75 ||70106055|| D3ate. PFHA p(pppbb)) 123.5 PFOA (ppppbb)) 1991.3 {P(opFppBbb))S 6637576 873.6 PFHS Pros ||1 1((11pp7pp.3bb4))7 || 2i16a(4 4p200p30ab,7c)6]| Sept-Oct 20002 [E DecemberB 2007 December 2002 [lJaannuuaarryy22000033--| 28.7 191.0 | ie 51.0 S80 [$00 91.0 yg [B2 E 0 2 assT7 C e 5 3 7] z/ls/o3 20.4 216.3 180.0 80,I 63.7 51.0 42.4 11.3 262.0 5.80 550.0 6.5 200 ]anua~ 2003 20.1 To77.9 Ee 45.6 6.7 177 [FFeebbrruuaanry 2003 2003 2003 --] 22//1122//0033 i 16.8 32.4 31.0 a 5.4 64.8 [arch2003 | E3/12e /90 5.9 61.7 [1500535161] .4 | P[R2 oerai0 zocs0s|| 74.7 42% b[aSails [--osoo5[509--0 --T3c6r61|s0 co6o0s.r1--o|] fufayrzaog0szo0s| S103L[ossiie[notsoo | 72.0 3sis5|35562|1a544a.1]| Bess Teun[go |189 41.2 Isoo|os Thess 96.3 2260.0 94.9 bin 2003 JE cw 7 50 J 5.7 55.1 | f2003 79.7 3680,0 5.7 55.7 Cre IZ al J eX 2m 63.7 [ September [September 2003 2003 |{o9o/10p/0sI3 [E1C2| 59| 060 [55 43,2 si51,7 | foocctoobeerr22000033 1| 1 1I 5030T 7 ar OC ra 35455,,33 | [NNoovveemmbebrer22000053 | l115l103 2 17,9 71.6 [1166,0 0[0601 .1 |tIrii.0o|s 5.1 |i ae 34.8 ren lm November2003 [Dea cembeEri200030 December 2003 AePi6s1s70| 12/10/03 17.2 15.5 e67a0.s8 TIF 208609.07 [aE5356.6 64.7 3 28.9 4.6 1 | i7 4o2.c8 | 15.5 December 2003 15.3 66.5 30.0 4.9 16.8 12003 Average 102 [ 7a3 | 72s | 2003 Average [2003575 o7 | 255 | My| 2003 STD 16.2 6.7 74,3 23,3 728.5 1177.7 Sars: NPDES antsdt wosata fom rdsumma hsale, Source: NPDES analytical data was obtained from 3M and summarized in this table. 5ws,es1 || s6$6Fz.2 42.7 SPPTFOEHA- -StPPeaernFdrlouorodrroDoheevhxiaaentioxoincaaanccicidd 12S1--"TDAAAvvv-eeerrSraataggageneeddddaddrdaadttaaaDettvtaaiakkakeetenninoffnrraoommm83 dduaatttaaapppoiiannntsss.. 2 - Averaged data taken from 3 data points. 4-37 22009955..00009999 33MMAA0011555511887766 | aLo |a oa [|Tn| Table 411 Table 4.11 Summaryof NPDESFGAnalytica Data- 2004 Summar~ of NPDE$ FC Analytical Data - 2004 _- smo `Sample|C CP a0rC PbFOAo||xPFyESSiur lf2 aonatteseos| bpenuJJaannnuueaaror el [February-0a] - rr al 0 3 | Febru~ Sample Sulfonates Date 11/144/004 (ppb} PFOA (ppb) PFBS (ppb) e107 0.57 1.60 0,70 0.67 1.74 0.72 PFHS (ppb) (ppb) 03g] 0.23 0.25 0,82 O,80 11122.66[21277.005[ 300.77[33Tea] 2/4/04 38.4 11.8 102,0 28.3 28.7 - asoon Fst Road[oiTon March-04 3/3/04 15.9 73.3 31.2 13.3 March-04 16.9 75.9 36,5 18.8 . [------Apu riof a] 44/p/77o//o0s44[[aa4s1 .1 T|o88s2.9 1[2562465.311[ o0s51[5200]| 4,5 9.5 34.1 -- - -- [93 1 25 T7701 .lune-Oz 7 5 02 [oo| .lune-0~ 5/5/o4[8899..19 |533446..385111133340..000 0%: 6/2/04 19.3 17.9 2.5 776.0 0,2 2.5 721.0 0.2 - re) Md 2Me | bad ]ul 7/14/04 14.7 81,1 844.0 16.3 soiv s--5sie .lul 13.3 73.4 1040.0 16.1 rr - [ AuAug(ust-0af 7,0 33.00 1 410,4 0 1 02 |000 a | 8/4/04 alka rt 2 WC TIE 6.3 G74] 2,7 421.0 SEEITATSSH EUS 9/1104 6.8 8.0 31,6 0,3 7,3 7.9 32.7 0.3 - --OctoOObcctteoorbb.eerr0--400]44 1100//1133//00[44[0os0d.4 I T 0.4 tt1o.o0 1.0 112202106.60|1o00s5.5 0.5 [0045 ] 21.0 - Rl we NovembeF-04 9.9 EEE IS SEES NovembeF-04 11/11/04 9 ,3 32.8 90.2 0.8 32,5 125.0 0.9 _ |EDeTcemE ber.04] ey [2sT285[ToSoiT[15a[aoo] He I 1 Xo December-04 7.8 a December-04 12/1/04 7.2 28.3 99.1 1,5 29.0 139.0 1.3 22000044 Average 89 | 324 C[217A 7| E 11 XH 2004 Average 575 52 | wi | Biel | an 2004 STD 8.g 32.4 217.7 1.1 5,7 37.4 316.1 Ste: NPDES aot divas clan om Sh ar sunrise Source: NPDES analytical data was obtained from 3M and summarized in this table. 77h - erorohesanolc acid PFHA - PeWluorohexanoic acid ~ ST" StandardDeviation STD - Standard Deviation | 7.4 10.0 -- 4-38 22009955..00110000 I3MMAA0011555511887777 r TTaabbllee 44-1122 `Summaryof NPDESFGAnaytcal Data - 2005 Summary of NPDES FC Analytical Data - 2005 -r o_o one |T [CEarbEoxyoia|tesouer||C soumtyl|foeny ates| January-05 rr IEC i a Januan/-05 SSaammppllee Date 1/12/05 PPCFFaHHrbAAo|~:yPlPaFFtOOesA (ppb) (ppb) 7.8 19.2 7,5 20,0 PPFFBBSS |SulPPfoFFnHHaSStes (ppb) (ppb) 96.1 1.5 80.9 1.1 FPFOOS (ppb) 1.5 1.6 [--rebruanyos} Lia[22[ssi [1[55] r Erebriengal 2/3 --iro----355172315051] February-05 2/3/05 13.4 22.2 75.1 1.9 3,5 ~e~brua ry-05 14,0 23.8 72.3 1.9 4,1 ~- I re lo2 XC 2 March-05 March-O~ " 3/10/05 2211,11 [262622.00 [11a455.00|228.8 | 77.,33 | 20.7 264.0 151.0 3,0 7.8 Drse ao [iedTze1[ses I 25[a0 | 4/7/05 14.4 26,1 186,5 2.8 4,0 7% 52 ero --5a s--T--i1] 13,9 24.7 167,0 2,8 4.1 mz Ma Ma IC 5/5/05 - -- [es[aus[iro [ 50 [0,1 .lune-05 -- Ii a June-05 6/9/05 r oof [ss[ser[a6|24 1 1561 --r Jul, LC 7/6/05 - E w-- eons [2s [1 Auc [ot2t[tieLeo | Auc 8/18/05 4,7 4,8 6,5 6.6 ww 5.7 5.9 5,7 6,0 4,3 4,3 41.9 48.0 46.7 42.4 32.0 28.4 276,0 2.6 308,0 2.5 161.0 3.0 158,0 3.2 2 43.6 50.7 2.4 2.3 12.3 1,8 11.0 1.8 | 15.6 13.7 r | O ASeGpAter mber-05] 5MdSA 9/15/05 [ 0.4 |0 11,22 [4 778 .8 | 00.56 | I i 2 SOa STH 0,4 1,2 7.7 0.6 00a ea | - OOccttoobbeerr-00s5] 1100//66//0055 FSoC0.s8 TC i1o.9 [776.4 Ic o0e.4 | 0s | October-05 0.8 1.9 7.4 0.4 = rs November-05 November-05 11/2/05 wm 5.8 5.5 66.6 52,5 26.8 25,8 2,2 2.2 si] [iz |oo[326 | 11 I 04] December-05 12/7/05 1,2 0,9 32,6 1.1 - ESSECR E dl J December-05 1.2 0.9 35.0 1.1 poarmmo0 A EeeSO Sv ps Td roa] 2005 Average |[nwEI 2005 STD 7.3 43.2 89.4 1.9 5,2 6.1 71.9 88.2 0.9 4,6 Stes NPDESaay dtwscto en odsuedin os ale Source: NPDE3 analytical data was obtained from 3M and summarized in this table. 0 Prtuoroheancaiccd PFHA - Perfluorohexanoic acid - STO Standard Devition STD - Standard Deviation wn4-39 22009955..00110011 33MMAA0011555511887788 _ `TThhee mmoosstt rreecceenntt rraannggeess ooff mmoonntthhllyy aavveerraaggee FFCC ccoonncceennttrraattiioonnss ddeetteecctteedd iinn 22000055 aarrce:: PPFFOOAA -009.9 (to0226633ppppbb,, PPFOFS---O00..44Sftoo 1144..77ppppbb,, PPFFHHSS --- 00..441to0 3.13.1ppppbb,, aanndd PPFBES-B- 77S..44 _ 1to0229922 ppppb. 44..44.22 MMiissssiissssiippppii RRiivveerr 44.44.22.11 SSeeddiimmeenntt IInntthhee MMisisssiissssiippppii RRiivveerr,, tthhee hhiigghheesstt aavveerraaggee sseeddiimmeenntt ccoonncceennttrraattiioonnssooffPPFFOOSS ((88..2288 ppppbb)) - aanndd PPFFOOAA ((1133..22 ppppbb)) wweerree ddeetteecctteedd aatt ssaammppllee llooccaattiioonn RR33,, wwhhiicchh iiss aaddjjaacceenntt ttoo tthhee `ooppeerraattiinngg ppllaanntt ppoorrttiioonn ooff tthhee 33MM pprrooppeerrttyy.. TThhiiss wwaass tthhee oonnllyy llooccaattioonn aatt wwhhiicchh PPFFBBSS - aanndd PPFFHHSS wweerree ddeetteecctteedd.. TThhee ffoolllloowwiinngg iiss aa ssuummmmaarryy ooff tthhee ffiinnddiinnggss aatt tthhee ootthheerr ssaammpplliinngg llooccaattiioonnss,, wwhhiicchh aarree sshhoowwnn iinn FFiigguurree 44.-99:: RnRlo1t qaaunnaddntRRi2f2ia--blAAevv(eeNrraQagg)ee sseeddiimmeenntt ccoonncceennttrraattiioonnss ooff PPFFOOAA aanndd PPFFOOSS wweerree NNDD oorr not quantifiable (NQ). R R4 - - AAvveerraaggee sseeddiimmeenntt ccoonncceennttrraattiioonnss ooff PPFFOOAA aanndd PPFFOOSS wweerree nnoott qquuaannttiiffiiaabbllee NNQQ.. + RpRpS5b,-~reAAsvpveeercrtaaiggveeelyss.eeddiimmeenntt ccoonncceennttrraattiioonnss ooff PPFFOOAA aanndd PPFFOOSS wweerree 11..1133 aanndd 66..1133 ppb, respectively. + pRRpG6b,--rAAesvvpeeercraatiggveeelssye.eddiimmeenntt ccoonncceennttrraattiioonnssooff PPFFOOAA aanndd PBFFOOSS wweerree NNDD aanndd 11.3355 ppb, respectively. 44.44.22.22 SSuurrffaaccee WWaattoerr IInn tthhee MMisisssiissssiippppii RRiivveerr,, PPFFOOSS aanndd PPFFOOAA wweerree NNDD oorr NNQQ aatt llooccaattiioonnss uuppggrraaddiicenntt oorr ~ aaddjjaacceenntt ttoo tthhee ooppeerraattiinngg ppllaanntt l(looccaattiioonnss RRI1 ttoo RR44)) aass ddeeppiicctteedd iinn FFiigguurree 449-9.. HHoowweevveerr,, PPFEBBSS aanndd PPFFHHSS wweerree ddeetteecctteedd aatt llooccaattiioonn RR22 aaddjjaacceenntt ttoo tthhee ppllaanntt wwiitthh aavveerraaggee _ ccoonncceennttrraattiioonnssooff00..005500 aanndd 00..007777 ppppbb,, rreessppeeccttiivveellyy.. TThhee hhiigghheesstt ccoonncceennttrraattiioonnssooffFFCCss wweerree ddeetteecctteedd aatt ddoowwnnssttrreeaamm llooccaattiioonn RRSS.. TThhee aavveerraaggee ddeetteecctteedd PPFFOOSS,, PPFFOOAA,, aanndd ~ PPFFBBSS ccoonncceennttrraattiioonnss aatt tthhiiss llooccaattiioonn wweerree 00..005988,, 00..113322,, 00..009977 ppppbb,, rreessppeeccttiivveellyy.. TThhee ddeetteecctteeddPPFFtH-ISS ccoonncceennttrraattiioonn aatt llooccaattiioonn RRS5 wwaass NNQQ.. CCoonncceenntrtraattiioonnssooff FFCCss ddeetteesctteedd iinn - tthhee ffaarrtthheesstt ddoowwnnssttrreeaamm ssaammppllee llooccaattiioonn RR66 wweerree NNQQ oorr NNDD.. Costonesse er a0 4-40 22009955..00110022 33MMAA0011555511887799 ~ 44.55 MMIISSSSIISSSSIIPPPPIIRRIIVVEERR FFIISSHH SSuummmmarairieess ooff FFCC ccoonncceennttrraattiioonnss iinn tthhee ffiisshh wwhhoollee bbooddyy aanndd ffilleet ttiissssuuee ssaammpplleess aarree r pprroovviiddeedd iinn TTaabblleess 44--1144 aanndd 44--1155.. AA ccooppyy ooff tthhee aannaallyyttiiccaall ddaattaa ppaacckkaaggeess ((wwiitthhoouutt aappppeennddiicceess)) iiss pprroovviiddeedd in AAppppeennddiix DD.. - + TTiisssuuee ssaammppllee mmaassss wwaass lliimmiitteedd ffoor ssoommee wwhhoollee bbooddyy aanndd flielett ssaammpplleess ffrroomm ssmalallleer bluegill sunfish and smallmouth bass specimens in the sample group necessitating analysis bluegill analysis of1 gram aliquos for these samples instead of$ ram aliquots as sunfish and smallmouth bass specimens in the sample group of 1 gram aliquots for these samples instead of 5 gram aliquots as necessitating ssttaatteedd iinn tthhee ~ FC FC WWoorrkk PPllaann.. BBeeccaauussee rreeccoovveeriress ooff PPFFOOAA mmaattrriixx ssppiikkeess iinn tthhee 1 1 ggrraamm aalliiqquuoott ffiisshh ~ samples ssaammpplleess wweerree bbeellooww aacccceeppttaannccee are not reported (NR) In ccrriitteerriiaa,, PPFFOOAA. order to provid rreessuultlsts., ffoorr tthhessee iinnddiivvidiudaul ssppeecciimmeenn e quantitative results representative of the sample types and locations, samples are not reported (NR). the sample types and locations, composite In order to composite samples provide samples of the remaining tsi homogenate quanttafive results representative of of the remaining tissue homogenate - ffrioomm ecaacchh ooff tthheessee 1177 ffiisshh ssaammpplleess wweerree pprreeppaarreedd ffrioomm lliikkee ssppeeccieis,, ssaammppllee ttyyppee aanndd individual fih tissue samples. 7 llooccaattiioonn yyiieellddiinngg 66 ccoommppoossiitte sammpplles (see TTaabblle 44--1133)).. AAnnaallyysseess ooff PPFFOOAA iinn tthhee ccoommppoossiittee ffiisshh ssaammpplleess mmeett aacccceeppttaannccee ccrriitteerriiaa aanndd aarree rreeppoorrtteedd wwiitthh tthhee rreessuullttssoofftthhee individual fish tissue samples. - PPFFOOAA ccoonncceennttrraattiioonnss iinn wwhhoolle body ttiissssuue sammppllees ffrroomm tthhe uupppeerr rreeaacchh ((RReeaacchh 11)) . `uuppssttrereaammooftf thhee 33MM ffaacciilliittyy rraannggeedd ffrroomm 00..881 ngg//g (ppb) in a cchhannnneell ccaattffiisshh ssaammppllee ttoo n from Reach 1 ranged 11..5522 ppppbb iinn aa bblluueeggiillll from Reach 1 ranged fom 11.0 gig sunnffiish sammppllee.. from 11.0 ng/g (ppb) PFOS (ppb) in channel cats sample to 754 pb in coonncceennttrraattiioonns iinn wwhhoollee bbooddyy ttiissssuueessaammpplleess in a channel catfish sample to 75.4 ppb in a _ bblluueeggiillll ssuunnffiisshh ssaammppllee.. FFiilleet ttiissssuuee all channel catfish samples end the PPFFOOAA rreessuullttss ffoorr bluegill sunfish c RReeaacchh omposi 11 rraannggeedd ffrroomm nnoonn--deetteectt te sample to 0972 ppb in iinn a smallmouth all channel smallmouth bas fie tissue catfish samples bass filet tissue sample. and the sample. PFOS concentrations in the Reach bluegill sunfish composite sample PFOS concentrations in the Reach to 1 1 0.972 ppb in a ssaammpplleess rraannggeedd _ from from 22..3344 ppppbb iinn aa cchhaannnneell ccaattffiisshh ssaammppllee ttoo 117788 ppppbb iinn aa ssmmaallllmmoouutthh bbaassss ssaammppllee.. BBlluueeggiillll ssuunnffiisshh ffiilleett ttiissssuuee ssaammpplleess ffrroomm RReeaacchh 11 ccoonnttaaiinneedd 3300..33 aanndd 3322..33 ppppbb PPFFOOSS,. ~- adjacent to the 3M facility ranged from 0.774 pp in channelcatfishsample 0 37.9 pps PPFFOOAA ccoonncceennttrraattiioonnss iinn wwhhoolle body ttiissssuue sammpplles ffrroomm tthhee mmiiddddllee rreeaacchh ((RReeaacchh33)) adjacent to the 3M facility ranged from 0.774 ppb in a channel catfish sample to 37.9 ppb - iinn aa bblluueeggiillll ssuunnffiisshh ssaammppllee.. PFOS coonncceennttrraattiioons in wwhhoollee bbooddyy ttiissssuuee `ssaammpplleess ffrroomm RReeaacchh 33 rraannggeedd ffrroomm 1122..66 ppppbb iinn aa cchhaamnnneell ccaattffiisshh ssaammppllee 0to 99000000 ppppbb iinn aa bbiluueeggiillll = ssuunnffiisshh ssaammpplele.. TThhee ootthheerr four bblluueeggiilll suunnffish wwhhoolle body ssaammpplleess ffrroomm tthhiiss rreeaacchh cm--------------" po 4-41 - 33MMAAO011555511888800 22009955..00110033 _ TTaabbllee 44--1133 CCoommppoossiittee FFiisshh SSaammplpeless. CCoommppoossitteSSaammppllee 1ID0 aanndd Deserpion Descript'ion | iarsampie Initial Sample 0 ID ] lo[CoRGheMNo-NFn1-oFt0Bu-1e-1g1iLiLMMFsFCuC.-0n0.-t00850l0e88t11c22omposite [CICcoGoFMm0N1-oF-r01.1U-11MLLFMM0FF2o0.1100-000-5055000888111222 Reach 1 Bluegill sunfish filet composite CGMN-F01-1LMF02-0-050812 [Reac3h Buogil unfih ltcompose [Com o1.30MF020050812 - |CCGGMMNN--FFO011--33LLMMFFCC--00--005500881122 |CCGGMMNN--FFO011--33LLMMFF0011--00.-005500881122 Reach 3 Bluegill sunfish filet composite CGMN-F01-3LMF02-0-050812 = lc[CoRGemaMcyhNs'-soF0Sr1m.-o3wlMomDoruFctC0n-b00a-s0s05088l11o22t compose |(CcCGoGMmMNNo--F1F0.O19T-MS3DNMFDD0FF100.210.-0.0-000555000888111222 Reach 3 Smallmouth bass filet composite |CCGOMMNN--FF0O13-M3MDFDOF30.20-0.-005500881122 :CGMN-F01-3MDF03-0-050812 lc[CoRGemaMncNhs-5oFr0B1.u-5sLeLMwsWcunC-f-oi0ss-h005wh80o81l12e2 body composite (|CCCGGOMMMNNN.F-FF0O01T1---55SLLLMMAWW WOG0121--000..-000555000888111222 - Reach 5 Bluegill sunfish whole body composite [C|CCOCGGOMMMMNNNN-.F--FFFO00OT111s--.SSLSLLMMMMWWOW WO#300-.2300--.00.--000055550000888811112222 |Comnor. suas 0.050812 CGMN-F01-5LMW04-0-050812 CGMN-F01-SLMW05-0-050812 eachs veg sunfish et composi |Com or.5UMFo0z.0050812 = |CCGGMMN-NF-OF10-15-5LLMMFFC-C0-0--005500881122 |CCGGMMNN--FFO011--55LLMMFF0011--00--005500881122 Reach 5 Bluegill sunfish filet composite CGMN-F01-5LMF02-0-050812 - [[CRcGeoMowNcn5h-FFo0St1m-ee5lMumDDauFFtCch-.b0-a00s05s088l11e22t compose ||CcCGoOMuMNNN.F-FF00o11..-6G5MMMDDDFFO0F120..100-0..-000555000888111222 Reach 5 Smallmouth bass filet composite |CCGOMMNN--FF0O1--S5MMDDFFO032.-00-005500881122 CGMN-F01-SMDF03-0-050812 a24-42 22009955..00110044 33MMAAO011555511888811 Sl iia Hh I _ [il o g 2 MiZeeicialoisiaigisl AEE is 3 l I l Sil E ifh ml R are EEL IE li ii [ElE iked R EEE (aHiIf -- 20950105 2095.0105 33MMAA0011555511888822 - i TI] TEER SC O iE tia ERLE EE E gEl Af ia el RBE Ep it uml] _ : iil il i HERE Ee apasae ii - {| IIIT I REG) -Cui E nl Ewl mn il CWE LH ] ni | biti 823 20950106 2095.0106 33MMAA00115555118883 contained PFOS at concentrations ranging from 55.4 and 334 ppb. Filet tissue PFOA creosnutlatisnefdorPRFeOacSh a3t icnocnlcuednetdrantioonn-sdertaentginfogr farlol mcha5n5n.e4l acnadii3s3h4sapmppbl.esF,ile0t.5t8isspupebPiFn OthAe rsemsaulltlsmofuotrhRebaacshs 3fiilnetclucdoemdponsiotne-destaemcpt lfeoraanldl ch3a2n1nepl pcbatfiinshtshaembplluecsg,il0l.58supnfpibshinfithleet scmomaplolmsietuethsambpalses. fPilRetOScocmonpcoesnitteatisaomnspilen Raenadch3.3f2i! lpepsb uine tshaempblleusegrailnlgesdunffrisohm 5f.il6e0t cpopmb pionsiate cshaamnpnleel. PcaFtOfiSshcosnacmepnlterattioons13in20Rpeapcbh i3nfialetstmiasslulemosuatmhplbeassrsansgaemdplfer.omPR5.O6S0 pcopnbceinntraaticohnasnnienlblcuaetgfiilslh s~uanfmipslhe fitloet 1i3s2s0uepspabmpilnesa fsrmomallRmeoaucthh3bwae~resa5m9.p7lea. nPdF7O0S9 concentrations in bluegill sunfish filet tissue samples from Reach 3 were 59.7 and 709 porpbb.. PPFEOOAA ccoonncceennttrraattiioonnss iinn wwhhoollee bbooddyy ttiissssuuee ssaammpplleess ffrroomm tthhee lloowweerr rreeaacchh ((RReeaacchh 55)) ddoowwnnssttrreeaamm ffrroomm tthhee 33MM ffaacciilliittyy wweerree 11..4411 t1o0.22.5544 ppppb iinn tthhee cchhaannnneell ccaattffiisshh wwhhoollee bbooddyy ssaammpplleess aanndd 00..660000 ppppbb iinn tthhee bblluueeggiillll ssuunnffiisshh wwhhoollee bbooddyy ccoommppoossitie ssaammppllee.. PPFFOOSS ccoonncceennttrraattiioonnss iinn wwhhoollee bbooddyy ttiissssuuee ssaammpplleess ffrroomm RReeaacchh 5$ rraannggeedd ffrroomm 3399,99 ppppbb iinn aa cchhaannnneell ccaattffiisshh ssaammppllee ttoo 662299 ppppbb iinn aa bblluueeggiillll ssuunnffiisshh ssaammpplele.. FFiilleett ttiissssuuee PPFFOOAA rreessuullttss ffoorr RReeaacchh 5 iinncclluuddeedd nnoonn--ddeetteeectt tto 11..7711 ppppbb iinn cchhaannnneell ccaattffiisshh ssaammpplleess,, 00..550044 ppppbb iinn tthhee bblluueeggiillll ssuunnffiisshh ffiilleett ccoommppoossiittee ssaammppllee aanndd 11..0044 ppppbb iinn tthhee ssmmaallllmmoouutthh bbaassss ffiilleett ccoommppoosisittee ssaammpplele.. PPFFOOSS ccoonncceennttrraattiioonnss iinn RReeaacchh 5 ftfilet ssaammpplleess rraannggeedd ffrroomm 22.86.8p6pppbb iinn aa cchhaannnneell ccaattffiisshh ssaammppllee (to0 55115500 ppppbl iinn aa ssmmaallllmmoouutthh bbaassss ssaammppllee.. PPFFOOSS ccoonncceennttrraattiioonnss iinn bblluueeggiilll ssuunnffiisshh fiilleet itissssuuee ssaammpplleess ffrroomm RReeaacchh 55 wweerree 333311 aanndd 333300 ppppbb.. Crmm---------- a5 4-45 22009955..00110077 I3MMAA0011555511888844 55.. RREEVVIIEEWW OOFF DDOOCCUUMMEENNTTAATTIIOONN OONN HHIISSTTOORRIICCAALL WWAASSTTEE _ DDIISSPPOOSSAALL SSIITTEESS 55.11 FFIILLEE RREEVVIIEEWW AA ffiillee rreevviieeww wwaass ccoonndduucctteedd bbyy WWEESSTTOONN iinn JJaannuuaarryy aanndd AApprriill ooff 22000055.. IInn aaccccoorrddaannccee - wwiitthh tthhee FFCC WWoorrkk PPllaann,, tthhiiss rreevviieeww wwaass ccoonndduucctteedd ttoo ccoolllleecctt iinnffoorrmmaattiioonn oonn tthhee hhiissttoorriicc 33MM CCoottttaaggee GGrroovvee ffaacciilliittyy wwaassttee ggeenneerraattiioonn,, wwaassttee ddiissppoossaall,, oorr ttrreeaattmmeenntt bbootthh oonn--ssiittee aanndd - ooffffs-istiete.. - IInn JJaannuuaarryy 22000055,, WWEESSTTOONN rreevviieewweedd 33MM ffiilleess ffoorr tthhee CCoottttaaggee GGrroovvee ffaacciilliittyy.. SSuubbsseeqquueennttllyy,, iinn MMaarrcchh 22000055,, WWEESSTTOONN rreeqquueesstteedd ffrroomm tthhee MMPPCCAA aa lliistt ooff aarrcchhiivveedd - fiillees aanndd tthhee ssiizzee ooff aaccttiivvee ((nnoonnaarrcchhiivveed)) ffiilleess ffoorr tthhee ffoolllloowwiinngg ssiitteess:: WWaasshhiinnggttoonn CCoouunntyty. LLaannddfiflilll,, 33MM CChheemmoloilittee//CCootttaaggee GGrroovvee ffaacciilliittyy,, 33MM OOsakkddaallee SSiittee,, WWooooddbbuurryy SSiittee,, - Kerriek (Pine County Landfil), and the Commercial Chemical/Pollution Control, Tn. Kerrick (Pine County Landfill), and the Commercial Chemical/Pollution Control, Inc. ((PBCCHI)) ffaacciilliittiieess., Iinn AApprriill 22000055,, WWEESSTTOONN rreevviieewweedd MMPPCCAA aanndd 33MM ffliiless ffoorr tthheessee ssiitteess.. - Documents that WESTON tagged for review included those that could possibly provide Documents that WESTON tagged for review included those that could possibly provide iinnffoorrmmaattiioonn oonn wwaassttee ggeenneerraattiioonn aanndd ddiissppoossaall oorr ttrreeaattmmeennt.t. TThheessee iinncclluuddeedd rreegguullaattoorryy - ccoorrrreessppoonnddeennccee,, ppeerrmilists,, ssiittee aasssseessssmmeenntt rreeppoorrttss,, ssiitee rreemmeeddiiaattiioonn rreeppoorrttss,, ssiittee cclloossuwree rreeppoorrttss,, ppeerrssoonnaall nnoottess,, ssiittee ddrraawwiinnggss,, sskkeettcchheess,, eettcc.. "The findings from the fle review, relativtoe the off-site waste disposal locations utilized The findings from the file review, relative to the off-site waste disposal locations utilized - by the Cotage Grove fasility were submited to the MPCA during a June 10, 2005 by the Cottage Grove facility were submitted to the MPCA during a June 10, 2005 `mmeeeettiinngg aatt tthheeiirr ooffffiicceess.. TTaabbllee 55--11 iiss aa ssuummmmaarryy ooff tthhee ffiinnddiinnggss rreeggaarrddiinngg tthhee wwaassttee - disposal locations utilized by Cottage Grove. Following the meeing, 3M and WESTON disposal locations utilized by Cottage Grove. Following the meeting, 3M and WESTON had a conference call with MPCA on June 13, 2005 regarding additonal information that had a conference call with MPCA on June 13, 2005 regarding additional information that - had been obtained on the Commercial Chemical Company/Pollution Controls, nc. (PCI) had been obtained on the Commercial Chemical Company/Pollution Controls, Inc. (PCI) ssiitteess iinn NNeewwpporotrt,, MMiinnnneessoottaa aanndd SSaavvaaggee,, MMininnneseosotata.. TThhiiss aaddddiittiioonnaall iinnffoorrmmaattiioonns! - ddooccuummeenntatattiioonn sshhoowweedd tthhaatt FFCC--rreellaatteedd wwaasstteess wweerree nnoott ddiissppoosseedd aatt eeiitthheerr ooff. tthheessee locations and that all FC-related wastes for the fime period of interest (i. 1960-1971) locations and that all FC-related wastes for the time period of interest (i.e. 1960-1971) - wweerree eeiitthheerr ddiissppoosseedd aatt tthhee WWooooddbbuurryy SSiitte oorr oonn--ssititee.. E:~FOLDERS.0-gk3m-cottage gr~ve~FC Da!aAssessm~nt Repot~t\Final.doc 51 5-1 22009955..00110088 33MMAA0011555511888855 Co oy 2 [5 TRE ee CEE nial | 5 ERE [22]: 13 gE #38818- [isd il o > gies gE33 f Phi | 88 [HEE TE SFr0 LL beg of EE2(N EE - 3gi1gd Fa E T E EE P TsE gAlnE gl? SR pl he ole EEL gaY g h sd TT ETTy 8 ee 1h |e Jag] Pil - Marla deh 0s] 3 [iss 18] o~ i HERIR | Bs | 5 3 CO : iPFala E FD BE RRER eEE n5| | Hs Z | HARE ITiligt $F5aR 1 T bLla e|] I1 - FGe BU REE BH ede | 1 CL~Z 22009955..00110099 33MMAA0011555511888866 55.22 IINNTTEERRVVIIEEWWSS WWIITTHH FFAACCIILLIITTYY PPEERRSSOONNNNEELL - WWEESSTTOONN iinntteerrvviieewweedd ccuurrrreenntt aanndd ffoorrmmeerr 33MM eemmppllooyyeeeess iinn tthhee wwiinntteerr aanndd sspprriinngg ooff 22000055 0to ccoomrroobboorraattee aanndd ssuupppplleemmeenntt tthhee iinnffoorrmmaattiioonn ccolllleectteedd ffrioomm tthhee ffillee rreevviieeww oonn tthhee - hHiissttoorriicc 33MM CCoottttaaggee GGrroovvee fei facility wwaasgttee ggeenneerraattiioonn,, wwaasgttee ddiigsppoossaall,,aanndd ttrreeaattmmeenntt. AAnneeww iitteemm ddiissccuusssseedd dduurriinngg tthhe ffaacciilliittyy ppeerrssoonnnneell iinntteerrvviieewwss wwaass tthhee ppoossssiibbllee eexxiisstteennccee ooff a ffoorrmmeerr oonn--ssiittee sslluuddggee ddiissppoossaall ppiitt,, wwhhiicchh wwaass ooppeerraatteedd pprriioorr 1to0 tthhee DD22 -~ FFoorrmmeerr _ SSlluuddggee DDiissppoossaall AArreeaa.. NNoo ddooccuummeenntatattiioonnooffttihis~ ppiit wwaass eevviiddeenntt iinn tthhee ffiillee rreevviieeww aanndd iitt hhaass nnoott hbeeeenn aasssseesssseedd.. IIttiss uunncceerrttaaiinn wwhheenn ooppeerraattiioonnss aatt tthhee ffoorrmmeerr sslluuddggee ddiissppoossaall ppiitt ssttaartteedd.. TThhiiss ffoorrmmeerr oonn--ssiittee ssluudggee ddiissppoossaall ppiitthhaassnnoowwbbeeeenn ddeessiiggnnaatteedd a1ss DDSg). es E:\FOLDERS.0-9\3n~-cottage grove\FC Data Assessment Re0o~\Final.doc 5-3 22009955..00111100 S3MMAA0011555511888877 66.. DDAATTAA AASSSSEESSSSMMEENNTT AANNDD IIDDEENNTTIIFFIICCAATTIIOONN OOFF DDAATTAA NNEEEEDDSS `TThhee ffoolllloowwiinngg sseeccttiioonnss pprroovviiddee aann oovveerrvviieeww,, bbyy mmeeddiiuumm,, ooff tthhee rreessuullttss aanndd oobbsseerrvvaattiioonnss _ ooff tthhee 33MM CCoottttaaggee GGrroovvee ffaacciilliittyy FFCC aasssseessssmmeentn.t. TThhee oovveerrvviieeww iiss ffoolllloowweedd bbyy aa ddeessccrriippttiioonn ooffaaddddititiioonnaall ddaattaa nneeeeddss,, wwhheerree tthheeyy hhaavvee bbeeeenn iiddeennttiiffiieedd. - 66..11 GGRROOUUNNDDWWAATTEERR - CCototttaaggeeGGrroovveeFaFcaicliiltiyty- IItt wwaass ffoouunndd tthhaatt tthhee ggrroouunnddwwaatteerr aannaallyyttiiccaall ddaattaa ccoolllleecctteedd ffrroomm 22000033 t1o0 221030055 uunnddeerr tthhee LLOOYI pprrooggrraamm wweerree ccoonnssiisstteenntt wwiitthh tthhee ggrroouunnddwwaatteerr ddaattaa ccoolllleeccteedd - uunnddeerr tthhiiss FFCC aasssseessssmmeentn.t. NNoo FFCCs wweerree ddeetteecctteedd iinn tthhee wwaatteerr ssaammppllee ccoolllleecctteedd ffrroomm tthhee BBuuiillddiinngg 111166 ccaaffeetteerriiaa ttaapp. - "TThheewwatateerraat tthhiiss llooccaattiioonn iiss ttrreeaatteedd wwiitthhggrraannuullaarraaccttiivvaatteedd ccaarrbboonn ppriror(it0ouousrs.e. - `TThhee hhiigghheesstt FFCC ccoonncceennttrraattiioonnss wweerree ddeetteecctteedd iinn ggrroouunnddwwaatteerr ssaammpplleess ffrroomm mmoonniittoorriinngg wweellllss MMWW--1122 ddoowwnnggrraaddiieenntt ooff tthhee DDS5 -~ FFoorrmmeerr SSoolliiddss BBuurmn PPiitt AArrceaa,, MMWW--1144 - ddoowwnnggrraaddiieennttofotf thhee DDS8 -~ FFoorrmmeerr WWaassttee DDiissppoossaall AArrceaa,, aanndd MMWW--110011 ddoowwnnggrraaddiieenntt ooff tthhee DDI1 -~ FFoorrmmeerr HHEF TTaarr NNeeuuttrraalliizzaattiioonn PPiitt.. IInn tthheessee aarreeaass,, PPFFOOAA ccoonncceennttrraattiioonnss rraannggeedd - ffrroomm 115500 t1o0 11,,886633 ppppbb aanndd PPFFOOSS ffrioomm 8800 t0o 332244 ppppbb.. CCoommppaarreedd ttoo tthhee PPFFOOAA ccoonncceennttrraattiioonnss ddeetteecctteedd iinn ggrroouunnddwwaatteerr ssaammpplleess ffrroomm mmoonnititoorriinngg wweellllss MMWW--1122 aanndd MMWW-- - 1144,, lloowweerr ccoonncceennttrraattiioonnss ooff PPFFOOAA wweerree ddeetteecctteedd iinn tthhee ggrroouunnddwwaatteerr ssaammpplleess ffrroomm `momniotorninigwwteelolllssrMMWiW-n1-10g011aannddMMWW-1-02a1atttt0hheeD2DI1 AArrceea. "TThhee hhiigghheesstt FFCC ccoonncceennttrraattiioonnss ddeetteecctteedd iinn ggrroouunnddwwaatteerr ssaammpplleess ccoolllleecctteedd ffrroomm ppuummppiinngg i. wweellllss wweerree ddeetteecctteedd aatt ppuummppiinngg wweellll PPW W--66 ((115555. ppppbb PPFFOOAA).). PPW W--66 iiss ddoowwnnggraraddiieenntt ooff tthhee DD88 AArreeaa.. GGrroouunnddwwaatteerr eelleevvaattiioonn ddaattaa ccoolllleecctteedd ffrroomm tthhee mmoonniittoorriinngg wweellllss iinn MMaarrcchh _ 22000055 sshhooww tthhaatt tthhee iinnfflluueenncceeooff tthhee ppuummppiinngg wweellllss iiss mmoosstt ssiiggnniiffiiccaenntt iinn tthhee cceennttrraall ppllaanntt aarreeaa aanndd iiss rreedduucceedd wwiitthh iinnccrreeaassiinngg ddiissttaannccee ffrroomm tthhiiss aarreeaa.. - WWiitthh rreessppeecctt ttoo ggrroouunnddwwaatteerr aatt tthhee 33MM CCootttaaggee GGrroovvee ffaaciililty,, tthhee ffoolllloowwiinngg ddaattaa nneeeeddss hhaavvee bbeeeenn iiddeennttiiffiieedd:: a IE:~FOLDERS,O-9\3m-cottag grovekFC Data ~ As;essment Report\Final.doe 66-11 22009955.0.10111 33MMAA0011555511888888 - TsThlheuedgffeiilledeisrrepevovsiieaewlw paiatnndd(D9pp)ee,rrsswoohnninnecelhl hiinnattdeerrnvvoiiteewbwesseiinnnddaiisccsaaettseesddedtthhpaartetvtithhoeeurrseely.mmaaTyyhibbsee iaas lffooocrrammteeedrr . tbbshleeuettdwwDgeee9eenndAittrshhpeeeao.wswaaalsGstprteeiotwwua(naDttdeegwrr)a,ittrwreeerahatimqmcuheeannlhtitatdppyllanaannontttdaabnnmeddeonvtthehaeemsseDDen22stsAAerdirneepaatrheaaevnniddaoruwweisailllyllo.fbbeeTthhrreeeisffDeeir9srreelfddoocttraoomteeaadrss stshllueuddDggee9ddAiissrppeooass.aallGppirittouhhanassdwnnooatttebbreeqeeunnacclhhitaayrraaacctntederriimzzeeodd.v.ement in the area of the D9 former : +* TdTohhweengrppaootdteienentntiitaaollf tmmhoeovvDeeSmm,eenDntSt aoonfdf Dgg2rrooAuurennaddsww,aathteaersr nottoto besseuunrrffcaahccaeeracwwtaeatrteiezrre,,d.ppaarrttiiccuullaarrllyy downgradient of the DS, D5 and D2 Areas, has not been characterized. W `Wooooddbbuurryy SSiittee:: OOfftthhee ffoouurr ppuummppiinngg wweellllss aatt tthhee WWooooddbbuurryy SSiittee,, ppuummppiinngg wweellll RR44 ccoonnttaaiinneedd tthhee hhiigghheesstt FFCC ccoonncceennttrraattiioonnss ((1199..77--2233..33 ppppbb PPFFHHSS,, 55..7722--1111 ppppbb PPFEBSS,, 22..7788-- - 33..1122 ppppbb PPFFOOAA aanndd 11.8833--22.2299 ppppbb PPFOOS)S.). TThhiis wweellll hhaass tthhee hhiigghheesstt ppuummppiinngg ccaappaacciittyy aanndd iiss tthhee cclloosseesstt ppuummppiinngg wweellll ttoo tthhee mmaaiinn ddiissppoossaall aarreeaa.. AAtt ppuummppiinngg wweellllss RRI1 aanndd RR33,, - ddeetteecctteedd ccoonncceennttrraattiioonnss ooff PPFEBBSS aanndd PPFEHHSS rraannggeedd ffrroomm 00..333377 t1o0 33..4477 ppppbb aanndd 11..0033 ttoo 22..6611 ppppbb,, rreessppeeccttiivveellyy.. PPFFOOAA aanndd PPFROOSS wweerree ddeetteecctteedd iinn tthheessee wweellllss aatt ccoonncceennttrraattiioonnss rraannggiinngg ffrioomm 00..115533 ttoo 22..3333 ppppbb aanndd 00..00556622 ttoo 00..114444 ppppbb,, rreessppeeccttiivveellyy.. NNoo FFCCss wweerree ddeetteecctteeddaatt ppuummppiinngg wweellll RR22,, wwhhiicchh iiss llooccaatteedd ffaurrtthheesstt ffrroomm tthhee mmaaiinn ddiissppoossaall aarreeaa.. FFCCss - wweerree ddeetteecstiedd iinn tthhee ppuummppiinngg wweellll ccoommbbiinneedd ddiisscchhaarrggee aatt ccoommppaarraabbllee ccoonncceennttrraattiioonnss ttoo tthhee ddiisscchhaarrggee ffrroomm tthhee CCoottttaaggee GGrroovvee nnoonn--ccoonnttaacctt pprroocceessss wwaatteerr rreetteennttiioonn ppoonndd.. TThhiiss - iinnddiiccaatteedd tthhaatt aaddddiittiioonnaall FFCCss wweerree nnoott iinnttrroodduucceedd ftoo tthhee wwaatteerr ppuummppeedd ffrroomm tthhee W`Wooooddbbuurryy SSiittee aass iitt wwaass uusseedd aatt tthhee CCootttaaggee GGrroovvee ppllaannt.t. TThhuss,, tthhee ppuummppiinngg wweelllls aatt tthhee - W`Wooooddbbuurryy SSiittee hhaavvee bbeeeenn cchhaarraacctteerriizzeedd aanndd nroo ffuurrtthheerr aasssseessssmmeennttooff tthhee WWooooddbbuurryy SSiittee aappppeeaarrss ttoo bbee wwaarrrraanntteedd aatt tthhiss ttiimmee.. 66.22 SsOoIlL ; TThhee hhiigghheesstt ccoonncceennttrraattiioonnss ooff FFCCss iinn ssooiillss wweerree ffoouunndd inn tthhee DD22 aanndd DDI1 AArreeaass.. IInntthhee DD22 . --- FFoorrmmeerr SSlluuddggee DDiissppoossaall AArreeaa,, tthhee hhiigghheesstt FFCC ccoonncceennttrraattiioonnss ((uupp ttoo 1122,,335500 ppppbb PPFFOOS"!)) were found in the sludge. Lower concentrations (ranging from 4.39 to 794 ppb PFOS) were found in the sludge. Lower concentrations (ranging from 4.39 to 794 ppb PFOS) wweerree ddeetteecctteedd iinn tthhee uunnddeerrllyyiinngg nnaattiivvee ssooiill, wwhhiicchh ooccccuurrss bbeellooww aapppprrooxxiimmaatteellyy 2200 0to.2255 ft bbgss.. PPFROOSS ggeenneerraallllyy iiss ffoouunndd aatt hhiigghheerr ccoonncceennttrraattiioonnss tthhaann PPFFOOAA iinn tthhee 00 ttoo 2255 fft bbegss N ssooiill ((sslluuddggee)) ssaammppleless.. TItt wwaass aallssoo ffoouunndd aatt hhiigghheerr ccoonncceennttrraattiioonnss ((11,,119955 aanndd 11,,662255 ppppbb)) aatt aa ssuurrffaaccee ssooiill llooccaattiioonn ddoowwnnggrraaddiieennttofotf hthiiss aarreeaa.. PPFFOOAA ggeenneerraallllyy iiss ffoouunndd aatt hhiigghheerr ccoonncceennttrraattiioonnss tthhaann PPFFOOSS aatttthhee lloowweerr ddeepptthh iinntteerrvvaallss ffrroomm 2255tto 5500 fftLbbggss iinn tthhee nnaattiivvee. st tf el 10 he Rs Vo or ss 0 For reference, the Minnesota Department of Health (MDH) has established Soil Reference Values for industrial sites of 200,000 ug]kg (ppb) PFOA and aO,O00 ppb PFO~. Erpa tm st e E:~FOLDERS.0-9\3 m-cottage gmve\FC Data A~sessroent Report\Final doe 6-2 22009955..00111122 33MMAA0011555511888899 soils at th ste was found in he D2 sudge at the 15 to 20 ft bs depth interval. ssooiillss uunnddeerrllyyiinngg tthhee DD22 AArreeaa.. TThhee hhiigghheesstt ccoonncceennttrraattiioonnooff PPFFHHSS ((11,,555500 ppppbb)) ddeetteecctteedd iinn soils at the site was found in the D2 sludge at the 15 to 20 ft bgs depth interval. IInntthhee DDI1 -~ FFoorrmmeerrHHEF TTaarr NNeeuutrtraalliizzaattiioonn PPiit AArreeaa,, tthhee hhiigghheesstt FFCC ccoonncceennttrraattiioonnss ((uupp ttoo - 44,,552200 ppppbb PPFFOOAA)) wweerree ddeetteecctteedd iinn ssooiillss ffrroomm tthhee bboorriinnggss oouuttssiiddeetthheeppiitt iinn tthhee 5$ ttoo 3300 fftt bbggss ddeepptthh rraannggee iinn bboorriinnggss ccoonnssttrruucctteedd jjuusstt oouustsiiddee tthhee llooccaattiioonn ooff tthhee ppiitt ssttrruuccttuurree aanadd ddeeccrreeaasseedd bbeellooww 3300 fft bbggss iinn tthhee nnaattiivvee ssooiillss ((raannggiinngg ffrroomm 553.39.9 ttoo 337755 ppppbb)).. PPFFOOAA ggeenneerraallllyy wwaass ddeetteecctteedd aatt hhiigghheerr ccoonncceennttrraattiioonnss tthhaann PPFFOOSS iinn tthhee bboorriinnggss ffrroommththiissaarreeaa.. - IInn tthhee DDS5 -~ FFoorrmmeerr SSoolliiddss BBuumm PPiitt AArreeaa,, ccoonncceennttrraattiioonnssooff PPFFOOSS ((uupp ttoo 22,,331100 ppppbb)) aanndd PPFFOOAA ((uupp ttoo 11,,337755 ppppbb)) wweerree ddeetteesctteedd iinn ssoiill ssaammpplleess ttoo aa ddeepptthh ooff aapppprrooxxiimmaatteellyy 1155 fftt - `bbgess iinn tthhee oonnee ssooiill bboorriinngg ccoonnssttrruucctteedd iinn tthhiiss aarreeaa.. LLoowweerr ccoonncceennttrraattiioonnss ((3344..55 aanndd 4466..88 ppppbb PPFFOOSS aanndd 2211..88 aanndd 4422..55 ppppbb PPFFOOAA)) wweerree ddeetteecctteedd aatt lloowweerr ddeepptthhss.. SSoommee ggrraavveell,, - aasshh,, aanndd cchhaarrccooaall wweerree nnootteedd iinn tthhee bboorriinngg lloogg ffoorr ssooiillss aa 66 ttoo 1144 fftt bbegss iinnddiiccaattiinngg tthhaatt tthhiiss. bboorriinngg eennccoouunntteerreedd tthhee pprreevviioouuss DDS5 aaccttiivviittiieess ((ii.ec.., bbuumrniinngg)) SSuurrffaaccee ssooiill ssaammpplleess ~ suggest that potential surface transport via erosion i not significant, ccoolllleecctteedd ddoowwnnggraraddiieenntt ooff tthhiiss aarreeaa ggeenneerraallllyy ccoonnttaaiinn lloowweerr FFCC ccoonncceennttrraattiioonnss,, wwhhiicchh suggest that potential surface transport via erosion is not significant. IInn tthhee DDS8 -~ FFoorrmmeerr WWaassttee DDiissppoosssall AArreeaa,, ccoonncceennttrraattiioonnss ooff PPFFOOAA ((uupp ttoo 554433 ppppbbj)aanndd - PPFFOOSS ((uupp ttoo 998833 ppppbb)) wweerree ddeetteecctteedd iinn ssuubbssuurrffaaccee ssooiillss ttoo aa ddeepptthh ooff 1155 fftt bbggss aanndd aatt aa ssuurrffaaccee ssaoiill ssaammppllee llooccaattiioonn ddoowwngnr~aaddiieenntt ooff tthhiiss aarreeaa.. TThhee ssaoiill ddeessccrriippttiioonnss ddiidd nroott 3 iinnddiiccaattee aannyy oobbsseerrvvaattiioonn ooffwwasasttee mmaateterriiaall,, ddiissccoolloorraattiioonn,,oorr ooddoorrss.. . AAlt tthhee FFiirtee TTrraaiinniinngg AArrceaa,, PPFFOOSS wwaass ddeetteecctteedd aatt ccoonncceennttrraattiioonnss uupp ttoo. 11,582200 ppppbb pprriimmaarriillyy iinn sshhaallllooww ssooiillss t0o aa ddeepptthh ooff5 fft bbggss,, wwiitthh ssiiggnniiffiiccaannttllyy lloowweerr ccoonncceennttrraattiioonnss . ddeetteecctteedd aatt lloowweerr ddeepptthhss.. I1t iiss nnootteedd tthhaatt tthhee aarreeaa aarroouunndd bboorriinngg FFTTAA--0033 hhaass bbeeeenn ssuubbssttaannttiiaallll.yy aalltteerreedd wwiitthh tthhee ccoonnssttrruuccttiioonnooff aa nneewwrruunn--ooffffccoonnirtrooll bbaassiinn.. - AAtt tthhee BBuuiillddiinngg 1155 ((llooccaattiioonnooftf thhee ffoorrmmeerr eelleeccttrroocchheemmiiccaall fflluuoorriinnaattiioonn cceellllss)) AArreeaa,, PPFFOOSS. wwaass ddeettecciteedd aatt ccoonncceennttrraattiioonnss uupp oto 883333//990044((dduuppliliccaattee)) pppbb iinn sshhaallllooww ssooiillss ((00--55 112 bbggss)) detecteda a concentration of $05 ppb at a depth of 15 20 ft bgs. A strong odor and - aanndd 11,,886655 ppppbb aatt aa ddeepptthh ooff 2200 ttoo 2255ffit bbggss.. AAtt tthhee FFoorrmmeerr WWaasstteewwaatteerr PPoonndd,, PPFFOOSS wwaass detected at a concentration of 805 ppb at a depth of 15 to 20 fl bgs. A strong odor and rset E:\FOLDER.S.0-9\3ra-cottage gmve\FC Data Asse~sraent P.eportkFinal.doe 6-3 22009955..00111133 33MMAA0011555511889900 hhiigghheerr TTOOCC lleevveell wwaass nnootteedd ffoorr tthhee 1155 ttoo 2255 fftt bbggss iinntteerrvvaall in in the the formerwastewaterpond former wastewater pond bboorriinngg;; hhoowweevvere,r, nnoo vviissuuaall iinnddiiccaattiioonnooffrressiidduue oorr waste waste material material was was noted. noted. SSuurrffaaccee ssooiill ssaammpplleess ((00--66 aanndd 66:-2244 in in bgs) bgs) collected collected in in the the vicinity vicinity of of buildings buildings where where FFCCss wweerree mmaannaaggeedd ((BBuuiillddiinnggss 77,, 1166,, aanndd 25) 25) generally generally indicated indicated higher higher concentrations concentrations of of FFCCss tthhaann ssaammpplleess ccoolllleecctteedd iinn tthhee vviicciinniittyy of of buildings buildings where where FCs FCs were were not not managed managed (Buildings 22, 102, and 112), the incinerator complex, and the D6 -- Former Ash Disposal (Buildings 22, 102, and 112), the incinerator complex, and the D6 - Former Ash Disposal Area, Area. `TThhee ffoolllloowwiinngg ddaattaa nneeeeddss hhaavvee bbeeeenn iiddeennttiiffiieedd for for soilsa soils at the the 3M 3M Cotage Cottage Grove Grove facility: facility: - DDsSi5ze,---hFFaoosrrmnmoeetrrbSSeooelnliidddssefBBiuunrrennd PwPiiittthAArrrceeasa.p.ecTTthhi1iss taahrreeeaaH,,owrwihhzioiccnhhtaiilssepaxpptrpenorotxxiaimnmadtactceollnyyce22ntaarccarrteeissoniinsn - oosofinfzlFeFy,CCshas.a.gseHHnnioeissrtttaooblrreiieaccrnerraede.cceoofirrOnddnessldaaywnnodditnhiiennrffbeooosrrprmmieaancttgtiiotowonnatddshiieddlhonncoooartttizessdohhnooitwnawltaahedixidsstietsantiritnencaactntadlnliidmcmoiisnttociffleoonrrstDDaramS5tpiolbbneuustst fornolym athigsenbeorrai/1ngareexah.ibiOtnedlycoonnceenbtorraitnigonws aosfFloCcsatperdimianrithliysatar0eatoa1n5d bsosisl .samples from this boring exhibited concentrations of FCs primarily at 0 to 15 ft bgs. - DwD8i8th---rFFeosoprremmceterrtWWoat~hsestteehoDDriiiszspopnootssaaalll eAAxrtreeeaan..toDfDuuaeenyttooreaamccaccieensssisniigsssswuuaeesss,i, ctthhbiiussriaaarrlee,aawiihssinncoohtt dwdeaeffsiinnneeoddt ~ pwprrieetvvhiirooeuusssplleyycrrteetmmoootvhveeeddh..orizontal extent of any remaining waste burial, which was not N + DDas99ses-- seFFdoorormrmeecrhrarSSallcuutddeggreeizeDDdiissappnoodssawalilllPPibitt.e. reTTfrehirirssednnteeowwlalsyy thiidedeeDnnt9tiiffAiierededa.aarreeaa has has not not been been assessed or characterized and will be referred to as the D9 Area. 66..33 SSEEDDIIMMEENNTT AANNDD SSUURRFFAACCEE WWAATTEERR - SSeeddiimmeenntt -- FFCCss wweerree ddeetteecctteedd iinn sseeddiimmeenntt.. Generally, upstream levels were less than Generally, upstream levels were less than ddoowwnnssttrreeaamm.. PPFFOOAA sseeddiimmeenntt ccoonncceennttrraattiioonnss iinn tthhee east east cove cove (11.7 (11.7 10 to 28.7 28.7 ppb) ppb) are are comparable comparable to to the the west cove (4.11 10 38.7 ppb). PFOS sediment concentrations in the cast cove (24.2 to west 267 cove ppb) (4.11 to 38.7 ppb). PFOS are higher than at the wseesdtimceonvteco(n1c5en2tration91s.1in tphpeb)e.ast Hciogvheer(24P.F2OtSo - 267 ppb) are concentrations wheirgehedretethctaend iant tthheeshwalelstow csoevdeime(1n5ts.2(0t-o109c1m.1) opfptbh)e. casHt icgohveer tPhaFnOiSn concentrations xvere detected in the shallow sediments (0-10 cm) of tile east cove than in tthhee ddeeeeppeerr sseeddiimmeennttss ((1100--2200 ecmm)).. IInn tthhee MMisisssiissssiippppii RRiivveerr,, aavveerraaggee sseeddiimmeenntt concentrations concentrations at at sample sample locations locations R1, R1, R2, R2, ~ aanndd RR44 wweerree NNQQ oorr NNDD.. AAvveerraaggee sseeddiimmeenntt ccoonncceennttrraattiioonnssooff 8.28 8.28 ppb ppb PFOS PFOS and and 13.2 13.2 ppb PFOA were detected at sample location R3, which is adjacent to the operating plant ppb PFOA were detected at sample location R3, which is adjacent to the operating plant E0 eet me8 c er E:\FOLDERS.O-9~3m-cottage gmvekFC Data Assessment ReportWinal.doc 64 6-4 22009955..00111144 33MMAA0011555511889911 ppoorrttiioonn ooff tthhee pprrooppeerrttyy.. TThhiiss wwaass tthhee oonnllyy llooccaattiioonn wwhheerree PPFEBBSS aanndd PPFFHHSS wweerree detected. detected. StSuufrfaacceeWWataeterr --TThhee aavveerraaggee ccoonncceennttrraattiioonnss ooff FFCCss iinn tthhee eeaasstt ccoovvee wwaatteerr ssaammppllee wweerree - ggrreeaatteerr tthhaann tthhee ccoonncceennttrraattiioonnss ddeetteecctteedd iinn tthhee wweesstt ceo0vvee wwaatteerr ssaammppllee.: IInn tthhee MMisisssiissssiippppii RRiivveerr,, PPFFOOAA aanndd PPFOOSS ccoonncceennttrraattiioonnsswweerreeNNDDoorr NNQQ aat tthheeRR11 tthhrroouugghh RR44 = sampling sampling llooccaattiioonnss.. TThhee oonnllyy qquuaannttiiffiiaabbllee lleevveellss ooff PPFFOOSS aanndd PPFFOOAA ((00..009988 aanndd 00..113322 PpPpDb,, rreessppeeccttiivveellyy)) iinn tthhee wwaatteerr ssaammpplleess wweerree ddeetteecctteedd aat ddoowwnnssttrreeaamm llooccaattiioonn RRSS. RReeggaarrddiinngg tthhee NNPPDDEESS ddaattsa,, iittiiss eevviiddeenntt tthhaatt tthhee ccoonncceennttrraattiioonnss ooff FFCCss iinn tthhee ssiittee hhaavvee ddeeccrreeaasseedd ttrreaatteedd wwaasstteewwaatteerr ddiisscchhaarrggee ssiiggnniiffiiccaannttllyy ssiinnccee 22000000.. WWiitthh rreessppeecctt ttoo sseeddiimmeenmt aanndd ssuurrffaaccee wwaatteerr,, tthhee ffoolllloowwiinngg ddaattaa nneeeeddss hhaavvee bbeeeenn = iiddeennttiiffiieedd:: - + nCCoootnnckecnneotnrwtranat.tiioonnss,, iiff aannyy,,ooff FFCCss iinn ggrroouunnddwwaatteerr eenntteerriinngg tthhee rriivveerr ((ppoorree wwaatteerr)) aarree not known. DisDitviresitrrbiaubrtueitinooonnt,,ikifnfaoanwnyny,, ooff FFCCss iinn ssuurrffaaccee wwaatteerrss aanndd sseeddiimmeenntt eexxtteennddiinngg aaccrroossss tthhee river are not known. 66..44 MMIISSSSIISSSSIIPPPPII RRIIVVEERR FFIISSHH `TThhee aannaallyyttiiccaall rreessuulltss iinnddiiccaattee tthhaatt FFCCss hhaavvee bbeeeenn ddeetteecctteedd iinn ffiisshh ssaammpplleess ((wwhhoollee bbooddyy aanndd ffiilleett)) ccoolllleecctteedd ffrroomm tthhrreeee rreeaacchheess ooff tthhee MMisisssiissssiippppii RRiivveerr iinn tthhee iimmmmeeddiiaattee vviicciinniittyy ooff tthhee CCoottttaaggee GGrroovvee ffaacciilliittyy.. TThhee FFCCss wweerree ddeetteecctteedd iinn ceaacchh ooff tthhee tthhrreeee ssppeecciieess ssaammpplleedd:: CChhaananmeell ccaattffiisshh,, BBlluueeggiillll ssuunnffiisshh,, aanndd SSmmaallllmmoouutthh bbaassss.. T`Thhee ffoolllloowwiinngg ccoonncclluussiioonnss hhaavvee bbeeeenn iiddeennttiiffiieedd ffoorr tthhee MMisisssiissssiippppii RRiivveerr ffiisshh:: TthThheeeMiccusursrriresensntitpdpdaiattRaaissveeett.rreepprreesseennttss oonnee lliimmiitteedd rroouunndd ooff ffiisshh ssaammpplliinngg ccoonndduucctteedd iinn the Mississippi River. - PePMnePdnCdiAinn,ggfuaarnntaahlleyyrttiidcciaasllcuwwssooirrokknsbbmeeaiinnyggbeppeewrraffroorrrammneetdedd oornnelaaatddidvdieitttiiooonnaaadllditffiiisoshhnalssaadmmatppalleensseedbbsyy. tthhee MPCA, further discussions may be warranted relative to additional data needs. E:\FOLDERS 0-9\3r~-cottage groveqeC Data } Assessment Report\Final.doe 66-s5 22009955..00111155 33MMAA0011555511889922 _ 77.. ARRCEETCCIOOOMMNMMEENNDDAATTIIOONNSS FFOORR TTHHEE FFUUTTUURREE CCOOUURRSSEE OOFF ACTION Substantial characterization has been completed at the 3M Cottage Grove facility as part Substantial characterization has been completed at the 3M Cottage Grove facility as part useful fo assessment) were identaindfsihoeuldd be addressed in ontdodeefirne the most a oofftthhee wwoorrkk ccoonndduucctteedd iinn 22000055.. HHoowweevveerr,, ddaattaa nneeeeddss ((aaddddiittiioonnaall iinnffoorrmmaattiioonn tthhaatt wwiillll bbee useful for assessment) were identified and should be addressed in order to define the most recommendations. eeffffeeccttiivvee ppaatthh ffoorrwwaarrdd.. TThheessee aaddddiittiioonnaall ffiieelldd aaccttiivviittiieess aarree pprreesseenntteedd iinn tthhee ffoolllloowwiinngg. recommendations. GGrroouunnddvwaatteerr - downgradient ofthe D2 and DSareas toward the river BBaasseedd oonn aacccceessssiibbililiittyy,, iinnssttaallll aa ttoottaallooffththrreeee ttoo ffiivvee ggrroouunnddwwaatteerr mmoonintiotorriinngg. wweellllss,, iiff ffeeaassiibbllee ((bbaasseedd oonn pphhyyssiiccaall ccoonnssttrraaiinnttss aanndd aacccceessss ccoonnssiiddeerraattiioonnss)),, downgradient of the D2 and D5 areas loward the river. - InFsInotsratmlalellrttwSwlooudttgooettDhhirrseepeeosggarrloouuPnnitddww(aDat9teerrArmmeoaon)nitittooorrdiienntggerwwmeielnlless gaarrrooouuunnndddwattthheeerppqeeurraiilmmieteyttee3rrndoofflttohhwee direction. Former Sludge direction. Disposal Pit (D9 Area) to determine groundwater quality and flow - + cDDoeelffliiennceetintthgheewahhtyyeddrrraaluuelvliieccl accaanppdttuudrrreeawaanndddoweenffffdeeicctttaoofffrppomuummepxpiiisnntgginwwgeelmllolssniPPtoWWrSi5ngaannweddllPPs.WWG6Thbbiyys collecting water level and drawdown data from existing monitoring wells. This mminaacyyinebbreeatoccrooomorardidininntaeatnteeaddnceww.iitthh aa ppllaannnneedd sshhuuttddoowwnn ooff PPWW--66 iinn eeaarrllyy MMaayy dduuee ttoo incinerator maintenance. soil _ DD1S052_5FFLoorbrmmseerorSfoSuloriltiddhsesrBBcuhuarrrmnaPcPittietArAirzereeaat.h IInnesxstttaelanlataonnfaaFddCddsitiiiontntaihlisotthhrnrreeeaae.1lto five five sol soil borings borings to 25 ft bgs to further characterize the extent of FCs in this area. DS - Former Waste Disposal Area. Review information on past survey and D8 - Former Waste Disposal Area. Review information on past survey and rreemmeeddiiaattiioonn aaccttiivviittiieess ccoonndduucctteedd iinn tthhiiss aarreeaa.. BBaasseedd oonn aa rreevviieeww ooff tthhiiss - iinnneffcooerrsmmsaaatrtiiyootnno afaunntddheaarcccdceeesfssisiinbbieillititthyye,,hoddreeittzeeorrnmmtaiilnneeextiifefntaa oggfeeaoonppyhhyyrsseiimccaaalilnissnuugrrvvweeayysewwobouuullrddl bbaeet _ ntthheicssellsoosccaaarttyiiootnno.. further define the horizontal extent of any remaining waste burial at D9 - Former Sludge Disposal Pi. Tastall two tofour sil borings 0 25 f bgs to _ characterize the extent of FCs,if any, in this area D9 - Former Sludge Disposal Pit. Install two to characterize the extent of FCs, if any, in this area. four soil borings to 25 ft bgs to nase E:\FOLDERS 0-9~3m-cottage 8rove\FC Data Assessrneat Repo~a\Final.doc 7-1 22009955..00111166 33MMAA0011555511889933 Pore WaterSuface Water/Sediment Pore Water/Surface Water/Sediment + CCaopolpllrleeoccxttimappioocrrleey 2ww5aatltoeecrratissoaanmmsppillneesstheuuMssiiisnnsggisssishphpaailllloRowiwverhhaaannldod-n-ddgrrtiivhveeennfaciwwleieltlyll shppooorieinnltitssne taaott aapspsreosxipmosastieblyle25grlooucnadtiwoantseirndthisecMhairsgseiss(irpopui gRhivebroarloonngstehdeimfaecnitlistyasnhdorienltionethtoe assess possible groundwater discharge through bottom sediments and into the river. - 20 equally spaced 2sh0oreeqluinaellybestpwaeceend stshaaemmppDlliSinnggArlloocccaaattaiioonnndss taahlleoonneggasaatppppcrrooovxxei.immaattTeehllyeyse44,,00s00a00mpfRlttinoogff TeslohoscctoaairttmeiialooitnnneseszwwobinielleltlowbbfeeeegenerssotttauahbbnelldiiwssDhahte8eeddrAbbdaarisseseeacddhaaoonrnngdetthhtteehoerrheeesesuauilsltvtssercoo.offvaae.fflloowwThnneeestteaannsaaallmyysspiilssinttgoo estimate zone of groundwater discharge to the river. FFMiiWvv-ee 1llo4occaa1tt0iiodoenntsseciitnnattnhhyee grrreeoaauccnhhdwbbaeetttwewreeeednnisctthhhaeergwwee.esstt cove cove and and monitoring monitoring well well MW-14 to detect any groundwater discharge. Collect paired surface water/sediment samples at the following sampling Tocations: Collect paired locations: surface water/sediment samples at the following sampling - - ~ PPoorree wwaatteerr ssaammpplliinngg llooccaattiioonnss (25 (25 samples). samples). East and west coves and associated drainageways (up to 6 samples). - - East and west coves and Collectsurfacewater samples aalsosoncgi_a&tedtrdanraseinctagaecwroasyss t(uhep tMois6sissasmipppleis)R.iver in RRCeeoaallccehhct33//s55uarrafreaecaaee(wesstatiitmemraattseeam1100p--l1e15s5 saalomnpglinag sampling ntroadnesse)c.t nodes). across the Mississippi River in FFiisshhi/Adgquuaattiicc BBiioottaa - + RRDeeepvvaiierewtwmeppneetnnddioinnfgg HMMeaPPlCCthAA(ffMiissDhhHss)aa,mmppMlliiinnnnggerrseeosstuualltss..DepDDaiirsstccmuuesssnstwwioittfhh NMMaPtPCuCrAAa,l, MMRieinsnnoneuersscooettsaa D((fMoMerpDDwaaNNrrRtdRm.))enpptllaaonnssf Hffooerraalatddhddiit(tiiMoonnDaalHl )ff,iisshMh sisnaanmmeppslloiitnnagg Dineptahretmrievnetr in the river otof to dNeatteurrmail neRetshoeuprcaeths determine the path forward. TTaabbllee 77--11 pprroovviiddeess aa ssuummmmaarryy of of the the recommended recommended Phase Phase 2 2 FC FC assessment, assessment, which which would would _ bbee ppeerrffoorrmmeedd uunnddeerr tthhee eexxiissttiinngg HHAASSPP aanndd FFCC WWoorrkk Plan. Plan. Pending approval of his Data Pending approval of this Data AAsssseessssmmeenntt RReeppoorrtt bbyy tthhee MMPPCCAA,, tthhee anticipated anticipated schedule schedule for for major major clemenis elements of of the the Phase 2 assessment includes: Phase 2 assessment includes: + MPCA approval of the Data Assessment Report ~ AprilMay 2006 - *FiMelPdCAwoarpkp,rdoavtalaoafnathlyesiDsa,taanAdscsoemspsimleantitoRne-poMrat -y A10pSrielp/Mteamyb2er00260.06 * Field work, data analysis, and compilation - May to September 2006 + inIntteerriimm PPrrooggrreessssRReeppoorrtt -~ Septem2b0e06r. September 2006. - + Phas2e FC Data Assessment Report- December 2006. Phase 2 FC Data Assessment Report - December 2006. ~ FFiigguurree 77--11 pprroovviiddeess aa bbaarr cchhaarrtt wwhhiicchh shows shows anticipated anticipated performance performance and and completion completion of of iinnddiivviidduuaall aaccttiivviittiieess ffoorr tthhee PPhhaassee 22 assessment assessment program. program. erm E:kFOLDERS.O-9\3m-coltage groveWC Data Assessment R~pon~F~nal.doc 7-2 22009955..00111177 33MMAA0011555511889944 - 23 I=: 2 g 52 02 SE |g 23 | 2 - z 8 &5 F g 2 Hl i, 4 ifr i il1li EshH . . (gB3za85f dtE50% 0i5 s& 2iH3e3EE&i4 - PolElig 2028 & SEBEL 2 |23162 3 ig 3g iis 9 - $0503: (222 3% 3 iid zi SEEEE Js 1 | nd op 35|3EE EC Csi} HEI LE c22|H 8|32I3 22 EfEF |iifigllie3vEd . ~ f ESES|HRlRiE sFgfLE op gfgirEcaEinigiiiailiieidscs 7 aE ERE HEE SF | [FEiefeueiifiiacEiccigyt SPafegiTizEizLraAiiRriiiAysaaaideiliAlyy | - 531 5i5eSeg23sigastinas | i cs Fe PERE REIT . 223835 Iga EEI E I i is sls sels a sls 3 ] 3 P) . x i H3|EFE RR = 1555a%4e 5B3eE%se |$3292443 i i EE%= 532 =LE 5 [822% 8 [i2g23 ii 22009955..00111188 33MMAA0011555511889955 o om AfgIZ iii gy I TI g: oo IVT, Cog 1 Nal 1 ES iLl] [TEEH =oe | LL [TEgs - oo TITTTTT : ;1 g - s 188 1 _ 5Poo 2 d iE i pe l5 Bl%i2lE Lid - geipafigey Bs fHgEiiriiiz2isiE2%ii8d% 83538838332358 22009955..00111199 33MMAA0011555511889966 88.. RREEFFEERREENNCCEE Lindholm, GF, LindholRme,soGur.Fce.,s HHoeefllggteehnnesseeLnno,,wel1.r.O0..S,,i. BBrCrorouousissxsaarrRddi,,veW Wr..LLW,a,teaarnnsddhedFFa,arrrreEelallsl,,t-DDCeF.Fn.t. ra11l9977M44i..nnesWWoatatatee.rr - RHyedsrooulrocgeisc oInfvtehsetigLaotwioenrs HReysdtroonl,oVgiicrgIinnvieastigations Atlas HA-490; U.S. Geological Survey. St. Croix River Watershed, East-Central Atlas HA-490," U.S. Geological Survey. Minnesota. Reston, Virginia. = wwwwwwco.c.ow.awsahsihninggltoonn.mnnu.uss WWeebbssiittee ccoonnttaaiinniinngg ccoouunnttyy llaanndd uussee aanndd ddeemmooggrraapphhiicc iinnffoorrmmaattiioonn.. Stone E:~FOLDERS.0-9\3m-zottage grovekFC Data Assessment Report\Final.doc 8-1 22009955..00112200 33MMAA0011555511889977 - AAPPPPEENNDDIIXX AA WELL EVACUATION/SAMPLING FORMS WELL EVACUATION/SAMPLING FORMS 22009955..00112211 33MMAA0011555511889988 PContedeniltClitrCori+GroveeMission Comqd,mtid Clicm- co,,. : Grove, Mianmota WEff'FON W.O.: 02181.-(N/-010-0001 oats nk_ o DATE: /.~ MARCH 200.~ ~ EVAC'UATION/SA_MI~LING FOI:LM GENERAL INFORM&TION - [Fate yar ems wor | EC AA A LR Sar~lm's Signmure: | - =ee | [o (0gS rate |Well D~amtt~. 6 ittek. - (rere (Cede SE ] - [Covem rcorm er72i 73[n Pag i f){7bo ec i m |i tt|pao > - E~TI)ICATOR ]>ARA.I'viETERS TineYAR 950 11401/14347 130835 |085S logs 0735 GGaellnomspPusrgded] 9 12)1931s[60 1/80 2Bo 47015pc| = [[ STeommpf eeraoturee nymGe (Cr):11n 297924a115(,s 59711e 09.497_ 7160_ 8.7011C 6/9050O661 0 | 71100.737,/0.09 7)15.94 | j0.00 Specific Conductivity Dissolved Ox.'vgen (rag/L): - (175207 72 [4 LH2 1 A77 335 25H27 5 [VowTwedyCRT/)| Visual Tu.t'bidity (L, M, t.I): Im Immom || I] - [1 T7711 I FE | (ror vi God wane vs () NAPL Ob~rved: YES / ors 79 ad ODOR: YES / _ TTS TO OdorTyl~ ( )Soivenz - = Sooo. Tr SAMPLE COLLECTIONINFORMATION sorieoate__ 3/c7ol 1 SAMI~LE DATE: fam Sample No. _ a 1 "wCwr Toa 1 pe ~ 5 id oi { imme pr)[mmm vs wo c tm o]ntSi amoan n tr mre Jol~n Flah~'r'ty S 14-~,.., I -S(,,.'. Time i{ - Zotn ZwgD op Ber EI ator VS T--C i 4, Di IAT 1g TAGEpoe Ren, rem iene re ston, { - TVosiagyeof2uN3s0ca0h5ot7o0p03]15od-887 5F5dgogil t.percfneeicsameonn::_5G3B_D++ (0DB _ || ecb Purge Factors: 0162"- 0.16; 2054"-0.65; Et O R"-2.61" 50!0"-4.0g ts mts (~allcns pet linear foot ot',,vater! 22009955..00112222 33MMAA0011555511889999 Conde)Clst CoeGrove Mimeson Confidential Clieat - Cot..~e G~ove, Mbmesota SESTONW.0. 02181.002010000) WE~rON W.O.: 02181-002-010-0001 oaTE:[4 Marcin 20s . ~W'ELL EVACUATION/SAMPLING FORM [ome I pp Fave: waz GENEIL~ INFORMATION Well Ne.: MW-02 f [reeee eee ewZee f[sPeCve ooTrEbe ing|w[aobwwmer oe CGT [RCo mroRToy ap0) | WEIJ., V'A.CUATION I~FORM&TION Tro seve emis [omevmommo A. Toell Depth (ToP ofCt~tg == TO~: B. ga |c e mCaa d [n LOR () femonts . ColurmofStmdJn, War (Hite G rower e) [fomworvToEmAe S D, Pur~ Factor E. One Wdl Volume: ber ore F. Three Well Volumes aos 1 1 TT TT | [[SC C opepciieo eO nt l er g spay ] m 1 _ || @ 9 |r|[ . [ &1 0 5[ ] 0 1 1 [Dobedonem wor(1.061721 | 1 TT 1 me lowly Mewtwwayem | [2 [|TT 1 1 [1| ga 1 'NAPL Observed: ~ / ~ Well Pumped Dr?.: ~ / NO C-- >--O ODOR: YES / ~ Orbs. [ort so Own Dos | - Oder'I'ype: i )Solvelt { )S~tt ( )Ot~er SAMPLE COLLECTION INFORMATION SpSaemprle Noo. [oTeime fFaomeTEE 1 feE ewewen www 3260 VOC om nanan Flucroch~'~icals Xo creme Seon 16 pH &Ditecmteme To f|ocaodaronittmyiemnion Specific S.~M'PLE DATE: Seno Sample No. P.311sate Bitk: YES / ~ ID ~,: ~mW: ~ R~h Ph~e'. 651-7~8-5352 |1i TT| Tittle tary |1 John Fl~herly ie 814-231-8032 de To bhuurss oe woCCOOMMMMEENNTTSS. SR EST "on PreevtioeusVrolsumePumrgsed:c:6gaCloI nEs 30 16 206% GT 265 17408 eb en ett) pumeFactors'~"-0 (r 4"-065; ~ 8".261 10"-4.08(~allonspcrline-rtbotofwater) " 22009955..00112233 33MMAA0011555511990000 _ Cf onr n Crsrern,Mis Com~der~al Clienl - Cotr C~ove, Minnesota WESTON W.O.: 02181-0~.--010-0001 a : - WELL EVACUATIONtSAMPLING FORM e ave sve e wd | - S[ESmLiLtIeNrFORATZIOZN Tem id JIZ Jsmenswen [a Frac CVa8yGD0om5ed Jlwoionmeer tea ChJ ome - [[mToeoeToepeCong oer [g2p10.]0]vel|Ea|tWenied 1| - [ Poe w mma[973e3l) TSTGE |1 - CR 5 F. Tore we Voars im: |199 3 TOTAL VOLUMEPURGED: 1 - TORTI To AT ] : ourTogss J1o1ti0 Jgo2zs319lo3g8y0[5iadp)L3u8d.a79ur60 a - [BDSpieEceietCionnigeimir0r([ggws,|csc1[l03a.79ar8i[|22z04d571v20a3.72l6|z170a35i2611z22440a7[|r7900a8| | | || | | -: NT oam Gum(T 2 [2(2Tole I [ee 11 -. fo[sr oSmAOe viEss (TO 0[ Y7ovTeTimoeewao vesm(<:0) l1ii . APL COLLSECeTnIOgNeWFORYATION SAMPLE COLLECTION INFORMATION T= SarSEamagTe:e T= 1 Sample No. Time Medm Sam'~ie ID: mT TC Er ! H:ime =|[comSe soito m nr Joi:n I:iaherly ||| |: | |II - Creon TS EarComeatmt, J rmervoR nentite. VE TS ! - eatromeasme:t EVYE: 0GD | l)iir--e Faclo~: 2"- O. 16; .i"- 08~: 8"-2.1)1; I0"-4.08 {_~llllorls !~el" tinelr t'~ol ot't~terl 22009955..00112244 33MMAA0011555511990011 ContsowlOoTer Gro0ve00Minion Confidential Client- Co~ Grove, Minnesola WESTON W.O.: 02181-0~.-010-0001 NEY anscnze0s bATE: /~ MARCH 2005 vtrELL EVACUATIONISAM~LI1NG FORM GENERAL INFORMATION (WWaelNl Neo:.: mMwWa-0s4 -------- [tes Sampling Te~m: T,~pl~7{m TWeaegSkmton Gn TewBLT JSeweseer [ EVACUATv IONTTFO@RMA5TI8 ON 23.7 wavs soa CEWELl, i INFORMATION I Concrete Bas~: I We 1 Diameter:. ~ 6 inch. ~ ~~ Damaged ~ ore ~ EVA~A~ON ~O~ON mee 200.00 Well Evacuation Method ( '~ BAILER 1i ,! i Fore md C. Co~u~ of S~ding W~ D.r~ ere ae] mS 1 ~. One W~ff Vols.: F. Three Well Volumes (p~m): ~O ~ TOT~ VOL~ PURGED: i i [cm filel i INDICATOR PARAMETERS PARAMETERS INDICATOR fp Setnp ee] |I oes11t 0 [2e 80[r sairil o30 o 3551420 l Gallons Purged oem Temperature ------00(C7):[937 33fos]Uselnidasel | ((SCSoapresccih~teCCsOoonvdmuecbdviwe~ or(rs):[f.65797[fJooodrsa0368]|]VVeez93lloszzdi0z79dal |__|1 ( Dissolved Oxygen VFeFmrrabn(I pH: (a4Al[z&n[lz2al7] 1 basto sTi7aa1g 1 Visual Turbidity. ~L',~[, [rorVE TG, NAPL Ol~erved: YES [prox ve Th ODOR: YE.S t ~, [aneeon WtlI~D~: joa . S750 YES~ ( NO OdorType: ( )~olveat ( )Se~ie ( )O~her : SASHPLECOLLECTION IYFORSATION SortsoT : SAMPLE COLLECTION INFORMATION SAMPLE DATE: sen Tw] ET = : [etme hemes ve wo : 1 Sample .No. Sample No. Media Sarr~le [D: Riasatr Blank: YF.~ / NO Ee Tor pe F A R .....------ -- fxH)siwcmon | ---- b a" aEoe ||1 - Te TT Re era 1 . eePreevieewmsaVoluamnePursiee s: 13galCeVsE S(EP |i 22009955..00112255 33MMAA0011555511990022 Rn WCWoEEnfSSiTTdrOOnNNtiWWaI..CO0l.;i:en00t27-~188C1oI.-t~....._~0-G1001z0.o-0v00r0,001M1inne,ota oDAtTeE:: L/b~ s.a.MrAcRCHx2o00s5 . ~LL EVACUATION/SAMPLING FORM GENERAL HqFORMATION - [WeiNo:Mw Em ey [Wee @Gmladin Tee Temp: eB | Twgare~ie~e= Snignasture: - [V 00 5 Jorlal olf wwe [FosrCany (Whe) Damages [CCoornrcers~BB~ee: Well D a~: tn6 ~ch. ~ E> . Doamrneg~ _ ees | [Te Te Team oTjanet ovis } Well Eviction Met~ frome 1.ofool ~ ~ |) ~ Hs BMLER 2-Inch G~nd~bs { - [CEoommie T735Ar7d ] E(eiEaecn i { ~;nch Gt~ndf~ [foewiv[e 77m a . sesto1npo o vor s rumen: G75] - Time 105517/75 [130 1//5914235 1/355] 1i GallowsParwed| 9 1/70|360[4401560 1595 ! i - [[eSmepteeaCweonO trp[; 20172.700((9069|G2A911g2egRF7o2s|1 | | _|| - [[rDo[ ishsotlve7 dOdne4 sCmoBl5 lyT{1 E1R)7 Y 1Z32 8 A0pRT2 5 7LA]7 FHFT ,2T 6 | T 6 1T ]1i :Visual Turbidi~ (L, M. H): /~ Z - [OE p=e 1 1 I [1v1am Wall Pumped Dry.: t vYeES"T (0A)T 1 _ r ER C -- kik ( )Other SSAAMMPPLLEECCOOLLLLEECCTTIIOONNIINNFFOORRMMAATTIIOONN seem Tw] Sime = Sample No. Time ] Saris oaTE__3//foS | S A~MPLE DATE: Sample No, Time I ------ Eragr. ! = eM~sliasSammcet ID: rr p1o/[,p'hpr'~t] eRinesats= awt~.c~:vYEeS ,'zNoO | ww | 1| Paramem~s: ~ } 8260 VOC & Isopropyl Ether (X} pH Phew | m0 : X ) Specific Conductance - 1 1i)Ter || e sass ans i| i X ) Temperature S~ College, PA 16801 C~: g~t LiaS~m t 3 M } -: | el a I ta er e r e e] D4|!| COMMENTS WeB Pttm~ed DR': YES ! 0 Previ~ Volume purged: 227 gallo~ W~i R~uires Maim~an~? ~ ~ ............................. pttt~,g [:actors: ~"-IL|6: :"-~)65: e g"-2.dl: !l)"-4.08(gglk~nspcrlinearrbotol'~ggtcr~ ............................................................ 22009955..00112266 33MMAA0011555511990033 EConTtenOt N0CleBi~iCboa >G1o0n00,0Miso Comqd~n~l Cli~a- o~ WESTON W.O.: -. Grove, Minn~sou outs: - arc x005 DATE: ,/SMARCH 2005 NGEaNEeR DwaOsRON etm ese WELL EVACUATION/SAMPLING FORM 57 Ea wmPos | [Cos aYi B | wider san RC W~[I Dian~q~r: 6 inch. EL TUACOTROTRIIAOTINON 2.0 coor 1 [TeoTope To 1Zia] Pel Ev~cu,,tion Metee~rosd BAI[~.R a | 2-inch Gmndibs ger { 4-Inch Grundlbs Other ~.Spec~ fy~ : [omanP P| E i x 1.47 Damag~ F. Three Well Volumes (~-,,): CATR PATE E~IDICATOR P.~RAMETKI~S i Te TTT TT Time Gators Pred] i TT Gallons Purged EC T TT Terr@emmre (=C): [o wr|e | p m 71 Spifi~ onduc~ivi~ (s): [DmeaonsnGor [71 | 1 Dissolved Oxygen (mgiL): TOTAL VOLL~rV[E PURGED: pNeowra Cwm ZlTT I I Visual Turbidiw (L, ,VL, H): i [oT meves 750 T [Waheiy T ve 50 NAPL Obs~: YES / ana Tor ODOR: YES / Cr ys ye TT ] Od~rTylw: ( )Solvent .NO NO ( ySe~ttc ( )O~acr Well i~ml~l Other: SAMPLE COLLECTION DTORMATION soma SAMI'LE COLLECTION INFORMATION SA~VIPLE DATE; Seen Tw] Smee T= Sample No. Sample No. i fMredeiam~mspel, eI~s: i CC 1 RW eese T Rin.~ B~nk: YES / NO | Mew ID NO.: i TT Cor Ea 8260 VOC & fsepro~.v! E~er D,,N~a~ory: Exy~ Research Try e ---- aoeCttaree (X~pH i: Fm Tm mtr soutien - $l~'c[fi Conducmec= ol | ) Tcmprmt~rc State Cot~e, PA IOAOI TTT| Ce~e: s~ni( ~an~nmm Ph~e: 6~ [ .778-5352 $a Loik (#5 RnR oem COMM E~'S Gr BurC72 Farmar Well Pumped Dry: VEYES N0O : IH pe pre 1390, vk ent CB. 0 Pola Spud Pr~'io~m Val~me Purged; ! 6~ scons Require sstenaocez 365 + S| Well Requi~ ~laintenanee? ~ , \0 Ac~ ~ui~ Maintenauce? YES ,' Pur~_-= I:';tctors: 2% O. lb; 4"- (}.65~ ft'- 1.47: 8"-2.(~ L; i0"-4.|)8 (gollcns per hneat" =b.~ of ..~uter} - 22009955..00112277 33MMAA0011555511990044 CEoTnOteNntWCOl.ee01Chonc+GGIroOvReD,ML imo Confid~atial Clicm - Co~ ; Grove, Mima~sota WESTON W.O.: 02181-b,,z-010-0001 DATE: La MARCH 05 - [Fave war G~N~UkL INFORMATION Well .No.: MW-07 [rkSn One Tee - VELLINFORMATION WFAJ~ INFORMATION [ramen (em) mee] = Em fo ows -- | L0ck~h - [FELLEVACUATIONINFORATION7527 1 [TT oaDR0 TeSCI010 vel Emmntaias 1 VCELL EVACUATION" INFORMATION A, Total Depth (Top of Casing = TO~): [omer pd| ME, B, Death roWamrtDTW) - x mE i C. Coiu~ or' Sm~g Wat~ (CfA-~ ~: D. ~ F~r [Fomwavam Tag ----------------------| E. One Welt Volu~: : Three Well Volumes (galore): _ ECATORP OEE Tr]1 INDICATOR PARAM~ETKRS , X 1.4~ ..~ TOT.~L VOLUNIE PURGED: Time AB le T I r2r 0 r 20%" 1 Gallons Purged ~ [ TemperT ature eCm (CC:):19e .781s 9.90 | 9.90 19.400 9.50 | 9.88| TT [SSopeecciifbiccCCoonndduucctiviivtyy. G(sY):|751597[578 (wz | 578| 52|8 3 _ [DwohetOnes wl)| LO fod[0.6110.60 [ol [0.60 |__| Di-csoived Oxygen (mgiL): Verto CR170[3235T/[re5iblTre aToolzaTee ] T1 _T i Visual Turbidity (L, M, H): L L - TTT TT [Fromm ves T An ;~APL O~erved: YES / poreTR ODOR: YES / [wean ves Ga) ow 1 eT | O~rTytm: ( )Solvent ( )$~p~ ( ) O~her ]Other: |SSAAMMPPLLEE CCOOLLLLEECCTTIIOONNIINNFFOORI~MMAATTIIOONN SSAAMMPTLLE DDAATTEE:: `fo0S | Tome = Somes = - [Ems Gs Media Sample [D: Sample No. ReeveSam0ple No. T Tow t iD NO.: TERE TCEr ' Laboratory: Exy~ Resrarch _ EE oatamoone i .~04~ Rose.arch Dri\'c State College. F.-x i {~01 eEne BESaves eEriTn ty | Contacts: Kent Lmd~rom [3M ) ~ohn Flai:erty 5 : I | Phone: ,~)~ 1-77~-5352; II I1[ i) -- COMMENTS - tCormergsllove 8oo y [miTmTi"TeSSS | - eters ames TE (| 22009955..00112288 33M MAA0011555511990055 CEosCnla e n--Cotr Cro ore, Minn Coafideatial Cllent- Cot WESTON W.O.: "Grove, Mianesota oaTe_JA_ sarc 0s OATE:_.~MARCH 2005 eue ne A AL LL ROTOR -- L -- YF.S Well Di=une~. 6 inch. p d o em mCAs ON Ni EO T] o--m5a7n ao hsel. Jc Comore Re (( TT~ ee2-~ch nn O~ndtbs Temes) | ETT feowva Pm e ~ ~ Other | Tero PRT le] TOTAL VOLUME PURGED: [C f EDe eono |t e ]y] o ---- ---- -- BE 1 {YosTTmsy Cm TTT T Ce r TorTs e veTm NYeoo TvorT eyTT wl I sxsuris Em CormseonmmroRvATITON = SriSzaoa, re N A rmr =Er | Enrratro IR !Tom TT [Coa nn Ketamine nny P/E nt] ow Comin speCOMMENTS [PROT VETS worsen vox k ns ofSourSovrocomrs rirnerVoetan sts peo YES i 152 NO coere _S23 . ....)co" YES ' 7 T ! =i I--!| || 1 "i | Pi 0 5.1 300 sto et 22009955..001129 33MMAA0011555511990086 - `WCCaonnEtfiidSdeenTmtiiaaOl}C0CNll:iiernn0tt2--1C8Co1ot0tta0a1ggee0GG1rro0ov4ve0e,,0M1Miinnnneessoottaa WESTON W.O.: 021gi-002-010-0001 owre_ 16 aegpymanes - WELL EVACUATIOM/SAIVlPLING FORM [WI !WeeillNG No~.:: ME MwW,-V80N O8 RM~ E A O~NR~A' ~~L~I' NvF ~ eeeOwR G~ inM ey AFpT g fIosON| - | y= A s~ r~'-T~- I WELL INFORMATION -. [E om r TE 0r __wao oeer r oa e -- WELL EVACUATION I~IFOI~ATION Concern Base: Well D~r: ~/ 6 ~. III Dan~ Fai - [FORO Trey (on) Sites 173.00 Well Ev~on ..,, ( ) BAILER fe eney a TT) ( ~ Suan 2-1n~h Grandfos ~ -- feowiivameTTR1.47 or72 TOTAL VOLUM~ PURGED: A : INDII CATN OR'PD AR,~IErEC RS _A__T __O _--_R_--P--AR --A --M --E --TERS 1 HE Time a er - SGalelomnspPte~erd ole lgolyelavelszo[gloaylzo| Temperature (C): ~ [sSpieceificCCooondcYilvOiidy" 'O(sr):l// gos=|sve| 7lgo2lcr[o9l%c]ry| Dive Gor[527[agle1917 1s raid less] Dissolved Oxygen '(mR!L): - Vey CHR] fo Te[Te| 1 Visual Turbid~ (L, M, t'D: [Crome To) weer vs To) NAPL O~rved: YES / TTT TT 1 Wdi Pmmped Dry: 1JT YES ; / NO ) 1 ODOR: .... YF~S / O~er: Odor Type: ( )Solvent ( )Sep~ ( )Olber = SAMPLE sme Te COLLECTION INFORMATION Sample No. mere SAMPLE DATE:,, Sam~ple No. /,~" ,~g ~7" ' [| ~ ~ Time ~Media San~ple iD: - [CE arm {s aFd eUEC osemye ESraarrai x -- i(3eIRm mscomsFxtonriemammmin ebaCnt:0 i ~ ) ID NO.: meme s3um~e C~ olh lPeA~g1iv6ec80,1 5mr C~I~, PA ~6801 Cmmcm'. K~ ~n~ (3M) J~n R~ P~: 65 ~-778-5352 ~14.231.8~2 COMML'NTS hte - Prrretv~imssVVo~umsePPuurrggeedd:: 152gatoms 770 I WWelelllR~equuiirre~sMMue~iuetmeaaoac~eer7 A~ Requi~s Mainte~? VES 1 505 Pe or 16 0,5, 20, 7A oe ta ............................ P.urgeFacl.or.~?~0..lf!; ~'~0.65 6"- I.,tT: 8"-2.61 0"..4 08 (,--~d ons per near fomot'wat~) 22009955..00113300 33MMAA0011555511990077 CoCtli a~Cor Grove,Miron WCEoSnfTidOenNtiWal.0C.l:i~0m21-81C-o4t...-010-0001 WESTON W.O.: 021~I-1,~,.-010-0001 OoAaTt~:: i/t4~_ MaArRcChH22000055 WELL EVACUATION/SAMPLING FORM G~'~ ~tAL INFORMATION [WellNosMW09 ___-- AROTa EntFe I TS Teesewmcpn W~dm': Sunny~L'l~I_..~R~n wew JOE) I Sg SS =Et SEe rmsr er TT.A0RR]] | iBnEt pessmo |i FoR ous _garliy |m | [D Cove Te] F. Three Well Volumes (gattem): I TORPARRoE1 SVZVESVEE(EVE -- INDICATOR r:.~ i i~,~/~. /~5.5 /5o5 / ~ , ISI~! emo Sour0a]1373e1lr3y0t1o2o0]Q7R0S81A/0H0) -- ~ [SpecsConducsviy ~.c):. ~,~3 le ~ /~.~i GX17,JAICHE100% ~0/Ad~/c ~,qg ~ | ,,i 1 1 1 [DoviOvenwon[13510[19.98 17[5551] D~solv~ Oxygen (~L): I ]. CT eeR = APT AT7A=STT O~R: YES ! Oiler: t YES Sr ALE CT OLLECTIONYToFORVTAoTIrON Saris oats | SAM.PLE COLLECTION INFOI~IATION SAMPLE DATE: = Seapie T= Sample No. Time Sample No. i Time fsorr ------ LEL Z TE -- : ] Medi~ Sample IDa Rinsam Bl~nk: YES / NO ew lID NO.: Laboratory.: 'Exy~-. 7 ALLL To tamer | 3048 R~h NH ecmtre | SeeColeg, 1891 State Colle~ PA ; (~801 Xa Toem mmm sn Con~: ~n~ ~a~om 13M ) John Fhhc~y |{ - I [Tm | Phone:. 651J78-535~ - Tm mE :1 - C~MMENTS W~l Pump~ D~: YES ,' ~ am crmormimme eaaner Ce5 G || ~ .Ac~ ~tr~ Maintenance? Y~ , soprTTaT tein nessphp 3 Purge 1:=ctnrs 2"- a. !6; ~?'. 1.47: ,~ -=.6 ,, !0"-4.08 (gallons per linear i~mt of ~atcr) ~ 22009955..00113311 33MMAA0011555511990088 _ - _ - - = - a _ - Conlin let Cotus rove,Miso Confidential Client- Cot=,ge Cctove, Minnesota STON Wo.HI os an0 WESTON W.O.: 02 lgl-002-010-0001 DATE akc0s DATE: [Fam sw GI~NERAL II~TORMATION Well N~o: M~ -10 [oversT7"FP ZA EE CC iii WELL EVA~ATION/SAMPLING FORM Teeseway] I I [-- Sw--em--ee--------------| TT oe WFA.L EVACUATION INfoRMATION [KTomrbomToeCame 00 Se1 Fv hod ~. Total I~pth (Top 0fCming = TOC): Eos ga] (Ba, B. l:~.pt~ ~o water ~Vw) [mss [TR (A) oc Gr 11 C. Column ~t'$tandsg Water(C--A-B): Pre D. Pu~ Factor RCT ia ame, E. One Well Volume: ora F. Three Well Volumes Well Ev'acuati~m Method ( ) BAILER TOTAL VOLUMEPURGED: LL re AEAE Tempcratm- [[sPmosihecdoone imro](2| 90 [34 Specific Conductivity (~C): (s): [T 437[600 777lote lotleo TT | VPDF~esDorlvecrdn'~agr~naa~mm~)i: [ ednede rdralne ernei [lorarlalolerlerTlT sd| N~PL O[se~: YES / NO W~ll P~mped !)~,: ~S ~ NO ODOR: YES ! E -- a Odor'l'yp~: ( )~olvent NO ( )Se~ ( )O~her [swmzcouscnonpromanoy --seoie________| SAMPLE COLLECTION INFORMATION swe Tw Smee Te [Eases M~ia Sa~ ~: Sample No. toE Ba T --| eoraEe rograamems ov" 3)on Otlmr: SAMPLE DATE: meemeevere Sample No. Bl~mk: YES / NO mw -------- Labo~at~y: Exygm R~h Time t 1 feom temin) Sm~ CoI[~ PA 1680I omey - ii) lara eevrmreeam.aT :tg1Tae | 50 COMMENTS Weft Pump~. Ih-y: YES Previous Volam~ Purged: MO gallons Wal R~ulre Main~nce? Accm R~uir~ Maintenance? YES YES 3, ER NETS ............................. Purge, f~acto~:~T~ O.L6:. 4", 0.6. ; 6:~- I.~!7;. 8'~2~61 ;, ].O.:':4~(~8.(ga.![o..n~ p~..[ linear foot of vzater) 22009955..00113322 33MMAA0011555511990099 WCCoEnlStTieOtN--W.C0o: 0.1_81032.0G1r0o.v0e0,01Miss WESTON W.O.: 02181-O02-010..0001 DATE_J2.MARCH 2005 DATE: 1~ MARCH 200~ W'ELL EVA~ATION/SAMPLING FORM ! GEblERAL INFORMATION "" ' '" " ' mre fotJT Jo ee r pe e om i y --f TT | -- es 7 Tei vat panes 5 [o fe wvavwe ITs A ED -- F. Three Well Volum~ (llano=s): TOTAL VOLUME PURGED: [ ENDICATc OR P~Im o KS mmoDt ALileo Tedn d] Sbemrestl jo 150 Lio 11501153 ssplist los || [TeCm O T16p 26 Vis o. 5 /0,57110.95 |io.33 10.50 0.57 Lio.57] | [Pie vor 7 (7. [7.27 For|707]Fea[7.17 7.7] [T eee Cum,(4[6TT 2J [o1 leT TeJ To1T)| [Arche VesTq) [wWad'lhPuereaedsDyry: vYeES Ty | ofo e omoe Oe e Other: | swe TET a ++=0+n =: Sa.._~e No. -- 7 -- >-- Blank: YES" ~ 'ID ~.: Ceaofe A A 0 Ron or om rrmeao 3048 Research Drive State College, PA 16801 Flee =|mom. Comae=: K~t Li,,ds=mm(3M) = imperiled Phi= 651 q78-~352 John Flah~rty 814-231-8032 me I Well Pamlmd I}r)': gS / ~.~ remem. | PrevieamVolume Purge: 40 Rallens ates vs 1 CB | Well Ralalres Maintenance? Icnere amar vrs 0) Access l~lUim Maintenance'! YES / YES 0 EE Eyr Wo e stn Purge Factors 2% 0.16 4"- 0 65; 6"- I 47 8"-2 61; 10".-4.08 (@lions per linear t~ot o t',,tater) + . I To 22009955..00113333 33MMAA0011555511991100 a SEie. Confidential li~m- Cc ~ Grove,, Minnesota WESTON W.O.: 02 ! 8 l-to2-(} 10-0001 ox 1 sacs DATE: # / MARCH 2005 om - EL c= Pematan lILEE Tee - E [C omT r I m wae se Tac een rr - T s eeatme Tgaag [vUrbi |1| owas Tmp]to------S--e--n ------------------ F. Three Well Volum~ (g~m); ) vEe EE n [295[e rotavoe uspcer 37 |: NECEESry | T 1 Time SuGReIIwonpsuPugregedd]0[75135] 1 1 I I ] Iieconta [3g177[357 - [Tempenue (O(Cl): as lyr17 3.549] Specific ComluctiviW (s): T 1 T1 [DDsiossvoleveidOOmxyegeenn _w(mo.~lLk):l0.8/ 0.09 05)| | | 1 i - ppHn : 18sTelGe.qel | | I 1 i Visual Tmeoidir! ~)M. H): - ee A Lo 1 1 1L1L 171A C--O or = 1 1 SSAAMMPPLLEE CCOOLLLLEECCTTIIOONNIrNNFFOORR.MMAATTIIOONN I a ----_ = Sample No. SAMPLE DATE: E Trwa g260 VOC & isoprop: Ether - Em = Fluorochemicnls ~H Bee dE ~X~ Specific Conduc.mnc - 5 Terr~'ature | oe smn saz Ea i --: i . CCOOMMMMEENr,T~TSS. 1 ',Veil I'ump~i Dry.: - Bertoscd Lk wild Bork Caters [wTaTlC.ON !i Previous Velume Purged: ~1~,~ ato omrmnet (| ~[Wt41R~uir~ ~.l~intenan~ ~ ; - ic Nels mene: 573 + @ | ~]~ .~s R~uir~ Malnt~ance? YES [)urge Factors: 2% O. h'): ~,"- (3.65: ()"- IA'7:,q"-2.61 : 10"-4,08 (g~lll~)~s i~r linear ;hot eft ~atcr] 22009955..00113344 33MMAA0011555511991111 : i ; i: | ConClde CeoeGrove,Missa WECWoSEnSTfiTdOOenNNtiWaW.l 0C.O.l.i:en00t22-11C88o11t.-t00..00.~32a--00G1100r-o-00v00e,0011Minnesota ' DATE:_(Z_ MARCH2005 DATE: [~ MARCH 2005 ..... WELL EVACUATIONiS~G FOltlll aosvn GEI'iEIIAL I~FORMATION eeemaie evze) Ea -- Concr~ S,~e: ~/ [mm ve go> wate cen | Well I~ame?: f. in~. Dam%,ed , WELL EVACUATION INFORMATION [ry Timea eer A. Tolal ~ Crop ofCa~aag = TOC): [omemeogmos d) {Be B. Ix~h ~ Ware, (DTW)O'OC): erm Z77] (Ti C. Colur~ ofStanding Wa~ Weft Evaoait~ M~x~l ) B , ( ) 4-Mch Grundfo~ [Eoowivan D. Pur~ Factor E. Ore Well Volurm: F. Thr~ Well ICATOR FARES i TY| ( ) Ot~r (Sp,ei~) TOTAL VOLUME PURGED:~ Tel) 01JSSTad] aslpsol 958] 1 1 4 Gaerne Jp 177.5145Ips 301925 11 [SpecieComctviy 01/74)156 Gq|sp | spgls32 1T1 PE 1&3 (7O7..t'A)Ai 25 zutlpas ||| [ome Cm fa THTn [Tw fp MT TT J 1 T TT T_T [1 1 m oor E ferme TT[ale = [essere= oT [LCCaMaVnG{CWAMmWmA]er302005082 (Jem - oC vo oaE nTm--aamone feta 1) (&3) recat 2 Cosmes memnir Stat~ Co~l~e, PA 16g01 Coi~li~is: Kent Lindstrom OM) wternya John Flah~rty | I; TTToCOMMENTS ETE 1 uk juts. oT La -- rem-- em-- CTD| 30 | PI sr ET 70 75 tet " Pur~ I-'aetors: 2"* 0.16;~6"- i.47; 8"-2.61; 10"-4.0g (galloP~ ~ linear toot of water) 22009955..00113355 33MMAA0011555511991122 C Won~Edeo mS~aWl.CTCn 0lli:oenOt1t --8d CNC1oom4mpe,e ,eG1Gr0ro.ov0vs e0e,0,M1isa ston WESTON W.O.: 0218 I-~ ~I0-0001 ate: 15 vascrizoes Cpegeese 2 CEE FromTATION WELLEVACUAT/ONISAM~L/NG FORM - Fase vee et e y _ Ee om ASZpee [WELLINFORMATION T [Foci ad ed ear oe OF . ([GFoEeLsL ACIATIOONTIT NFORRMA(ThIONkg 22 07|Wel3lDamen: inch. {t [see - RYE erwr]vr erEsaee 1i i TE a om -- e TmpEy TOCATORPRO TERS i { ouowpeTisnle| 0 (2 3g R0 | IRCS)0R0R | TTT1 i - Terperaure C: fe. SC 1028 1, 1?1 I {SpeSciefictCoonanms,1538AS15.445 7S152 eg| '! T = _ FE _ 17% zo Fg T Vel Tardy (LYLAY mim? T1 1 = S oortrS yseTe vara ! Well Pumped 5) ow = i Ot~er: (Ew SAMPLE COLLECTION INFORMATION Sora SAMPLE COLLECTION INFORMATION SAMPLE DATE: _2 ER a Spic] e. L wTTToorR r ESreirpee ve. = Sample No, Ti~ I Sample No. R.insate Bl=nk: YES lid ~o.: [ Lab~to=~: Exy~ Time | NH toe 1 Stee. 0 ~:le Cotle~. PA ~ r+~r)l t - | Akeps new: oc - I COMH~S rim Seer.VE15 (i %Vell Pa~ D~': IRCRY 22009955..00113366 33MMAA0011555511991133 I ERE Confidendal Clicm- Co~ ~rove, Mi~eso~a / os 12 anc WgLL VACUATION/SAM~L1NG FORM [FE =momToe y1 ------e --ee INFORMATION EE Emmston FIL [m= > >i Jeeseewg <r--% Well D~meter: 4 inch. 1 - [5 oar Oop Top Cuma "TOCY hE, TarWeni Evacane] n od ! rT arvana [e owveriome-- F. Three Well Volumes |T,oX775,50c0.6g51] TOTAL VOLUME FORGED: 172.5 i INDICATOR PARA3~LEtEZgS | comma ER ae RT IE 10 Soebevtl/7.5 | 35170Los[40 [1751/9251 ] iy 009938|. HT 2719.83 | 1 [SCpeocinacsvGrry 193, 1774/1573 5[ 7 54|59 501 550 71 [DischedOrser wey 0.29137710.0710.2310,33|0-340 I AT1E 7.079.87507172.5417A.5S0(2P.A50WT7.45] b[ ore TTT 1 I 1 . C--O To feeo See Towne {08 | SSAAMMP:PLLEECCOOLLLLEECCTTIIOONN IINN-FFOORR!MVAtATTIIOONN a - oe Sample No. r~ I SASAMMPPLLEE DDAATTEE:: _/22. Samo|e No. ' Cea eg [CCMN EWW M I500503|J/ed3s P% Cm; 13] Prien' Fluo~h~icals . t" 200RaresOve. ~8 ~a~h = = 15) emer : Fe rs ~ P~e: 05 I-~8-5352 ---- ,iohn Fiafieny , ..,~:, -4)3_ es I revere so Loin wm CorroZod A aE CE i Previ~as Volume Pnrged: r~0 gallons AcesRies iasouame: lWell Requires Maintenance: VES wei :1 || i | || CoP | 22009955..00113377 33MMAA0011555511991144 TTT = CWWEoEnSSfTTtdOO~NNtWiaW.l0C..Ol:i.:en00t22-11C88o11t--~00e00~22-e-00G1100ro--0v00e0,0011Mimae~ta DDAATTEE:: //o&~ MMAARRCCHH 22000055 - ~r~ INFORMATION = = No,: 1~1W-16 WELL EVACUATION/SAMPLING FORM ............. --- ovenfn[TE $~i~|ingTmm: ~ /-T~" [wesees 2ae - Ee -- > W~LL ~~ON [Pocc oneiDe ameCs ong|Concr~ S~. ~: Imact / Datmg~i - [t[ r ~m~vm ~o~~m 'noT Nr g/at~,ge/)os|a) en i Zl (x Lie [came Ad (4 HEE - a1 eu~.~ x ..O~ .~ - Cr -- INDICATOR PARAMETF.E~ cumnesTaell'p SrEag a GEogm]| . 1] | _ [SpecificContuciviy 71957 (298 [#16 (ev | | | | | | [DisclvedOnsen Goal):|336"|494[0.39038 | | | | | [7g 7p|zr2lpsy| | | | i . [Verte TEL 41 TeTTT - Cr-- 1 C 1TT1 T 717 1 1 1 1 NAPL Observed: YES / ~,'~C ~ Well Pomp~l ~rT~: ()~t ()~ ( )~ me mwemme ToT seom me Te] Es Tmmwewro Cana ta Cre ------ - [CEM CW MWeOO50 BIA 1/636 0 | Tim~ | - H i ormonoer Xion SoneCollege. PA 16801 John Finherty g t 4-231 .g032 - well Lut weed chmod um. amt am. REA, Wry re m renters sto ............................ Purg~.Pacto~s;2.'hO.l.6;. '.'-0 " 6"-1~7" 8"'-26 ; lO"-408(galom~ mearfOotofwater) 22009955..00113388 33MMAA0011555511991155 CoEnSsTtOrWOC:hGe3t1an00 G1r5o0v0e,00Mims one LYYi viascrnams ~I.T. EVACUATIONLSAMPLING FORM [e Foesysteem --| (Ta LL n romRaSin [ses } {nC Ge) Dag 7 rm 7 Ie m mern eedo 2 malt) eforEhnite ounjdit [Proivse7 geT r e mle | =n : ERToR ARTES ] I rai EYARZA (DSpeeeciveeCioOnutsiGols | [2359511726751|77.06371]72.667711,764711)76608|177.5971 --3 [oer TYR]Jyg TETLTT e T 18 1 [oor vesTZi -- ad i! SAMPLECCOOLLLLEECCTTIIO ONNIINNFFOORRMMAATTIIOON N oyE SmE eeT To sm f C re Sample T SAMPLEDATE [wTE VS To | I 1 ! Th'ne . TP N m Tm Sc=eere e |i| {X-- I X ) Sp~fic Conduc~nce ee ary eas: i C.ot_--Lod off fn Fre COMMENTS. SiRRnane ig 1i trme n--t vis of| set ny 2 2 4pn ert 22009955..0011339 33MMAA0011555511916 _ CoCEnonffiiSdecnmitalVl OCCllie~tim---CCoo.ry aGG1rr0oo0vv%0M0Miinsnsessootas WESTON W.O.: are 1144vascuzmos DAT~: I ~ ~V~RCI-[ 2005 - - [vEmLemrFaOnRMATRIOuNzJp seesees 1 [rman BaF Demed T = - 2 - e CE e TC---- aCR [Cw om renID] | de soalPon7y |i N po A r a o/n C 5 wed,R@EE| = | -- INDICATOR PARAMETERS ~OTAL VOLUME PURGED: = Gallons PugJed/(]) 120 |30140150 | 7i - [[Deapsiac coOmmiicesrywr[|73A0L 117,4530(1716378 1117.231911]742551|07711 Br TisW dar as ZHI |1 7 1 - [VC emrTaary CX A1 [0 pd[1 BTLTT a T -- N E SGe Tore TT L[eFry v8 8 j ] PLE COLLECTION INFORMATION oro SA~,YLE COLLECTION INFORMATION - Smee Tm sme Sample No. --Tow : mses Media Sar~le ID: - FTRTE ET Toe Eahaamevae 1 VOC & lsopropyi Ether Simple No. Twesewow ID NO,: $e nons Conductance Tcrr~ratur~ =r ras | !I - We oid oo ev, Jeter? Fume H[reraeenvetmerraaemmaimtes.neV:EtTCmH 0 |i1 = i | sconsRees omens: VES BD | hn 715 Cin rapier I'urTc F~ctor~ 2"'- 01 il~'4"'- f)~;' ,"- I...tT: ,I"'-2 (~1: I0"-1.0,t (~allcms per linear Ibot ~l'~vaicr'l 22009955..00114400 33MMAA0011555511991177 CVoEnSteTnOtNWCO-eoitiCeoLr aGlrouw,mMima WESTON W.O.: 02181- _-010.0001 ate. 5 arcuans DATE:/'.~ MARCH 2005 Faves Woes [estan IT Juda [epee (Sees zs | 1 [em = y [A FTemrooatm C || T132O 000.000]WWeell)e]~cvaucuadonvMie~ood [Fees 59.93] (HEie, fas? ~.. I~B ioWiier(DTW)(TCX:.'): [Comore 173091 |) pmo C. Col~ma of Sr~din_- Wam'(C=a.B): C [ole-- m FTY ol D. Purle Famor () O~hm" Specify) F. T~ WeB Volum~ (~m): /3 .77 TOTAL VOLUME PURGED:! ES E S SSA Suoaspursed]11 TL 1 fepewee col | [21 T TTT T 1 [m DVeesahrcwtosaobmmaieytesyCwT oGwr7 [ |r T T T 11 T T 1 VismlTm-bidi~. (L, M, H): ---- TT TT I [ANArPLOOIw~reveds: VYEESS Eee ODOR: YES ! NNoO ! NO TT [Wareioy Well Painted Dry.: ve . YES 7; N61 I S~MP~ COLLE~O~ ~FO~ON Smee Tre mew Sample No, Tl~e SAMPLE DATE: [swe mesmo rr | we i hia er 82~ vOC & Iso1~o~y| Ether XPe hew ~X Roorcchemica|$ ~X pH S~ecific Conductance Teml~mlum =|Immm0 Tw | i Time 1 IE John Flaherty | CTTm T arr, 0 cr omit COMME.N'rs er 1 Wleurmes pol w-oferonss., rrre------ ola ow | Ippsid To Pl she cosRrvane: ves GN geFactory 3 inET Pu;.~e feacii~rs: -'"- (I. t 6; vn 200: 11Q0"745.008g, g,.a'=lllloonnstpneor loineesar foot of wer 6"- 1 .-i7: ,";'"-~..01. 22009955..00114411 33MMAA0011555511991188 - WESTON Wo: 036 0410000 CConofnifdiednetnitiaallCCllieent-CCo6~g.gs,eGGrorovvee,,MMininnneessoottaa WESTON W.O.: 02181-002-010-0001 ote: 16 illus DATE: WELL EVACUATION~SAMPLING FORM - prSIeTEwIeNoFOrRwMaATiIoONn ------ | Well No.: MW-19 Ce -- -- = - pW re~LsLeLNoFrORmIVaIAnToIOnN C7 1 C~ ~: ~ / Damaged Well Dimr,ete~. ~ - [TT eoooT T130o 0]ve Eo rni WELL EVACUATION INFORMATION 120.00 - [ fcChom F orsmaryo vrem i oir e GCY o) amdemimn _ [ovear E3a5] Te 2 TOTAL VOLUME PURGED: [omavsro, varmey (rw| = ON INDICATOR PARAMETERS -- |coTir me ms TTT] - SGuaeblleownd]s Purged oTo1 1 1 T 1 1 T[ 1 [owe Temperature co (=C): [71 T[T TT T 1] SSops~iibfiec CCoonndtuucctitviityty_ |(s): 711TTT - [DDiissmolhveeddOOxnymgemnG(omgr/l.)e: SX pr prH:o rr [VveisauarlnTaubrbiidsiyty mm (L, M, H): 7 TTTTT = [errorrg msm 7 o------ NAPL Obse~ed: YES / ~O~O_.~ w,. Pn,,p~ YES ! Other: O~rTyp~: ( )~lv~= (~p~ SAMPLE COLLECTION INFORMATION SAMPLE DATE: / = [ SwSmamppeleNNoa. pamsmes | mwemwoy Media Sample ~ [eCmaimr Gt wmuogopet oEto a logioToheer Br | Paramctcm ( ) Pl 1 arama com~X)~ TeTime | SaSmamplpleeNNoo.. Rinsate Blank; YES og/o ID NO.: ~:l Exygen Resea~h ee Soe Clg Lt. 3048 Rc~mch Driv~ State Colleg~ PA 16801 7TTeimxe| = I il wm pireefwi--g|L--L-- pfrw ied 3 Contacts: Kent Linds~'c~ (3M) ! Phone: 651-778-5352 John Flallcrvy 814-231-8032 COMMENTS :Well Pumped Dry: (,~YF_~.~ / NO RATURES T SZC fraser: 00 0 5.10 Previ0=VolumePtl~ed: ~l~s /'C :o~.. FTE F1ITF metre yo 3 Well Requires Maintenance? ,~ / NO - CoaIRl -- (lush Rms rcsReis Acee~ Requires nites? Maintenanc ? VYEESS 1/ ~ SE Fs 016 063.610, 201, 1408gates roc tm) Purge Facmn: 2"- 0.16; 4"- 0.65: 6"- 1.47; 8%2.61 : t0"-4.08 (gallons p~ linear foot of water) 22009955..00114422 33MMAA0011555511991199 Game: som Meee W'~TON W.O,: 02181-,,,,2..010-0001 ou2runsco.n . _ SIT~ INFORMATION Well No.: MW-IO1 l = = WELL INFORI~kTION" oe deo vw W~B Diar~mr. 2 inch. ~ EVACUATION ]~IFOItM.~TION re TomeoT peal] im ir i^. To,~! De!~th (Top ofC=inS = TOC): PR {Cou ColumnooffSS~adk~ngWadseir(Cn=Ag8} os1 { | enCones i er--v7 5 DE -- ~.. On~ welt Volume: a F. Three Weft Volumes FIomcomGm bpcsol3e1 T1]a2n1g2e0l15e0]| T3190 AITTAA r pesm r e omTA y osm|r AA mal : FC or-- s eO r oe-- ose] --I : T T i 1 5AMI>I.~ COLLECTION (mem a | SCAGEIaoO t] [CEMACHATO[00s 31 |[ = CN =] i VJ LL. 7A a I 1405 2 = L j 1 lire a | COMMENTS reeves sane !| mores | 22009955..00114433 33MMAA0011555511992200 WCESoTnONtWd.C0lei.en07i1C1oa.r0 0G1r0o0v0e0,1Misesoa Confidential Cliem- Cot Grove, Minnesota WESTON w.o.: 02181-0~,,.-oi~-0ooI ote: 2Marci 05 MARCH 3005 _ SITE INFORMATION Well No.:' MW-102 - [imwomamoy T~: WELL INFORMATION fewpe ava un Dan~b,ed - T Tr eo WELL EVACUATION ~WFORMATION sedi - [[ me ee mv eeTgJie g]y| (7 M |) seh er ree Ix a0n.16]CC fe omwevowme 1pog3 | | i - ToewaiVouimear | 3 |TOTALVOLUMEPURGED:_/i5-- | F. Three Well Volumes ~ EDICATOR PAOMETERS 1 INDICATOR PARAiVfETERS "T,'+er,.0lp75L!,'a+mp'+, [03s |og T T1 - [Tove GollnsPrcseod|l9 7l51a0g.z5i0/,00 Ilgeono |TT 1 - [[DSpuescisewCeoomnmgwaso)[2a6,:2221107-0685"[pi7/.4s~,27~[[7f20d|I 1 11 PVohw_ TRA7g47lz(eA0T71/gl7-/".7dTed0[ l TT TT T] - C C ortCve G0) 1TT1 ]oWR cqwl PT umm pel Dr1 y.: "SY1 ES T`O7711} _ rT TT Se (08 Other: SAMPLE COLLECTIONINFORMATION Saver paTE__JR. S+Iu'VgPLE COLLECTION I"NIPOR-MATION - famseen TT[eee See = M~ia Satanic Sample No. - (CCEA EEx)S FC otRoW S A egi oa oo ESra--iT eo sa|1 ( ~ ) Ftu~h~ls - [M iE: e HE [Conge recimnmi e Srmys iii ( N T~tu~ SAI~PL,E DAT~-" Sample No.. RJn~aIcBlank; Y~.S '~) ID NO.: Time I - - "COMMENTS. COMMENTS Cami TT BART CARE TC iar, |ret Ve O00 Y : Well Pumped Ory: YES ! A i tPrm.'io.s ~oiume Puc,~ed: ~ ~nllons atu tint GB | - cos Rares sonra: NES i ~o il Access Requires Maintenance:' sarc048 1.4: $30, Pr Getms PLir=e Factors % 0.65: 0"- ! .47 : g"-2.6 ! : ] O"-A O8 ~f gallons ~r [ie~ear foot o1' water) 22009955..00114444 33MMAA0011555511992211 CrEaStTdOeaa 0l:iasttiand-lGooaoe0Minson "0V'~S~I'ON W.O.: 02181-(~.-01@-0001 xref DATE: /q M_sAaRnCcHuz2000s5 WELL EVACUATION/SAMI~NG FORM [[ Eo LLEeVACm TAE TI#ON5FTFTOoR@mAAea TsION 72s 7.T7w7oewer den Eo TE [[oTO ommeo TopoT CoramTO S 1|Zt{ggaag]wet{ Eme miahsad [camaro[778g] |) seis |1| [owvaves 1777] adel To rsAE TTT Saewstsed] 100520[7| 95 17 [[SDpeeacreCdoOonmeoevwy0g1/.47716 ,09.076D2o7el[po2d]7| 01| ] |1 11 |1 i - oSo r TeyGyo TO or | SIFLECOLLECTION INFORMATION `Sores DATE: S~34PLE COLLECTION I~FORMATION SAMPLE DATE: [sTe e t wget e Te| fesse Sample No, , Mgdia S~,~r~lc ID: Fe TET Tr 1 erro eesmew Time I Sample No. Time R,ima~ Blank: Y',~ / NO o ID NO.: T - I..~bora~ory: Exygen R~h 304g R~h Dd~e a nmesens | S~eColle~ PA 16801 hme TT | ina ns | C~mc~: ~ L~d~m d3M) Ph~ : OS -778-5352 EE llrein & "CCOOM MMM ENET~SS. Lar soma 030 7% Aemoke Loin Tram = 1 i |AccesRequiresMsinemance: YES. feo] i rt 056.14: oh, hvprs Puree irtaclors: 2"- C'. I b; 4"-O.bS: 6"'- 1.47; g"-2.bl; lO"~,Og (_~alloo.~ pro" iinear t'tx~t at' '.',uterl . 22009955..00114455 33MMAA0011555511992222 Condon lt Gv,t Mins = WESTONW.0.07181003.010.0001 Coafideatial Client- Cottage. Gr~ve, Minnesota WESTON W.O.: 02181..002-010-0001 DATE: MARCH 2005 DATE: [ 7 MAgCH 2005 - SITE INFORMATION ZvAcu TIO I G Well Ne= ~w-el " ' ra Ae = - [Seoerem 7 WELL INFORMATION - Paea Ca ,Well Famtioz F'~eProtemiou Supply ~ (S-- eee-- me gC oogE) | Cucsunt iowAme 729aks (Avenger2000) Well in openakm at timeofsampling? Yes ~ Cak'ulamd Flow Rate: 729galkms (Averagefor2004) ~J. gVACUATION INFORMATION A. Tmal Delal: ffo~ creasing = TOC~: 205.00 - EeTRTL YEL RSe [PC Po Vo in|108] ef rsctpre be edweed JC Ave oma Rempog foe 000)ge | B. Well Dimneter 20 inchand 14 inch(h~hes) C. Avera~ AmmatPumpingRat~(2004)(glan) 729]PURGE THREE VOLUMESTO CLEAR LINESANDWELL. 2O IF WELL IS ACTIVE, PURGE ONE WELL VOLUME TO CLEAR SAMPLE LINE FROM WELL ~ IF INACtiVE "/29 PURGE THREE VOLUMES TO CLEAR LINES AND WELL. -- 11 |S [aoa 0 IF. Thr~WellVolumes 6316 TOTAL VOLUME PURGED: - I INDICATOR PARAMETERS _--- f[bm[ r T rE eormFmcaoumcrToTv | oTmiT 1r svr|i T o--o[l o sgocroret r oasT m| Ii| .1 s | 1 T[ r oTpT ] r 1 1 T 7T] z|||] [oroo m rvveisTT(pNoe) |[WaReeioy vYeESsTra) SAMPLE COLLECTION INFORMATION - see Te mee Te| presen |(emceSeaN )No. |Cem GOPl fs osesrgloggNOe ,: r -- Time 1 [| - EET Ea I ~g Resem~h Drive -- caam ~e Coi~a PA I com ee ry - PhPon~e:: 665511-5~3g8-52~ 8[1~r231e~0r32 = Fe GE Foer wr RaveTip, ae[rrnAavn TvaSS| (9) - cw 1 Volume Purged: wweellll RReeqquuiirreessMMaiasiaeteemaaanaeeee?? Aeeesa Reqttirea Maint~ance? 3YUEFS.~ 1/ ~ (SOD YES / ee 1 14.20 roata ............................. l~trge Factors: T~, 0. tO;-'+"" 0:.6~:+ 6+`~+ 1:47: ' 8"~-Z;@l: I 0"+'-4+08 fgallons pr-Hmm'-foo[.of- ~vlt~ ................................................................. 22009955..00114466 33MMAA0011555511992233 ConClfeatiCtd. eGrovne,Miiosasos `WESTON W.0: 02181-002.010-0001 Com~idendal Cliem- Cot..~ Grove, Minnesota WESTON W.O.: 02181-002-010-0001 DATEf_MaARCH20200055 SITE INFORMATION mes77 wen No.: FW--02 [eens poe2 [r Foc br (Vey a [ wd Fun~en: ~ W~ ~ Well in operation at time of~m~li~g? Ym ~ CaimdatedFlo~ Rate: 749 Sslltw.~ (Average for200~) 20S.00 omens [I r PCat Vy-- e |--74]L[RGETemrRVkoaLEeOweeEsTprOwClnosakLseisossnepoWdik F, Tl~reewellVolumes 20 749 1974 iF V~,LL IS ACTIVF.~ PtYRGE ONE WELL VOLUME TO L'LF_A~ SAMPLE LINg FMOM W~LL IiEAD. IF INAL'q'IVg PURGE THREE VOLUMES TO CLF.~ ~ AND V~I~LL If no flow meter, cnlc~iate p~rie ~oiume bull on estaidished 5924 TOTAL VOLUME PURGED: IN])ICA,TOR P~TERS Time oGealelosnhs ePmre-gtedl,___l | g T oo T o [oFVloeweMreR~reRaeadctisngg b23vsec |zzicforel | || -- rT rT foe cof TFTTT TT SectContocivy Gr TTT pr TTTTT SAMPLE COLLECTION INFORMATION [C__E__ SweeNe ---- aTx)S Rima Ck a TO| RT SempiZeANa --T-- v | CrthEeraOve CormenCStoenorClogm11bsenry Tarik Rar Avi META pFo ea: --ves7 wcetmReeerssiisetcnnnceer: v_viu5s_ 11 ((3R6D3 PF o c016, 085 6145, 285, 7,408 prspce hre) ................................. Putg= FactOrs: ~'- O. !6: ~? O..6f!:67~ !..~7;. 8~T2_:_6.1.~. !~'7~_._0.8_ _[~_!lP.m.. p~__ !i_ncar f'ogt O_W,~Fr).............................................................. 22009955..00114477 33MMAA0011555511992244 CondonClit rv,Mims -) WCWEoESnSfTiTdOeOnNNtiWaW.l 0C.O.H.::e00n22t11-88C11o--t00002~2--00G110r0o-00v00e00, 11Minnesota DAATTEE:: /~/_,, MMAARRCCIH-122000055 - em --------e 2 --] ~ [Fo Com vio 72) 6]cutFwBt: 524 (Avea n20e00Up] -K e me me--|r -- EFRRIE AESE raR r ve ve or no [[PCCRO APmaoTPVeivemspRioEmG) @e|]| S] 924]lPUnRGfETHrREEbVOLtUMEuSrTsOiCLeEARdLINESANbDWiEdLL. FT 1 : onsen F. Three Well Volumes (~iem): 9020 TOTAL VOLUME PURGED://, INDICATOR PARAM~fJ~t~ 4 | [verecrm Gallons Purged !0 Pos TT i r rr r rr T Flow Me~r Reading 4 [[oommeeI rcolw 7 | T [T T T TT _1 T T| C C C --C 1. LS NU >I femoeetmo---- | p rr oOn F | SAi~vlPLE COI.,LF~'WION ]~FORbL~TION ji swe Toon] Sample No. Time pMoedsia Ssampele s 1Teemvegey 4 heer aia |Cem Go)POSc oes iflogzyIDdNOo.: ---- -- -- ce a Param~ers: ( ) 8260 VOC & Eas ae ( X ) Fha)rochemicals 304~ Resea~h I~ve tara State College, PA 16801 C~: Kern U~ 2 a eo ~: - - -- me meneerre:VE1Rc ne 17 RT ET Eh 22009955..00114488 33MMAA0011555511992255 Conte ClitCo. Grove Misneson WESTONW.0. 02181.0030100001 Coafid~a~l Client- Cot. Grow, Mina~sot~ WESTON W.O.: 02181-002-010-0001 ATE DATE: ~('/ MMAARRCCHH22000055 Fares pod SITE INFORMATION Well No.: PW-04 Pt eee te meme] ~L INFORMATION [PC e oom oe_Vo m {7iuet dieRn: 17 ps hr200) [P Far ema[Wa Well Functio~ Proce~ W~~ pw e old (2) Flow Rat~. 817 graces (Avemgefor200d) ET CY Well Emcuafion Method [ RC | ---- |re------------------------} IF. Three Well Volumes 11,487 IF W~LL I$ ~ PURGE ONE WY&L VOLUME TO CLKAR SAMPLE LINE FROM WELL HEAD. IF INACTIVE AC LeE bh IR.~GIE Tll~E~ vow'tO CLEAR L/NE~ A~ND WELL. Ifn~ flew meter, ealtmlate pur&~e voluate based on esmblislmd re 2 TOTAL VOLUME PURGED: INDICATOR PARAMETERS Gallons ~f0b leeds TT [oIwFlMoweMeeRteer sRedaidiongg [T7171 T 1} rrr TT fomTepmepesraetueree c(o*C):: TTTTTTTT} rememoT11 TT TT - pe TT [1 1 J 1 1} Specific Conductivity (s): pH: [reeRS NAPLObserv~l: YES / ~ warmer ve yw) . LLL ODOlh YES / ~ [ereCe De owe OderType: ( )S~lveat ( ) Sqme ( ) Oma- I I I I Tims SAMI~LE COLLECTION INFOlt2~4ATION fos Sample EL Media Suaple ID: ~o. T=~meLor, 2 re PE (x)Pint P~a-ae~: ( ) G60 VCC & i.~WI Efl~r ( X } ~uamdm-ai~l~ a van Dive 3048 Ib~:muh Ofiv~ Soca Sin College, PA !680! x om r Coa~cB: Kern Lindmom ~3M) aa lrnon~ 651-778-5~52 eamny John Plaheny 814-23.1-8032 fre Fon 2004 vests | 8 -- cCoOM wMaEwNTsS USnakmiBmren[BRonT RAecceonoPhEl)TAFLro |e Well Pumtx,d Dry: ETS 1 YE~ - / ~ eh 1 00,14, 01 10 lt re bt Purge FactoB: 2"- O. 16; 4"- 0.65: 6"- 1.47; 8"-2.61: I 0"-4.08 (galloas per linear tool of water) 22009955..00114499 33MMAA0011555511992266 Contd lo. Grove,Masson Confidential Clicnt- Cot Grove, Minnesota _ SESTONW 0: 01k 20210000 WESTON37/.O.: 02181-002-010-0001 pare. 4 Laneus DATE: [ ~/ MAR(Yd 2005 - -- fr eeeTrmemje meeele e [Po Cometi Go por{Tor>No CI Wall in operation at dine ofsan~ling?,.~ No | Cok Flow Rat: 148)pike (ge br 008 Calculated Flow Rate:. 1.481 gallom (Avetage for 2004) Well Evacuation Med~od -C[1 oe C om e T|aleo AsAEecvoenemTom aat hen stnends F. Tbr~W~ll Volumes ce Ry IOLINETD IF WELL IS AL'WIV~, PURGE ONE WELL VOLUME TO CLEAR SAMPLE LINE ~OM ~LL PURGE ~E V~U~ TO ~ ~ ~ ~LL ~w n~ 19,030 TOTAL VOLUME PURGED: ENDICATOR PARAMETERS - Telorss Torey[TT OGaullwohnsuPwudrgleod 0 - Foteio | Flow Meter Reading avec TT 1 - [m-- er eolr [r | r [ r 71 [ r 1 | Temperature (C): [smo cootsy_wT Specific Conductivity (s): - pr 1 1 TT 1 1 11 pH: Co -- >-- I ~rTy~: ( ),S~em ( aI ( )ot~- -- tf pian OF SAMPLE COLLECTION IlqFORMATION - swe [smTe e| pMeedi~ Sa."ade [D: Sampk No, - [Carn60 Pe 05 5stoaTTIppor:E -- 1] Pammetem: ( ) 8260 VO~ & [sopmpyl F.th~ Tol ae I enamine { X ) Flum~chemicals "rtm~ Sample No. |[emnrveey ID NO,: Sokcame an State College. 'PA 16801 Comestri sty Conlacts: K.~t Lindsrmm (3M) - man Phone: 651-77~-5352 [1 14-231=g032 - mw COMMNTS FT _ Well Paml~d i~: YES oatwereere mene: Volume / 25 1 (-3~ meee mame: v5 (30) Pa a A FR Ar Purge Facton: 2"- 0. !6; 4"- 0.65; 6"- ! ,47:8"-2.61 : [ 0"-4.08 (gallons ~ linear foot of water) 22009955..00115500 33MMAA0011555511992277 WCEoSndTeON W.C0l:st0--3C1o8r1_005G0r1o0ve00Misnosoa Confidential Client- Cot .., Grove, Minnesota WESTON W.O.: 02181-002-010-0001 DATE: 4MARCH2005 - Sl'I~. INFORMATION ~ mr~ e TV~E- eer rts 'W~J.L INFORMATION [Foi ry Tape del (7 W~ Bum~n~ ~ Supply [Po o Commv a o) cdoa pio rt) Pam~ .C~mtmomd ~ha flo~ m~. Yes ~) - ~ EVA~A~ ~O~ON [Fe | rammwm | mollaSLVR B. Well Diamet~. 24 ~nch ~mhes) J[CETCe PePVoommei on aT| 3576 5 URGEIerE.eVO1 LnIIMeEASgT0OCLEeEeAHbR] LLediocebVEsL C. Average Ar,~d~Raze(20O4) 2e~.oe Well Evacuation Method 20 IF VC~,L i~ ACTIV~ PURGE ONE WLL VOL~ TO ~~LE LI~ ~OM ~LL ~ IF ~A~ ~GE -r~E VOLU~ TO ~ L~ ~ ~ 2631 F 1 e | 1 [aw ge3 - 7893 TOTAVLO~LUME/J,7-r-PKU_ RGED:. levis Tosyg TT} _ bls IT [owMeeRedios 1 0TTTT} T -- TT -- TTT [oT~m-~eatnurse e(Co): ]TT TTTT TT [SSppeeccifCiconCdoindcuicvtiiveityy @r(s): TTTTTTTT 1 ppIe~: 1 [oWeeavseTEs NAPL Oiaw.rved: Y~S / ~ (T vanT es v1s 1 = 11| - o Odm'T3~p~ ( )Solvem ( SAMI~E COLLECTION INFORMATION DATE: [__ SwweNe Sample No. [CeaoammmemTsx6)P0t70s2soresiqlgafocEmoemmeikmSunOtmocvommvine)een oi ePmrya | - Media SampleID: TATimRe T Sample Sample No. Blank: Y~ I NO | vTeime | Labccatow: Exygen B__-'~"~__,'ch 3048 Re~ean:h Drive SmzeCollege, PA 16801 Conlacts: Kent ~'ndmom (3M) Phone: 651-77g-$352 John Rahe~" 814-231-8032 CEEEC T L E Se TrC a -- TES ano Tamron fer Imire sc ersMian _ve3 1(E> Beer G-Pen. [rams Velume Pm%,ed: Well Itequires Maintenance? Aeeess Requires Maintenance? ~ t ~4 YES ! ~ Ir 16 085, 614, 20 488 ro Purge Factors: 2"- O, 16: 4"- 0.65: 6"- 1,47; 8"-2.61; I 0~.4.08 (~allons per linear foot of water) 22009955..00115511 33MMAA0011555511992288 _ WCoEnfSiTdeOntNia.lC0l:em21-8C1c0_070Gr1o0v0e0,M1 isa: DATES Mascuams DATE:7~"~MARCH 2005 ~WI~.I.L EVACUATIONISA.M~Li~G FOl~4[ - stTg INFORMATION [E FWaellfNao.: il'vWa-0r7 7TS ee phe e--s--pe - [ W~:n ~,L ~e ~IOe N e ' =r --o 7e-- 7--]I - WELL P-VACUATIOR [Te Tame To | Soom] Emmi Well Ev~u~ionM~md JE OoiVa GIO: rp] eebd ped eredsamenG0) D~tk m w~mr ~ ~ l~'~i~dy reeor~ea rneamr~wnt (2~4) - oT rm oes| Jo E wwavenwe l [me | anlar TOTAL VOLUME PURGED: ~ INDICATOR PARAMETERS |curiTinmeg ff SGwaellownsbPem-wgedd L ] T = [FFolowwMMe~wter~RReaaddiongg [7 TT} rrr _ ---- T=1 1] [openee cofTTTT T 1 TT 1 SopeeciifeiCc oConndtuictcinvidtyy w(s)r: i 1 T/ TTTTTT 1 - pe 1 1 [1 1 1 1 | NAPI.. Ob~rved: YES / ODOR: YES I [Fs omscoisenoa no soma-- m] O~rTylM~ ( )Solwnt NO ( )s~ ( )ot~r Well Pumped Dry: Other: / NO S~MPLE DAT~: - |swwieNo _ fF reT eeEC Ton pCew oeramSrwimw -- ~: ( ) 826~ VOC & Isopmpy[ Etb= TVR SiSammppkleNNoo. Rir,~m BL~tk~ YES / NO 11 Te | 11 Sete 41 S~e Col~ PA 16801 CKo o Lee r) 30 bry C~ K~ ~m (3M) .lob. Fhhe~ > oe GR prete P~: 651-775-5352 S 14-231 ~032 ~ DE [EF FRoiEN fe aReR i atm VE TVESN1 YO Same CowecTREO Well Pumped Dry: VV~oiummePPuarrggeed:: YES / NO W~I Requires Maiatenaaee? YES / NO - Icos Rein ret VES 130 r-- r ------ er e -- v---- ---- Access Requir~ Maintetmnee? YES / NO Pa Fn 1 045 1465 351, 408 ppl ret a) Purge Factors: Y- 0.16: 4-- 0.65; 6"- 1.471 ,~'-2~I; !ff'-4.0S (gallons p~ linear foot ofwater) 22009955..00115522 I3MMAA0011555511992299 SET Oreb aro CoCnofnifdidenetnitiaallCClilieenntt--- CCoo,._#,eGGrorovvee,, MMiinnnneessoottaa. WESTON W.O.: 02181-002-010-0001 4 oare:_14 MA Lighomns 2005 DATE: I ~/ SITE INFORMATION Well No.: PW-07 mre [eeesems 70 WELL INFORMAT[.ON [FaTroFat Sy [Wna e do e Ye Well Function: TrapField Warn" Supply [Fo o Comma va CBS |wesDar dhs Pump Conmugm~wi~ a flowmet~. Yes Well in operation z time ofsampling? Y~s CL [Teme] Emr a cL orc ar do revi cso} WELL EVACUATION INFORMATION |C Com migwarcas 200,00 WII Eva~afion Mtthod jase] -75.00 D~pth to w~er based oe previomly meordM m~urement (2004) -- i 0,65 r [oe we e |s ol aloe F. Thre~WellVolumm 244.00 TOTAL VOLUME PURGED: INDICATOR PARAMETERS are [mT Time GGallloonwsbPeurggedd T 0 T mel [|] [e Fv peee r| ozae n| | | Flow M~er g~g ~ [IswTeeocommisiny CGGiF[[caFoel3u6z 3sudglJeor[l2a3a8sloovaez]][||1|| [ariOwreves (0) [oor vs Ty {Sort CbCrea owe (Wahmedoy: VSTRON = SAMPLE see TST ee7 | COLLECTION INFORMATION ee[RESrears orSS aTocroaramrmaara cm oe Ke amm heies Fo COMMENTS Well Pumped Dry: YES ! NO Mina Voltt~ revo amses 1 1 50 Well Require~ Maintenaace? VES / NO errr -- VE 0 A~e~ Reqair~ Maintemnee? %T~S / NO F-- e ----n eff 8'8''"pi gg P00, 845617 24 herl o rr Purge Factors: 2"- 0.16: 4"- 0.65: 6"- 1.47; 8~-2.61 ; 10"-4.08 (gallons ~ linear 22009955..00115533 33MMAA0011555511993300 Coln et Grove, Mion WCWEoESnSfTiTdOOenNNtWiaW.l 0C,O.l.i:e00n22t1-18C811x4-4u"~2-2'e-001G100r-o-0v00e0,00M11 innesota DATE: 1] MARCH 2005 _ - [rent (oa 7Dong | = = Well Diarrmer:. . ~ -- [TCee mRrmmste mo ZOFS[v] S oetE en0N neoR3dARr-- BAE2-- R F. Thre~ Well Voham~ (g~): - BIDICATOR PARANIETERS IF WELL IS ACTIVE, PURGE SD~E~ VOLUME TO o G-~" TOTAL VOLUME PURGED: - [ cuGaollnonrs eP~Tr'igmiee edl'| cTos[rerom pnllnialaiezcrllogo oasrl]2J ig|| - [[osmmtneicoommerwy_o| |Taosgo1601ev|o[roToJTT]] Vers com|1|h[a 1rT neT 7 s] s - [|oi_o_mmcemYmes T_FaGmlinle awarrlymdveen(6i)zr1dl|| _ CT C4 oo = - Sample No. CRtgp el Pc MEedia SamEpleE re aa el {camo POF Oso3;9 [jessqove: 1} _ EEtE ne | L[ L -- S= eton (X) pH ( X ) S~ifie C~du~ - fbr ee ( X ) T~ 1 Toe ( John ~al~r~y e IIII er e gE gal [onOa I Pe en [rm = C ORPTA AmG WATRR OE! [WWelelll PFaummppeeddDDrryy.:: YViEsS 7 (50. Preci~s Volume Purged: A ij Well Requires Maintenance? - taal oY ~Access Require~ Mtiatenaaee'.' YES A, Purge Factors: 2". 0. ~ 6: 4"- 0.65; 6"- i A?; 8"-2,51 ; 10"-4.08 (ga}lors per linear tboz of water) 22009955..00115544 33MMAA0011555511993311 CCoEeST wCOlssCoorroGrove Mins Coafiden~l Client- Cot .~ Grove, ~ WESTON W.O.: 02181-002-010-0001 DATE/qL v~iacrc~izzoso~ DATE: EVACUATION/SAMPLING FOlh~ ten7 [eee fo Jr Conardva show mer? Ve aye(3D (%5 [Komatrea 00 Rim TAP A= | wet we at WeE Evac,,='io~ Method AtrhoNmATE [Craryvis|| 2 gem Fea IF mivaTESS [v oC ee 11 r|e [ee er] TOTAL VOLUME PURGED: : INDICATOR PARAMETERS aG e uTJe oeprrr L To T T " ]1 Gallons PLu'ged o Fv | ~ow M~ter Reading [-- [i-- remp e o vo|rr [ [ T r r | T 1 1 1 || Specific'Conc~ctivity (s): pr -- 1 1 pH: I ai rrme----t [orm Ts ler NAPLOb~.rv~I: YES I ~ C o0o,:' ' ~= ~ ~L OderTyp~ ( )S~iveat ( )Seek ( )O~l~r = WTR SAMPLE sme COLLECTION II~FORIVIATION = SewnLf T 0o=F| fame -- | esmeveey 1 |LFan2niGe gBiIEgCcooveryJoperooo rm ma--mata | : coc oni eitmy Siro Kirened SioK www COMMENTS aeae -- 1 ime Vdu~ ~: rreersnin 5 :_15s_ +5()83 ~ ~u~ ~n~an~? ~ " 01 04-140 24 4 22009955..00115555 33MMAA0011555511993322 AAPPPPEENNDDIIXX BB = SSOOIILL BBOORRIINNGG LLOOGGSS 22009955..00115566 33MMAA0011555511993333 [FT TT | in ' i i HL il | |l ST AEA i mwl ERIE 1TAR - Mm] Gag ie !i! Ci) mp) | [ le E PE y t i TE fa qi ! i i CTT de =i dif TTT i [Ris TT RB || | ll| | EHEEE FerErTTT | ill EEE i ialkl R HemE may 2095.0157 3MA01551934 a ul. ol 5 I I [[|1 || 18 |p FE TARE i i |i f Jd i 0] - pene [111 Po [EEE feog,a20t01 1 [=h ] [TTTTTT] i ii i He TTT RE ; El FeteREE TT 2 E alan 14] = i ai [ofTINO i [omen [eel [TTTTT TT] } 3 | [emmm fTlsleelslralelel=les1T[TTTTTTTTTT] | | E Be EE TTT | HIT BERR TIT BREEi alli. | i Er e e T IIIh T oo 22009955..00115588 a3MMAA0011555511993355 [ET -CB i! | - = Win a. | i led || #2 14 I. i hl if | in ] m1L i GH tE sEJi MEE dl hi [=rETT EEi i [= [ITI IYEYER RETaaaT A EE _ g ee i ee] - 2$|l ||[|=i == [leeal e if _ UHHH FE EEEE ee 1, EE i i -: | | | S eE e EE : piltlt |[ H fe (T0 i 2095.0159 3MA01551936 a | | I I J EEE | J wnl oan18 : Ii ; |i fH u|git[E omE ney T111i1i gl remem LL : | ki i 1 : BH Te iETH [ee | ORNEYIRTTRREE[TTT] Fell Eeeeel TTT TTT | EE 3 er iH (10) - net 1 1 g [ome [le al|[TTa TTHE 3 [mem Tle ellelslesleel [TTT] [== [rR TTTTTTTTThy . Rlereeleeele[pTeTTl]a(ehe | Ee ferme =e |[1] 1] [ele eRE TTT TTT]Th abptt [A[TTI i il [pe lH elzsle elsTlTe[l lTTeTleThley i ---- 2095.0160 3MMAA0011555511993377 - HH | i f R WEe Te - wl ee Toiil Es ee n as al4 - yi Elrm---- i - }i fllhi][[ = E ETEn i HI ~ 1 iS [= ee ming 1 ~ 3 RRR ERRR i : plat [ATO ~ El[VER |[|e= n|[eelfe a el |] - WIWWE EEE " H| {TliN Sfpriree rereEE 0pHt - . |Eee i sf il 3f Leh Ii ; 22009955..00116611 33MMAA0011555511993388 WIT + | aiul Bl I i | | I i= | i ll . |0 ; || iod IT Ii fg. 2311[== HETTT - Wi =E Hi i: | ki HT [oe [HETTT] TT iili ii:! iii LI | EEE ; EH - z i fgi [== TTT 8 [W8aad || [R TIT TTTl TT s . i i IlE er e HI rrr . ele] CTT TTT i i i : i saat | ALTTTTIITITTTTTThy i..~.iiiil |Be Ii Hi : 2095.0162 33MMAA0011555511993399 gl HHH HITT 5 j a] Wm i I - MLE 2 ?WTIE E i :: WI1HL phe sme ae s im Baksh | i - | ap Ridings 002 3 222 4 i bh [Eel : Hl bil "Bi _i 8 12 _ g Fe [ee I [oFTTT T~Y, T Y..E..E. E..N.N.T N.E.NR.T EA.TN.E TR iin PClEEFEENREEEEEEEEEEEEECEEEEDEEEEEEEEEEEEEEEN[] | 5 AE ITL ThE if f] EE sll Lselallalslalszlsllsllslaslslo Ji ERY [a 8 [TYSTRHTed|||[onTRel alese sa | Ih Fe -. Hii HIH Se EEREanmee anercay i ] aailtl ||AHETTIC ; i i 22009955..00116633 33MMAA0011555511994400 J| |H|HHI i] | iIl i od a22n 4L AHHE H i! ga A Hil ,!! !i >IIiiiI HITT : iI!t! I I t ~I t!II i A! etl ld .t ..... i ilii ii i uo stn [memLLL sh) ry ~ it il if i0 A2 2 EiW BH Ce WT~iiI~!ii~!!i~i~!!iI II! [ewer JERT E TT] "I'I-!--i i ! ~ I ~ i ! I i I ! i ~ i I i i i i . t . . 1 .... t .... HE HHHHH BEER BER TTTTT TCO i i l i i !~~ li!i ;!lt i i iiiti~ Itii t!i !Iiitl {ESTHMREA ! i ~i i ! ! i i i i ~ i ~ ~ I ~ i i i I i i ~ ii ifilt~iltl~l!t t ii 1 11i i ii i t l Ii i1 1 1ii iI i |(| =[ = esa[ =L e C ii-- iiiii Hi i |r i If : ~I~'~ i ~ ---- i : ii i HH I| E sE r psiitl ||A HT TT i 2095.0164 33MMAA0011555511994411 - ly | o dil IRE i aE I ii _ 5 : of i HE 3 _ ikee]i dgiyt d HHH ag 1Ll If : JmTElH f mEEdem r dae - iI _ i il [--[-- > i il Cdk HliH[CoTr [FEIVaES TEEe e e | _ i 8 3 - 2 BEE EE i pleizieleieleleslale =Relelolele elo=lE] | [lESERRIEFERE FREEEREEERE [1,5 Gaia | CF ER = a [| -: ill |I gE ieEee i . HHH EEE = cy |EEE Th - haideh |[pA TTTi 22009955..00116655 33MMAA00115555119942 :| Ld | R ll H T THTITTTT ]i: i of Hi | Wy BEEBTis EIlL STE J ai mA da iid n 3 1111 1HHHE | Hi I] FP esas Em=== == RRRANAE dad Ce i HC WIEETETTR] i [oe JHEYEEERRE [T1111TTTT] F008 Sh g HEE HH |= JemTTT ~ tll~tI~ 2 NR =I TIT 1,1i11~ , 8 [THaTliTl |||[E oomReee l e[Te TTTTe a TTTTT] TTT] HiWilili Iii |i | FB ETs s TT r Ufai!LliL!li)i ! |f HEEccSoT EcomT mmmmT amnnHma Ra| ; pitas[ANTOTIOT 8 HY 3: 2095.0166 33MMAA0011555511994433 = Flt JT -- {Bl [1] H|UTTHh 5 -: aBlopfhi - Jgafal i |Eie HHH -: :: Sd zf - fg ER ml 1] bide pBILLhiH | E bi y [pee 111114i HH Ce TTT Eg] FER EEE CRERRE INAR ( GhiaEH - g |4 praseesacene: i iif [ATO - i I [= [sesazaslesdassle[11111171 - 8 |iHn||| [E foe AsSfEsNiEeCE sElEeEClCfCaClEeNlNr [eAeTfRTarTlRs]l], s1] - iHilll HHH FB EEEE CNEEGE Em E OEEE E eNT r R - all WE a| { iii iiiiii ii iiiiii! ii i !! iii i!iii i i i i 22009955..00116677 33MMAA0011555511994444 | iI|I [aE EETELTTRTR HH i8 i FIBRog REE A : phan AHlo TEiE nalHL g 0 -- b/ liCI Eis 1--et--alT|||hi . gti! =] WE - ii BE = ee WETTTT TEETeR TTTT T] N og Hee - :g | Fheie jAeE eBamielaleHnTiyTllTi _ Hl| S [=e a hhI F Ee ee et -. ei aaiglht ||H ATe ITOeOOOTT i F 2095.0168 33MMAA00115555119945 - Del L BIITTTTY ; ld pie HET i . EE EE Ll : hii 0801 HH I S- Ldilmn WfEhamea eid ~ I r ~i I i I ~ !" ~iI~ i~ i! ~ ~ i~I ~ ~ I~ f i i I ~ I I i i WITH fegziiaanagy ||| at - F-e's," " 2 ]' " " [| I i mi bm i i |i [i |]i , Hi ~ ~ ~- i $ i ~ ~ -,-,-,-,-,-'-'-'-'-'-'-'-'-'-'--'-'-'-'-'-'-'-'-'-'-'-" Hl =e H"E ! w~eo WT E T TE TTT T i@1 i~i i i i i i i~i i i=i i i i : f [o 1ul y e . i : ; : ' I I = Ee - g EeeBos ae TT i 11 ~ ,-~,, ! ~ 'i 'i i~ i' T ' ' ' T ~ CIN bese 2 | ay BR ls ii ii1fi'1il t~11/ i hil CECE !1 f I I I I I i I i i !, i i I i i i i i ! !i D I HI | e Ee Ee E - 1i ili T~Hiii["~e.i'ie ~i~ie i~ i:i~i:m ~ ~ ~ ( ! Ty i ~ Hii Ile]Jello TTTTTTTed , --" --, ..... ! o'-1 .... "'" !~I ............ ~ ~ i i,iiiI gaittlat [ | Se ALTTH O | I 22009955..00116699 33MMAA0011555511994466 JI | [ TTRdy i Jia i l AEHoy ma glif iil adel)| GHEE HaIF ANTI Eke ||de ks MT us, that {=|e ET e[Te TT i i3 - k] HT [=e TTRTRIRNE TTNTTT YTTT] 8 fj - g Freese TTT g i EsTT iH N 0 icA pips |A{[TIITTIITIOOT g 8 |W | |[[[w=o=mT J[f|T[[geE <s SasllE lTosaaldlaaselR e]lf[TsTTl] TTe]lT7] i i | | II E T {EeR eE E TTE TT E J HTH| E eE eE r all eeI 2095.0170 33MMAA0011555511994477 :- ]] paIl [ nAi An A i: CM y E EE E :- 1 5jh i die| iI - i 2| EE - 2i ar : Hm bid il oh iE z 2 EE EE EECCAE Hest leased |||] Ti EWE || [=TTm T TTI - 3 [Yi [enJAlafslelleleTlTeTlTslTaTlf]e - | WiI| EE meeLEER TTTTTT -- I Hi E FE TTT : ath tt |I eeT e II - of i HESCECEEEEaCENENANNRREN] 2095.0171 3MA01551948 Ligh7 dHd E| THTH THnt 5 - Hey ie i: A mH IH - {| 0| Rfeem|| lei )a ih i TThI] dEBpaessderussalas)Hh| i yt [lee[ITH HEE ol HH e eeT TTT it [ve JTTFRTA ETE[T AY(TT T77] i 23 Hesse sree ee HHHl - BEE Ee Tee mE TT _ 2g fl:i - iWelz E a i Fsslaisleee] sls i i: - sheesh HLHH Hi| ee[ERPs] Tle JETTTT - FEE iii FEE ree - HH Di B di CATT all |Hee i. 095.0172 2095.0172 33MMAA0011555511994499 mm TATTRT A .! 1 ITH ) _ a BL . i = ! HH IL, wi i| . 4 : 7 1i: HHj T ani 1||||i | aA ke i; HE LE a Fr TTTThwEl : M Pl E EmEre } } Sqi = [== nL Ee a Bin | } i HEfeLRl ] = Eiie sa i TT ;- - I TAT | | == TeeTT Cl HHI i F pefEr m E mme Hni . |HEE uh PEE pili|4 Hil i i : 22009955..00173 33MMAA0011555511995500 En ld HII ! al dE Hl ill B1 EL ITH ml fd git Co-- Ti i saihlit | EoH lit bo, Elm [REE Ey g i 2 [SIRE ERRRR=== TTT Ts - { isislslslslsi islalalalele || [|Ih Il| i E [en[|festa (TITTLE 8 [YH W1T [P=E FAE{elfellellafeef|eer lTTTTTr Tr TT71] | || PTETFERRE (TTT TT ollnll,|||TFoHESree (TrrH | aitart [ATT 2 2095.0174 33MMAA0011555511995511 ll IER Hill | - adi 8it i EEf] l i : k! al bi ) LiL REE iPR hyTMIELiEt [BR=aa]be l-- i]IT) 4ki "ig : A cE | - i 5 [ik Hoo [=eWITEERTEERTEETYT2E EETTHTTE]R EE eeR 3 I PE [em [Jill[o]o| [TTS [ome el ll elel Te1 [TTT - | PEE _ I | i Coo | PEATE ET TTT ThE | i!ii e pit | ofTTT all |BET rr s - :3EidiE i i i 3 '''iiiiii iitt 2095.0175 33MMAA0011555511995522 _ ANNUAL REPORT AAPPPPEENNDDIIXX CC FOR COLLECTIONS UNDER SPECIAL ANNUAL REPORT FPPOEERRRMMCIIOTTLNNLOOE..C11T33I00O33N11S UNDER SPECIAL 22009955..00117766 33MMAA0011555511995533 ~ Wonsodtirsnc. Wes~n SolutJnns, Inc. 1400 Weston Way i P,O. Box 2653 West Chester, Pennsylvania 19380 = WEEN S = TT TC 610--701-3000 Fax 610-701-3186 www.wes~onsolutions.com : _ JJaannuuaarryy 3300,,22000066 - FPPiaasuuhllerJJ.i.eWWsiRinneggsa,aettaeerch Manager - `MFFMiiinsisnnhheneMsreiasoeontstaaaRgDDeeesmepeepaaanrrrcttthmmSeMeencntattoniooafnfgNNearattuurraall Resources Resources DFiisvhisMioannoafgFeimsehnatnSdeWcitilodnlife - 5SD500tiv00PiaLLsuiaaolff,naayyMoeeftNtFtteei3sRRh5oo1aaa5ndd5d Wildlife St. Paul, MN 55155 = RRee:: AAnnnnuuaall RReeppoorrtt ffoorr 22000055 CCoollelctlionesucunndtdeeirrSSpoepcneciiasall PPeerrmmiitt NNoo.. 1133003311 - DDeeaarr MMsr.. WWiinnggaattee:: - "TTthhheiissvaiancnminnuuiatalylrorefepCpooortrtththaaagssebbeeGeernnovpperr,eeppMaarireenddnoeonsncocoaollluleenccdtteiiroonntsshoeoffsicfisisehhntppieferircffoocrrommleleeddcitinnitotnhhepeMeMirsmisisitssis(ssiSippCppPii)RRiSivpveeecrriiainnl tPaPheneerdrmmvitiithtceiNNnoRio.te.yg11io3o3f0n03aC31l.1o.tFtPPairgsriiheooerrrGitterooosvtthMehe,aenMccaoogillnellenercce,ttsiiooDotninareekufffnfoPodrerettt,r,erttthshhoeeen,AAscrrwieeeeaanretFFi.fiiissnchhoeetcriroiifeleilsseedcMMtaiooanfnnaagtpgheeeerrr,m,peDDitnaad(vviSeenCgZZPaas)ppaeSpmteppitellicilllionoa,g,l - paaacecntrtdiifvvioittthriiemeesse..RdieNNngooaiocntthahclrreeoaFattiersenhndeeedwrdaiieootnsrrhcM teehenneadndaaaSngnCgegPerec,rroeenDdddiirsstkppieeoPccneiiseet.essrswwoener,reeweeennreccoonuunontttieefrrieeeddd and all collections were of the pending sampling and all collections were performed in accordance with the SCP conditions. - FaFdiisjshahcceconoltllleetccottiiootnnhsse ww3eeMrree CppoeetrrtffoaogrrmemeeGddrbboeevttewweefeeacnnilAiAtuyu.gguusSstpte88c,,i22m00e00n55s aawnneddrAeAuugcgouulslstetc11t2e2,d, 22o00f0055smaaattlttlhhmrreoeeeutrrheeaaccbhhaeessss - ma((?adM,cij,~arcciroceocrnpohttpie:rctriors)'~s.thddeGooell3aooMmtmiiteeywCup))oe,,sttccaihhgnaaecnnlnnuGedelrelodvccaeeatltffefiicassthchriol(f(itliIycsc.thtaialSnluguprreufucossirmppsuuemnnnacsclttalawtmtuueossru)e)thaaennobddallsesbbclltauueendeggdiilolbllflussscuumgnnifafliilslsmhshuon((ufLLiteehspphoobammanisidsss tmtirrnoaocttelllriuinodniieinnhngggiru1ff1oso)rr.scmGcaaatetlffaliirssmhhto..yuptNNehosonbn-ian-tstcasalr,ruggde3eet0tdcssehpplaeeecncciniteeerssolfiwcwsaehetrifrneeigshrrfeeaollnereadasssree2ndd1a..llbmlAAuoeugttiotohlttlaalblsauoosnsfffisa66hn22.d Wffbiihlssuhohelgwweielelrbresoeudnyccfooilolsllrheeccfaittneleedddt - tistiinshscssoluuwueeidsninsagagmmpt1hpl1eleessscmowwlaellerelrmceetpoiprounretehpplabaorcraeeasdtdsi,forf3nio:0sommcathnathdhneencseocallomlcpllealectecftiteseIhddDssaspnpediecsci2i1pmmreeobnnvlsusifedfgoeodirlrl iccsnhhueenAmmftiisticchaaa.cllhWamanenhanlaoytllyesse1ebs.s.o.dTAyAabfouifrlgisgufiuirlcreeedt m`shmooorrwpphihnoogmmeetthtrreiieceddoaltlaeoacontniotttnhheelfaofiicssahhstisaoamnmpslpelaesnsadaerseappmrporlveidoIeDdisivnniAAsitttptaardccohhvmmiedeeennddtt 22i.n. Attacb_rnent 1. Tabulated oWWfEEFSSisTThOOaNNndaappWppirrleedccliiiaaftteeessintthhpeeroaasvsssiiidssittanangnccteehepprrSooCvviiPddeefddorbbtyyhittshheeprDDoeegppraaarrmtt.mmeTenhntetrooeff aNNraaettuunrroaalliRRmemesesooduiurarccteeesspDDliaivvnisissiifooonnr - oaaddfddFiittiiisoohnnaaallndccoolWllleeiccldttiiloiofnness ioonffpaarqqouuvaaittdiicicnbbgiiootthtaae.. SCCoConPnsseefqoqurueenthntitlslyy,p, rttohhgerrraeemiis.s nToheprreesaernet no present nnoeeidmtmoerdeianteewptlhaensSCfoPr need to renew the SCP merc s ompairi 22009955..00117777 @ 33MMAA0011555511995544 _ DiDDvNNiRsRonofFishandWidife 2 Division offish and Wildlife -2- JJaannuuaarryy 3300,,22000066 - ffoorr tthhiiss pprrooggrraamm.. PPlleeaassee ffeeeell ffrreeee ttoo ccoonnttaacctt mmee aatt ((661100)) 770011--33778877 iinn tthhee eevveenntt tthhaatt yyoouu nneeeedd addidonal information on the caletion activities described above andinthe tachment to tis additional information on the collection activities described above and in the attachments to this leterrepont letter report. Very aly yours, V~n'y truly yours, - Ta WE N SOLUTIONS, INC. - J r-- Attachments CharorlesTeTc.hYnoicuanlgManager ] ~ ~enior Technical Manager - ce: MM.. SSaannttoorroo ((331MV)0 R Pascike GM) R. Paschke (3M) G. Hohenstein (3M) G. Hohenstein (3M) - 7 Kesar (WESTON) J. Kesari (WESTON) 22009955..00117788 33MMAA0011555511995565 AATTTTAACCHHMMEENNTT 11 22009955..00117799 33MMAAO0011555511995566 gal el AE 3 iy 3 iH | iml. i } HER i411]11111 EES 4 itt uf Sn |Bg vd \ $e 2 i. il. ( SEin IE i7 i Tii mes |S nn] ni Ld 4 : I a 4 nN : = ; 8 J n i : + : ;i . 3 pl i ; A liiiifm i e dN i| | aiiifif Eo a isuearom|}s| | 22009955..00118800 33MMAA0011555511995577 AATTTTAACCHHMMEENNTT 22 22009955..00118811 33MMAA0011555511995588 odBsazsseense iBrggegasase i$3533800man - Ag if if cd frazsessees sssgsaszss frasssaness - sig i i 3 {lessannanee {lumsazasn jlassasasane 5233 i3 P3 SHR HH HOHE HHO Ena Bh He ~ 3z3z3z 83z3z333~7 ~oo~oo~~ 2z3z3z 38z3z33~3~3 i53aaaaiit 22009955..00118822 3MMAA00115555119959 - fsssnsne .i s -CdBusessss Zeasis i 3 ABerrar Ssseak s Prgzes 5319s i s Dagese - } {sifnsane isffezzas dsffennes Hiisens :i Chgik fBOfR ii jhasnnse jlssass jhsss fleesss | CH a - i ii5 i Zegzi S8%85ss S238 Eecsess hand had gl oaen gsgssas sasas smsss anaes 2 ooooooo CL an a ~~ ooooo ~~ 99999 99999 99999 ooooo jean gle pte pn - sisi `een: Crieee ceesnd ~ZZ~ZZ ZZZZZ ZZZZ~ ZZ~ZZ 22009955..00118833 33MMAA0011555511996600 - 3z i3 - fesse fase: .i i _ f3zgsgss 3FSfsseas - i i og ff f shssses Hears e- S3 33 35lees ji3}s he =F ifi 52 Ca 3 sasgazs geErr - f$i3g31:1 ~ 88888 a Esaasests fen diainie 88888 22009955..00118844 i : 5i ii i i2: : $3 33MMAA0011555511996611 _ AAPPPPEENNDDIIXX DD AANNAALLYYTTIICCAALL DDAATTAA PPAACCKKAAGGEESS 22009955..00118855 33MMAA0011555511996622 --_------II pd = = "- = = = . IINNITEERRIIM MRREEPPOORRTT##22AAu,auialvyssissooff.,C.Coostttagl~eeGGrroovvee1,annddWWooooddbbuurryyWWatateerrSSaammpplleess SSTTUUDDYYTTIITTLLEE AAnnaallyyssiissooffPPeerrfflluuoorrooooccttaanncoiicc AAcciidd ((PPFFOOAA)),, PPeerrfflluuoorroobbuuttaanneessuullffoonnaattee ((PPFFBBSS)),, PP`eSree fdliur moernof th,~Fal insehu s,uaLo nfodnCralta~om((sPPh FFUHHsSSe i))n,.gx aaLnnCda d/PPeM~n rS'ff/lle uMnooSrrfs ooooocrcutttaahnnl ee~ss3uufMllffCoooonntaatttnrea(g(a PPeFFGOOrtSoS)v)eieinnMWoWanattieetrro,,riSSonoigflt,, Sediment, Fish, and Clams Using LC/MS/MS for the 3M Cottage Grove Monitoring Program DDAATTAARREEQQUUIIRREEMMEENNTTSS "EEPPAATTSSCCAAGGooooddLLabaobroartaotorryyPPrraaccttiiccee SSttaannddaarrddss4400CCFFRR779922 JSiSTsTiUmUDbDaYYcDDoIIaRRtEEPCEC.TTOODRERE Jaisimha Kesa~i P.E., DEE W`WeWese11sts44tt00Coo00hnnWWeSSeesoosslltuuttettooiiPrnnooA,nnWWss,,a1a5IIyynn3cc6..0 WPehsotoCeh:es6t1e0r-,1P01A-317963180 Phone: 610-701-3761 ICINNTTEEORRIIMMMRREESPPPeOOpRRLTtT eCE0Om9,Mb2TPe0L0rE5ITIOONDDAANTTEE September 09, 2005 PPEERRFFOORRMMIINNGGLLAABBOORRAA.T.TOORRYY. ExygmResearch Exygen Research 3058 Research Drive 3058 Research Drive `SSttaattee CCoollllezggec,, PPAA 1166880011 PPhhoonnee:: 881144--227722--11003399 STUDYSPONSOR STUDY SPONSOR 33MM CCoommppaannyy 3M BuiCl23d6i01-nB-g10 3M Building 0236-01-Bq0 SStt.. PPaauull,, MMNN 5555114444 PPhhoonnee:: 665511--773333--66337744 Protocol Number: PO001400 PPRROOJJEECCTT `ExPyrgoetnoSctouldNyuNmubmebre:.rP:00P0O1O4O0I0400 Exygen Study Number: P0001400 "Toul Pages 15 Total Pages: 115 22009955..00118866 33MMAA0011555511996633 dts rei Interim Report #2-Analysis ofCottage Grow and Woodbury `WWaatteerrSSaammpplleess Sess Exygen Study No.: P0001400 w GGOOOODD LLAABBOORRAATTOORRYY PPRRAACCTTIICCEE CCOOMMPPLLIIAANNCCEE SSTTAATTEEMMEENNTT Con pe EExxyyggeenn SSttuuddyy NNuummbbeerr PP00000011440000,, eennttiittlleedd ""AAnna.~l!yyssiiss oofPfePrefrlfluuoorrooooccttaannooiicc AAcciidd ((PPFFOOAA)),, PPeerrfflluuoorroobbuuttaanneessuullffoonnaattee (P(PFFBBSS)),. PPeerrflfulouroomhheexxaanncessuullffoonnaattee ~~ ((PPFFIH-SIS)),, aanndd PPeerrfflluuoorrooooccttaanneessuullffoonnaattee ((PPFFOOSS)) iinn WWataeterr,, SSo~ifll,, SSeeddiimmeenntt,. FFiishh,, and CCllaamms UUssiing LLCC//MMSS/~MiISS ffoorr tthhee 33MM CCoottttaaggee GGrroovvee MMoonnititoorriinngg PPrrooggrraamm,,"" ccoonndduucctteedd ffoorr 33MM `CCoommppaannyy,,iissbbeeiinngg ppeerrffoorrmmeeddiinnccoommplpiliaanncceewwiitthh EEPPAATTSSCCAAGGooooddLa! b~ohroar~ttoorryyPPrraaccttiiccee Standards 40 CFR 792 by Exygen Re,earth. 4 fee rHUi. b /~obn Flah~ " / Ei Principal Inve~ilgator Exyge~ Research J By JJaailssiimmhhaaKKescasarrii PP..EE..,. DDEEEE StSutuddyyDDirireeccttoorr ge Weston Solutions, Inc. "Tas, RRoboeberrttAA..PPaas.c~hhkkee trheen Sponsor Representative 3M Company TE Yo/es Da~e lsps. alsles DDaatte~ -- w Exygen Resea~h --. Page 2 of 115 22009955..00118877 3MMAA00115555119964 IInntteerriimmRReeppoorrtt##22--AAnnalalyyssiissooffCCoottitasggeeGGrroovveesanmdiWWooooddubruryy ~~EExxyyggeennSSttuuddyy NNoo..:PPO00000I1440000 \ `WWataeterr SSaammpplleess. | vw QOUUAALLIITTYYAASSSSUURRAANNCCEESSTTAATTEEMMEENNTT EExxyyggeenn RReesseeaarrcchh''ss QQuuaalliittyy AAssssumr'aanmcee UUntit r:'eevviieewweedd EExxyyggeenn SSttuaddyy NNuunmibbeerr PPO0000011440000,, | eentnitittlleedd,, ""AAnnaallyyssiissooffPPeerrfflluuoorrooooccttaannooiicc AAcciidd ((PPFFOOAA)),, PPeerrfflluuoorroobbuuttaanneessuulfffoonnaattee ((PFFBBSS)),, . Perfluorohexanesalfonate (PFHS), and Perflocooctanesulfonate (PFOS) in Water, Sol, | Perfluorohexanemlfonate (PFHS), and Perfluorooetaaesulfonate (PFOS) in Water, Soil, SSeeddiimmeenntt,, FFiisshh,, aanndd CCllaammssUUsisinngg LLCC//MMSS//MMSSffoorrtthhee 33MMCoCtotttaaggeeGGrorovveeMMonointiotorriing Program" All reviewed phases were inspected for conduct according 10 Exygen Program". All reviewed phasesI were inspected for conduct according to Exygen > Research's StandardOperating Procedure, heStudyProtocol,adall applicableGood | Research's Standard Operating Procedure~, the Study Protocol, and all applicable Good LLabaobroarattoorryyPrParcatciticceeStSatannddaarrddss.. AAllllfifinnddiinnggsswweerreererpeoprotrteeddttootthhee EExxyyggeennPrPirnincciippaall | IInnvveesstitgiatgoartaaonnrdd MMana agen mena taanndg dttooe tthheem SSttuude dyyDDin rierecct ttoorr.. | DateReported toDueReported | Date Reported to Date Rq~rted to Duc Pracpsl Sum | DueReponedio | Date Principal Exygen Date Reported to = TM lowed Insite Massgemen Sad Disr Pha~ Inspected Investigator Ma~a~mcmt Study Director SRewDuaReiew 4. Raw Data Review OSB2A0S 05/23-24/05 GWADOS 08/30/05 00205 09/02/05 098NS 09/09/05 ShermAmyicd 0525205 ONN0S oSu0S 09nsms _ Repart Review 5. Interim/Umlytieal Report Review 05/25-26/05 08/30105 09102/05 09/09/05 | - - 88.. IInntteerriimmAAnanlayltyiticcaall ReRpeoprortt RReevviieeww 0O8R/3311-.0099/0011/0055 0099//0088//0055 0099//0088//0055 090/90/099//0055 - Cydia Ser a Lydia ~Ter (//~/' TTeeclmi~dLLeeaadd,,QQuamlfilitcyyAAssssuurraanncceeUUnniitt orfostes DDaatee ~ anaelvyiticoafl reporteaitthreecponrclnudsisonioftdhestruvdyd. cThis QAsateinvmolveesonnly tthe | = "1NNoottee:: AAllllinin--llaabbininssppeecottiioonnsswwililll bbeedodoccuummenentteeddiinntthheeQQAAststaatteemmeennttfoforrththeeffiinnaall analytical report at the conclusion of the study. Tiffs QA statemem involves only the review of the interim r~ort and associated raw data. wv ExypenResarch Exygen P.es~roh 22009955..00118888 Pagel 115 Page 3 of 115 33MMAA0011555511996655 rnp 2.AfomsdaobfiCaogGovesdWoof Interim Re~rt #2-Analysis ofCottage C-rovr and Woodbury Water Samples BeedynNo F010 Exygen Study No.: P0001400 w C CEE RTR IFICTAI TIOFNOI OFFC AAUUA TTHHT EENNI TTIIO CCIITTNYY `TT~hiissinitnteerriimmrerpeoprot~,ffoorr EExxyyggeenn SSttuuddyy NNuummbbeerrPP00O000011440000,,isis ion Fa ow representation ofthe raw Sbmitedty: BpmResarh Subw.itted by: Exygen Researoh 33005588RReseeseaarrcchhDDririvvee StSatatteeCColollleeggee,,PPAA 1166880011 ((88114,))227722--11003399 aatrtruueeaanndd cro~mxpplleettee PrPirnincciippaallIInnvveestsitiggaattoorr,,EExxyyggeenn:: eeGpriiscn Bry Reach Baethbs Date [-- AExygen Re~e,arch Facility Management: v Tperiyaned, FogReact Exygen Research B2eJel-05 Date SadyDisc WoonSolin, Weston Solutions, Inc. "Hui fWereneSolras,w P.E., DEE Weston Solutions, ~ DEatoe ! / `SSppoonnssoorrRReepprerseentsateiven,3t3MMaCtCooimmpvpaaennyy,::. a. od, 0 Robe APacts Robert A. Paschke - Neg: Tt ComparesEnsePrognrams Manager, 3M Corporate Environmental Program~ ExEyxyggeenn RReesseeaarrochh a{13los bw Date PPaaggeed4ooff 111155 22009955..00118899 33MMAA0011555511996666 "w - ~ - - ~w - - - - - - - - | Interim Interim Report Repo~ #22V--AAinnnaaellyyssSisasomopfflCCeosotttaaggee rove snd Grove and Woodiey Woodbury ExygenStayNo: BOOI4G0 Exygen Stud/No.: PO001~30 i Wa~" San'rp|es STUDY IDENTIFICATION | STUDY IDENTIFICATION Analysis of PeciuomocActiad(nPFoOiA)c, Pefuorobutanesulforate (PFS), | PerflAuonraolhycsxisanocfsPuelrffolnuaotreoo(~PFtaFnSo)i,caAncdidPe(rPfFlOuoAro)o, cPtearnfelusoulmfbonuatatnee(sPuFlOfoSn)ati~n (WPaFtBerS,)S,oil, 1 Pcrfluomhvxanesul.fonat~ (PFHS), and Pcrfluorooc~anesulfonate (PFOS) in Water, Soil, Program SSeeddiimmeenntt,,FFiisshh,,aannddCCllaammsUUssiinnggLLCC//MMSS//MMSSfoforrtthhe33MMCCoottttaageGGrrooveMMoonniittooring 1 PROTOCOLNUMBER: Po00L400 | PROTOCOL NUMBER: P0001400 EEXXYYGGEENNSSTTUUDDYYNNUUMMBBEERR:: PPO0000011440000 | TTYYPPEE OOFF SSTTUUDDYY:: ReRseisidduuee | SSAAMMPPLLEE MMAATTRRIIXX:: `W Waatteerr | TEST SUBSTANCE: Peclomactanci acid (PFOA), | TEST SUBSTANCE: Perfluorooctanoic acid (PFOA), PPeerrfflluuoorroobbuutmanneessuullffoonnaattee ((PPFFBBSS)),, Perluorobexanesulionate (PFES), and | Periluorohexanesulfonate (PFHS), and PPeerdflluuoomrcooccttaanneessuullffoonnaattee ((PPFFOOSS)) | 3M Building 0236-01-B-10 | SSPPOONNSSOORR:: 33MM CCoommppaannyy ! 3M B~lding 0236~01-B-10 `SStt PParuold,, MMNN 5555114444 | W1e4s00toWnesSotlountiWonasy, nc. | SSTTUUDDYY DDIIRREECCTTOORR:: JJaaiissiimmhhaaKKeseasarrii PP..EE..,, DDEEEE Weston Solutions, Inc. 1400 Wcston Way W`Weesstt CChhees.tset~r',, PPAA 1199338800 SSTTUUDDYY MMOONNIITTOORR:: RRoobbeerrtt AA.. PPaasscchhkkee 3M Company 3M Company 3M Building 42.02.E-27 3M Building 42-02-E-27 SStt.. PPaauull,, MMNN 5555114444 PPEERRFFOORRMMIINNGG LLAABBOORRAATTOORRYY:: State College, PA 16801 EExxyyggeenn RReesseeaarrcchh 33005588 RRee,s,c~aarrc~hh DDrriivvee. State College, PA 16801 TIMETABLE: Inet Analytica Sant Date: 03728105 AANNAALLYYTTIICCAALL PPHHAASSEE `SSttuuddyy IInniittiiaattiioonn DDaattee:: 0033//0033//0055 | TIMETABLE: Interim Analytioal Stm Date: 03/28/05 IInntteerriimm AAnnaallyyttiiccaall TTe=rimuiinnaattiioonnDDatame:: 0088//2222//0055 IInntteerriimm RReeppoorrtt CCoommplpelettiioonn DDaattee:: 0099//0099//0055 Brg Reseach Exygen Researvh 22009955..00119900 PPaaggee S5ootfl11155 | | 33MMAA0011555511996677 Interim Interim Report Report ##22A-WAnaantlaeylrysiSsisspooiffCeCosottataggeeGGrroovveeaanndd Woodbury Woodbury Water Samples EExxyyggeennSSa'dal~yly NNoo;,: PPOOOOOOLL44O0D0 - PPRROOJJEECCTT PPEERRSSOONNNNEELL TfThohleeloSSwtituunddgpyyDeiDrrsierocetmcoteorlrfffororor mhthEiisxsypprgoreojnejecRctetisisesJa~araicishsiiwmmebhraaeKaKess~sasoacrriiiaaatttedWWweieststthoovnnaSorSliouolutu~isooplnh3sa$,s,Ie]nsncOo.,ftTTihhsee iifnnottleelroriiwmmipnpgoorptieor~nooonftnfttehihlees~ostotuumddnyy:E:. xygcn Research were assv~ted with various phases of ~ `Name TTiittllee Naln JJoohhnnFFalhaeherrttyy `VViicceePPrreessiiddeenntt KareaRisha SScciieenntliisstt `PPaauullCConomnonlolllyy TechLenadi-cLOaMlS Technical Lead - LC/MS CChrhirsisssyy EBadwwaarrddss Technician `BBrriitttaannyyKKraravvetests TTeecchhnniicciiaann MMararkkAAmmmmeerrmmaann `SSaammpplleeCCuussttooddiiaann v AAmmyySShheeeehhaann AsAssoscoicaiatteeSSciceiennttiisstt BErriicc EEddwwaarrddss `SSaammpplleeCCusutstooddiiaann SShhaawwnnRRoobbbb TTecehniccalLhLe~aidd -cFFacaicaliiltitilieess EEddwwaarrddRKaaiis~err Scientist v ExEyxyggeennRReesseeaarrcchh 22009955..00119911 PaPag~e66ooff1I1155 33MMAA0011555511996688 _--_-- lt Ree2 iisof orgGove Voy EnoF100 Interim Repor~ Vite Samples #2-A.nalysis of Cogage Water Samples Grove and Woodbury Exygen Study No.: P0001400 i J `TABLEOFCONTENTS | or PagePage i. TITLEPAGE... sd TITLE PAGE ....................................................................................................................... 1 GOOD LABORATORY PRACTICE COMPLIANCE STATEMENT... d GOOD LABORATORY PRACTICE COMPLIANCE STATEMENT ......................;.......2 `QUALITY ASSURANCE STATEMENT... oss 3 QUALITY ASSURANCE STATEMENT ..........................................................................3 - CERTIFICATION OF AUTHENTICITY ..ooeereorneeeenee d CERTIFICATION OF AUTHENTICITY ........................................................................... STUDY IDENTIFICATION. ...cerseemoseoomeenenenneS | STUDY IDENTIFICATION................................................................................................5 PROJECT PERSONNEL.....................................................................................................6 - TABLE OF CONTENTS.....srmmmmesemsneorsesermssnmoon] | TABLE OF CONTENTS.....................................................................................................7 LIST OF TABLES... ose 8 | LIST OF TABLES ............................................................................................................... 8 LIST OFFIGURES... messes. | LIST O1~ FIGURES ........................................................................................................:.....9 - LIST OF APPENDICES... ---- LIST OF APPENDICES .................................................................................................... l 1 1.0 SUMMARY ............................................................................................................... 12 2.00BJECTYCE .............................................................................................................. 12 3.0. INTRODUCTION... oe12 | 3.0, INTRODUCTION...................................................................................................... 12 0 ANALYTETSTISACMPLAESL. | 4.0 ANALYTICAL TEST SAMPLES............................................................................. 13 5.0 REPERENCEMATERIAL..........comsommmnososomnnoron 13 5.0 REFERENCE MATERIAL ....................................................................................... 13 - 60 DESCORF AINALPYTITCAIL ON METHOD. room on 13 | 6.0 DESCPUPTION OF ANALYTICAL METHOD ....................................................... 15 | 6.1. Extraction Procedur~ ............................................................................................... 1 62.Preparation ofStandardsand Foricalion SOITHONS. rereIO 6.2. Preparation of Standards ard Fortifioafion Solutions.............................................. 16 6.3. Chromatography ...................................................................................................... 16 6.5.Description ofLC/MS/MSlnsrumentandOperatingCondions...........11 { 6.4. Instnanem Sensitivity.............................................................................................. 17 6.5. Description of LC/1MS/MS Instnanent and Operating Conditions .......................... 17 6.6. Quanfitation and Exampl Calculation ............ 7.0 EXPERIMENTALDESIGN oscommerce 7.0 EXPERIMENTAL DESIGN ..................................................................................... 19 80 RESULTS... oes ossosemsessoremeere9 g.0 RESULTS ................................~................................................................................. 19 100 RETOFEDATNAAT NDSIAMEO LES N vrei 20 9.0 CONCLUSIONS .........................,..............................................................................20 10.0 RETENTION OF DATA AND SAMPLES .............................................................20 v ExygeaResearch 22009955..00119922 | | Page7of115 | Page7 ofl15 33MMAA0011555511996699 ItInteermimRReeppoorrtt##22-.AAWnanatalelyyrssiSissaomofpfClCoeotstitaaggeeGGrroovveeaanndd Woodbury Woodbury Wate~ Samples EExxyyggecnn SSttuudyyNNoo..: PPO00000I1440000 wv LLIISSTT OOFF TTAABBLLEESS age TableL Table I. Summoaf PrFSy, Summm7 of PFBS, PFHS, PFHS, PFOS PFOS aad and PFOA PFOA in in Water Water Sample...22 Sample~ .................... 22 TableIL Table IL MMaattriixx SSppiikkee RReecocveoryovoffePPrFFBBySS aanndd PPFFHHSS iino WWaatteerrSSaaTmplpeless..................................2255 Table IL Tabl~ MMaattrriixx SSppiikkee RReeccoovveerryyooffPPFFOOSSaanndd PPFFOOAA iinn WWaattcver SSaammppll~e..s.................3.....232 TableIV. Table IV. SSuumrorgogaattcv SSppiikke RRecwoovevr~yoofftV~CC PPFFOOAA iinn WWaatteerr SSAammpplleess v3) ...........................39 wv - Exygen Exygen RReessevaarrcchh 22009955..00119933 PPaaggee8Booff 111155 I3MMAA0011555511997700 --_-- -- _ - - BR _v -; N - - oInttreriimnRRoeprort ##22W--aAAntnaeallyryssiSissaoomfpflCCeoostttaaggeeGGrroovvee a~nndd WWooooddbbuurryy EExygrenSSttyauddyyNNgoo.:: PeF0O0O0O1nI440000 || Water Samples Be LISTO) | LIST OF FIGURES Figur1e. TTypyipcicaall CCaalliibbrraattiioonnCCuurrvveeffoorr PPFFOOAA i in ReAgent Reagent Water Wer. AT Page ................................. 47 | Figare2. ExB Etxrtaracctteea dd SSttaannddaarrr ddss ooffe PPFFOOAAi-- in~ RReeaaggeenntt WW-- aatteer,, 2255nngg-- /Laanndd 5500nn-- gg/L,, || Respectively .................................................................................................... 48 FFiigguurree 33.. PPFoFFrOOtiAAfiieindnRRReeaeaggeenanttWWWaAgtIaeCttere,r,,5R5n00SnnPgtgC//LLHFVForoEtrLitiffiieveddReReenaaggoeennmtt WWataeterr,, aanndd5500003ngg/L AD i| Fortified Reagent Water. Respectively ...........................................................49 FFiigguurree4.. CPChFhrOrooAmm,aatDtooFgg=rr1aam0m(RREexpeyrpergesesenenIntDtii:nnggCaOa0WWGo7oo8od6db0bu,urrDyyatWWaataSeteer:rSSGma4raaLlpIleOeSAAzAnaRalYlyyzczeeddfvfoorr: SO PFOA, DF=10 (Exygen ID: C0067860, Data Set: 041105AR) ......................50 RTT --,, | FFiigguurree 55.. TTypyipcicaallCCalailibbrraattiioonnCCutrwvveeffoorr 1"3'CC PPFFOOAAiinnRReeaagegnteWWneattrer ..........c...c...v..v...n...c...S.511 FFiigguurer66e.. EESxOtxBrtrGaa/ccLtte,eddRSEStStaaDnndOdaCarHrddVssEoLoff"t3c CC PPFFOOAAio innRReeaggeenr nttWWataetre,rr ,2255 nngg//LLe aanndd 52 Figur7e. 5'0CnPsF/LO,ARienspReecatgiveemly W..a..t...e..,.5...0...n.g../..L.....F..o..r.t..i.f..i.e..d.R..e..a..g..e..n..!....W..a.t..e..r...S..p..k...A..,...........52 Figm,e 7. 2~1Cd5P0F0OnAgi.nFRoretaigfeiendt RWeaatgeer,n5t0Wnagt/LeFSoprktifBi,edRReEagenSt WPateEr SpCk A., 53 || Figur8e. Cahnrdo5m0a0tonggr/LamFRoertpifrieedstRienaggeantWWooadtebruSrpykWBa,teRresSpaemcptilveeAlyna..l..y...z..e..d..o...r..........53 | Chromatogram Representing a Woodbury Water Sample Analyzed for ]3C PFOA (Exygen ID: C0067860, Data Set: 041105A) ...............................54 Figure. TypicalCalibration Curve for PFBS inReagent Wale... 59 | Typical Calibration Curve for PFES in Reagent Water..................................55 Figure10. EExxtrtraacctteeddSSttaannddaarrddss ooff PPFFIBilSSiinnRReeaaggeennttWWataetrer,, 2255 nngg//LLaanndd SO 50 gL, ng,/L, { RESPOCHVEIY esmm---- | Respectively....................................................................................................56 Figure 11. PFBSinReagentWater, 50 ng/LFortifiedReagentWater, and S00ng/L Figure 11. FoPFrFotrBitfiSfiieeinddRRReeeaaagggeeennnttt WWWaatateteerrr,,, RESPOCHVEI coerce 50 ng/L Fortified Reagent Water, and 500 ng/L Respectively ...........................................................57 | FFiigguurree1122.. CCPhhBrroSom,maDtaotEog=gr1raa0mm(REeRxpeyrpgerseeensneItnDit:inngCgOaaOSWW7oo8oo6dd0bb,uuDrrayytWWaaSatteee:rrSSOa3amm1p1pl0leeSAAAnRna)alolyyozze.edd.f.foorr 58. | PFBS, DF=IO (Exygen ID: C0067860, Data Set: Oa1105AR).......................58 pes. Cameosor | Figure 13. Typical Calibration Curve for PFF_S in Reagent Water .................................59 Figure 14. ExtractedStandardsof PFHSinReagentWater,26ng and S00g/L, Figure I4. Extracted Standards ofPPHS in Reagent Water, 25 ngiL and 50 ng/L, fii) | Respectively....................................................................................................60 Fie 1. PSfsRvp Wate, $8. Foe i, S015 Figure 15. Fortficl Reagent Water, REAPOCHVEL verve 61 PFI-IS in Reagent Water, 50 ng/L Fortified Reagent Water, and 500 ng/L Fortified Reagent Water, Respectively ...........................................................61 FFiiggaurree 1166.. CfChorhrPoromHmaStat,ooggDrrFaam=m1RR0epe0pr(erEesxseeynngtteiinnnggIaaDW:WoCooOdo0bdSub7ur8ry6y0W,WaDtaaetterarSSSacamtmp:plGle4eA1An1an0la5lyAyzRzee)dd.......62 | for PFtLS, DF=IO0 (Exygen ID: C0067860, Data Set: 041105AR) ...............62 FFiigguurree 1177. TTyyppiiccaallCCalaihblrnaattiioonnCCuurrvveeffoorrPPRFOOSS iinRReeaaggeenntt WWaalteerr vv .................................6633 FiFgiguurree1188.. ExlRitxrtraEacetteeAddSStDtaannddEaarrddRssooff.PPRFOOSSiinnRReeaaggeennttWWataeetrer,,i2255nngg//LLaanndd 5500J nrgig//LL,, | Respectively ....................................................................................................64 BxygenResearch Exygen Research | PaPaggeeo9folf 111s5 | | 22009955..00119944 33MMAA0011555511997711 IntteerrimmRPep,~orrtt ##22--AAWnanatallyeyssSiissaoopffCCloostttageeGGrroovvee aanddWWooodobdubruyry ExygenStyNo: PUO1400 F.~en Study No.: PO001400 Water Samples LIST OF FIGURES (continued) v LIST OF FIGURES (continued) PPaa~gee FiFgiguurree 1199.. PFPoFFrOtOiSfSiieind~RRReeaeaagggeeennnttt WWWaaattteeer,,, 55R00OngSgP//OLLFGFoHroVtritEiff.iiee.dd.RReaergaegnentmtWWataetrer,, and500g, and 500 ng/L 65. Figure Figure 2200..C{CFfhorohrorrPotm~FmaeOtadSto,oRggDreraFaamgm=Re1enR0pte(rWpEersxaeeytsenegrtne,itnRinnIgegDs:paeWWCcoOtoioDvoGded7blby8um6.r.0-..yy,..DWW..ia..at.t.ta.ee..rr.S.SS.t.e.a:.nm..p4.p.1l.l.1e.e.A0.A.n.5.an.A.la.R.yl.)y.z..z.e.e..d.d......................6665 for PFOS, DF=I0 (Erygen ID: C0067860, Data Set: 041105AR) ................. 66 vw - Exyge Research 22009955..00119955 Page 100115 Page 10ofl15 33MMAA0011555511997722 teriInterim RRepeort ##p22--AAaots~eaalrsyysSisaoopffiCeoonttataggeeGGorvoeve and and Woolley Woodbury Water Samples yea SyNo: PO00100 Exygen Study No.: PO001400 w LLIISSTT OOFF AAPPPPEENNDDIICCEESS PPaaggee Appendix A. Appendix A `SSAttucuaddyyytPPcrraoolttooMcceootllhoPPdO0:0000V114400O00 ((7EE8Oxx0yy:ggMDeeenntShSIotuyddyoNNfoAon..aPPlO0yOs0Oi01s144f0o0r00t))ewwiitthh DADenetateleyrrtmmici~innLaaIttiMioonenthoooffdPe:elVrof0lru0oo0amt7co8ac0n~:"o-MoiicectAhAcocididdo((fPPAFFnOOaAAly))siiinsn fWWoarathtee~rr bbyy LC/MS/MS". .............................................................................................. 67 -v vw BxEyxyggeenn RRe~sseeaarcchh 22009955..00119966 PPageaLlllogoff1le1l55 33MMAAO01155551197733 JomReport #2 AnyiofCong Grovead Woory | BxdyyNosgPOOnLA00 Int~'im Report #2-Analysis ofCortag~ Grov~ a~d Woedbuv! ater Sales Wa~er Samples Exyg~n Study No.: P0001400 - 10 SUMMARY 1.0 SUMMARY Bxygen Reseach exacted snd suslyged wate samples for the determination of Exygen Researcl~ extracted and analyzed water samples for the determination of pecfiroocancic iid (PFOA), perluobuiculfnste (PFBS), `ExygenMethodV0001780(Appendix A). perfluorooctanoic acid (PFOA), p erfluorobutanesul fonate 0UFBS), ppeerrfflluuoorroohbeexxaanneessuullffoonnaattee ((PPFFHHSS)),, aanndd ppeerrfflluuoorrooooccttaanneessuuliffoonnaatte ((PPFFOOSS)) a~ccccoorrddiinngg ttoo Exygen Method V0001780 (Appendix A). TThheelliimmiittooffqquuaanntitittaattiioonnffoorr PPFFOOAA,,PPFFBBSS,,PI~FFHHSSaannddPPFFOOSSiinnwwaattemr"wwaass5500 nngg//LLaannddtthhee limit ofdeeation for PFOA, PRBS, PFE 12d PROSinvate was25ag. limit ofdet~tion for PFOA, PFBS, PFHS ~md PFOS in water was 25 ng/L. Ansytcal results and assessed acccies fr the analysis of PFOA, PFES, PEHS and Analytical results and assessed accuracies for the analysis of PFOA, PFBS, PFHS and FFOSin watersamplesare summarized in Table I. Theavesge prvens rcovere=s PFOS in water samples are summarized in Table I. The average percent recoveries +_. andar deiaions for FFOA, PRBS, PFHS and PROSinwiesamples were 116% 2 standard deviations for PFOA, PFBS, PFHS and PFOS in water samples wcx 116% 3300,, 113377%% ++ 3377,,111133%% ++2200aanndd 111100%% ++313,1,rreessppeccvttiivvellyy.. TThheeavaveerraaggeeppeerrcceennttrereccoovevreireiess ++_ssttaannddaarrddddeevviaiattiioonnssffoorr z"3CC--PPFFOOAAiinnwwaatteerrssaammpplleesswweerree 9999%% ++ 1188.. 22.000OBB3JEECCTTIIVVEE The cbjeciveof the analytical pan of hissudy was to determine levels of The objective of the analytical part of this study was to determine levels of ww peprefrlfluuaorrooooccttaanncoiicc: aacciidd ((PPFFOOAA)),, pelmrfrlfluuoorroobbuuttaanneessuullffoonnaattee (P(PFFBBSS)),, ppeerrfflluuocrroohheexxaanneessuullffoonnaattee ((PPFFHHSS)),, aanndd ppeerrfflluuoorroooocettaanneessuullffoonnaattee ((PPFFOOSS)) iinn wwaatteerr ering to Protas POGOI400 (AppeadAi)z. according to Protocol P0001400 (Appendix A). 33..00 IINNTTRROODDUUCCTTIIOONN This report details he rus f th aie foth determination of PFOA,PES,PRES Thi~ report detail~ the results of the mmiyms for the determination ofPFOA, PFBS, PFHS an PROSinwate sing he salyiclmedcid,"VOO1780: MetofhAnosyds and PFOS in water using the analytical method entitled, "V0001780: Method ofAnalysis or teDeterminsionof ounrooctanieAcid(ROA)in Waterby LC/MS/MS." for the Determination ofPerfluorooctanoie Acid (PFOA) in Water by LC/MS/MS." Thestudywas inatedon March 03, 2005, when thesady dict sigue pool The study was iaitiated on March 03, 2005, when the study director signed protocol `nnuummbbeerrPPO0000011440000.. TThheeanaanlayltyiticcaallssttaarrttddaattee ffoorrtthhiiss iinntteerriimmrreeppoorrttwwaass MMaarrcchh2288,,22000055,, te yal ination dt for is eis port was May 03, 200. and the analytical termination date for this interim report was May 03, 2005. - ExygenResearch. 22009955..00119977 PPaaggee 1220off111155 33MMAA0011555511997744 InIntteerriimmRReeppoorrtt ##22--AAWnanatalelyyrssiSissaoopfflCCeoosttataggeeGGrroovveeaannd WWooooddbbumr'yy Wa~vr Samples EExxyyggeennSSttuuddyyNNoo..: PPO000O0I1440000 w 44..00 AANNAALLYYTTIICCAALLTTEESSTT SSAAMMPPLLEESS sOOintneees, hh(utmEndxdryreegddenaannIddD tthhCii0rrt0ty6y-5sei4igg3hh2tt-CwwOaa0tt6eer5r5ss0aa6mm,pplleCesOs,,06ww5hh9ii7cc3hh-Ccc0oor0rrr6ee5ss9pp9oo6nn,dd (tCo000tih6i5rt9ty3-t0hy-rCee06ss5aa9mm4pp5ll,ee FCCseiOr0teDr0s6e6,St59(9E4a4t7x7-y-3CCgM0e0n0E066n!55vD99i669rC9))o0ww0ne6mer5reee4n3rrL2eteac-caCebeili0.vv0ee6Tdd5aa5tt0aaw6mm,bbiCieee0nn0tt6ttn5ewe9mam7tpp3eeter-rrCasata0tuum0yrrp6eel5ooe9nn-9s6,MM,waahsrCricc0chh0h6ec1158o8,r9, r322ve000s00-Cp55o0efnf0rdro6otm5omn9sPP4ai5atx,.t s`sFAaapemrmriprpleltle0teis7ria,ittt2ee30ssM0((5EEExfxnyryvoggimeeranoPInaImDtDFeCCnetr0arO0le6Lt7a08ba5.t66T-3CwM0e7E0n6nty7v3-8si8e2rv5)eownwen6erwmreeaertn-eenrtc:LcesaeCaiblimvv.eep0ddAlaelastt,0awatmmbh6oiibceiheag7nlcttoeetrt8emrhmtepesepsp8rheeoarsnatead2tumurtrrpeoel)os,eoinnsx reAreppprrreieslse0enn7tt, t2thhOiiOrrtt5yy--fnnrioinnmeesPsaaamrtpapFlleeersriestittteeissaataan3ddMaassEssnoocvciiiraaottneeddmfefiineetlladdlQLQCaCbs.saamAmpllpleltesos.g. eTtThhehere,stsahamemspeplleseassmwwpeelrerees lologgggeeddiian bbyyEExxyyggeennppeerrssoontmneell aanndd pplaacceeddiinnrreeffrriiggeerraatteedd ssttoorraaggee.. SeSamampslpleesTolowgogie-tinnhcataninidsdcianchthaeairtiinnmooerfefpcocdurusts.ttoodSdtyyoirnianfgfoeorrrmmeactaoitrioodnsnwiiisslllolbocecakateteepddtiinantEthxheyegrreaanwwRdeadsaettaaarpcpahac.ckkaaggee associated with this interim report. Storage records will be kept at Exygen Research. 55..00 RREEFFEERREENNCCEEMMAATTEERRIIAALL ETxThyheegaenaannlaoylt~niiccaaDllstsetaanndcdaarerdd,,mP0PFF8bOO,AA2e,,0ww0ar3as.spputruTc'ehhhaeassseeddffruroommmSSiigsgopmmiakagiAAnlgdldarrsiitccahhlnadananerdddww,aassr'reC~celeiaivvbeeeddlaeatdt wv ppE3eeMxrrfCfyllognuom~orrpooaoooncenityaa.nnDcoii~ece3aamMccsiibddu~p((p~l30CCi8e,PPdFFt2OOh0AAe0)3),a,.nwwaalay~sTtirrheceecacleeiismvvteemndd'doaaagttraEtEdexxsyysPggpeFeinnBkiSoonnang nAApsdptrarinilPldFa11H5r5,d,S,2.2P001003B44C rfSrlooamwmbeattlhehsdee orr3neeMcceJeiiavCvneeuoddamrffpyraoo2nmm0y,.332MM030aM3at,t EEsPxtvFyxpOgelSinyeowdonangstJhJuupeleulyy,ra,cn0nh0a6a6ly,s,tei22dc00a00fl00r..sotmaPPFnFFldHuHarkSSdaswwCaoPasrsFpBrroeerSccaeetiaiivnvoeedndd aPffrnrFodoHmmwS3a3.MsMrPaaeFttcBEEeSxxiyyvwggaeeeadnnts oExnyJgaetmnoarnyA2p0r,il20203,3.20P0F3.OS was purchased from Fluka Corporation and was received at Exygen on April 23, 2003. TThhee aavvaaiillaabbllee iinnffoorrmmaattiioonnffoorrtthheerereffecrreenncoee mmaateterriiaallss iiss lliisstteedd bbeellooww.. PPFFOOAA wwaass sstoorreedd aarmmebfbiiiegenentrt.a.odP.PFFBBSS,, PPFFHFISSaanndd UCCPPFFOOAAwwerereestsotorreeddfrfroozzeennaannddPPFFOOSSwwaass ststoorreedd refrigerated. CCooPmmFpvoOouAunndd 1V3CPCPFEPPOBFFSAOOAA PPRPPrFFEFoBSISSs PFOS EExxyvggeSenPnOIlnOnvvCee3nm8ti00o_0rryyNNoo... SSSSPPPPO00o000o000d043i218s580s240 SPSSSoPPP0O00O0G0M002220446200551142 SP0002694 2LL3ooUttGf#HB 32353501017170-6-111H99B55 4SS3E01E00113s861 430180-1 PPttu9rri7ti.vt6y(4(%%)) ExEpxipr1iart2ati0ioo8nn5DDaattee 9%799.77764 001133222//02099481//00006959 98696.7 9g.6 1012 011142002//10133480//00006666 101.2 04/23/06 `TTfhohelelmomowloienlegccupulalagarerssst:trruuccttuurreess ooffPPFFOOAA,, "t3'CC PPFFOOAA,,PPFFBBSS,, PPFFIH-ISS aanndd PPFOOSS rareeggiivenvoonentthnhee following pages: EExxyyggeenn RReesseeaarcchh PPaaggee 1308115 13of115 22009955..00119988 I3MMAA0011555511997755 InIntte~rimRReeppoorrtt 7#22--AAWnara~tlaeylryssSiissapoofifCcCsootttageeGGrroovvee1a2nddWWooooddbuyry Wat~ Samples ExStyyNgo: PeO001n400 Exygen Study No.: P0001400 wv PFOA PFOA ChemicalName: Pefluorooctanaocied Chemical Name: Perfluorooctanoic acid Moleolar Weight: 414 Molecular Weight: 414 "TTrraannssiittiioonnss MMoonintitoorreedd:: 441133 -----) 336699 ((ffoorr qquuaannttifiifciatcioant)iaoannnd)d 13 2219 forcontimuaton) 413 -~ 219 (for confirmation) Structure: Structure: . riefT e F F F FIFIF|F O II FF~ F O F H" FF FF FF FF CMhoICIleahCeCemPcmiPuiFcFclaOaaOllrAANNWaaemmieegh::t 11,242-1-16133pCeprerfiiluaoorocooctoacnotiacacacciicdd vw TMTSrroaialnneess~itiutteliiaoo:n~nMMWooenniiigtthootrr:eedd4::14641155 5370 -~ 370 elFe F F ter F rF d Pfr to] ne" Non F FF PBS PFBS ChemicalName: Pecflscrobuaneslforate Chemical Name: Perfluorobutanes~fonate M Moloel~cuullaarr W Weeiigghhtt:: 333388ssuupppplliieexdiaasstthhee ppoottaassssiiuummsasalltt ((CC4iFFgsSSOO3y"KK"+)) Transitions Monitored: 2995 99 Transitions Monitored: 299 ~ 99 Structure: Su-uctu~r: [a F F eleF F Po' E F F - ExExyyggenn RReesseeaarrcchh Page dof115 Page 14 ofll5 22009955..00119999 33MMAA0011555511997766 S-- E InInteterriimmRRepepoorrtt##22--AAnanlaylyssiiss ooffCCoottttaaggeeGGrorovveea~ndd WWooooddbbuurryy `EExxyyggeennSSttuuddyy NNoo:.: PPO0000011440000 | WWaatteerr SSaammpplleess - i - ! PFH$ I enrrs | M `CMhooellme~ciuucllaaalrrNW Waemieiggeh:htt:P: e44rf33i88uossruuopphppellxiieeaddneaasssuttlhhfeoenppaoottteaassssiiuumm ssaalltt ((CC&~F31SsOSs0'KK"~)) f=Transitions Monitored: 399 ~ 80 eed St~acture: F F F FF PF rF eF teF 1| Tv retro | PPFFOOSS | M C`Mhooellme~ciuucllaaalrrNW Waemieigegh:htt:P: e55z33fl88uossuuropppoplcliiteaeddneaas~suttlhhfeeenppoaottetaas,~siiuumm ssaalltt ((CCsiFF~iTsSSOOay'KK'~)) =TTrraannssiittiioonnss MMoonintitoorreedd:: 449999 ----> 8800 | Structure: TMmM v FIF F t7F F F IfFFF |TFFF . F- $03" { F F F F 66..00 DDEESSCCRRIIFPIT'IIOONNOOFF AANNAALLYYTTIICCAALL MMEETTHHOODD TThhee aannaallyyttiiccaall mmeetthhoodd ""VV00000011778800:: MMeetthhoodd ooff Analysis Analysis for for the the Determination Detvrmination of of | PPeerrfflluuoorrooooccttaannooiiccAAcciidd((P'PFFOOAA))iinn WWaatteerrbbyyLLCC//MMSS//MMSS"" wwaassuusseeddffoorrtthhiisss~ttuuddyy., 1 61.Extraction Procedure | 6.1. Eztraetion Proeedmre A 40 mLaliquot ofthewairsamplewas usedfortheextraction procedure. Afer | A 40 ml, aliquot of the water sample was used for the extraction proc~lu~. After eeen ee ffoorrttiiffiiccaattiioonn ooff aapppprroopprriiaattee ssaammpplleess,, tthhee ssaammpplleess wweerree llooaaddeedd oonnttoo aa CCi~s SSPPEE ccaarrttrriiddggee v ras alyzed by LC/MS/MS electrospray. | condilioned with 10 mL of methanol and 5 mL of water. The eluate was discarded. A Appproxpimrateo lyfifx ivveemi imllilm illiliita teerrsstooffe mmeetl thhaany noolI wwaass aaddddeeddttootthheeccaarrttrriiddggee..FFiivveemmilillliililtiertseorofsf { eelualtewwuaassa ccolot llleeccteteeddiinnttoo aaggrraadduuaatteedd 1155mmLLppoollyypprrooppyylleennecenetnrtriiffuuggeettuubbe~.. EEaacchhssaammppllee was analyzed by LC/MSiMS electrospray. `ExygenResearch PPaagg~e 1155 ooffl11155 | 22009955..00220000 33MMAA0011555511997777 ItneterriimRReeppoorrtt ##22W--AAannaaalrlyysSsiiassmoopfflCCeootstttaaggeeGGrroovveeaannddWWooododbbuurryy Water Samples EExxyyggecnnSSttuddyyNNoo:.: PPO0G0O0L1A4G000 w 62PreparofaSttanidaordns andFortificationSolutions 6.2 Preparation of Standards and Fortification Solutions IpnIrdneidpviaviriddeuudaaallss~ stpoek cckisfstitaeandndidaanrrddEsxo~ylogulutetinioomnnessotohfi"oPPdFFOVOOAA0,0, 1u'7CC80PP,FFTOOhAAe,,sPPtFFoSBck,$s, PPFtFIH-SIaSaannndldudPPtFiFaoOOnSSsrwweedrree pp(prrcreeeopppmaaarcrreteeddedadfaaitsoaarscppocvunocrcniiefctnieeytndratarnitanditiosEonanxloytogfcfeonn11t00me00negt~t,hg/o/immdfn.LeVcb0bey0sy0dsi1das7irssy8so)0oil.lvvniiTnnmghgeet11hs00atnommocglkgo.sofFtfarneeodaamcacrhhtdohofsefotstlhhueetsisotosnla~usnatdniwador~nadsrrd,.e a(p11cp.00orporrpg~~rg/it/eammtdelLsffotofrorotcpritukfirfaiiicntcyaadttiaiboonrnndi.nssgstaitaalnntngddctaoarhnrdedtesvnoostlo,luluuitftmiinooe~nnucssp~wswfseoaerrryee1)p0r0ipnemrepmpLaarewreneidd,tbtohombyley. tthatFaakrknioionnmlgg.th1|eBmsy~mtLLsaoolkuoftifiton1thnhgs0ee, m`mamLpLLpowrooiffptttrhhhiameeatee~ptppshrptooarpocnrpkoiraliaatn,teed0.111bu..r00gin/~ggLg/i.n/mmgfLL.thoffeoorrvtrtioiffliimtcca-anttiivsiootnnuasfpntstdataiaonnrddd1caa0srrw0ddaaemanrrtgdLibpwbrirrieiintnpohggairimnnneggvdt.tthhBheaeynvovotlol.alkuuiBmmneygeutu1pap0kmit0noLg11o001f000 twhmtihetLehaapwmppeiprttohrhopamrpnireaaitaltht,eea0n00.o..01l1,1g0~w.g1/g//~m~lm_gL../mfffooLrrtotififofiirrcctaaitfttiiicoonanististsottanfaannnsddditaaaarnrrdcdddasaawrnandeddsrbtewbrpireriinrneggpiopiannrrggetnepdhtah.reeevdvo.ollBuuymmeetawkupipntgto110100m00mLmLoL.f with methanol, O.Ol ~g/mL fortification gtandard~ were prepared_ SpServeeevpreaarralelsdeisetnts~woaoftfesrtstaanandnddaarprdrdsosccceoosnsnetadtitnahinrigonPuPgFiFhOOtnAhAg,e, eU"x'tCCraPPcFtFiOOoAnA,,pPrPFoFcBeBSdSu,r,ePP,FFIiH-dSIeSnatainncdadlPPtoFFsOOaSSmwpwelreesere. pTTrhheeepfafoorellldloowwiniinnwggcacotonencrecanentndrtraapttriiooocnnessswsweeedrreetphprreroepupagarhreeddth::e extraction procedure, identical to samples. "CCooSnonel.coot.ifooFnofrFt orVFoFV olourxmt eoForl tVifoileudmm Seaomfple e FCao iFlsiinabarllatCl Ciooonnnee.oSotfdf (ogml)' Solution (ng/n~)1 ul) Volume (@L) Fortified Sample (og) CaLibration Std. 00 0(~L) 0 (mL) 40 0 0 w 10I00 211000000 ~4Wo00 225550 101t10000 1420000O00 44Wo00 21155000000 110011000000 242010000000 "4400 12S5050000000 of PF1O00A, 'C PFOA4,00PFBS, PFHS an40d PFOS 1000 ofPFOA, UC PFOA, PFBS, PFHS and PFOS AAprnnepaaaddrddeidittaiiootnn1aal0l 0mm0iixxpeegdd/ssmttooLccakknsdsoodlliuutltiuioot~neodoftfoPPFF1OO00AAa,,nd~'3CC10PPFFgOO/AAm,L,.PPFFoBBrSSb,o, tPPtFFlHeHsSSp,,ikaainnnddgPPpuFFrOOpSSoswweasas.s. Complete talscanbefoundintherawdatapackageassociatedwith thisstudy. prepared at 1000 i~g/mL and ~iluted to 100 and 10 ~g/mL for bottle spiking purposes. Compl~e details can b~ found in the raw data packago associat~ with this study. s`tTTohhreeesdtstoocicnkkstsataraennfddiasgtr'eddrsa~otoluloutrtiioo(4nna+anndda2alllCf)foorwrti'hdfeificncaatnfiiooonntaiannnddcuacslaielib.brraatDitioonon scst"au~nndmdaarerddsnsoohtolt~faitiosotntmsainwwdoeaerrnrede ppsrtreoeprpaeardraatitinioonniaissrlleoofcrciaagtteeerddiatinnotrthh(e4rraaww_+dda2attaCap)paacwckkhaaeggneeasanssosotocciiinaatteeuddswewi. it~hhDtthhoiic~uiimnntteeenrrtiiammtrioerepnpoororttf.. standard 663.3 CChhrroommaattooggrraapphhyy QcQlumeacmnroitsiffpiirocaayati.oonnoTohffePPrFFetOOeAnAt,,ioPPnFFtBBiSSm,e, oPPfFFPHHFSSOAaann,ddPPPFFFBOSO,SS PwwFaaHssSaaavcnccodommPpplFliiOsshSh~exdwiabbsyy~LL1O2CM!mMSinS/,/MM~SS3 - mairvnanleyisnco,~sf,ro~t-s1h1pe00ramrryeia.anignseTs,n,hatabennlddraen~~tke11ns33atmimmoipnnilnseds,si,ncrreeoessropprefeeccsPttipFivvoOeenlldAyyi..,nPgPPetFa~oBktksShs,aeaabPbnoFaovHlveyeStttehahreneedLtLeOPOntFDDiOwowenSrt~wirecmaenso.ot-t1dd2eet~em:ccittnve,ddi~in3n any of the reagent blank samples corresponding to the analyte retention time. BEoxygge~nnRReesseeaarrcchh PPaaggee 11660o7f111155 22009955..00220011 I3MMAA0011555511997788 IInnteerismRReeppoorrtt##22--AAWnisnslaeylyrsisSissaomofpfClCeaosttgageeGGrroovveeaannddWWooododbbuurryy Water Samples ExStuydy Ngo:PeO0O1n400 Exygen Study No.: P0001400 wv 6.4 Tostrument Seasiivity 6.,t Instrument Sensitivity TTchohenecesnmstmarlaatllileeossnttosfts2ata5nndndagar/rddL oafammPoFuoOnuAntt,iPinnFjjeBecSct,teeddPdFuHdruSiriannnggdtFhthOeeSc.hcrhormoamtaotgorgarapphhiicc rruunnhhaadd a a onc,atration of 25 ng/L ofPFOA, PFBS, PFHS and PFOS. 665.5DDesecsr~i:rpitpitoionnooff LLCC//MMSS//MMSSIInnssttrruummeennttaanndd OOppeerraattiinoggCCoonnddiittiioonnss IInnssttrruummeenntt:: AAPPI144000000 BBiioommoolle~ccuullaarrMMaassssAAnanlaylyzzeerr IInnttecrffaaccee:: TuTrmb'boo onIon Ssp~raayyLLiiqquuiiddIInntrtorduoetditmuIcInttteirfcoaCn.e CCoommpuptueterr:: DELL OptiPlex GX400 DELL OptiPlex GX400 SSoofit'awvaarree:: WWiainddoowwssNNTT,, AAmnaallyysstt 11.44..11 IH-PIPLLCC:: HHeewwlelettttHPPPaaccQkkuaaarrtdd(P(HluiPPm))pSSereirieess 11110000 HHlI-ilPPpP VAVQuaautccaouutsuPuamummmpDDlpeeegrgaasssseerr HHPP CAoultousmanmOpvleern HP Column Oven CHHoPPlLLuCCmnCCTooellmuupmm.nn::: TT3hh0eerrmmCoo FFlluuooppbhaassee RRPP,, 050 zmmmxx 22..11 mmmm vw `ICIMnnoojjbeleitccmlttieimooPnnhTVVaeosomle.l.p(::.A:11)55:3sp20LL.mCMAmmoAcentatieinuwatmer M Moobbiillee PPhhaa~see ((AB)):: M2emth.ManAolmmonium Acetate in water Mobile Phase (B): Methanol TTimi0em0(reams) %%6AA =%3sB. 8011..0000 2636s55 333755s 1110801.00.00 2226555 7377555 Totalrntime:111~8181..0800min 665 65 3535 35 FTFlTolooontwswalRmParoutannetei:t:timo00re.e33:d:mm-1lL8iimmriaiinnn Ions monitored: AApppprrooxxiimmaattee AnAanlavi~iee. MMooddee MoTnTrioamntssoiirtiieoondn RReemisa(atmitoiinno)nTTiimmee PFOACPPoFFfOOiAArmlon nnneeegggaaatttiiivvveee 444M11133o3n--i-5t)o323r61e699d9 ~~~i11(222rammriiinani)nn... CPFOA PFOA Confirm Ion nneeggaattiivvee 441135-5-)327109 ~~1122mrianin.. - ~P3CEBPFSO.A PFPFHBSS. nnnDeeoeggggaaaattttiiiivvvveeee 42159~993970 2399995-*.8909 ~312 mminin.. ~-130mriainn.. Pros PFHS PFOS negaive negative negative 499-580 399 -~ 80 499 --~ 80 ~13min. -10 rain. ~13 rain. `EExxyyggeennRReseseeaarrcchh PPaaggee 11770o1f1l1l55 22009955..00220022 33MMAA0011555511997799 TIonttere~rmaRReeppoorret##22--AAWnanatlaeylrysSsiisasmoopfflCCeoostttaaggeeGGrroovvee aanndd WWooooddhbur~yy ExEyxgygeennSStuydyNNoo:.: FPO00O0O1I40000 WX:er Samples v 66.66QQuuantaitatniontaanniddEExtxaammapplleetCCaialclcouollaattniioonn "FFTihiffettpe~eennakmmiicrcrerooalliiwttecarrsssmooefafsssauamrmeppdllesvonordrctcahlaeilsibbtraraanttdiioaornndsstctauannrddvaaerrwddawwseegrree~nieninrjjaeetcctetededd(isinintntoogtthh1ee LL6OtCwM/MlSg/Sh/MMiSoS.d. liTnheeaprreeagkrae~sesaiwona)sbmyeAasnuarledysatnsdotfhtewsatraenudsaridncgusrivxe wcoanscgenetnrearattieodns(uosfinsgt1a/nxdfairtiwse.ighTtheed Concenration wasdeterminedfrom theequationsbelow. lineax regression) by Analyst software using six concentrations concentration was determined f~om the equations below. of standards. The standard curve(iocarregressionparameter)generaedbytheAnalyst software program. `EEqquuaatitoino1n1ccaallccuullaatteeddtthhec aammoouunnttooffaannaallyytteeffoouunndd((iinnnngg//LL,,bbaasseedd oonnppeeaakkaarrceaa))ursuiinnggtthhee standard curve (l~near regression parameter) generated by the Analyst software program. EEqquuaattioino11n:: AAnua~yy~ffooumnd v(n1g/L)) ffi P(Paeakk rama ar~a.- imercevt) DDFF WWhheerv:: DDFF ==DDiillutitioonn FFaaccttoorr,, ffaaccttoorrbbyy wwhhiicchhtthheeffsiilnnoaapllvevoolluummevwwaassddililuutteedd,, iiffnneecceessssaarryy.. priortoextraction,Equation 2 wasusedtocalcultethepercent recovery. `FFoorrssaammpplleessffoorrttiiffiieedd wwiit~hhkknnoowwnnaammooutnmtts~ooffPPFFOOAA,, PPFFBBSS,,PPFFHHSS,,PPFFOOSSaanndd 1"~'CC PPFFOOAA prior t~ exlraction, Equation 2 was used to calculate the percent recovery. Re`REcE.qeoqucvuaoeatvirtmoyi~'y2o2((n::%(4an))al==te found (ag) - snavie in control (g/L) x100% (analyte found `(anam~mo'oLuu)nn-ttaaanddaddhe~ndie(ianglcLo)ntrol (n_W~-)) x100% - AAnneexxaammpplleeoof faaccaallccuullaattiioonnuus~iinnggaannaacetluuaallssaammpplleeaannddreresuslutls~f~roommtthhee PPFFOOAAanaanlaylyssiiss ffoolllloowwss ((vvaalluueessmmaayydidfifffeerrsslliigghhttllyyffrroommtthheerraawwdadtataa dduueettoorroouunnddiinnggddififffe~reenncceess)):: Water sample Exygen ID CO065436 Spk F (Set: 032805C), fortified at 10000 ng/L Water sample Exygen ID C0065436 Spk F (Set: 032805C), fo~fied at 10000 ng/L wilPFOAwhere: with PFOA wh~r~: peak ares = tim inpteearkceapreta intm~t === 001.6001110850339 slope = sw slope ddililuuttiioonnffaaccttoorr ngng//L PPFFOOAAaaddddeedd((ffoorrtt lleevveell)) = 1530 == 110000 == 1100~00000 amtincomespsoamnplde (isng)g* = 0(NotDetected) amt in corresponding sample (rig/L)* = 0 (Not Detected) (+Theprimarysample result wasused oral calculations) (*The primary sample r~tlt was used for all calculations) FFrroommee`qqAunuaaatltiyitooennf1o1:u:nd (nL) = [161=0001503]9x 100 Analyte found (ng/L) = 1530 [16!0~ - 0.0153] 1530 x 100 4Recovery FFrroommeqequautaitioonn 22:: % Recovery == 110052233n0g/9L == ((0130522330n81N0fL0L0---0O001nn._gg/L)) xx 110000%% 10000 ng~ - ExygenResearch l~ygen Research == 110055%% PPaaggee 11g8ooff111155 22009955..00220033 I3MMAA0011555511998800 ItnteeriimRReqTpotrt ##22--AAWarntaaellryySssiassmoofpflCCeosottitaaggeeGGrorovveeaanndd WWooooddbbuurryy Water Samples EExxyypgeennSStutuddyy NNoo,:: PO0OI400 P0001400 wv 77..00 EEXXPPEERRIIMMEENNTTAALL DDEESSIIGGNN sUaCmCpPlPFeFcOOolAAlewcwatiasosunusbseoedtdl3easss naastsuhumrorlogagabatoteerfsfooorrryablaelllfotthhreesbsaeamimpnlgpeslesks.i. p1"p'3CeCdPPoFFtOOhAAewfwiacakssfaoaddrddseeaddmtpltooitnthgh.ee aFdoFsdaormerspdsalameampclpoealleskls~dndeotseiwisoingngncnbaooatnttetecdleda~nstasrsifanfititeiehlolddnmltmaaotbaorttrrihiaxxetsbosprapiytikkbeeesssfoPiPrFnF~OObtAheAi,,nlgaPPbFFsoBBhrSiSa,tp, PopPrF~FyHHbtSoeS,ft,oahraennedfdbiPeePlFiFdnOOfgSoSsrhwswieapermprpeeeladialntlssgoo.o ttahhdeedfefiddel.dat. TaThkhenesosawammnplpcleoessnwcweeenrraee'afftiiillollneeddtot0o.t2ha2e200b00omtmtlL_eLsvvoilonulutmhmeeterltariibccoffrlialtloliriynneebiiennfotthhreeefbfiieeelilndd.g. shipped to `rTTehhaeegsesanatmmpspplileekseswswefoerrreteiefexixtertdraaactcttkeenddoiiwnnneeiciggonhhcttessntettssr..aEtiEsoacnch.hsTshteteiinfniccrlsluuttddereddeoeonsnecetrser~caaggoecnnntt bbtllaaannskkiixaasnnnaddmetptwwldoeo bsilrsteiateaensgskceaenaatnccshdhp.,tikwTeTohshteferofirfotopuibtfruiletladhhnaaakntnsdkdpniffokiLwfeRtshnhiscseneotetnssaccceconohntntsrtaaeattiii.nnoTeenddshf.ifeivTvseheisexsaftaimmhrpssptleltetehscriseiteteoessseeteansaccchhot,f,naitalavalioeonsnneiaggdwmwsipnitxilthhesesaaaimttdrperiislpep, s`iwbwhtlhaieilnl,eketatlahhnoeendsgseetwvwveieontnthtthrhisapsteetibtclpcoaonnbtnkla~aisnnpnkeieakddnetsdthhritrneeweesoeasacamrhmippplselebetsl.isaitntTeeksshs..peTiTskhihexeesth.eeiFisggoeahttrthchcoascncettthcacisnoioetnedt,anafinivtseedtaastrhamemrieeppenslaselaafemmseiRpepdle,llseed, oddsfuiutpteplshlii,cecaaaptltoeeraniagnmndadwrttiywtwhosoa-a-mmmtmrpaiatlprreibxihwfeinaelkslddaessnxppdtiirkktaeewcsstwoweedterriropeacncbodollaltllnewckctoteeslpddsi..kbeFFosoor.rrsceFoaaorccryhhmessaiaitctteehr,,iasaxitlleaas,bbpoaoirrkasateatoosmrrwypydelduer,puelpailicfcaiaelatsltedeo seoeaxxfmttrrptaahlcceetmecddpo..lrilFmcFotaoerrrydtthhsfeaermtetpwwhloeeeslailwabtbaoeosrwraeatetroxoertrryypaomcmuatertdareridxxafnsrdspopimiktkwetesohs,,etlbtawwobtoootrla44ez00aomnrmyLdLfmpoporatrotritriftixiiooenndss.spoiokfNefosttthohweenpelrpryirewimmeaaarrlsryeoy. PsPPFaFFOmBBSApS,lw,ePPacFFosHHlalSeSd,c,dtPPeedFdF.OOfToSSrhaatehnnaedddsPdPiiFtFetOOiwoAAnaeardaeldddepXedoCduiPninnFdttOhrhAieeo.ll,wa,aabbtsooharreaadtthdoooerryryddtpperoriiaotonhrrdettoolfoaeebrxxtotitrfrriaaaectcdtot.iirooynnNm,,aobbttuurtotinaxallslysspooiwkeerCse bePbceFcaOauuAsseewtthahseelaleedvvedleesldso.offTPPhFFeBBaSSd,,dPPiFtFioHI-nSIaS,l, PP13RFCOOSPSFaaOnndAdPPwFFOaOAsAasdspdpieikkdeetddoiintnhttoeotthlhaebesosaramamptolprelyessmwweatrerreiexkknsnpooikwwenns - 1Pt0FoeOexxAcceeleeeddvtethlhseewceacrlaeilibabrdrajatutiisootnnerdraatnnggreeesqsuaianrndedtwhweeersreeanmnoeottdaianlnauarlliyyozzneesddswiwthtihthoootuuhtetdrdialinluuatltiiyootnne;;st.thheerreeffoorree,, 13CC PFOA levels were adjusted to require the same dilution as Lhe other annlytes. AcoAccucbunrcaictfieeossrawwecearrcieehassaanssmseepsslesseeesddtdfefoo.rrcIeanaccmhhosssatamcmpapslleeesb,btyyherrereevviwieeewwrieinntggwtothhleeaibniondrdiaivtvioiddruyuaaallndQQtCCwreorsefsiuuelllttdss spikerecoveryresultsavailablefo cachsamplesit thatwereusdtoassesth accuracy. obtained for each sample site. in most cases, there were two laboratory and two field spike zecovery results available for eash sample site that were used to assess Lhe accuracy. `TaThheerrseetwwheseerraeecsecseuevrveaescnnyi.nindIdinivvitiddhueuacalal s]"e3'CCswPPhFFeOOrAeA.rthereccoLoavvbeaerrynyrerfesisueulltltdssQppeCercrsoisuittleetdthnhaoatttwbweerecreeaalalclusslooautusesede,ddtthtooe XC PFOArecoveriesalonewere usedtoaccesssocuriy. assess th~ accuracy. In the cases whore the lab and field I~c PFOA recoveries alone were used to access accm'acy. QC could not be calculated, the 88.00 RREESSUULLTTSS 'AAPnaFnlOaySltyiitcincawaal trreerssruuslRtassmapanlndedsaaasrssseeesssssueeddamcaccmucuraaracrciiieneissTfazfoobrretlethhdLeeaannaallyyssiissooff PPFFOOAA,, PPFFBBSS,,PPHFSH,S,aanridd PFOS in water samples are summarized in Table I. FdoeFrttoaiirtfliifeicdcaaittniioonnTraerbeclcoeovsevIrefirieaesns fdfooIrrI.PPTFFOOhAAe,,avPPeFFrBBaSSg,,epPPeFFrIHcLeSSnatannrdedcPoPvFFeOrOiSSesiin+ntsththaeendwwaaraldteedrresvsaiamamtpilpoelnesssafaorrree PdFeOtaAil,edPRinBST,abPlFeHsSHananddPIRIOl.S iTnhewaatveerrsagaemppleercsewnetrreeco1v1e6r%ies+_+30s,tan1da3rd7de3%v7i,ati1o1n3s%fo+r 2P200FaOanAndd, P11F1B01%S,+0Pi3F%3H11,S, rareenssdppe~PcctFtiOivveSdlyyi..nFwoFratotiretfriifsiccaaamttiipoolnnerserewccoeovrveeerr1iie1es6sf%foor_r+ 3"'0CC, P1P3FF7OO%AAinin3t7th,he1e1ww3a%tateerr - fossaarmupPpllCeesPs F~ arOeAddieettnaawiillaeetddeiirnnsaTTmaapbbllleeesIIwVVe..reTT9hh9ee%aavvve1xra8agg.ce ppeerrcceenntt rrerccoovvecrriiems _++ssttaannddaarrddddeevviiaattiioonnss for 13C-PFOA in water samples were 99% 18. ExygenResearch PaPaggee11990o1f 11155 22009955..00220044 33MMAAO011555511998811 IInntteerriimm RReeppoorrtt ##22--AAWnnesayrlsyiSsisasomopffClCoeotstttaaggeeGGrroovveeaannddWWooodobdubruyry Water Samples ExStyudyNgo. PeOUDInA00 Exyg~n Study Ho.: PO001400 w FwFoeorrrceearacchhepprriipmmfaarooryyrssaraCmmpPplelFeecOodAlo.llelecSctoetedmd,e,bbseeattmwwpeeleeensttghhaeevffeiieerlleddcaoanvneddrlilacabsb,f,soserevveennCininPddiFivOviAidduouaualtlQsQiCdCreeorsefustluhtltses wwnneoorerrremmeaaarcll~cpaaeoccprcct~eeaeppbdttlafaenonicrcn~e1e~rrvC~aenrPggyFeesOotoAf,f7.7i0n0S-s-o11tm33r00ue%%mse.a.nmtBBwpealececssaahutge~saseevwelleaarrbeboeocrorfaavrtteeoorerrioyyesfccoofnoPntrCtrr~ooP3llCFssOPppAiFikk,OeeassAtffooolarretas1si3dtCCanPPocFFfOCOthAAe "swPPpFieFkOrOeiAAnargcreoeccrecopoevhvxeaterbrryalyepcpteiienrnrtgethvhceeesorysueelvsvdeeebtnn,eiddnfoosnonteruefanomfdore,rtnnthhteoewsraseaa-msmchpxeplislerewwawacetraseosancfasrcoeweveepetropatefabpb1le3leerCafaPnonFdrdOmpneAoode,,eveavitxiddc[eeeenanptsttterforoonrorretrssh1i3ienCn. oMslopWwwiSk-inlaLagbSb-oss0rpp5iie0kkx3eet1raoo6cff.tiWW ngBBMCcMNo-PuNlGFd-WOGb-AWeRI-rfReo-cuI0o-nvO-de0,-r0i5ne50os033ro1~1u4.4tesxiaahdnn-e'dodacftttihh7oee~0s-llow1oww3er0fef%iieeplladedrrefssoppdriimekk~eeeomdoe,ffdeCxCicnGGedMipMctNaNtf-oi-GGvreWW tho-ef- mari effets. MW5-LS-050316. matrix effects. ~C PFOA recoveries out~ide of 70-130,/, are deemed indicative of 99..00 CCOONNCCLLUUSSIIOONNSS "TPThFheOewSwaatactecerorsrsadamimpnplgleetsoswwsemerarel~syusiucccca,ecls~msesfftuulhllolyydeVxOxt0trr0aacIctt7ee3dd0aa.nnddTahanenaralleyywzzeeeddrfefoo0rr0PPcFFiOOArA,c,PPuFFBmBSsS,,tPPtaFFhIEna-ItScameaannsydd hPhaaFvvOeeSaaffaffceecccotteerdddtitnhhgeedtdaoaitaa~naqquluyaaltiilcittayyloomrrieninttheteoggdrriiVttyy0..001780. There were no circumstances that may 1100..00 RREETTEENNTTIIOONN OOFF DDAATTAAAANNDDSAMPLESAMPSLES - AwAillll oobrreiiggsiinnaahllppaaippteeropdtdhaaeptaasgpgeeoeannrsedoarrat.teeddTbhbyiysEExdxyoygegescnaaoRRetseiseneacarlrcucdhhetfthhaaattpcperzitrtaaliinntss yt0ot-htrhisaisswpiindneta~etcr-aiimismurf~cepphiaoocrsrtt twhiineislitlnrnubtmeesresinhmttioaponrprrateltedyematmptioecrmpatahleterreueasrpp~eonloronltogastgosnsr.d.. EaElxTlxahacei~srttidcgcooiopenpisaielensfsocoiotflfiatnalycl-lllsurrpdaaeewwcdifadaftciaaictal,ir,taayas-wsswdpwaeetelcaflit,~aawcssirlaaaslwsibigegdnrnaeeettddaaccisounopecpydhyiaoonfsf" ttthLhheeeEiaEnxxtyeygrgibemennParRonaRecasetlseyieatrcairecrScacthlhaaraneardprcacohtrhridtivvsaeeno4ssd0ffoCaorrlFrltRohther7yieg9pi2pem.errliiofoaddcoiolfifttyt-iismmpeeecsipsfepicceicrfiafiwieedddiaitnna,EEwPPiAAll TbTeSSrCCetAAaGinGoedooodidn Laboratory Practice Standards 40 CFR 792. v ExEyxyggeennRPe.s~eseaarrcehh 22009955..00220055 PaPaggee 22000off111515 33MMAA0011555511998822 InIenr~i-rha~ RReepporetr#2t-#AWan2ta-elyrAsSinsaoamofpflClCyoeotssittaiaggsee GGrroovvee aanndd WWooooddbbuurryy Water Samples Exygen Exygen SStauddyyNNoo.:: PPOO000O1I440000 wv TABLES v v EExxyyggeenn RReesseeamr-cchh 22009955..00220066 PPaaggee 2211 ooff 111155 33MMAA0011555511998833 tri Repo 2 ArlysiofCogsGrove sd Wow 1ntczim Rrport #2-Analysis ofCoUag G-rov and Woodbury `WWaatteerr"SSaammplpelrss B BxygmaSSttuyd~NNg oos.: PP0O00011440000 TTaabbllee II.. S Sumummarm yoofafPPr FFBBy SS,, PPFFHHSS,, PPFFOOSS aanndd PPFFOOAA iinn WWaatteerr w `SSaammpplleess v E rT EE EETEe 3700 3~10 1OG~O 100/50 2480 2630 Found ~q~ aWL) 22OO 222O (~% !- %) 3or3o 3200 2730 81.6 BE IBE IBIN BEE NO ND 3~v30 MD 30/30 MD 3O,'3O ND ~ID 3or3o hid ND 30~3~ MD 30/30 C0~44~ C0460441 WBM N-GW-R3.-O-0~14 W~MN-GW-R3-OP~M3~4 110 30/30 15G 30~30 110 30,'3o 15G 3~'30 99.$ 30n0 14, FB EEE 1~00 1110o 11000 lOO/50 197O0 l~rO~ t 0700 REEEER 24a0 224o 21e0 40/40 40~40 2~0 27"/0 30/30 30~30 E i, FmsA es(we BwelEwsEwBlE wBeEnoEn 10050 t0~00 11000 2~00 3or~) 30/30 16100 IO0~D 388 30/30 222O 1720~ lOOn~o 4O0 C~SMST CGMN.GW.MWl~4)P4S~18 18100 1OC~0 372 21e0 ~ 21g0 oe EEC EE C4~S440 Rep CGMNA;W-M'W4--O-O44~1~' Ergrmm tml gly gig ~ ~ I~p ~| GGMN-GW4iW~O4~ S COMN-GW-MW34)-~0318 OQ MN~D P-08~31 E an. sI naoBa lIeBBm iI7l SBiRn n E= C004S448 Rep CG~14-GW-trW!-O.~Slr t~100 1560~ 1450Q 390 1QOrSO 1QO~'-~ 222O 2110 2O7O 8140 8150 30/30 111D 30/30 CS~lSiS| GQMN4]W.MW1.DP.05031| 73.5 ~.5 1180 30/30 G~gS4~ E pEA E PiE BEFBEEFE B IERE C4~4~7=I~p GG~N.GW-MWS.O-OSO31 s CGM I~.~W-I~V~04OSlS' N~ 100~ NO NO 142 t01 3o~3o 2~7 30nO 2S4 30/30 314 30130 ERIE EE C~O4S4~ I~p C806~481 O MN-~W-MW2-O-OS011 S" gMN-OW~4S131S mn meBm EBe EBs EoS C404StM R~ CGMN.GW.MWt.O4S031S' Nq S3.G 52.4 124 1~0 301 0~4~ OGMN-GW41V/~4H~-~IS t24 312 T EEEE tt umswensomisisiinsmmnsn vw Sots ---- Page 22 of115 22009955..00220077 33MMAA0011555511998844 ri Report 2 Aly of CotageGrove nd Woody #2-Analysis ofCottage Gr~ve and Woodbm'y `WWaatteerr SSaammpplleess. ExesSoyNosPNO1A0 Exygen Study No.: P0001400 "TTaabblleeLL. SSuummmmaarryy ooff PPFFBBSS,, PPFFHHSS,, PPFFOOSS aanndd PPFFOOAA iinn W Waatteerr ww `SSaammpplleess CCoonnttiinnuueedd EncE4~400 49700 323OO BREESE 30f30 ~ ~ 4~/40 443N0 21,t0~00 224~C00 121O000 40/'40 40/40 40/40 EE FBIBE E EBEE 375 I ~0~0 M1 linG0 30/30 31~r30 2710 2O20 24OO ~O/GO SO~ ~0,'~0 488 30/3D ,SgS 40/40 17eO 30/30 TRBI LBLE BLE 414 577 40/40 1A10 30/30 6~ 40140 9O2 40/40 "r~ 40140 fy Shem mele sly ming 948 4~40 1090 40/40 97~ 40/40 T ro memi e |eow noelm emw emllmm emigrey ND 12800 ND 30/30 ND 3O)3O ND ~ 19~0 30/30 1340~ 1910 30/30 7D2OD 12800 tIX~,~ lggO ,~)t30 11700 30/30 724~ 34~000 80/80 15"r~o 5o/5o 26200 ~0~ 2~9000 t 470~0 50f50 v EE b iye E mmi mEE |SIlEl E imEtlmEoElii Em BSmEEiEE lm] lIlEFEmrEiS]o 14OO0 EE EREIE REEEE 14000 I00.50 10~50 92400 1~70 leOO 2430 t990 1830 100/50 100P~0 t00F~ lOO/~D 100/~ 459~ ~ 4110~ 320O0 70/70 70~'0 5OPt0 ,50~0 12Z00 100/50 1870 18100 11300 SEI EEE EEREE 10700 IOOF~ 100~0 mre| mm T 2 HD EE iREEE EE 516 I00~0 170 30/30 533 100/~0 524 100~50 167 ~ ETE BIB BEE 3~0 3~0 4310 EE LBBB ND lO0t~O ND ~ ND ND ND EYEEmE, th urns rsssnsmsspsienss NO ffi Hotquar~lab~fM~mattatl~nl~'~en25n~LardtheUmltofOuan~t~lo~(LOQ)v~k~ls~ ~ BrymRest v Exygen R~scarch Page 23or1ts Page 23 of 115 22009955..00220088 33MMAA0011555511998855 I nItneterriimmRRepcpoor~t##22W--AaAnntaaellyyrssSiiassmoopfflCCeostotttaaggeeGGrroovveeaaondd Woodbury Woodbury Water Samples ExStyidyNgo. PeODOLn400 Exygen Study No.: PO001400 TTaabbllee]I,. SSuummmmaarryyooff PPFFBBSS,, PPFFHHSS,, PPFFOOSS aanndd PPFFOOAA iinn W Waatteerr w V SSaammplpeless CCoonnttiinnuueedd cuss comoumoseu| wu ww| www| 0 mx| wm ew cml cannon | RoomR| ER OB|8 ON | WO 14~ 14,~0 Ei E REE EEEE 14~)0 gmgum mmm amie momid msom 158O0O 151000 gm, mmm 2 mr zom|E ORE OB 1570~0 (~44S9~ CGMN.GW.PWS.O P.OS0314 oH. SEEIEE ~ Rap GGMN.43W.BI l~.O-0~0~i4 CGiIN.GW.81 ss.O.e~'t ,P COMN4)W-D114-D P.0~0314 OZ EE BE EEE ~-zm Itep G~E~I~7 r,41N.~W.CW0.O4~4~' GGMN-GW-GWD~P-O~,mI - Coe m T mm em|| x ml| wme 2RWE OEEE EE C~7~O R~ :m/SO ~ ND 30/30 NO 30/30 EEE EE EBSEEE c~ urm wmowasomus | WgMN-~W4~-~-I~-0S0406 wo wo| mo ww| ow CI mien| Wo@mlw ORE me | wm we ND 30/30 [|| ER t91 ~ 2~0 233O 2810 cotetr~'8 ~,~87m ~ WB M N-GW.~-4.O,.EGO406" veer mourns] 0 C0~71|5~ WBMN-GW-Fleld-Elank-~ vom| wo ww| 0 3120 3070 wm| www NB BTRETeEenmo nso 3at ra mn ret ek v ExygenResearch 22009955..00220099 PaPgagee22440o0f111155 I3MMAA0011555511998866 IinrteirimRRepepoorrt~ ##22--WAAnemarylyssiSissaomofpflCCeosoattaggeeGGrroovveeaanndd WWooooddbbuurryy Water Samples ExSyyNgo: PeOOOIn400 Exygen Study No.: P0001400 wv TaTbablleeIILL. M Maattrriixx SSppiikkee RReeSccaoomvvpeelrreyysooff PPFFBBSS aanndd PPFFHHSS iinn WWaatteerr Samples E=E wEas ~L) I~ 113 ~0~ 1Oil 117 ~ 2480 248~ 24e0 2480 a 134 ~ 117(1 -- wn 1210 2480 -- 31300 = i: - BogenResearh Exygen Research 22009955..00221100 Pugs2501115 Page 25 of 1 ] 5 33MMAA0011555511998877 InIntteerriimmRReeppoorrtt #22--AAWnnaealrylysSsiiassomopfflCCeosot~taagge~GGrroovveesanddWWoood~dbbuurryy Water Samples ExStuydy Ngo: PeOOOIn400 Exygcn Study No.: TTaabbllee IHL. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSS aanndd PPFFHHSSiinn W Waatteerr w SaSammplpeless CCoonnttiinnuueedd SEDTIER || we ~mmmie (20D0I CATE |ae we - mw. 0|Z)II I cfm om oe ow w mr [fw w|m ww a I 3: To BogenResearch Exygen Research 22009955..00221111 PPasggee22660o1f 11155 I3MMAA0011555511998888 lIontterrimRRepepoorrtt##22A-WnAaat~leylrs~SiiassomopfflCeosot:tstapgeeGGrzoovve~aanndd WWooooddbbumryy Water Samples ExygenStyNos POOOLAOD Exygen Study No.: P0001400 TTaabbllee llIl.. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSS aanndd PPFFHHSSiinn WWaatteerr w SSaammpplleess CCoonnttiinnuueedd ~ 115 ~ ~ 1!1 113 ~ 1t3 ~ ~ 110 - EEReE l 35~ 3~ 3e3 348 348 348 348 mw xf = 0t7 ~ I ~ ~ ~ 107 ~ ~ 1~2 ww vw `EExxyyggeennRReseseeaarrcchh 22009955..00221122 PPaaggee2277ooff" 111153 33MMAA0011555511998899 IItnteirimRRe~pooret##22--AAWar~taaellryyssSissaoomfpfCCeostoitatage~GGrorvoew sannddWWooodobduburryy Water Sample~ EExxyygge~n SS~uasdyyNNoo:.: PPO0O0O0L144D000 - TTaabbllee IHL.. MMaattrriixx SSppSiiSkkaaeemmpRRpleelceceososvvCCeeorronyynttooiifnfnuPPueeFFddBBSS aanndd PPFFHHSS iinn WWaatteerr =e 02 WDD oa - RIT el me - mw v ExEyxyggeenn RReesseeaarrcchh 22009955..00221133 PPaaggee 22880of111155 33MMAA0011555511999900 InItneterriimmR.Reeppoorrtt##22--WAAiunsaaellryySssiassmoopfflCCeoostttaaggeeGGrroovveeaanndd WWooooddbbuurryy Water Samples EExygx~nSSatyuddyyN1g~ooi.:PPeO0O0001n140000 TTaabbllee II1I.. MMaattrriixx SSppiikkee RReeccoovveerryyooffPPFFBBSS aanndd PPFFHHSS iinn W Waatteerr - SSaammpplleess CCoonnttiinnuueedd (nOAJ I%1 ~ 117 1000 li~ V v a SEER =e = .- mom 131 t74 178 LJ ExygenResearch 22009955..00221144 PaPaggee 22990off 111155 33MMAA0011555511999911 te Regt AcionfCots Gove Woy Report #2-Analysis ofCo~t~ge Grove ~d Wocdbury Water Samples ESly Nn o ODL00 Exygen Study No.: P0001400 - TTaabbllee HXl.. M Maattrriixx SSpp`iikSkaeemRRpelececoosCvveoerrnyytioofnfuPPeFFdBBSS aanndd PPFFHHSSiinn W Waatteerr Samples Continued FE=ams = GGtEFGW-~W~).~I 4 EEE | 1~/ lO6 11:$ o | -] - - ow t700 1~ 1~# ND w mmm ww on [e-] e - oo. minim, mto F,~.~) 1040~ 5750 183000 1044 1~ wv `ExygenResearch 22009955..00221155 PPaaggee 33000off111155 33MMAA0011555511999922 trimReport Interim Repor~ P#22--AWAamntlaeylrsyisSisseoopfifCeCosoittgageeGGrroovveeaanndd Woodry Woodbury ~~ ExSuydNgos PeOOOIn400 Exygen Study No.: Water Samples `TTaabbllee IIlI.. MMaattrriixx SSppiikkeeRReeccoovveerryyooff PPFFBBSS aanndd PPFFHHSS iinn WWaatteerr - SSaammplpeless CCoonnttiinnuueedd Emma WOeAN-~VI~R-~.I.8,q60405 v poe) WE~N~r4b4.0.O~4~ WE~N.GW.R~S nme a maf] mw ow v ExygenResearch Exygen Research 22009955..00221166 PPaagg~e3311oof~1'111s5 33MMAA0011555511999933 trim Report Inter~ Repoe ##22--AWAamntaale3yrysSsiiassmoopfri'CceoostitaaggeeGGrroovweaanrd~ Woodoury Woodbury ~~Exygen ShadyNos POCOLADD Exygen Study No.: P0001400 Water Samples TTabablleeIHILI.. M MaattrriixxSSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PPFFOOAAiinnWWaatteerr Ld SSaammpplleess en mm SEE mgm Breer mow sm w DTOST PE (0D 2 IIS www -! - = OTL 2 wow w mE- | - om 15 - om === em e e - dee Zz w ee www ow ow - wm wf]. - ExygenResearch Exygen Researoh 22009955..00221177 PaPgagee332201o1f 11515 33MMAA0011555511999944 Interim Rept2:Anyi of CotsgeGrove 1d Woodbry | ExygenSusyNo: POLAND Interim Report #2-A~alysis ofCottage Grove snd Woodbury `WWaatteerrSSa~mtp~lf,eless. Exygeu Study No.: PO001400 w TTaabbllee III~I.. MMaattrriixx SSppSiiakkmeepRRleeeccosovvCeeorrnyytooifnfuPPeFFdOOSS aanndd PPFFOOAA iinn WWaatteerr Samples Continued EEE | em~rlO Fa EEL wl| =we ww wm] 47 1I om o| f-] ]--- 133 I mw -- - ce mime lo] LC alae = CMIITIIIT | a [we wf ww " v mrmimme |TV D0 TID LT SEES le. oa 3 m mm tm [|| hweamemm Z pt n m| w om weHl e M ow ow ow wwo w w EExxyyggeenn RReesseeaarrcchh 22009955..00221188 PPaaggee 33330off111155 33MMAA0011555511999955 teri Interim RReeppoorrtt##22--PWAmanatalleyyrssSiiasszoofpflCCeoostttaaggeeGGrroovveeaanndd Woodiury Woodbury ~~ExxyyggeennSSttuuddyyNNoo.s: PPO0O0O011440000. Wa~r Samplcs TTaabbllee IIIILI.. MMaattrriixx SSppiikkee RReecocveoryvooffePPrFFOOySSaanndd PPFFOOAA iinn WWaatteerr w SSaammpplleess CCoonnttiinnuueedd Cs - me = wo. w min i - af. - - EEE | re wwf ne om v ExygenResearch 22009955..00221199 PPaaggee33440off111155 I3MMAA0011555511999966 WaterSamples IInntte~r-ii~mnRReqp~oorrtt##22--AAnnalaylysisissooffCCototttaaggeeGGrroovveeaannddWWooodobdbuurryy Water Samples ~`xygE en SSx ttuuddy yyNNoo..g ::P10'e 000010n 410~00 TTaabbllee HIII.. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PPFFOOAA iinn WWaatteerr Ld SSaammpplleess CCoonnttiinnuueedd SUI fe] vm fd om I 3 == vw EE |wn : --- ETE we owe - 154 vw EExxyyggeennRReesseeaarrcchh 22009955..00222200 PaPgagee 33550o1f111155 33MMAA0011555511999977 _-- - InIntteerriimmRle~ppoorrtt##22--AAWnanatlaeylyrsSsiisasmoopffClCeesotmgg~GGrroovvee1anndd WWooooddbbaurryy ~~ ExygenStudy No:POGOL00 Exygen Study l~o.: P0001400 Wa~r Smupl~s TTaabblleeI~LI.. MaMtartirixx SSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PPFFOOAA iinn WWaatteerr SSaammplpeless CCoonnttiinnuueedd Ee = aus = Tommie fem fe 1t0 v =r fee ow afew ow 115 v EExxyypgeennRReesseeaarrcchh 22009955..00222211 PPaaggee33660o1f111155 I3MMAA0011555511999988 | Inter Interim Rept Report ##22--W.A~aumtsellyryssSisasomopfflCCeosotttaaggeGGrorovvee od and Woody Woodbury Exygen StyNo: POOLAN0 i Water Samples wv TTaabblleeIIIHL..MaMtartirixxSSppiikSkeaemRRpelecceoosvveCerornyytooiffnPPueFFdOOSS aanndd PPFFOOAAiinn WWaatteerr || Samples Continued SEE pe - oe wf--- --- a | - |e ---- | v mi |- wf]. - --===CznozonZjzooo ERE FO I w BuypenResech Exygen Research 22009955..00222222 Page Page 37 37 0o1f 111155 33MMAAO011555511999909 InIntteerriimmRReeppoo~4#22--AAWnanatalelyrysSsiiassmoopfflCCeosotttaaggeGGrroovvee aanndd WWooooddbbuurryy Water Samples EExygxenSSttyurdayyN~gofo.,: PPeOOOOO0In1A40000 TTaabbllee IlIllI.. MMaattrriixx SSppiikkee RRece overc yooffo PPFFv OOSSae annddr PPFFOy OAA iinn W Waatteerr w `SSaammpplleessCCoonnttiinnuueedd == [E =w E m ETT fee wwe ow fee] om owe v Sm | e wwm om wow ES = . wow |e. oe ww v ExygenResearch 22009955..00222233 PPaaggee 33880off l11155 33MMAA0011555522000000 n~ er RReeppoorrtt ##22--WAAnamatlelyyrsmiSssaomofpfClCoetostllaaggeeGGrroovveesannddWWooooddbbuurryy EExygx~nSSttuyuddyyNNgooi,:PPeOO0010n1440000 - TTaabbllee IIVV.. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff 1C3C PPFFOOAA iinn W Waatteerr SSaammpplleess _r Gmm--omsp=mnmt wVooufsnosowv eawrrvoSr se Spw mpeoariw pslecmsomcrtne Ramcwor C0055432 Spt D Cons eon Oe Ww wn C~65432 cometary SAS 2 0 7 C0065432 Rep CC065433 comCEsosassonme wy ViORSww RRAnasoNwnSaa1053500 om e ww e w now C0065436 sp~ E Cea WOWRO wwe cooss~ sp~ F caamneess TnnaSnESoeomn. F 2 =S5 C0065436 Rep Case none = a ow C006543T Cameos GESava {0 ow ow C008543B comSuoamseasa VOnH anaR soioA oua 0 mo w wm mwm cooa.,.,.,.,.,.,.,.,~ sp~ o emily ORCou oo C00~440 $~k H cCaaanscuueirss eWeoonv onnmsocn ootes 2m=w 8w = w C0065441 Gos Wein Satin Lowe70 ww C00fl5442 = WES AR 14Hh a OF new C0065443 coms om1 wow ooo mom ow C006S444 Spk I Comes Veonso wo C~444 S~k J vw cuConoamttteen Womnoensaeesosos w 8 w% C0~65,H4 Rep C008544S S coGmoml meattsa VIErnwmesAeconA oosAsonaa 1512500 mwe hm wow cooss4~ s~ K C01~5448 Spk L he Vaaovcoes www C0065448 cosa nN xe now = C006,S448 R~p ;006544~ fS=m WennS OO oH eOpenO 190 omwe o0w 0 n1 C0065451 coven su coumamamieone mao mo coos~s2 s~ M Cemsan Smovamieomm bo C0065452 Sp~ N Cos Cinovwamivomsa = m8 C0~5452 comin Sowamicomsa 2 = os C00~452 Rep Coes Conca ES = om C0065453 CCoost f cormi nteasr os oo 1000 ia C0065454 WBIdN-GW-R1-D~,4)50314 WBMN-GW-R1-O-050314 WBMN-GW-,R1-O-0F~314 WBMN-GW-RI.-O4)50:H4 WBUN-GW-R1-DP-050314 WBMN-GW-R1-L~0~0314 L~vSplKe 1 ROb WBMN-GW-Rt-HS-050314 High ~piko 10 ppb WBI/~I~w-R2-O-05~14 WBI~q-GW-R2-O.050314 WBMN-GW-R2-O-05~314 WBMN-GW-R2-O.OS0314 WBMN-GW-I~-OP-050314 WBMN-GW-R2.LS-050314 Low Sp~e 1 ppb WBMN-GW-R2~14 High ~Ike 10 I)pb WBMN-GW~I+ WI~MN..GW-R3-O-05031+ WBMN-GW-R3-O-050314. WBMN-G'W-R3-O-050314 W BMN-GW-R3-DP.4~:=0314 WBMN-GW-R3-LS-(~03f4 Low Sp~e I ROb WB~-R3-HS-OS0~14 High Spike 10 ppb WBMN-GW-R4-O-O50314 WBMN-GW-R4-O.050314 WBMN-GW-R4-O-050314 WBMN-GW-R4-O-050314 WBMN-GW-R4,OP-(~50314 WBMN..GtN-R4,-L,.~0~;~031# Low ,~ke I Rob WBMN-GW-R,I-H~14 Hig~ Sl~ke lo ppb WBMN.GW-CWM-O-050314 WBMN-GW-CW~14 WBMN-GW-CWM-O-0~0314 W~~M-~14 ~~M~14 W~~~314 ~ ~e I p~ ~MN~.CW~H~14 H~ ~ 10 ~ CG M N-GW-MWl 4-O-05~316 CG M N ~"~/*MWI4-O-05031e CG M N-GW-MW 14-O-05031fi CG M N-GW-MW 14-O-050316 CGMN-GW-MW14-LS-050316 Low Sp~e 100 ppb CGMN-GW-MW14..HS-050315 I.~ Spike Iooo ~ Amount nC-PFO~ Amount 1500 10500 500 ,500 500 1000 10000 1500 10500 500 500 ,500 1000 10000 1500 10500 500 500 500 1000 10000 1"500 10500 500 500 500 1000 1o000 1500 1~00 SO0 ~ ~ lO~ 1~ 1005~0 1000500 500 ~ 100000 1 oooo0o 12g0 107~ 376 383 395 989 11300 1540 11100 463 426 450 1130 12000 15~0 10900 422 403 420 1010 11500 1530 11300 435 4t7 434 . 1060 12100 1520 10900 4~ ~ 419 ~ I~ 107000 979000 284 282 107000 962000 B8 1~ 75 7~ 79 99 113 103 SO 113 "120 106 t04 84 81 8~ 101 115 102 108 87 83 87 106 121 101 10~ ~ 8g ~ ~ 1~ ~0~ 98 57 56 107 9~ FO ------------------ -- Exyg~a Research 22009955..00222244 PPaaggee 33990off111155 33MMAA0011555522000011 InterimRReeppoorrtt 7#22W--AaAtnnaeallryySssiassomopfflCCeoosttataggeeGGr-orev~eeaaanddWWoooeddbbuurryy Water Satires E ExygxenSSttyuuddyyN1g~o0:.: PeF0O0000n 11440000 Table IV. Surrogate Spike Recovery of "C PFOA in Water Samples Table IV. Surrogate Spike Recovery of t3C PFOA in Water Samples v Continued Continued -- Coomioenr=nessus _cDa-- emcoowmaaalanrnioernoioom-- oee -- SBw otha rw esaecwc= oormrmmosonaw mwacoey CO0~SpkD coCGsoriosnsyes JfSmrcrwarnrieooo]se w&=o W @= Bo2o C0065457 SCmemssaeanssar O COcaaNnoIuBIaS SomAHoomLa mo e e12e0 om=wmo owow e wio8wo C0065460 costar Sonia 2 & ow C0~o54~ Pep rncraa CCO H SCnA owamNeorILsowaSA ea 150 E moEw) n 006S482 Ses CpSa soa w C~06S483 v fSccccu"SeoorniC SCosassssirsssaaisouinnrasreaerr sssssranpaayep1xo CCaoamCScNcvCCCCcoooooAoianomhuunmnmmcommcvoonwoiwwowinniwoemamlmasnennmotoencioSrSoOsNansoGesoocoeaoeonawesuvrainsyaoeoppsssehnaka01$155500 =www w =2m=25Woow0ow m%mweo==wW ww mw mme w s woooooo7xwwwwnw GOO~72 SI~ K Smal Coma osen = oe ow C0065472 ,Spk L C006S472 Carrirye CCSaomnamsoonvceatse Rooomm wxm C~065473 Sons CCBA 200 owSo 150 wow C0065474 Sis ane ou 10 wm C0065475 comme comomamonns = ow C00SS476 S~ M Soman Somancous om C0065474 Spk N coreasinress Sobnoonmaanrososooutss w oowm o%w C0~65478 Rep GGaCoexrurn CCouonSnviAaSHCHcLeoehvaonko150 w FBI Ow W e0m C~065478 CGMN-GW-MW10-O-050316 CGMN-GW-MW1GO-050316 CGMN-GW-MW104~050316 CGMN-GW-MW 10-O-0503t 6 CG M N.GWJ,~Nt 0-Op,0rj03 t6 CC-#R'4-GW-MWl~16 Low Spike 1 PI~ CGMN-GW4,h'~ 10-HS-050316 Hi~t~ Spike 10 ~ CGMN-GW~4W4-O-050316 CC~4N-GW-MW4-O-050316 CGMN~W-MW4-O~0s0316 ~~3t8 ~W~~16 L~ 1 ~ CC-~ I~GW4WV3-O<~)316 CG M N-Gl~-kN/3-O4150316 CGM~~16 ~M~W~~16 ~M~~16 CGM~-~~16 ~ ~ 0.5 ~b C~W~~15 H~ ~e 5 ppb CGMN-GW..MW 1 -O-050318 CGMN.GW,.MW 1 -O,050316 C~-MWt-0-050316 CGMN-GW-MW~-O-0503|$ CGMN-GtN-MW I-D P-060316 ~-MW1-LS-05031e L~N Slake 0.! Pfl~ CGMN-GW~W1-HS-050~16 H~gh SCdke I PI~ CGMN.GW.MW~I6 CGM N-GWr-IVlWS-O-0r-------------~318 CGMN-GW-MWS-O-O~316 GQ MN-GW- I~NY5-O-054~316 ~~~16 ~~~t6 L~ 0.t ~ ~MN~W~~16 H~ ~e 1 ~ CGMN-GW-MW7-O-0S0316 CGMN-GW-MWT-O~50316 CGMN-GW-MW7-O-050316 CG MI'f-GW-MW7.O-050316 ~-IvlWT-DP-0~0316 CUMN-GW-MWT-LS-050315 LOW Sl~Im 0.1 pp~ CGMN-GW-MW7-~ 6 High Sp~ke 1 ppb 1500 10500 500 500 S00 1000 10000 1500 5500 5O0 ~ 1~ 1000 5500 ~ ~ ~ ~ ~ 800 1500 500 S00 500 100 1000 800 1,500 ~ 500 ~ 1~ 10~ 600 1500 500 500 500 100 1000 ~59~ 10800 444 429 467 ~J~ 10400 1550 5990 ~1 4~ tt~ 848 5620 417 417 ~ ~ ~0 5~3 1560 492 4~.'~ 533 96.4 1300 ~ 1450 471 468 5~ ~,8 11~ 598 15~0 498 578 532 113 1160 106 103 69 88 93 100 104 103 85 119 85 ln~ ~ ~ ~ 79 77 99 1 04 98 ~ 107 96 130 gg 97 94 ~4 t01 ~ 117 100 106 99 116 I0~ 113 116 nS omeri ko 7 Exygen Research Exy~*n Resem~h 22009955..00222255 Page 400115 Pa~: 40 of 115 33MMAA0011555522000022 ItnteeriimnRReqpoxratt ##22--AAWnanatalelyyrssitS.sseozofpflCCeoostttaaggee GGrovreaannoddWWovoooddibeurryy ~~ ExygenStudy Exygcn Study No. No.: BOOOI400 P0001400 Water Samples - Continued Seaman TTaabbllee IIVV.. SSuurrrrooggaattee SSppiikkee RReeccoovveerryyooff Z'3CC PPFFOOAA iinn WWaatteerr SSaammpplleess Contiaued ~IC.pFOA [ci-- CmccsoGo"ioS= sCusEouuiaenzossnntniiassc-- srssee -- -- CCoOu CcOcCoSSoo-- omnimvaaESonLwniHsnSaaSneommmmaznsa-- ncccoosioSeoocometEmsmnSessssoan-- iSzo -- p~m==m22FhoIaot~-- M:awToww =wcwmmoonow-- w iawrwcooo&5wwmre} C0065484 Spk E C0085484 Spk F a crsn fCom onas n o] my =FEww- C006,.~484 Rap Cos Coumowamson sins = ow C00804~5 for] COAL 0e ow 03 0 2 om ow C00654a6 Ser Nae cs a 0 FI C0065487 ScceComnmasswiuaomsmnpa CcmS ioccumnvaaoS wmmmiizszoE owormsmesss m= owo=W m wooww C00654~ Rip Cams Some ms Bw C006S4~g = CoS Ss on on 110 w-wh C00654g0 ams rrivtireciinthi J C0065491 v wcCcoac"ccCoCCsCmCSomfimaosooomgemtaatmssaioadteesreanereeaslysect CCO E oouCuncn SRCccRomS mooos omNmms omioeoo monwASoSwanzroeo nasze mo muimoeosnPSTomooootom m:wreesSmsspsa ssaaeeed05S 515500 EEfwwsm 2oowE m wmmI2oooww - m mmme5Soo8w wmeo- m amw=ooo3mww C006S500 Spk M C(~6.~800 ~pk N em Canonsseams = wv C~065500 ccCSomo= oasiinioeineress CCoc n OuUmNoScCnom ao T TmnoRcnTvooLac wm mmE mneozmoooss antsaassssa3s0e awBo d @FIoww etodw oB wwowm-ow1 C0065500 Rap CG MN-GW- MW2-O.0rJ0315 CGMN-GW-MW2-O-050315 CGM~W~~15 ~M~2~15 ~ 6~ 0.5 ~b CGMN-G'W-MWg-O-~50315 CGMN-GW-MWg-O-050~15 CGMN-~W-MW~I,5 CG MN-GW-MW 9..O-050315 CG MN.GW-MWg-OP-050~ 15 CGMN.GW-MWg-LS,050315 Low Spike 0.5 ppb CGMN-GW-MWg-HS-~;~31S Hi~l ~ 5 ppb CGMN-GW-MW12~1~ CG M N.GW-I~P/V12.O.0~0315 ~MN~W-~f2~315 ~M~W-~I 2~I 5 ~W~12~15 ~~12-L~15 ~ 1 p~ CGM~12~15 H~ ~e 10 ~b CG MN-GW.-PZ14-O-050315 CGM N-GW.,PZ 14.O.050315 CGMN,GW-PZ 14-O-050315 CG~N-GW-PZ t 4~O-050315 CGMN-GW-PZI4-DP-050315 CGMN-GW-PZI 4-LS.050315 Low SI~,e I ppb CGMN-GW-PZ14-HS,050315 Hlgl~ S#i~8 10 ppb CG MN-GW-MW 17-O-[L~3 t 5 CGMN-GW-MW 17-O-050315 ~M~t7-~45 ~W~17~315 CG~17-~15 CGMN~W~17-~315 ~ ~o 0.5 ~ ~W~17~0315 H~ 5 ~b . ~-MW18-O.05~15 CGMN-GW-MW18-O,O60315 CGke'~-'W-MW 1B-D.0503 t5 CGMN-G'W-MW 18.O-050315 CG M N.-GW-MW 18-D P-0~0315 CGMN-GW-MWq &LS.(LK0315 Low Spike 0.5 ~ ~N-GW-bP.N1~-H,~0~0310 High Spike 5 IX)b P-.,G M N-G1NoTRI P2-O-O50315 CGMN-GW-TRJP2-LS-050315 Low Spik~ 1 p~b 1000 1030 103 S~00 7~ 128 ~ 611 122 1000 5500 ~00 500 500 500 5000 1,~00 10500 ~0 ~ ~ 1~ 1~ 1500 10~00 500 500 500 1000 10000 t000 5500 5~ ~ ~ ~ 5~ 1000 5500 500 500 500 500 5000 500 1DO0 g82 6200 "91 514 537 502 5740 1480 111~ ~ ~ 315 11~ 1~ 1800 15000 507 513 560 t310 14300 1040 ~10 5~e ~ 5~ 4~ ~ ~1 ~ 434 450 516 496 5100 541 t110 96 113 98 103 107 100 115 120 t43 101 103 112 131 143 104 1~ 103 1~ 118 ~ 119 ~ t07 87 g0 103 99 123 108 111 CGMNK3W-TR~P'2-HS-050315 Hig~ Slake 10 p~ 10000 11000 110 nS om i mm ee Note: Sinc~ lhis tory table sroi~ ~Jndml mmlls, recovmy,ualuos ~ v~,cy dghlly from b'te v'a~ues In 1~e raw da~. ExEyxygge~nnRReesseeaarrcchh Pagedtof11s Page 41 of 115 22009955..00222266 33MMAA0011555522000033 Ld w InItneterriimmRRe~p?oorrtt##22--AAWnanatalelyyrssSiimssopoflfCeCosoitatagge~GGrroovvee aanndd WWooeoddbbuurryy Water Samples ExygEenSSxtdudyyyNNoogs.: PPO0eO0O0L1n44D0D0 TTaabbllee IIVV.. ----c__o--a--orsmsnc C00659T3 ~ok C Senn C0065973 Spk D our C0065973 caring C0065973 Pep Coware C0065~74 SeGoovern C006597S C0065976 commsae COD85g'I7 ~ E Cam hr C00~59~'7 SpkF a C0065977 cme C006~T/' Rep Son C00651)78 Gen C0065979 csCrasex C00__~59~__1 S~ G fii] C00~5981 ~ H art C0~1 xt C0065981 Re# C00~.~83 f=] C00~_~J~__ Gin ~ comme C006598~ ~ I C006~)85 ~ J os (30065985 came G006,~J65 Rap on C006598~ GonC00689~7 a C00658a8 consomon C0065~6~ ~ K foenatn C00558~9 S~ L C0065989 CO065~B9 ~ "ea C0065~90 fr] C0065991 feed C00e~S~ cusom sme C0065993 Spk C Sms C0065993 Silk D cSaanmss C0~59S3 fmoE] C008,5~3 R~p C0065994 C0~,5995 C0~5996 Surrogate Spike Recoveryof C PFOA in Water Samples Surrogate Spike Recovery of Continued scorn Conttaued PFOA in Water Samples mC4~OA comeoncmaeniroems: Grwhlos weormelems WmamsrOy CGMN-GW-MWtl-O.050312 Conor sams ww CGMN-GW-MWtt-O-050312 Sonia asmm ww CGMN-GW-MW~1-O-050312 Snomamnroma 2 wow (;X3MN-GW-MW11,-O-0~)31Z rami) FA CGMN-GW-MWI1-DP-050~1~ conSim ha ae 10 mm CGMN-GW-MWIl-LS.050~t2 LowSpi~ | ppb ai a aw ww CGMN-GW-MWII-HS-050312 High Spike ~0 pp~ comonmaromz po CGMN-GW-MWI01-O-050312 ferme fi CGMN-GW-MW10t-O-050312 Sorosm = ee CGMI'~,GW-MW101,,O-0~)312 Bios = om ow CGMPkGW-MW101-O.050312 me: =z CGMN.GW-MW101-DP-050312 Camo 0g won (on 2 CGI~I~.GW-MW11)l-I.S-~0312 Low ~ 100 ~ Cocmaononnamzmommozsm aome omamn wwoon CGMN-GW-MW102-O-050312 Bins mB CGMN-GW-MW102-O,4kS0312 Soe: = Ev CGMN.-GW'4/M~ 102.-~12 Sonammmoom: FE CGMN-GW4/IW102-O.050312 CGM N-GW-MW'~ 02,.0 P-050312 Ber NE CGMN-GW.4~102-LS"050312 LOW ~o~e 100 ppb Canon Game Wows owe 1B CGMN-,GW-MWt02-HS.~50312 High ~ t000 pl)b comounsosmz = oem CGMN,GW-MW13,O-050312 CGMN-GW-MW13.O-O~0312 frst % w= CGMN-GW-MW13-O..050312 Sonoran osmt 2 = = CGMN-GW-MW13-O-050312 rrr) 2 oo a ~W-MWt~:FM)50312 counts be tn BE CGMN-GWJ~N13-LS.050312 Low Spas I ppb rmsdSR -S CGMN-GW-MWI3-HS-050312 High ~ 10 ~ camannreoms mw CC4AN-GW.MWI6.O-0r=0912 premier mmm CGMN-GW-MW16-O-050312 Cnuamessan: = Em CGM~W-MW16.,O-~312 CGMN-GW-MV~t 16-O-0~>0312 Comme ow ow CGMN-GW-MW16-DP.050312 Cou ES Lo Se 10 -omm CGMN-GW-MW164.S-050312 LOw ~ 1 p]YO SNMESEEGIZ ww we ow C.GMI~'W-MW16-HS-050312 High Spike ~0 ppb camanmisosas mm we ow CGMN-GWoMW15-O-0,50312 Rome ew C,GMN-GW-MWl~O-050~12 noosa: wn CGMN-GW-MW150-050312 fre FEI CGMN-GW-MWl,~O.059312 CGMN-GW-MW15-OP,050312 coun amarot 1 mom R CGMN-GW-MW15-LS-050312 Low ~ ~ ppb a we ww CGMN,GW-MWIS-HS-050312 High Sp~e 10 ~ 15g0 1720 115 10500 12800 122 500 4t5 83 ~ 41~ 84 500 432 86 1000 1230 123 1DO00 13200 132 100,500 139000 138 1000500 181Q00~ 18t 500 ;LXJ6 59 500 284 57 500 262 52 100000 112000 112 100500 135000 134. 1000500 15g00~0 15~ 500 33~ 67 500 342 88 500 348 70 100000 134000 t34 1000000 1200(X)0 120 1500 tel0 121 10r~00 138~ 131 500 488 98 500 48~ 98 500 841 128 1000 1250 125 10000 143~0 143 1500 1780 I'19. 10500 12900 123 500 ~)06 102 500 5t0 to2' 500 465 ~3 1000 1T/0 177 '10000 13700 137 1500 1840 109 10~00 11100 lO6 500 470 94 500 502 100 000 473 95 1000 97~ ~8 10000 13100 131 tee yeei en E. xEyxypgeen~RReesseeaarcchh 22009955..00222277 PPaagge4e2do2f1o1115f5 I3MMAA0011555522000044 Inet~r'imraRRepepoorrtt#~2-AAWnnaesllyryssiSissaomofpflCetsoa~gge~GGrorovvee aanndd WWooooddbbuurryy Water Samples ExStydyNgo:BeOO1n400 Exy~'~ Study No.: 1>0001400 v TTaabbllee IIVV.. SSuurrrrooggaattee SSppiikkee RRCeeoccnootvvieenrruyyeoodff"1SCC PPFFOOAA iinn WWaatteerr SSaammpplleess Continued [= ee C0085g30 ffreee] C006,~32 p---- cooez~ ~ot e SomatSpk F es C00S.~.~ Rap hd C0~5934 = C0065935 fed] C0085936 evn eee DSTO CG MN-GW-TRIP 1-O.050314 Camano CGMN-GW-TRIP1-!.S-050314 I.~ ~ke 0.5 ppb emma CGMN-GW-TRIP1-HS-050314 High Spike 5 ppb common mos CGMPt.GW-PW1.O~0314 eno CGMN-GW-PW1-O..050514 NS CGMN.GW.PW1.O.~50314 CGMN-GW-PW1-O4~0314 Presser CGMN-GW-PWI-DP-0~314 comSowsand en CGMN-GW-.PWl-LS-0503$4 Lo,~,Spike $ PI~ SRANSEAEGN CGMN-GW.,PW1-HS-05~314 High Spire 10 pp~ Tos toa eer OR RY OS 500 517 103 MB 500 503 101 wm ww 5000 5360 107 mum ow 1500 1530 102 = om n 10500 11600 110 = wo ~ 410 82 500 412 82 oa ou 500 424 85 mom 100~ 1130 113 = ww 10000 10800 108 CGM N..GW-PW2-O.~S9314 Seaman nan Some =m ow CGiMN-GW.-PW2-O-0r'j~314 Crs frst) = ww GGMN'GW'PW2"O'0~0~14 crores frre] a om 0 CGMN-GW-PW2-O-050314 a Cn 5 = CGMI~3W-PW2-DP-050314 Ca omc mw 8 P_~MN-Gw-PW2-L,.~.0r~314 LOW Spike 0.5 ppb en TSE mw a CGMN-GW-PW2-HS-050314 High Spike 5 ppb pr cmon momm om ow CC-~e.~-GW-PW~O-050~t4 Span nena 5 wR ~W-PW3-O-050314 ey ras ww 3 CGMN-GW-.PW3-O-050314 commit Smee 2 2 CGMN.GW.PW3.O.0r-~'M w Co final @ om CGMI~.GW~;rW'3-DP-050314 S= E cRUoMmBaRa NE w Wm W ow CGMN-GW-PW3-L~-05~314 Low ,~ke 0,1 ppb 1000 873 87 5500 5580 t01 5OO 401 8O 500 410 84 500 483 93 500 401 96 5000 5140 f03 SO0 474 79 1500 1440 ~ 500 363 73 5O0 42E 85 500 549 110 100 99.2 9g pro coo~ s~ K Samant C006~e5 Spk L cfofoTmomndy]a C0065945 Rep CGMN-GW-PW3-HS-050314 High 5pk~ 1 ppb comoumiomm CGMN.GW-PW4-O-050314 Sno CGMN-GW-PW4-O-050314 faa CGMN-GW-PW4-O.050314 RmiChruom CGMN.GW-PW4-O-050314 Praise CGMN-GW-PW4-O-0~314 Dup cW om INEsR oe CGMN-GW-~W~S-0S034,~ L~ ~ 0.s R~b 1000 1050 105 wo ww 1000 881 88 --) 5500 5580 101 = 9 5OO 443 8~ 2 8 = 500 432 ~ oe 8 500 462 92 O3R a4 e 5O0 444 ~ fr c~S0 S~kC csmmn,tn C00&S,~ S~k D SESCa00m65hn8a51 Scconommnsrstce GTrSoamss CGM N-GW.PW4-HS,.050314. High ~ 5 ~ common msm wn ow wm CGMN-GW..PWS-O.05~314 prmnrasoi mm CGMN,,GW-PWS-O.05f1314 Sono wu CGM~-GW--PWS-O-OS0314 Bn res 5 2 = GGMN-GW..PWS-O-050314 Sn 5 5 = C~W-PWS-DP-050314 comin m os lon ioe 1 C:GMN-GW-PWS-LS-050314 LOW Sldlm 10 I:~Ob i ow 0 CGMN-GW-PWS-H_S-,'~__314 Higtl $p~ke 100 ppb common moss ww CGMN-GW-PW6-O-050314 freee om n CGMN-G'~N-PW6-O-050314 priest ww 8 CGMN.GW-.P4VS-O.050314 ranean 2 % 8 CGMN-GW-PW~-O.050314. frie) = x 3% CGMN-GW-PW6-DP-050314 Cmdr a dB COI~-PWS-LS-05~314 Low Spilm 10 gpb fiia bo at-S- CGMN-GW..PW6-HS-050314 High Sldke 100 ppb 5000 5160 103 10~00 10700 102 ?00500 113000 112 500 429 86 ,~00 430 86 500 443 89 10000 10900 10~ 100000 105000 105 10500 10500 I(~ 100500 109000 ~t 08 S00 301 60 ~00 301 60 500 294 5g 10000 9300 93 100000 91600 92 EU ---- Exygen Researsh Exygen Research PPaaggee 4d33ooff l111S5 22009955..00222288 33MMAA105155522000055 ItnetzrriimRReeppoorrtt #22--AAWnanatlaeylrysidSssopoflfCeCosotttaaggeeGGrroovveeaanndd WWooooddbbuurryy Water Samples EExxyyggen~SSttuuddyyNNoo..: POGOI0D PO001400 TTaabbllee IIVV.. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff 13CC PPFFOOAA iinn WWaatteerr SSaammpplleess ~ CCoonnttiinnuueedd s -- f-- cCcc cCfuoeaeosoECemonarrmmmrtotagsaea-- s]ies)armdci --ourn-- sCCfcfsCaoocheoiPmonnWmrooa-- omAnneaomLnnan= Seoneowmweeeeeaoseoose-- -rmoooemohtmmspynala-- 015 --vSwoww ew PEn a-- mnEwIedos m lRw SowB-- oocoorlwemmrmoeensw o-- ReewcoEwoowwveery C0065962 SpkJ Coroo=ena=ses]s CacnoComnCSoowmmaoErweicSnoeou onErssooabe0spge wfo =oooawdww mo n%o=w C006~6~ cammnsu counrwomboc mo wm ow C006,sg66srk K Smt Sonoom Oca wm C0065986 Spk L "Cus ocr ompoc ww ow C0065866 oumere Sonnoa = mow C9O~.~66 P.~ CrSoem comSPiONnDoScooonroen ors t2oe 08% C0065~68 Ses mr oe wm C0065~11 CGMN-GW-E116-O-050314 CGMN-GW-B116-O-050314 CC~IN-GW-B116-O-0503t 4 CGMN-GW-B116-OA150314 ~MN-~W-B116-0P-0~0314 CGMN-~N.-B116-LS.,0~0314 Low ~ t0 PI~ CGMN-GW-B116-I'k%4}~314 HIOll Sp~e 100 ~ CG M N.PW.CWD,.O,050314 CG M N.,PW-CWO-O.050314 COMN-PW-CWD-O-058314 CGMN-PW-CWD-O-050314 CG M N-PW-C1ND-DP-050314 CQMN-PW.CWD-LS-0r'~314 ~ Slake 10 ppb CGMN-PW-CWD-HS-0"~0314 High ~#~ke 100 p.ob 10500 10900 104 100500 53400 53 500 390 78 500 449 90 500 462 92 10000 11400 t14 t00000 91~00 92 10500 11~50 t10 100500 56700 58 5OO 450 9O 500 47"2 94 500 473 95 10000 11300 113 100000 92600 93 v SccmCSmSSScoorCoooCoaramsrsomerneseaereeaeesrsss:tsesyero Wo WCeoonuPSOWnSSroCwvScoasouCamammunmooneooonwwSowws SwoicvnaoSaammmooasoobsoooScsorooaoeooommooiwswwuwe:eeSeSaasssssskokaoo11e520 woow wm o m=m%2F mmoowmom m e mwTwwE %2R seem wo8oo8=5owwwm C0057S64 Spk G Somamn anonzomows =e C00STI~ S~ H Cosse Gases eB C00~r~ or iS 5 = C0067864 GSooomos W ol SA LiN os owoA aah0o wo ow em m18 C0067567 CGMN-GW.CWD-O.050405 CGMN-G~,CWD-O'0~40~ CGMN-GW-CWD~ CGM N-GW,.CWD-DP-0 50405 CGMN-GW-CWD-LS-050405 Low Slake I ppb CGMN-GW~'~IND-HS.05040~ H~gh Sp~ke 101 ppb WBMN.GW,CWM-O-0504~ WBMN-GW-CWM-O-050405 WmJN.GW.CW~O~ WSM I't.GW-CWM-O-0'0940@ WBMN.-GW-CWM-DP-050405 WBMM.GW-CWM-L~ Low Spi~ I R~ WBMN-GW.-G'~M-HS-050405 High ~pike 10 ppl~ WBMN-GW.R-2-O-058405 WBMN-GW-R-2-O-050405 WBMN,GW-R-2-O,0~0405 WBM N-GW-R-2-O-050405 W BMN.GW-R-2-O P-050405 WBMN.GW-R-2-LS-050405 Low ~ 1 ppb WBIR~I-GW-R-2-HS-050~05 Hi~ ~ 10 ~ 1500 1430 g5 1050O 9450 90 5OO 395 7S 500 473 95 1000 993 9~ 10000 7420 74 1,500 1420 1O50O 9320 50 ~ 457 91 ~00 415 63 500 429 86 1000 8~0 85 10000 7950 1500 1410 94 10500 10100 96 5OO 456 93 500 422 84 500 4.88 ~8 t000 1130 1 t3 10000 10600 106 amt ey or i i yeor v Exygen Research Exygen Research PPaaggee4444o0fl11155, 22009955..00222299 33MMAA0011555522000066 Itntr~-iigma RReeppoorrtt #22--AWAsaaatalelyryssSiisaoomfpfClCeaostgtaegeGGrroovvee aanndd WWooaoddibuurryy ~~ eygen Exygrn Sy Study No: No.: POBOI400 P0001400 Water Samples - TTaabbllee IIVV.. SSuurrrrooggaattee SSppiikkee RRCeeoccnootvvieenrruyyeoodff 1'3CCPPFFOOAAiinn WWaatteerr SSaammpplleess Contiaued e-- e eng -- = -- ead s"aocmomeosna aco eeID eee Descdp/Jon ,, 11,, , ee (nQg/ML) (r9igM/L) O(%Y) ccSCcc--mfSrcScoa_oSTSSmniCDSarSoomamaomomoearoraRirvnromsnrneamnnznEnoetxnynnreetscnne me R Oo p o Rn WpVn GwIpGTWehHHriaaRmn eaneraoannnniioosp ra ioCoo aoAnnoio nnos hrnwaueIanaasaAsn5rrmro0osrorop o00Ceeo0rss0eoo Iosseen osoitssoR0-som, cspe0oSEsssesgo ee ro o8sdaee 550n 0t Re aW o = e -W m-mww2w w aF "5eooowoomw wW w o w S lmtemW tomww8&8aT w eees:] n1W8==oooO3oo3wuwwwww - C00678'/'2 SI~ E C00ET872 Spk F C(X~rt~/2 C0067872 Rep C0067873 G~7875 C~6"r874 WBMN.GW-R-1-O-050405 WBMN-GW-R-I-O-0~0(~5 W BMN,GW-R.- 1-C-05040~ W BMN-GW-R- 1-.(~059405 WBI~I-GW-R-1- DP,050405 W~BM~-R-I-L,5-05040~ ~ ,~gik~ 1 p~ W E)MH-GW-R-t -H S-050405 High Sp~e 10 ppb 1500 I500 '~00 10500 10,~00 ~00 500 ~.75 75 50~ 401 80 500 450 g0 1000 1070 10Y 100(X) 11300 113 comer C0067882 C0067880 C0067881 esos an 0005 WBMN-GW-FWd-Blank-05040,5 WBMN.GW.-F'mld.51ank-LS-050405 Low Spike 1 ppt> WBMN.GW.Fildd-Bla~k-HS,050405 High Spik~ 10 I~ wo500 t000 10000 ww 547 109 1160 116 11300 113 Standard Devlatl~: 18 - ExEyxyggeennRReesseeaarrcohh 22009955..00223300 PPagaea4S5gooff1el1l55 33MMAA0011555522000077 IInnteerismRReeppomrt't##22--AAWnaantlaeylyrssiSissaomofpflCCeoostttaaggseGGrroovver ianndd WWooooddbbuur~y Water Samples ExygenSty NosPOO1400. E~ygerl Study No.: P0001400 ~ FIGURES v v EEnxyggeenn RReesseeaarrcchh 22009955..00223311 PPaaggee 4466ooff 111155 33MMAA0011555522000088 -_-- IInntteerriimm RReeppoorrtt ##22--AWAnntaaelyyrssiiSssaomopffloCetos a~ggre Grove Grow end and Woodbury Woodbury Wamr Samples EExxyyggeenn SSttuuddyy NNoo..: POOOIAOD P0001400 w FFiigguurree11.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFOOAA iinn RReeaaggeenntt W Waatteerr gu il v = v EExxyyggeenn RRee,sweaatcchh 22009955..00223322 PPaaggee 4T7oorf 115 115 33MMAA0011555522000099 ternReport Interim Kcport #22--AWAarntaaellryysiSisasmoopfflCCeosorttaaggeeGGrroovvee odWoodbury and Woodbury | ExSyyNgo: PeO0O1n400 Exygen Study No.: P0001400 Water Samples w FFiigguurree22,. EaExnxtdtrr5aa0ccttneegdd/SLS,ttaaRnneddsaparercddtssioovfeflPPyFOOAA iinn RReeaaggeenntt WWaatteerr,,2255 nngg//LL and 50 ng/L, Respectively RE SR nt I 3 - ml mano PR ee WER ---- un SL ge, Boum. v - onsen1. -- v ExEy~TggeennRReesseearrcchh 22009955..00223333 Pagedof 115 Page ~8 of 115 33MMAA0011555522001100 s-- r ------------------------ InIntet~riimmRReeppoorrtt ##22--AAnnalaylyssiissooffCCotot~ataggeeGGrroovvee aanndd W Wooooddbbumr-yy WWaate~r Sammppll(e~ss `FE.x,yxgygeennSSttuuddyyNNoo..::PPOO000011440000 vw FFiigguurree33.. PPFFOOAA iinn RReeaaggeenntt WWataeterr,, 5500 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt W Waatteerr,, and 500 ng/L Fortified Reagent Water, Respectively and 500 ng/L Forlified Reagent Water, Respectively OU -- 3 += an os w > = = 2 ee i. mn---- 3 flee = = seve Nm ---- 5 v He f~tt, ~m v Exypen Research Exygen Reseerch 22009955..00223344 PPaaggee 4901115 49 of 115 33MMAA0011555522001111 IInntteerrimnRReeppoorrtt #22--AWAnaantleayrlsyiS~seorofpfClCeoositataggeeGGrroovveesan~ddWWooododobuurryy ~~ExygenSadlyNos POOOLADD Exyg~a Stay No.: P9001400 Wate~ Samples ~ FFiigguurreed4.. ACnChahrlroyomzmeaadttoofggorrraaPmmRRROeAepp,rreDessFee=nnt1tii0nngg(EaaxWW yogoeoonddbIbDuu:rrCyyOW W0a6a7tt8ee6rr0SS,aaDmmapptlalee SAent:al0y4z1ed10fo5rARP)FOA, DF=I0 (Exygen ID: C0067860, Data Set: 041105AR) RRR v = | PN Time. v Exygen Resarch 22009955..00223355 PPaaggee 5S000 115 of 115 33MMAA0011555522001122 pi -w Lt~teerrimmRReCpleXr:~##22-AA`nWnaaatlelyyrssiSissuoaofpflCCeosota~geGOr~o'ovvea~ndd WWooooddbbuurryy Water Samples ExygxcnSStRyutddyyNNgoo.::PPeI0O0O0L1n440000 FFiigguurreeS.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrv~ee ffoorr 13CC PPFFOOAA iinn RReeaaggeenntt WWaatteerr i v hr v EExxyyggee~n Reseach Research 22009955..00223366 PPaaggee S51Looffl1l155 33MMAA0011555522001133 ItnrteirimmRReeppoorrtt##22--WAAnenaatllyryssiSissamoofpfCloeotsttlaaggee GGrroovveeaannddWWooooddbbuurryy Wat~ Sampl~. EExxyyggeenn SSttuddyy NNoo:.: PP0I0O0OL1A4O000 wv FFiigguurree 66.. EEngxx/tLtrr.aaaccntteeddd5SS0ttnaagnn/ddLaa,rrRddesssoopfefc~CtCivPPelFFyOOAA iinn RReeaaggeenntt WWataeterr,, 2255 ng/L and 50 ng/L, Respectively ETT ETTy eS e iz Bm reem ee so i v ~ v Exygen Research 22009955..00223377 Page s201115 Page 52 of 115 I3MMAA0011555522001144 Vier Sempies IInntteerriimmRRepepoorrtt##22--AAnsnlaylysisissoof~CCototttaaggeeGGrroovveeaanndd WWooooddbbuurryy Water Samples `Exxyyggeenn SSttuuddyy NNoo..:: 0P0000011440000 FFiigguurree 77.. "C 13C PPFFOOAA iinn RReeaaggeenntt WWaatteer,r55,00 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt w W Waatteerr SSppkAAk,, aanndd 550000 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt WWaatteerr SSppkk BB,, RReessppeeccttiivveellyy [LT ---------- |ihJ eat VToArsThaWToEp AesReGcm mmm Eon fd Bl TET ----" v EExxyyggeen RReessecaa~chh 22009955..00223388 Page s3of115 Page 53 ofl]5 33MMAA0011555522001155 WaterSamples InItne~r.immRRepepoorrtt##22-A-n,~al]yyssiissooffCCototttaaggeeGGrroovvee a~ndd WWooooddbbuurryy Water Samples E Exys~x mSStty uuddyyNNg oo..::Pe O001n 400. FFiigguurree8.. CChhrroemmaattooggrraamm RReepprreesseennttiinngg aa W Wooooddbbuurryy WWaatteerr SSaammppllee w A0An4na1al1ly0yz5zee4dd) ffoorr 13CC PPFFOOAA ((EExxyyggeenn IIDD:: CC00006677886600,, DDaattaa SSeett:: 041105A) WTR ET | EExxyygge~nnRReseseeaarrcvhh 22009955..00223399 PPaag~g55e44 ooff I11155. 33MMAA0011555522001166 IInnttenr~imm RReeppoorr~t##22--AA`nWnaaaltlyyessSissaoorffpCCeoosttttaaggeeGGrroovveeaannddWWooodobdubr~yy~~EEx~yggeennSSttuuddyy NNoos.:PPOO000011440000 Water Samples ~ FFiigguurree99.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFBBSS iinn RReeaaggeenntt WWaatteerr to m v wl pd w EExxyyggeenn RRe~sseeaarmchh 22009955..00224400 PPaaggee5s5 ooff 111155 33MMAA0011555522001177 InIntteerrimRReeppoorrtt #22:-AAWnneaa|elyyrssiiSssouofpfCeCoostttaag~GGrroovvoem~ondd WWooooddbburryy ~~ ExygenSSttuydyNNoo,s: PP0U0O0O1L4A0000 Water Samples FFil~gnurree 1100.. EExxttrraacctteedd SSttaannddaarrddssooffPPFlBUSSiinnRReeaaggeenntt W Waatteerr,, 2255 nngs//LL. W w aanndd 5500 nrigg//LL,, RReessppeeccttiivveellyy BTR oo } pms i| w See pan SF Romente | IT v EEnxyggeenn RReesseaarrschh 22009955..00224411 PPaaggee 5S66ooff 115 115 33MMAA0011555522001188 _ vw v I nterimReport Intmm Report ##22--AAWnanstalelyrysdSssuoolffeCCsootttaageGGrorovvee and Woodbury and Woodbury Water Samples Exygen SyNo:PO0O1400 F,xyge~ Study No.: P0001400 FFiigguurree 1111.. PPFFBBSSiinn RReeaaggeenntt WWataeterr,,5500 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt WWaateterr,, aanndd 550000 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt WWataeterr,, RReessppeeccttiivveellyy 1 -------------- F5 ATT i. oe 5 Femawall Tor amN90 nz Pu WTR ---- i TeMe tnee Wmmmm-- vg i SE Ae w ExpsenResearch Exygen Research 22009955..00224422 PageSTof115 Page 57 of 115 33MMAA0011555522001199 IInntteerrinm RReeppoorrtt ##22-AW-antAaelysrsSissaolomfpfyClCeosost~iataggsee GGrroovvee aanndd WWooooddbbuurryy Wa~er Sample~ EExxyyggeenn SSlt~ddyy NNoo:.: PPO00O0O1L4A0000 FFiigguurree 1122.. CChhrroommaattooggrraamm RReepprreesseennttiinngg aa W Wooooddbbuurryy W Waatteerr SSaammppllee w SAAennta:all0yy4zz1ee1dd0ff5ooArrRPP)FFBBSS,, DDFF=--1100 ((EExxyyggeenn IIDD:: CC0000667788660e,, DDaattaa | Set: 041105AR) | WERE iz3 -f | vw y | v EExxyyggeenn RReesseeaarrcchh 22009955..00224433 | PPaaggee 5SB8 ooff l11155 33MMAA0011555522002200 Inerin Interim Repon Report ##22--A`AWsnasatlleyyrssSiisaomofpfClCeoostttsaggeeGGrroovveesa~dd Woodbry Woodbury ~~Exygen StudyNo:20001400 Exygen Study No.: P0001400 Wa~er Samples v FFiigguurree 1133,.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFHESS iinn RReeaaggeenntt WWaatteerr i wv al v E`Exxyyggeenn RReesseeaarrcchh 22009955..00224444 PPaaggee 55990off 111! 55 33MMAA0011555522002211 Intern Int~-im Reger Rq~or~ ##2.2.WAan-tmelrAysSisneoomffpaCCeoosltttaagygee sGrorovsvee sad and Woodbury Woodbu~ Wa~'r Samples SxytudNyo: FOO1400 Exygen Study No.: P0001400 FFiiggaurree 1144.. EExxttrraacctteedd SStatnadanrddsoaoffrPPFFdHHsSSiinnRReeaaggeenntt W Waatteerr,, 2255 nngg//LL - aanndd 5~0 nngg//LL,, RReessppeeccttiivveellyy WRT gs = | Bm -- T~ s v - . i v Exypen Reser 22009955..00224455 Page 60 15 P~g~ 60 of 115 33MMAA0011555522002222 ItnrteirimmRRepepoorrtt ##22--AAWnanataleylyrssiSissiooffeCCsooattaggeeGGrorovveeaannddWWooooddburryy~~EExxyysgecnn Sy StudyNNoo.:: PP0O0G0O1I440000 Water Samples FFiigguurree 1155.. PPFFHHSS iinn RReeaaggeenntt WWataeterr,, 5S00 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt W Wataeterr,, - aanndd 550000 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt WWataeterr,, RReessppeeccttiivveellyy [YE ---- ul Ae en 8Ld VERE ---- 3f= LJ i 1 '2 3 ~ 7 6 G 10 v ExygenReseach Exygva Research 22009955..00224466 PPaaggee 6611 ooffl11155 33MMAA0011555522002233 --_--_-- ImtceriinmRle~ppoorrtt##22--AWAnamatdleyyrssiSissaomopfflCCeoostttaaggeeGGrroovvee and and Woodbury Woodbu~ Exygen StdyNo: POOOLAOD Exygen Study No.: PO001400 Water Samples FFiigguurree 1166.. CChhrroommaattooggrraamm RReepprreesseennttiinngg a a W Wooooddbbuurryy WWaatteerr Sample Sample - AAnanlaylyzzeeddffoorr PPFFHIISS,, DDFF=-110000 ((EExxyyggeenn IIDD:: CC00006677886600,, DDaattaa SSeett:: 004411110055AARR)) BT RT R = {i = w - vv EExxyyggeennRReesseeaarrcchh 22009955..00224477 PPaaggee 66220o1f11515 33MMAA0011555522002244 netae Interim Rl~r~ #2-Analysis of Cor~a~ Grope ~d Woodbury `WWataet~rSSa~mmplpels~ rer Exygen Study No.: P0001400 v FFiigguurree 1177.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFOOSS iinn RReeaaggeenntt WWaatteerr i v he options w Exygen Res~rch 22009955..00224488 -- Page 63 of 115 33MMAA0011555522002255 InternReport Interim Report ##22.-AaAnnalarlyyssiSisseoofmfCeCtnosttaggeGGrroovvee sad aud Woodbury Woodbury Water Samples Exygen Sty No: POOLAOD Exygez'z Study ]q'o.: PO001400 FFiigguurree 1188.. EExxttrraacctteedd SSttaannddaarrddssooff PPFFOOSS iinn RReeaaggeenntt WWataeterr,, 2255 nngg//LL wv aanndd 5500 nngg//LL,, RReessppeeccttiivveellyy TET w-------- i i x- " NET -- .= v a a 4 oe v BogaReseach Exygen Research 22009955..00224499 PageSh 115 Pa~64ofl15 33MMAA0011555522002266 Figure 19. PROS in Reagent Water, 50 ng/L Fortified Reagent Water, rimRReeppoorrtt #~22--AAnnaallyyssiissooffCCoottataggeeGGrroovveeaannddWWooooddbbuurryy EExxyygge~nnSSdtuydyNNoo..:PPO0G0O0L1440000 | `WWaatteerr SSaammpplleess Figure 19. PFOS in Reagent Water, 50 ng/L Fortified Reagent Water, wv aanndd 550000 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt WWataeterr,, RReessppeeccttiivveellyy oh BET RSa R ------ , || {l.os en mse wh"it Roe k- Hanks | BER--R | [3 1o7 we 1 "J a mssame | 5 of v I; = T | " | v ExeReseach Exygen Re.arch 22009955..00225500 | | | Page 6Srls | Page 55 of 115 || 33MMAA0011555522002277 ItnrteirimsRReeppoorrtt ##22--AWAasntsaellryyssSissaomofpfiCcosortataggee GGrroovveesannddWWooooddbbuurryy Water Samples EExygxenSSttyuadyyNNgoo:.: PPeO000O01n1440000 FFiigguurree2200.. CChhrroommaattooggrraamm RReepprreesseennttiinngg aa WWooooddbbuurryy W Waatteerr SSaammppllee v AAnnaallyyzzeedd ffoorr PPFFOOSS,, DDFF==1100 ((EExxyyggeenn IIDD:: CC00006677886600,, DDaattaa SSeett:: 00441111005SAARR)) BI RI TTR 3 =) v 3 | e Tim*, 10 I1 t2 13 t4 1~ 10 17 v ExyeenResearch 22009955..00225511 PPaaggee 66660o1f111155 33MMAA0011555522002288 ----+ ---- IINNTTEgRRIIMMRIE~EPPOORRTT ~ 4 --AAnnaablyyssiss ooffCCototttaaggeeGGrroovveeSSoolillaannddWWataeterrSams SSTTUUDDYYTTIITTLLEE AnaoflPeryivorsoociianscic Acid (PFO), Perlurobitamesufonte(PFS), Aaalysis ofPerfluorooctanoic Acid (PFOA), Perfluorobut~esulfonate P Perfeluorrohfexainesv ulfoonatre((PPoFFHHShS)),,e aannddxPPeerarfflluunoorrooe oocctts aanneesu suullffloonnsaftlee((oPPFFOOnSS))a iinnWt Wataee terr,, SSooiLlI,, Sedimen,Fish, and ClamsUsingLC/PMrSo/gMraSmforthe 3M CotageGroveMonitoring Sediment, Fish, aad Clams Using LC/MS/MS for the 3M Co~t~e Grove Monitoring EPATSCAGooDdRDALAEaTbToQAAraURtoIEryRPQrEa~cMtMicE~eSNNtaTTndS$ards40CFR792 EPA TSCA Good Laboratory Practice Standards 40 CFR 792 JSuTSsTUUtDDaYKYeDsDIaIrRREEPCCE'TT,OODRREE Ja~W`Wsie1emss4tth0ooa0nnKWSSeoos~lletuu'ttsiiiooPnnW.ssE,,a-,oIynDce.E. E W WePhs~1ottn4eCC0:h0heWes1ste0tese.rtr,7,o0PPn1AAW3171a996y3318g00 Phone: 6| 0-701-3761 ICIN]I~EEORRIIM MMRREEPPDPeOOcReRLmTTbeCrEO1M,2TP0L05EITIONODDAANTTEE Decembe~ 1., 2005 PPEERRFFOORREMMxyIIgNNeGnGLRLeAAsBeBaOOrcRRhAATTOORRYY 3088 Reseach Drive Exygen Research 3058 Resear~]: Drive Phone: 142721039 StSa~tts~CColollleeggee,, PPAA 1166880011 Phone: g 14-272- I039 SSTTUUDDYYSSPPO ON NSSOORR 3M Company 3M Compmqy 33MMBuBiulidldiinngg00223366--0011--BB--1100 SC Paul, MN 55144 St. Paul, MN 55144 Phone: 6517336374 i Phone: 651-733-6374 PROJECT |i PROJECT Protocol Number POOO1400 | P~otocol Numbe~. P0001400 E`ExxyyggeennSSttu~dlyyNNuummbebrer:: PPO0000011440000 ! "TTootatallPPaaggeess:: 117777 | |{ 22009955..00225522 33MMAA0011555522002299 tfiroRene 4 yiofCoeGroveSlod [-- GOOIDDLL.ABORA,.TORY PRACTICE COM~,LIANCE SSTTAATTEE!MENT Exygen Std NumberF0001400,cil "Asay of Pesiaorocianc Ac (PFOR), Exygen Study Number P00014~0, entitled "Analy~i~ of Perftuoroo~tanoic Acid (PFOA), PPeerrfflluuoomrobb~ut.aannccssuullffoonnaattee (P(PFFBBSS)),, PPeevrfflluuoorroolb~exxaamne~suullffoonraatt~e (P(PFFHHSS)),, aanndd Pelor(sPFOSo)iacWatemr, Soel, Snodmeint,fFish,oandnClsa Useing Perfluorooctanemlfonate (PFOS) in Wam~, Soft, Sediment, Fish, and C~_~'~ U~tng LOMNS fo to 3 CotasGrove Mining Program condosd for3M LC/MS/MS for the 3M Cottage Grove Monitoring Program," conducted R~r 3M Compacy isbiogprom i compl wihEFATSCA GoodLasrsryPcie Company. i~ bein8 ~ed i~ compliane~ with EPA TSCA Good Laboratory Practice `SSttaannddaarrddss4400CCFFRR779922bbyyEExxyyggeennRReseesaearrcchh.. i onFiM ery Boge Reeaeh heu x 5.sOEE `SSttuuddyyDiDrierc~ttoorr WestonSoins, we~ton Solu~ons, Inc. Sea Rober A. Pati `SSppoonnssoorrRReeppreresseennttaattiivvee SHCompany 3M ~ny tl eR Exyge~ Resem'h Baelbs hs B1ue2]z[0S |} ota | Page2 o/" 177 22009955..00225533 33MMAAD011555522003300 ------ WoivSisaRepoprt 4A ofCogs GroveSoiad Iat~ R~ort #4 - Analysis ofCo~ Grov= Soil and Water Samples ESvyNa o FO0n 1400 QQUUAALLIITTYYAASSSSUURRAANNCCEESSTTAATTEEIVMIEENNTT Exygen Resarct'sQuality Assruace it reviewedExygen Stdy Number POOOL4D0, Exygen Res~arch's Quality Assurance Unit mvi~wod Exyg~n Study Number PO001400, `eennttiittlleedd,, ""AnaAlysn isoa offPPel erzffly luuoormsoooccti ~aannos oiicc AAcciidd (~PFFOOAA)), PPeerrfflulourobruombnuestualnfoensautlef((PoPFnFBaBStS)e~, PPeerrfflluuoorroohheexx~ann~essuullffoonnaalt~e ((PPFFHHSS)),, aanndd PPe~r'fflluuoorrooocotcamnac~suullffoonnaat~e (PFOS) in Waattetr, Soil, Sedna, ih, 0dClaus UsingLOMSMSfrtoe 3M CotiageGroveMotoring Scd.im~t, Fish, and Clm~s Using LC/MS/MS for the 3M CoRage Grove Monitor~g Program". Al reviewedphases' wereinpecedfor concut scoring (0 Exygen Progr~n". All reviewed ptmses~ were inspected for conduct according to Ex'ygen Rescarch'sStandardOperatingFroodure,LeSadly Protocol, ad all sppbicableGood R~h's Standm~ Operating Pmc~ums, th~ Study Protocol, and all applicabhr Good Laborstory Practice Sunirts. All ndings were reported fo he Expge Principal Laboratory Practice Standards. All findings w~r~ mport~l to ~h Exyg~n Principal InIvnevessttiiggaattoorraannddMMaannaaggeemmeennttaannddttootthhee SSttuuddyyDDiirreeccttoorr.. Ba 10 RevDuoReies IL RawDmRed II. R~w I~m R~,,'iew 10`2. uFFinneallIlnAimrymimReReasew D~m and Anal~l RRe~ppoorrt~ RRev~ieww DueDa~ lowed T~ctcd Ra 11/02-07,'05 10S 11/08/05 1005 11/09/05 DaDt~eRRepaoprotre~dttoo DDaat=eRRepo~rtIedftoo hd | Bogs | Primipal Exys~n lec Musser Inve~eator Muumement ARGS ows ! l/Og!05 11/09/05 10S 1090s 11/Og/05 11/09105 ONS 10905 11109/05 11/09/05 SDD~iumdeRRDqgxio~vmneder~do Stu~ Director wows teens 11109103 10a9es ! 1/09/05 Te Lead,Quality. Unit Bue[2]o1for~ "N~oNtote:: AAlllliinnl-laabbinisnpsepcotaiioonms wwilitll bbe~dodoccuummenentteedd iinntthhee QQAAstsatatteemme,nnttffoorrtthhee final aalyicl report a1 thecomcuion of tesy. This QA staivoclvens nly t i analytical report at the comlusion of the study. This QA statemem involves only the Teviow of te tei por nd ascii aw a. review of the interim mlx~rt and associated raw dam. -- Exygen Research 22009955..00225544 ---- Pag~ 3 of 177 ii i 33MMAA0011555522003311 e--r----------------------------------------rer? JSIanlrs~oiSm RRueepppoort $4 #4 - AAnnaltysiisooff Cage Cottage GroveSi Grove Soft 0and Water Samples Eoyem StyNo: oo140 CCEERTRIFICTAITIOFN OIOFFCAAUUATTHIT:EI~NNITTIIOCCIITNTYY TeThhiispsiinrterreimnrroeofptrobre,ti,rfefooordBanErsxyygennSSttuuddyyNNummbbee~r PPO0G0O01I#4~R00, is is 3 a true and true and complete complete reprmenm~on of the raw dam Submitedby, Submirmd by:. SEx33Bt0y0'x0e5gy88geCcRRnnoeReseals.aerrlca,hrDPecDArhgri1ivv6e~e80,1 State College, PA 16801 ((8S1I44)) 227722-- 1t003399 `PPrriin~cippaallIInnvvesetsitiggaattoorr,, BExxyygge~n:: ViceFrieesriyn le ErVyicpeePnrReseidsenet r ~ R~h Bae fhe Date `EExxyyggeennRReseesaearrcchhFFaaccililiittyy MMaannaaggeemmeenntt:: dReematn.a Erg Research President Exysen Research SSttuaddyy Diss, Direc/~ W Weessttoonn Stations, Solutions, Inc. I/V Wesh tonSota s, ne. W~n Solu~o~, ~ . B--ae22-05 Ss | `SSppoonnssoorrRReepprreesseennttaattiivvee,,33MM CCoommppaannyy::. i Raba2tA5p,re: 2 B1u2elzjos |i| MRaonbaergteA,. 5P4~oChokeportEnvionmena rogums Date | Manager, 3M Corporate E~vimnmcnml Programs i ErynRess Exygm Researoh Pagebor177 || Pag~ 4~f177 i 22009955..00225555 33MMAA0011555522003322 _--_------ WTaeterrnSuReppolrss #4. AnalysisofCotgeGrove of 20d Inte~h~ Report #~..e~.a~ysis ofCot/affe Grove Soft and Wa~r Samples Exim Sud No. PotaLic0 Exygen S~y No.: PO001~O SSTTUUDDYY,IIDDEENNTTIIFFIICCAATTIIOONN Program AAnnaallyyssiissooffPPe~r-fflluuoorroooeccttaannooiicc AAcciidd ((PPFFOOAA)),, PPe~ruflouroorboubutatnaneessuutlffoonnaatte ((PPFFBSS)),, PeP`r~Sf,elflduuioomrreoonbhtee,xxFaainrssmhs,usula]fnfodonCnalattaee(m(PPsFUFHsHSiS)n),g, LaannCddMPPSe~r/rffMlluuSoorrfooooorccttthaanneeess3uuMllCffooonntaattteeag~(ePPGFFrOOoSS)v)eiinnMoW Wnaitateteorrr,,iSSnoogii.ll,, Sediment~ Fi~., and Clara~ U~ing LC/M$/MS for the 3M Cotlag~ Caeve Monitoring PROTOCOLNUMBER: PROTOCOL NUMBER: EXYGENSTUDY NUMBER: EXYGEN STUDY NUMBER: TYPEOFSTUDY: TYPE OF STUDY: SAMPLE MATRIX: TTEESSTT SSUUBBSSTTAANNCCEE:: `SSPPOONNSSOORR:: SSTTUUDDYY DDIIRREECCTTOORR:: Pocoric0 P(}O01400 PPO0O0O3I1440000 Residue Residue Soil nd Water Soil and Water PPeercfituuoororooccttanaoiice aacciidd ((PPFFOOAA))., PePPPPreeeelrrrsfflclllouulurooouorrroccoobhtbruueatxctnaaaehnnnseeeesslsxuufulfaolfffonoconnaneaatattseteee(u((((PPlPPPFFFFFfEOBHEoSSSS))n)),),,s, atxnedd P~'llao~ccctan~sulfonate (PFOS) 333MMMBCCuooimmdpipananngyy0236.01-8-10 3SMt PBauuli,ldMinNg 03253164-401-B-10 S~. Paul, MN 55144 JWJaaeisssiimomnhhaaSoKKteeussiaeorrnisPP,E.EI,n.,.DDEEEE WW11e44e00ss00ttCoWWhneasSsstoetloorunn,tiWWoPanAasyy,1I9n3c8. 0 West Chester, PA 19380 SSTTUUDDYY MMOONNIITTOORR:: Ro3RbMoebCrinotmAAp..aPPnaayssc~hhkkee i 333SMCMMPBBCauuuoililm,lddipMinangNngy445225.-1004224.-E5.-2277 St. Paul, MN 55144 mae mat gy | PPEERRFFOORRMMIINNGG LLAABBOORRAATTOORRYY:: ~ E3li0x3c5yy8ggeeRnnesRReeesaseecaahrrccDhhrive ii SS3tt0aa5tt8~e RCCleo.llsleeeagewe,,,hPPDAAri11v66e880011 i ANALYTICAL PHASE Stay Initiation Date: 03/03105 TIMETABLE: Interim AnalyticalSuntDate: BOBS | TIME~ABLE: Interim Analytical Start D~te: 08/08105 Interim Ansytcal Temiaton Dat: 1001/05 Interim Analytical Termination Date: 10/01/05 IInntteerriimm RRe~potrt CCoommplpelettiioonaDIa)xtte~:: 1122//01/05 | ErypenResamh i PPaagg~e S5 aorf117777 i 22009955..00225566 33MMAA0011555522003333 _--_--m-- IWnitSreoRlepeorst#4 -AualysisofCoteGroveSiland ExyenSudyNo: FODIADD PPRROOJJEECCTTPPEERRSSOONNNNiE~LL Tfoh~ leloSwtSitunudgdyypDeDirirsreoecacttnooerrlfffororormthElidxspyprgomej~necRtteisisesarlJcaihisswimmelrmeKKeamsss~aorcdiaaatttedWWweeissttthoovnnaSrSoiololuuutstipiohonams,,seoIsnco~..f tTThhhie~s intr potofith ostundy: following personnel from F.,xyge~ intm'irn portion of~ study: Rese.zrch were associated with vm'ious phases of this Name JonFsbery Kare Risa Chrissy Edwards MakAmmen AmyShocban SrcBavarts MindyCresiey BritanyKrave TTiittlee ViVciceePPreressiiddeenntt LaLbaobroarattoorryy SSauptze:rrvviissoere TTezcchhinciziiaann SSaammppeleCCuus~tooddii~ann AAssssoocoiiasteeScSizenit~isstt `SampleCustodizn Sample Custodian Tectmician Technician Teetmician Technician `BExxyygg~emn RRemsemarrrchh 22009955..00225577 | i PaPagger 66o0f1t7777 i 33MMAA0011555522003344 eee ItWnatmit-eLemSRaReppeipoeorrntts#d.4 --AAnnaalyysaisooffCCootttaggeGGrroovveeSSooiillsaondd W~ ~pl~ EExryygg.eenSSttuddyNNoo.:: FP0O000L1A4O000D `TOAFCBONTLENETS TA]~.E OF CONTENTS TITLE PAGE cose]Page TITLE PAG ..................................................................................................................... GOODLABORATORY FRACTICE COMPLIANCESTATEMENT orcorroerenr 2 GOOD LABORATORY PRACTICE COerCE STA~ ..............................2 `QUALITY ASSURANCE STATEMENT... ce. sononsd QU~ ~S~CE STA~ .......................................................................... ~R~CA~ON OF A~C~ ...........................................................................4 ~Y ~~CA~ON................................................................................................5 PRO~ PE~~ ......................................... ~ ........................................................ 6 BT -- T~ OF CO~ ....................................................................................................7 LUISSTTOORFFTIGAUBRLEESS.... ooooomeosmosesoIeoeIseIeoTee 3 ~T OF H~S..............................................................................................................9 LIST OF APPENDICES... ooooenrmesmsonronoreoeoeosoeees 11 ~T OF ~P~IC~ .................................................................................................... I 1 1.0 S~Y .............................................................................................................. 3.0 INTRODUCTION,...osmeonreemoeecoereeeesooeemoen 13 ~.0 ~ODU~ON....................................................................................................... 40 ANALYTETSTISACMPALELS. ..eoomnsoomseoersneeeeeoeoo 13 4.0 ~~ ~ST S~.............................................................................. S.0 ~CE ~~ ........................................................................................ 60 DESCOF ARNALIYTIPCALTMETIHODO. N overs 16 6.0 D~C~ON ~ ~~C~ ~OD ........................................................ 16 6.1Extraction ProcedueRoSi. rere sooo 10 6.I ~on ~~ ~r Soil ....................................................................~.............. I6 62PerntSolids rocedarsForSi ...-v-vovroseroenoreroeer 16 ~.2 P~ SoH~ ~~ For Soft ............................................................................ 63 EXacion Pdr or WaEr.......c.c.vvreoeomeeroeee 16 6.3 ~on P~ ~r W~................................................................................ 1 64 PrparationofStandardsa Fortification Soon... 17 6.4 ~on ofS~ ~ FoX.on ~lu~om............................................. 17 6.5 ~~hy ...................................................................................................... 1 6.6 ~~ ~~ ............................................................................................ 18 67Description of LOMSIMS InsraatandOperating Conditions...18 6.7 ~p~on ofL~S~S ~t ~ ~i~ Condi~o~ ...........................18 6QuanodtEXAmapletCUiCUo.n revere 19 6.8 ~on md ~ C~l~om...................................................................19 7.0 EXPERIMENTALDESIGN...cemeoosssosrones ores ce 21 7.0 ~~~ DESI~ ..................................................................................... TOBIRATooS cummmmmammemmsmenmrssemmmmmremernreererdd 8.0 ~S~ ..................................................................................................................22 ~.0 ~N~USIO~.......................................................................................................23 10.0 RETOEF DNATATANIDSAOMPLNES veo 23 | 10.0 ~ON OF DATA ~ S~ .............................................................23 ExypenResearch 22009955..00225588 PPagee 770o1f117777 | |{ i 33MMAA0011555522003355 ItfntierrinmoRResegpemtrt 4#4. AsifCoteGreSliod A~lysis ofCo~gc Grovc Soft xmSty NoPOOLA0 No.: P0001400 TableL Summaryof PDS,PLFIS,STPROOFSTA4BPLFEOSAinSoll Umpc.B.2a.5s TablvI. TubeIL Summary ofPBS, FHS,FFOStnd BOAinGround WateSpe. 33 TablvIL LIST OF TABLES Pa~ Summary ofPFBS, PFHS, PFOS and PFOA in Soil S~mplcs ......................25 Summary ofPFBS, PFHS, PFOS and PFOA in Ground Warn- Samples.......33 Tule IL. Summary of BBS, FHS,FFOSsad OAin Rie BlkSpc... 34 TabI~ I~. Summit ofPFB$, PFHS, PFOS and PFOA in ~ Blank Sm~pl~s..........34 Table IV. MatixSpike Recovery of PFSsnc EHS iSolSap.....--35 Tabl~ IV. Matrix Spike R~ovcry ofPlUS and PFHS in Soft Samples ........................ TableV. MatrixSpike Recovery of PECS 3d PFOAin Sil Spe... 5) Table V. Matrix Spike Recovm'y ofPFOS and PFOA in Soil Samples ........................ TableVL MaiSpikeRecovey of PBSsnd PFHSinGrdWeer Sape..71 Table VL Matrix Spike Recovary ofPFBS ~md PFHS in Grotmd Wate~ Samples.........71 TableVIL Mix Spike Recoveryof PFOS nd PFOAinGround WaterSample...TS Tnbl VII. Matrix Sps~ Recovery ofPFOS md PFOA in Ground Water SmnpJes........73 TableVIL SupeSpike Recovery of "CPFOA[3Sil SEB ....75 T~ble VIH. Sttrrog~t~ Spike l~ecovery of ~C PI~OA in Soil Sm~pleg .............................. TleX. Surogse SpikeRecoveryof PFOAIn Grow Wit Semples..53 Tabl IX, TableX. SurgesSpkeRecoveryof C PFOAinRint Blk Seles... TableX. ~urroga~e Spike R~ov~ry of IsC PFOA in Ground W~t~r Sampl~ ..............93 Surrogate Spike Recovery of ~C PFOA in _Rinse Blank S~[es .................95 TableXL Total PeSolisds ortSil SHE rere6 T~bl~ X~ Total P~rr~t Solids for Soil Samples ............................................................96 ExEyxpygeen~RReesseaercrh 22009955..00225590 | PuseBof177 Pa~8of177 || | 33MMAA0011555522003366 J I _ II I . I ~ LIJ .. I LI ~Jlll I I III ~1! I I I I I IInn~tiemrRr Reeppotrt ##44 --AAAnnailalyysssiissoooffCCoootttataggeeGGrroovvee SSiolil ada~d Water Samples Exypen F.xygen SStytSutdyy NNao:.: Po0a1a00 L LISTI OOFFFFS IIGGUUT RREESS Figure 1. Typical CaliCburrveafotr PiFOoAiniREAgEat Wer... Rage 105 Figur2e. Figm~ l. Figure2. E2TEx0ytx0pr-iat5crc0aatl0eetQCd~LaSS,luitbnaRrdaaEadtSnimoPcnEe~TCooNfufPCrPvlFFeYOO.fAoA.ri.PinenFRROeeaAaggeheannRtt eWWaagateteemnr,t,eW2265rantnegegr//.L.L.......................n..e..c...l10065 Figure3, PaaFdO5A0inngR/eLa,gPe,net~CeoOntivreolly,.5..0...n..g../..L...F.....o.....r....R.t.e..a..ig..e..rf..t..S.i.p..i..ek..e..A.d..,..................... 106 Figure 3. 2aP~0FddO55A0000in0nR$g/e.LagFFeronrrtitifCfiioeedndtRRroeelaa,gg5ee0nntntgSStppLiikkFeeoBBrt,i,fRRieEedsSpRPeecEatgiCveEemllySy..p..i.k.............o..v...r...r..e...c...r.. 110077 FFiigguurreed~.. (CCoEhrrXoommEaRattooLggD:rraaCmmOORRFee1pp3rr5ees5se,ennDttaiinntggaSaaeSSto:oiil0lS8Sa2amm3p0pl5leeC)AAnnraallyyzrzeeddrffoorr FPFFOOAA 108 Figures. C(EhrxoymgaeinoIgDr:aCmR0e0p5r1e3s5e5n,tDinagtaaSGert:o0u8n2d3W0a5tCe)r.S..a..m...p..l..e...A..n..a..l..y..z..e..d.................. 108 Figure 5. forPFOA(BygenID:CO081228,DataSe:091305A) co.cc. Chromatogram Representing a Ground Watzr Sample Analyzed for PFOA (Exygen ID: C0081228, Dma Set: 091305A) ............................. 109 109 FFiigguurree6., TTypyi~cia~lCCaalhib~raaftiioonnCCuurrvveffoorrl3CCPPFFOOAAiinnRReeagaeg~W WeAanLteEtr .....c.....c......c.......1. I1100 FFiigguurer77e.. E0Ex0tx50rtra/accttLeeddS,SttaanRmdEiaarSrddPs~oEofTfVt3ECC.PPFFOOAAir innRReeaaggemntt WWr aatteer,, 2255nngg//LL.r 11 Figure8. a"nCdP5F0OnAgi/Ln, RReea~geeenttivCoenlytr..o..l.,..5...0...g...L.....F..o.r..t..i.f..i.e..d..R..e..a..g..e..n..t..S..p..i..k..e..A...,..............111 Figttre g.. aa~ZnnCdd P55F00O00nnAgg/i/nLLFRForeotatitgfiteiienedtdCRRoeenaatggreoealn.tt5SS0ppinikkgee/LBB,F, oRR~Eei~fSieeDcdEtiRvCeeHalyTge.O.n.N.t..S...p...i..k..e.r..Ae...,r....v...e....c.11122. FFiigguurree9.. CC(hBrhxoyrmgoae~tnoMIgDr;oaC~mOR0Re8pe1rp3erSse5esn,etnDitainntggaaScSStoo:iil0lSS8eimm2p3pll0eeA5ACnna)lyaczerdlmffoonyrre13zCmCnPPeFmFOOmdAAn.cne 13 Figure 10. C(hErxoymgaetnoIgDr:aCm0R0e8p1re3c5a5t, iDnagta8SG~rto: 0u5n2d3W0a5tCe)r..S..a..m..p..l..e..A..u..a..h..y..z..e...d................ 113 Figure IO. CffooIrrL~'roCCmPmPFFoOOgtAAam((EERxxyeypggreeensneIItDDtt:i:nCCgO0a008G81t1'o22~2m28_8d,,_DDWaatataateSSreeStt::am0099p11l3e30085AA).).......................c..o..c.......1[ 1144 FiFgigaurree 111I.. TTypyipcicaallCCalaihb'rbarattiioonnCCuurrvveeffoorr PPFFBBSSiianRReeaaggeenmtWIG... 115 Water................................ 115 FFiigguurree 1122.. E2xE0tx8rta5rca0tzeBtd~LSS,ttaanRnddaEarrddSss ooPffEPPFFCBBSS.iinnRRreamggeeennttWWartaeterr,r,2255nng/L eeel 16 FFiigguurree 1133,. BFBSin Reagent Control, 50 g/L. Fortified ReagentSpikeA. and 50 ngiL, Respectively........................................................................... 116 PFBS in Reagent Control, 50 ng/L Fortified Reagem Spike a0~d! 550000 ngg/L/L. FFoorrttiiffiieedd RReeaaggeenntt SSppikiekBBe,, RESDECHYEY rrr Respectively................................ 1117 FiFgiguurree1144.. C(ChErhxoryomgmsetanmoIggDr:raaCmmOROReSp~1rr3ee5ss5ee,nntDtiianntggaaaSeSStoo:ii0llS8Se2emm3p0pl5lee)AAncnaalelyyznzeeddffoorr PPFFBBSS 18 (Exygtm ID: C0081355, Data Set: 082305C) ............................................... 1 FFiigguurres 1155.. CfChohrrrPooFmmBaaStto(ogBgrxraymgReR enprIeD:s~ eCnt$ inOg aa0GGrro8Douiuntn1ddaSWW2acsa:ete2r9r1SS38aa0mmp3p,lAlee)AAnonaallyyrzzeeddc 19 | for PFBS (Exygen ID: C0081228, Dart Set: 09 I305A) ............................... 119 FFiigguurr~e 1166.. TTypyipcicaallCCalailibbrraattiioonnCCuurrvveeffoorr PPFFHHSS i~n RREeQaGgEeDnt WWAaLrEm" cece 120 ............................... 120 FiFgiguurree 1!77..ExEtxrmacmtteeddSStatannddaarrddssooffPFFFHHSSiinnRReeaaggeennttWWataeterr,,2255n~gg//LL i and 50 rig/L, Rezlm~Vely............................................................................ 121 FFiigguurree 1188.. 2PP0FF4HH5SS0i0inngRR/eeLaa.ggeFeonnrtttiCCfoionentdrtroRolel,,a5g50c0anntggS//pLLiFForoBtrti,iffiieeddRReeaaggeeamtSSppRiEikkSeePAOAC,,HVEL.vvrcree1e2e2c. |i and 500 ng/L Fortified Reagznt Spilm B, Respectively ................................ 122 ExypenReseach PPaaggee99ootf117777 { 22009955..00226600 I3MMAA0011555522008377 WeireeSaRmeplpets #4 -AnalysisofCotageGroveSoiland ExygenStudyNo. PO1400 Exyg~n Study No.: LIST OF FIGURES (continued) Figure Figur~ 19. 19. C(iCErhxoryomgnaeutntotoIgDgr:raaCmmORORe8pe1rp3er5es5se,enntDtiianntggaaSSeSotoi:li0lS8Sa2amm3p0pll5eeCAAn)anelalyyzzeerdffoarrm!P~EFHHSS er 123 Figure 20. Co0r~oxmYaSt~oIgDr:aCm0R0e8p1re3s5e5n,tDiantg~aSGert:ou08n2d30W5aCr) .S..a..m..p...l..e.A...n..a..l..y..z..e.,d.................. ]23 Figm~ 20. for PFS(ExygIeDn:CO081228,DataSE 091308)... 124 Chrematogram R~n~ating a Ground Wa~et Sample Analyz~ for PHtS (Exygen ID: C0081228, Data Se~: 09! 305A) ............................... 124 FiFgiugrue~ 2211.. TTyyppiiccaall CCaal~]lzztiionbCCururravwetff~oirrPPoFOOnSSiinnRRecA~ggEenntt WIE Water vce 125 ............................... 125 FiFgiugrue~2222.. EExxttrraaccteeddSSttaannddaarrddss ooffPPRFOOSSiinnRReeasggeennttWWatae~rer,,22552ngg//LL anndd. 50 n8/I., Respectively .................................................................................. 126 FFiigguurree2233.. 4PP0FRdOO5SS0i0innnRgRe/gaLug.tegFenonrtttCiCofniotenrdtRoroela,l,g$5e00nntngs//STLp.i. FFkoe~rBytr,itiffRiiEeeddSRPReOeaCagIgeVenEnttSSppiikkeerAA,, rr 2] Figure24. Cahnrdo5m0a0tonggr/LamFRoertpirfieecdaRteianggenaSt iSpliSkeamBp,lReeAsrpa~ltyivzeeldyf..o.r....P..F..O..S...................127 (Exy3e0 ID: COO8Da1taS3t:50825305,C) errr A2B Figur~ 24. Chroma0asrmm Represmting a Scril S~mple Analyzed for PFOS (Exygen ID: C0081355, Data S~t: 082305C) ............................................... 128 FF igiur~e2255.. fCCohrhrroPomFmaOtxSot(g~ErgxraymmgRe~en'ppIrreDms:emnCtOti0inn8gg12a2C6r,,o~DumantddaSWWtaa:ttee0rS9Sa1trm3o0pp5lh4eeA)Ananlalyyczzeeddrore29 for PFOS (Exygea ID: C0081228, Data Set: 091305A) ............................... 129 Ege Research 22009955..00226611 i PaPaggee1I000o1f117777 i 33MMAA0011555522003388 WneereSReempits4-Ansys of Cote GroveSod nd L,~r~m Report #4 - Analysis of'Cottage ~rove SoQ and Wa~r .SampZes Eye SyNo. Po01ct0 Exygen Su.~dy No.: PO001400 AAppppeennddiixx AA LALIISPSTTPOOFEF ANPDPEINCDIECESS Page SSttuuddyy PPrroottooccooll PP00000011440000 ((EE:xxyyggeennSSttuuddyyNNoo.. PPO0000011440000)) wwiitthh `AAnnaallyyttiiccaall MMeetthhood&s aanndd AAImEeNnAdMmEeNnEt 11 ..................c..v..r..v..r.s..n..m..m..m..s..s..s..s..s.s..m..i..s..e..n.s1|3n30e0 PAExysen 22009955..00226622 pp ]i Pag~ 11 of 177 33MMAA0011555522003399 We Sis IInntteerriimmR~ eport##44 --AAnnaallyyssiissooffCCotot~ageGGrroovewSSooiillaanndd EExxyygge~nnSSttuuddyyNNoo..-:" P~01004104000 11..00SSUUMMMMAARRYY ExygonResearchextractedsndaayoedsil and watesamplesfoehedeermintonof Exygee Research extracted and ar~_lyzed soil ~d w~r ~pl~ ~ ~e de~on of perflucrooctancic acid (PFOA), perfluorobutanesulfonate (PFBS), EpecryfeleuncrMoheeaxadnessVulOi0oOna1t8e1(PF2H0S)V,00a0n1d7p8e0r,irluosroopciaene(csAulpifpoenenatdel(PAyO)S) accordintgo ~ M~ V~1781 ~ V~1780, ~vely (Ap~a~ A). Sevenof heanalyzedspl weno poredue quality Gotol file.Samples failedbecausethe PFOAand "'C PFOAsurrogatespikeswere 100 lowrelattiovthee oil supecanbe ound nTable 1 endogenous levelinthesample10allowassessmentofmatrixinterferenceorfailed the `eligibility criteriaforreporting(seeSection8.0).Assessedaccufrortahecreimaienisng Thelimit ofqusitadon ox PFOA, PFBS, PFSmtPFOS isoil was 04ng/g(vs The Iirn~t of quanfitation for PFOA. PFBS, PFHS and FFOS in soil wa~ 0.4 n8/g (wet weg)12d the liof detection fxPFOA,PBS, PFStad PEOS in olwa 02 lg weight) and the limit ofdetection for PFOA, PFBS, PFHS a~t PFOS in soil wa~ 0,2 ng/g (etweight).Tholintof quatiainfo PFOA. PFBS, PFHSand FFOS i wate was (wet weight). Thv limit of quantitation for PFOA. PFBS, PFI-IS and PFOS in water wa~ wl 5500nngg//LLaannddtthhee lliimmiittooffddeetteeccttiioonnffoorr PPFFOOAA,,PPFFBBSS,,PPFFHHSSaannddPPFFOOSSiinnwwatateerrwwaas~2255 AnAanlayttyiticca~l,rreessuullttssfoforrt~hheeaannaallyyssii~sooffPFFFOOAA,,PPFFBBSS,, PPFFHHSS,,aannddPPFFOOSSiin~ssooiills:a~mnpplleess a~r-ee: ~smummazmizaedriinniTTazabbelleedII.. AAnanlayltyiticcaallrreessuullltssffoerztthheeanaanlaylsyi~sooffPPFFOOAA,,PPFFBBSS,,PPFFHHSS,,aanadd FOSin roundwaxspi remmmrizdin Table I. Aasiyial rus the anaPanFlaOylysSsiiaisnoofgfPrmPOFmOAdA,w,PaPFteFB~BSSs,a,mPPpFFlHHmSS,a,~aaennd~ dPPiOFzOS~ SiindnrritinnnssTeebablblaalnenkkIsIs.aammApplnleaeslsyatarirceeaslsurtmem~mmallrm~iizfz~eerddithinne Tabien. Table IlL ForifctonrecoveriesfxPEOA, PEBS, FHS andFOSinthoso scples re Fortification re~ov=ie~ for PFOA, PFBS, PFHS and PFOS in the soil sample~ are cal inTabIVle0sV. The erageprcntrcoveis + standarddeviions oc detailed in Table~ IV mtd V. The average perce~t recoveries 4- standard deviatiom for PPFFOOAA,,PPFFBBS8,,PPFFHHSSatnnddPPFFOOSSiinntthhe~ssooiill sma~mmplpleesswwer~ev8866 + 1177Y%e,, 8844 :+l: 99%%..8888 1 l1i0P%/, 21 854 16%, respectively. Forticsion recov fo PROA, PFS,PFS ndPOS i iainnntd%h8ee5ggr+roou1un6nd%dw,wareattseep~rescuatuimv~pepllylee.ssaFaroreertdideftiecataiatliielo~dnirinnecToTavabeb~llieee~s~VVfIoIraPanaFddOVAVI,ILIP.lT;BThShe,eaPavFveHerSraaggaeenpdperPecFueO~nSt cove standard oviaions fo PFOA, PFS, PFHS aad FEOSinthe round water `rsseaa~mmoppvll~eerssiweweser+ree9s9~88m+da11rd77%%d,~,9-9v77ia:+t!i:o11m00%~f,o, r11P0033FO+AI18,8%P%FaaBmnSdd, 99P11F&H1S177%a%~,d,rrePesFsppOe~cSttiivivneelltyyh..e ground warm i FForto i~cartiot nrreeci coovveef rriieei ssffoorc r ~'CCaPIF~t OFOAAi i~nnto ~heesn sooiillssaammpplleessa~ red~ etailedi~n TTab~leV~IL.. ~Thee `7d~ 7a9v9er.+e aege112p2i~ %e%a.rTa.m caeFbnF olttrrdete~iTcfo oXivvc.aeT~t~ rhiiomeensrae~~ +vceso~ rtvv aaengrde~ ipaeersdrfdcfoe~ eovr~iar'~tcaCiCoovPnPesFFfrfOOoi~rAeAitS~snCCtPtaP~ hFnFdeOaOgAr~Ardiood~nue~tnvd&ihdswveisaw oortnaieis~llrfs~osa~ ramlpm~lpCelsPsewsFwaeO~ rr~Aee { : iid ~nnt~ eaeb~ ga~ rnouknTsdaaww pbapktle~~ ersssarm~e~ pdllee~ tsaawiw leverd~~ e 88~ 55Ta+.b3l30e~%X.r.,~FTFhv~ eo~ avo re~rn at~ gsr~ eipcoevrfev~ rdiie~rsofcfoco~orm v'ae~'rCCiftP~PF2~Oi~sA ACaioP~nFaOnt~hdAe ii ~e b~ ~I~ ~ ~ ~ T~le X. ~ av~ ~ ~v~ ~ deviationsfor "'C PFOA intherinseblanksamploswere 78 5%. | | ExypenReseach Exygen l~esea~h PPag~e 11220o1f1[7777 | 22009955..00226633 33MMAA0011555522004400 InWIntatei~riS~nReizepp~itsA#4--AAnsails~o0fCoo~na~eGrroove~SSooilland Water Samples Exyim F.xyg~m SSttudyy No: FPO00O0L1440000 No.: 20OORBIJEECCTTIIVVEE The objectiveof he smayical pan of thissly was todetermine levelsof The objective of the analytical part of tlfis study was to determine levels of pepref~lluuoorrooooccttaanncoiico. aacriidd (P(PFFOOAA),), ppeerrfflluuoorroobbuuttaanneessuullfoonatee (PPFBBSS)),, ppeerrflfulouroobrexoa~neIsfuolfnoanattee ((PPFFIHISS)),, aanndd ppeerrffllutomrrooooccttaannesulfonat~e (PFOS) in soil and ggrroouunrddwwataeterraaccccoorrddiinngg1~0oPProrottooccoollPP00000011440000 ((AAppppeennddiixxAA)).. 33.00IINNTTRROODDUUCCT~IOONN This report desi th rou f the lis foxthe determination of PFOA,PFE, PFHS This report details the result~ ofthe analysis forthe detaining'on ofPFOA, PFI~ PFHS aannddPPFFOOSSiinnssooiilluussiinnggtthhee aannaallyyttiiccaallmmeetthhooddenetmiittlleedd,, ""VV00000011778811:: M Mete hodt ooffhAAnnao allyysd siiss foforrtthheeDDeteemrrmmininaattiioonnooffPPeer~flluuoorrooooccttaannociiecAAc~iidd((PPFFOOAA))iinnSSooiillbbyy LLCC//MMSS//MMSS""aannddiinn wwataeterruussiinnggtthheeanaanlayiyt~ica~llmmetethhooddenetnitittlleedd~,"'V~O/0000011778800:: MMetethhooddooffAAnanlaylysisiss ffoorrthe DeterminationofPerforoociancicAcid(PFOA) in Water by LOMSIMS.TM Detem~ation ofPerfluomoctanoic Acid (PFOA) in Water by LC/MS/MS." TuThmheebesatruyPdOyDwwOa1asAsOii0n.iatTiahtdeedoaonnnalMlyVtailaccraclhhs00a33,,2d200t50,5f,wowrhtheiennstnthheeesistdurdyeypdoidrritreewcctitoosrrsAsiuigggnnueesddtppr,roo2ot0oc0ce5ol,l nd the aytal termination dat fo i teri reportwasOctober 1, 2005. numb~ P00014420. Tim analytical start date for ~ interim repor~ was August and the analytical termination date for this intczhn repot~ was October 1, 2005. 8, 2005, 44.00 AANANLYATILCAYLTTTEESSITTSSCAAMMAPPLLELESS One undead 10d seventy sil npn 2d ftw water samples (Bxygen ID One hundred and seventy-nine soil samples a~d fifty-two wate~ samples (Exygen CO0BI163 -- CO0BI28S, CODRI325 - COOS1438) wer received at ambient empertare C0081163 -C0081285, C0081329 - C0081438) were received at ambient temperature onJuly23,2005 from Pt Frets st 3M EnvironenalLa, Thityro-unsd wialne on July 23, 2005 fi~m Pat Fe~mtti at 3M Environmental Lab. Thirty-six ground wat~ samples represented pins samplesisadmocited eldQC samples. Foursamples samples rq3resented nine sample sites and ;msociated field QC samples. Four samples enadota we 0aeae 150QCsamples. irewessamples rept't~-ntod de~on~ water and associated field QC sample~. Three water sampIes eprested wipblacktnd tw tipblakspc,aa rine samples reprsted fl represented a trip blank aml two trip blank spike,s, and nine sampl~ repre~nted ririnnsseeblbalannkksssusuppplpilieeddbbyy WWesesttoonnSoSloulutitioonms,,IInncc.. tthhaattddiiddnnoott ccoonnttaaiinntthheesusrurrrooggaattee,, 'C PPFFOOAA.. TThheessaammpplleesswweerreellooggggeeddiinnbbyyEExxyyggeennpepresrsoonnnneellaanndd ppllaacceeddiinnrefrigerated ssttoorraaggee., SsSaammpsplleeloloowggii-ticn~hatahnniiddcicthnheaaiinntoooffodccruus.sttSooddayyriignnfefoomrrme~acato~irioodnniwisisllllbooec~akteeeddpitainnttEthx~eyergrean~wReddsaaettaaarpcpah~cckkaag~ee associated with this interim report. Storage records will be kept al Exygon Research. 55..00 RREEFFEERREENNCCEEMMAATTEERRIIAALL BTTohhgeaeannnalayloytitniccaDall essttaanncddaarerdd,,mPP0FO6bO,AA3,e0,w0wra3ass.ppuTurrcochheaassseedudfmfo~ommgaSSeiisggpmmiaakiAAlnidgdr.riiscchahnaadnnddewdw,aas"'rreCec.ceeiibvveeelddoaadtt Erygen on December 08, 2003. The surrogate spiking standard, 1~C labeled BeyeE,xygen RReesseeaarc~hh Page 1306177 Page 13 of 177 22009955..00226644 i i | | i i 33MMAA0011555522004411 -- ee ------------ T-- A---- ------ ------ -- Ill f nVaitmSRuepplos#4 Ansysof otag GroveSolsd BenSyNo: POI Exyg~n Study NOo: PO001400 SpeNfluGoormopoacatya.oic3sMisdpp(lCicPdFOtAh)e,awnaalsystiicavlseansdcEdxsygFeFnDoSnaAnpdelPF15S,.200P4FfEoSm wthaes oencsJivead o2mm0,I0yM0a3t,xPEeGSnwonaMparych1s3s,e2d0f05omFFHhSwCoarproercaetiivoendsfrnodmwa3sMraetceEixveydgstn ExoyaAigl2e, 2n005. "sTThcheieaeavnvala.iilbalbPelFeBiiSnnf,fooPrrmmFaatHtiiSoonnf2of0ordrtthheeCrervfPfeeFrweOnnAcceewmmaetasemrsriiaaellseiidss lliistgeededbnbesellaoowwd.. PFPFOFOOSAAwwawa~nsssts~ooorrr~eddd prrmatiy ambient. PFBS, PFIIS and ~SC PFOA were ~tored R,ozen and PFOS w~s stored refrigeramd. Com~d PFOA Shooosin 2IIGHB | Teh 120805 PFOA CrroA Smeostss amon 97 owns ~C PFOA FBS SPo00ST28 0 7 1s PFBS pris Soil Som6 sss iiss PFHS bros Skee aot 1012 oeodne PFOS Er,v.~ Inwntnrv No. $P0003800 SP0004184 SP0005726 SP0002401 SP0002694 Lo~# 231161-IB 3507-19~ 101 SE036 430tg0/1 ~ 97.64 97 96.7 98.6 101.2 ~ 12/08/05 03/29/09 12/04/06 10/I 8/06 0~/23/06 The lecular sctures ofPFOA, "CPFOA,PFBS,PHStnd PEOS as givencnthe The molecular stnuetures ofPFOA, '~C PFOA, PFBS, PFI-IS md PFOS are given on the following pegs following pages: CPPaFFOOeAAlName: Periuoroctsoaicied MoTM Crlahoneeslmc~ituicilaoalnrsNWWMaeomeinieggi.h-httto:Pre44er11fdl44u4o1m3o--cta3n6o9ic(afcoirdquitifctossd) Transitions Structure: Monitored: 413(.for5con2fir1mati9on) 413 --~ 369 (for quanRfication) 4~.3 -> 219 (for onfumation) md Stricture: k E si F PFF~ eLfEO rE H F F F F BClhC~icepnPircFaOOlAAName: 12-13Cperfsrooctacsicd i Moller Weight: 416 Chemical Name: 1,2-13C perfluorooctanoic add TMraonls~it'uilo~n MWen~iigthotr:e4d:14615-370 i| Suc: Transition Monitored; 415 --> 370 Structure: Fr[ieTle fd || Eg) icicon iii rm -- PPagee taofr1?77 | 14 22009955..00226655 i 33MMAA0011555522004422 --rr--r ---------------------------- Snort iris Somme Interim Repor~ #4 - Analysis ofCottage Grove Soil and wo Water Samples Exysen Study No.: P00Ol400 BE fosray rNmeosps `MolecularWeight: 338suppliedas thepotassiumsalt(CiFsSOSK") F F Ng! el i ems`MolecularWeight: 438supplied as thepotassium sat (CFO) Chemical Name: Perfluorohexanc~tdfonate Molecular Wdght: 438 su~pl~cd as the la3ta~am salt (~I3SO3"K~') MNe oo Si Transitions Monitored: 399 --~ 80 Tm ,F F F F F F rosPFOS CChhe_emmilcica,all NNaammee:: PPerefrlu~ortoaocntam nes~ulofonna~te MoMleocleuclualarr W Weigighlt~: 5$3388ssuuppplpilieeddaas~t~hheeppootmasasaiiuummssaalltt ((CCsaFF~SSOO3y"KK"~)) "TTrraannssiittiioonnssMMonointitoorreedd:: 44999 --~89800 = Structure: or F F P P HH FeF teP F F i EExxyyggeenaRReesseeaarrcchh 22009955..00226666 PaPaggee 11550off117777 i i 33MMAA0011555522004433 eee-------------------------- TIWenatteeerirnmSRRleepepotrt ##4~ --AAnnaallyyssii~sooffCCootla~gaseeGGrorovveeSSoolilsanndd ExSuydyNgo. PeOOnL) Exygen Study No.: P00OI400 Water Sables 66.00 DDE ESS ~OCNOR OFF AAIN2qAALPLYYTIIT'ICCA~I LLMMEEOTTHI:IN OODD TPehTrhefelauaacnaralolyycitaiccnaaollimcme.iA~bcxoi~ddss("PV'%FOOO'0AO0L)07i187nI8S:1o:MiMlebetytt~LdOoMoffSAIAuMnsaSsl"yistiensfdfoi~r"rVt0hth0ee0D1De7et8te0e;rrmMmeiintnahtaiootndiooooffnf Analysis for theDetermination of Perflorooctmoic. Acd Perfluomoctanoic Acid (PFOA) in Soil try LCJMS/MS" and Analysis for the Determinaxion of Perfluorooctanoi A~d (PFOA) in "V(X)01780: (PFOA) in Water by Mel~od of Water by LLC/MCS/M/S"wM weerreS euusse/ eddffoM orrthtbiS is~ssttu" uddyy.. 66.11 EExxttrraaccttiioonnPPrroecceedduurreeffoorrSSooill BZBiepfelfooorrceetbthaheegssaaamnnpd~llemesiswxweeerdroetwhweoieriogguhhgehelddyf.foorrTtthhheeeesxxaama-pacoltteiossn,,wtehhreeyeytwwehreeerneptplrlamacce,eefddeirineotdo b8aanncwekw,t,oc~tlleehaaean samplingcontaine. A$gramportion ofsoilwasweighedio a ifymillilitercentrifuge Zip]~ bag and mixed thoroughly. The samples were then transferred baok to the sampling container. A 5 gram portion of~oil was weighed into a fifty nlilliliter ~enlrifuge tua<atu1dbbdeemeifd~io1ortnrotdtuhthtehhseeeeaesxesnatxarmdmtaprwcldp~teelisreoo.sen~.t.ThATuAefhne.tc~sestoersarnafmifompocrltraptietlifeiseiisodcwiaawtetniieoaorrnnvnoaolaflflrllaoaosppwwpoperrndooipprr0c6oisabashttaheeatashskkafaeemmopor~lpnme~les18as,5, wmw5$rmiriminssLtLtiaaosocfo,ftmmioneTenthtshhsheaahavanakoooke~lelrwruwfefmoaosrser ~w3~vac01as5~0t~t0aakki1neepnntml~tt.oT4a4h0n0edrasiwlLvL,epwrweierittmthhhaweawlanlatttgweeoraxefsaicdnatdttehthdhneeinsksaoaamnmdpeRplle]eotrssnawtsweoorezerlaiectCtbhhsaeenn~.SccPfeeoEtnrcrt~ariir1ffti5utrggiIeeRd~dginefitc'olootrern~S-d.1Ii0t0Timhmoienimenvd~eOweslitslat~athet `-11m300i0mlm0lL0Leroropsff"mmom.fcmT~eehhtaehntasonulaopalnhenwmddasa5tmaamnLdt.n.Ldwooeafofsdwwathtalteethenrer..lcoTaaThrdvheeiededgolsnu.ltaFotFiawivuvweeC~m sa~mssaddiSilsiP~sctoi Eiaiartctd~daeeserdodtol .r.fifdleAgA3aepuptl acpptoerrrnowwoxdaxiiase mtiiscoamconmolaellldtlr yececwrffttliiieevtvydhdee ~nilli]i_lm.$ of m~.hanoi wcg added Io the cat'tridgo, LOMSASS sectropry. ininttoo aaggrraadd;u,_a_t~e_~d_1155mmLLppoolylpmyppylcrneocepntnrytirf~lufguee~tnruubbeey.. EEaacchh ssaammpplleewwaass aannaallyzyezdbebydy LC.YMS/MS electrospray. 662.~PPeerrcceennttSSoolliiddssPPrroocedcuereFd~ooarrS.rSoeelgl PP'eVcrOrc0oe0en0at4t2ss7oo.lliiAddpsspwwreeorexeiddmecattteceral'mmyi2inne0eddugusrsiainmngsgtothfhepsparrmoopccleeeddwuuirreesiiwnnedciiiccag_ah_t_eet~dd_inianfEoExxyyppgaeennn.mTmehettehhwooeddight of t~hV1t0e0e4s0s:a0am0m2p4p2ll7eCep..pThA lhuisetPnthhteelhp~ peaasnenawmwlapyaslse2rrwee0ccagoosrrraddtmeerddse..noTaTfhfshearemsrsadpa1mmlpe.plwleedaweswaswasisteatihihseohenensdr~ identdaoliailnnopa4wanenod.ovTvenh~seooovwlve~efroaing'r~ihigtg1hhot5tfaatt 104 2 eC. 'l~aen tim sample was transferred to a dessie.~or and allowed to ~ool ~ ~15 percentsolidforeachsamplewasth calcalated. `mmiinnuutteess..EEaacchhssaammpplleewwaasstrhheenawweeiigghheeddagagaaiinn,,iinncclluuddiinnggtthheewweieigghhttoofftthheeppaann.. percent solid for each ~aaple was then a~cnlatecL TThhee ii 6633EExtxrtraacettiioonaPPrroocceedduurreeffoorr WWaatteerr | foAAni4f4i00cramtliLonaaolliifqquuaooptptorofofprhthieeswewsaatamteeprrlsesasa,mmtpphll~eeswwaamaspslu~ essewdeffroorerltothhaeedeexdtraaucttoioanCpyrs SoPEdca.riAdftgeer cofnodrititfiicoantieodnwiotf happ1r0ompLri.aotefsmaemtphlaens,olthwedsata3mptcLsowferweatloeard.ec~Thoenc to a C~ewh iSsPE cse aeratrtieddg.e | `AcApoppnprdroiotxxiioimnmaeatdteelwlyyitfhiivvee10nlfmilefLili~roefrsmoof~fmammemtoholanlaonldwwa5assmaadLdddoeedfdwtooatt~hhre.ccaaTtrtIir~didggeeel.u.aFtFiivvewemamsiildlliis~lotaeerrdsreoodsff. i cweialuusaaattneawwlasysszcecodolbllelycetLcemOddiMniStntoIo MaaSg~r,aalddeuncaatt~eeoddgp11a55ymm.LLppoolylpyrporpoyll~emneecceennttrriiffuuggeettuubbee..EEaacchhssaammppllee | was analyzed by LC/MS/MS electrospray. ExygenResearch 22009955..00226677 PPaaggee11660o6f117777 i 33MMAA0011555522004444 --_--_--m----,,-------- IWtaIntete~r-muSRe~ empporets#4 --AAnanlayl)ssiissooff CCoot~at~g8e~GGrorovve~SSiolilaanndd Water Samples `FEx.~ygSemnSSutuddyyNNoo:.: PPOO000011440000 64PPrreeppaarraattiioonnooffSStta~suddaarrddssa~xtddFForotritLfifaictsitotonnSSoolluuttiioonnss prAepmairxeeddastto3ccoknscteanntrdaatridosnoolfuti1o0n00ofg/PmFLO.Ab,ydi'sCsPalFvOinAg1,0P0FmSg,ofFeHxcShaonftdhPeFstOaSndwaradss (c2o1n0r0ectpegd/fmLo.rfpourrtiiftiycaatnidonssatlatncdoanrtdseonl,uitfionpewcaesssparreyp)iarnemdebtyhtaankoli.ng1F0mLr thoifsto sholeustm tioocnk, angd/mbLrfionrgtiinfgitcahteivonosluuxmiearwpda1n0db1r0i0nmgiLngtwihthvmoeltuhmaenuoplf.Boy10t0amkiLngwi1t0hmmeLthoafnothle, &11000 fuorgt/ifmiclaftioonstrantdaridastfnadnbidraircndgiwanagtsthpeirveopolaurnemde.up Byt1a0k0imngLw1i0tmhmLetohafnotlh,e&110.0pggifnlL stfanodartdaindsfbtraiinndgaicrndg watehretveopliruepmoaerenwdp. By10t0amkiLnwgit1h0 mmeLthoanfolh,o31..0.01pgg//mml..ffoorrttiiffiiccaattiioonn bsrintginagtwnhaesdvporahepuarmreedudp. 1B0yt1a0k0minLg1w0itmhLmeotfhatnhoel0,.1a0p.g0/1mpLg.mfolrt.iffoirctaitfiiocnasttiaonnsduarmddaarndd. wereprepared. inAAswesactt'teoorffsast~namdnpddararorddcssecscosonetadataitinnhiir~nogguPgPFhFOtOAhA,e, e'"x~'CiCrPPaFcFOtOoAAn,,pPrPFoFBcBSedS,u, PrPeFF,HHSiSdmeantndidcaPPlRFtOOoSSswawmeperrleeepspr.reeppasTrrheeedd fof~olnlllwooww~iti~nnrggcacnood~npmcrotrec~~nosentdsrwwtehaerore~tupgprihre~poaathrnrecedsde::xtraction pro~lur~, id~ntica! to samples. The CoSnocl.uotfiFoonrt VoFlourme ForiVfoiledmSeaomfple (ogni wh) (mL) 100 1000 "o 1100 0200 " " 110000 21000 " "ofPF10O0A, 1*C PFOA,0P0FBS,PFHS a"adPROS CFailaiablraCtioonne.Sodf. (gL) 20 0 215000 1500000 ``0AAdnna0ad.dd1idtpitigioo/nnmaalLl ssfttooorccbkkosostloluleutsitpiooinnkoiofnfgpC~uCrpPPoFFsOOesAA.wCwaoasmspp~ rleeptaerdeetdaaiatlt sI1c00a00n/~gbgef/mf.oLusaedmnidtndditilhluuetrteeaddw~0doa11t..a00 i and 0.1 FE/mL for bottl spiking puq~os~, Con~l~ d~tails ~1b fom~d in the raw data psckage associated with th~ sttldy. s`tTTohhre~esdsttiooccnkkasstrtaaennfddaiargrddesrsoaololuutrtiioo(n4na~na+dd2aallCll )ffoorwtrhilfeiicnEantcioo~tnaian~nddcuacslaeilib.brraatDtiiooonnscsttaaunz~dmatarerddsnosoltouluftatiisoottnnasisnwdwoeaerrnrdee ppsrtreoeprpaeardraattiiinoonnaiisrlleoofcciaiagtteeerddaiitnnort~hh(ee4ra~ww~:dda2attaCap)paacwckkahag~~easa[~ssoostccicia.itae~udt~wwi. t~thhDttihoiscsiuinmntteeernrit~amntrieorepnoproot~.f sta~[azd `EExxyyggeennRReesseeaarrcchh 22009955..00226688 PPaaggee11770o1f117777 ii i 33MMAA0011555522004455 -_ tereriSRaempss#4 -Analysisof CotageGroveSo and Water Sarnples 65CChhrroommatatooggrraapphhyy EExxyyp$eenaSSttuuddy,!NNooa.: FP0O0O0L14A000 QcQuluocatnrntotiisfipiccraaaytii.ooTnnhooeff rFPeFFtOOenAAt,i,oPnPFtFBiBmSSe,,oPPfFFPHHFSSOAaa,n~PdFPPBFFSOO,SPSFwwHaSassaacanccdocmoPpmFlOpiS~swhhecaddsbby~y1L0LmCOi/nMM,SS/~MM0SS5 aremnnlicyinc.sost,r,fo"ts-h8p8e.r.55armye1i.1a"ng.~seT.n~,ht, 2esb2~lrdcdatca~1kx!s1t1ioma~ninnpltnefls~,nrccreoesopmfdePec.FstrOipevoAelnly~yd..iPPnFPefBeoaaSkkh,ssePsaaFbbnHooavvlSeey:tattenhhedee:LPLlOFOtODDoSwnweweriare~een.-o!ot0tdderetateiencct;tee-dd0i.i5nn any of ~ reagent blank ~tmplea orrc~xmding to the analy~e retention time. 666.6IInassttrruummeennttSSenesuisttitfvviittyy TcTohnheceenmtsar~alttileoe~notfss2tta5annnddgaalrrLddoafammoBuoFnuOntAt, iinCnjjeePccEtteeOddAd,udPurriFinnSgg,tthPhFeeHS~cahhnr~odtmaaPtloRoOggSrra.apphhii~c mnnm hhaadd aa concentratien of 25 ng/L ofPFOA, ~C PFOA, PFBS, PFHS and PFOS. 67DescriptionInosftrLuCme/nMt:S/MASP[LnAsOtOrOaBmeiatoamndoOlpMeeraasctsiAunnglalCayonzrdeitions Intecface: TorbolonSpryLiquidIntroductionIfe Computer: DELLOpaPlex GX400 Turbo Ion Spray Liquid Irttroduct~on ]ntcr~- Software: DWELiL OnNpT~d,xAnoGlXsw4t010s41 HPLC; HeWwtlndeotwt~PNacTk,aAr~du(dHP~) 1.S4c.1ien 100 EPQuatPump I-lewlet~ Packard fllP) Series 11 O0 EHHPPPAVVuaatctc~uaunmnmnpDlIekegrgsasse~r HlPipCAomloom~maO~vl~ern HCPoLlCumCoTluemwn::Th3e0rmCoFlapbaseRP,50 mnx2. rma MojbecitlionPVasosLe:(1A)5:k2LmMAmmoAcnesiinuwatmer Mobile Phase(B): Methanol T00m %5A 43Bs 0811.0.000 266as55 3733ss55 ii 1118010..0900 o222s55 2377ss55 i "To m rmt e: 11.0 1~819818.0 min os65 65 3s35 35 FTlootwalRnamte:fi0~3:m-1l8 n i How P~: 0.3 ~ somes Exygen lU.search -- ~ge 18 of 177 i 22009955..00226699 I3MMAA0011555522004466 -------- TWaeeirSRaemppolrets 4 -Anyi ofCotge rove Sil sd Epp StudyNo:POO Exygen StudyNo.: P0001400 _ fonsmentored: Ions monitored: - AAppppmrxiomvame Anab/te .- PROA mptve M4on3it0o3re6d m(mian) PFOA FROACafmlon nepive 413219 ~i2min PFOA Confi~n Ion = ficrroa give 41530 ~izmin 1~C PFOA PBs Dogive 299599 ~5min PFBS PRES give 39530 ~llm. PF~IS - Pros give $958 ~DBmin PFOS Mode negative negative negstive negative negative negative ~ Monitored 413 --~ 369 413 -~ 219 415 --~ 370 299 -~ 99 399 --~ 80 499 --~ 80 Retention Time (rain) ~12 rain. -12 rain. -12 rain. -5 rain. ~11 mi~. -13 min. - 668.8QQuuantaitatniontaanniddEExtxaammapplleteC~a.il~clucolualattniioonn : F"FTihitfelpeeen~ammkiriccerosrlwiotaessrsmooeffsssasammeppldleeaonordrcatclhaielbisbrtaraatnitidooannrsdtsctauannrddvaaerrwddawwseegreeeniinenjrjeecctteedd(iuisnnitnoog ttUhhxeeSLLtOCMw/MeSiISgh!MMtSeSd.. - cTlinnheeearoprreeragekngreraesrsescssiiwowoannsa))esdbbemyyeneAraAnmsniamtanll~eyydsatrsfnrsdooofmtiabhw~teah,saretrteaecnuqdmsuaiia~rinndog8ncsosuscbervvileeenonnwwc.scosongnemceezcnntl~tietoidonn(susosoifnfgsst1t~d/xdafmriti'dwss.c. i~TTthehede o,~ntration was det~m~ned fi-om the Ou~tiom below. EqbEuoqaupaitaoionnnde11 cdcaacllu~orulvl~aetee(ddltotheceaamrmeooguurnnettsosofifoaannplaatyryatemfefoottuemrd)((giiennangerg/a/mmieLLd,,bbbaayssteehddoeonnApInzes:eaykkasarrse~o)af) wusasiirnnegg - tphreog~ ram. e~rve Oine~r tz~r~io~ parameters) geaerzed by the Analyst ~flware Eq~ uto ionn11:: As Analyt rmfound 1) (rig/L) --Paks:ts fPeak ar~ - int~] DDFF - WWhehreree:: DDFF ~=DDiliuluttiioonn FFaaccitoorr,, ffaac~t'lo~rrbbyywwhkii~chtthhee ial volume was slope final vohune was ddiilluutteedd,, iiff npeeccessssraryy.. FFmooer~s~tamom~pc'tlpaelels fflooerrtiitffihiedpdewwricitethntknrooewcwonnvaearmmyo.uonutnsts ofaly of analy~e roc10 prior to xiacion,Equsion exa'action, Equatiou 2was 2 was . Raec~o.voevr~y(,((4%a)m) =-i- e ound(ng)maliincon (rg) 100% | (amlyte foundae(monun~n)t-saoadaddeneaudl(v(masssig/nL))c~ntrol {n~L)) x100% -- NhNooettpe::FrFoorritthheemsadnmasalalyyrmtepelryreee.ccoovveerryyccaallcaullaattioonn, he the ""ccoontmrool"" is is he ~e spied umpiked aalliiqquuoott ooff the primary fi~ld sample, - Equation 3was used10convertth amountofanalytefoundi ng/mL.10mg/g(90). i Equation 3 was used to conve~t th~ amount o analyte found in ng/mL to ng/g - : EaypnRecah Exygen Research {| } PPagee 1199 6of117777 | 22009955..00227700 33MMAA0011555522004477 WItneteerriimnSRaRemeppplooerst 4#4 --Analy Anal3,sisooffCCootUaaggeeGGrroovveeSSoiolilaanndd Water Saraples `aygenStudy Nos:POOOLADD Exygcn Study No.: P0001400 Eausto3n: anayts foun(ppt) = anteo`usadm(plpetw)eigshto()pssrated(12) sample weight (g) Equation 4westhenusdtocalculat th amountofanalytefound ippbbasedondey weight. Equation wright. 4 was lhen used to calculate the amount of analyte found in ppb based on dry Equio4n: AAcnaallyyttee ~oouunndd((ppppbb))ddrryywweeiigghhtt ==AAnnaallyytteeSfuounnd((p~pbb)) x[[110000%% /otottaal ssoolliid~d%e))J AAnn ,zaxmampplleooff aa ccaallccuullaattiioonnwuisninggaan~ cal a~tual ssaammppllee faolllloowwss:: SoSiolilssaammpplleeEExxyyg~eennIIDDCCO0008g11335588SSppkk DD(S(Sete:t: 008800990055A),),fofrotritfifiieeddaatt5500000000nngs//LL. `wwiilthhPPFFOOAAwhere: peakares = ms inpinteteaerkrccaeerppe!ta f==fi 931120300800128 dope Saw dope ddililuuttiioonnffaaccttoorr - 2430 == 110000 nllaly added (otevel) = 50000 aSP-. ana~yte added (fort level) = `aammttiinnccoon'rcsproendsingpssaoammpnpllde~((innggn//LLg))** =- `vvoolluummeeeexxttrraacctteedd((LL)) bd= ~oooo 113311 00..0044 sampl weight 5) - os sample weight (g) ttoota~lssooltiiddss((%%)) ffi 5 =- 8866.38S8 *TThaeepprriimmaarryyssaammpplleerreesmuilttwwaassuusseeddffoorraalllccaallccuullaattiioonnss FFrroommeAeqnquaualatytiisooennfu11::nd (gl) ~ found (rig/L) FFrroommeeqqumatatiloenn 22:: %%RReccocvoevra'yy. FFrroommeAqeqsumaaitsytiltoosunf33o::und (ppt) Analyte found (ppb) =-- [[112200818221862-0891239010]3xx01I000]00 459600521430 - 45960 ng/L -n% 50000mg == ((44 5965 0.n9 g/L6 --1130 311n0 ne~l.lg)) xx/11000L0%% 50000 ng/L --92% =-((49596600 n0Sg3x/L0x004.041) =368ppb5g = 368 ppb I I i `ExygenResearch 22009955..00227711 P, Paaggee2200eoff117777 l 33MMAA0011555522004488 --------------------ee-- e e-- -- rWatterSReecppls#4. AsyaofCotigeGrow Silad ExyeenStadyNo:POLO From"Aenqaulaytiofnou4n1d(ppt)dryweight =368ppb x (100% 86.88%) = a230b NOTE:Thisvaluemaybe lightly iffeeatthantht oftherawdatadetorounding. 77..00 EEXXPPEERRIIMMEE~NITTAALL DDEESSIIGGNN uaCCsaPPdFFdOOeAAdtwwoaatssuhusesesedodiaaslssaaamsspuulrreroosggaaattnedffsooaramalpllllttehhreesesapamlmpiplcleaes~seiexnxccteehppettlttahhbeeorrriianntssoeerbbyllaaaafnkeksrs.,cotU3lCClePPctFFiOOoAnA. bew~XfCCaosrPPasFFbdOOdeeiAAdnwgwtasoahsstiahpeadpddesdoadetiddl1ost0taohmtehtpheleefg~e~lroaonufudonnrddsswaawammtappetlelerrisxnsa~ga-m'mpplFiplcolaeetrce~owloilalnelecrtcthtisieooannlmabpbbloooerrtsateltdeossreiyinnsatfiththeegerla~nlbao2oabllrsoetarcta~eoteiorodlryny.d +mmobaetatftoeriribxeossptbpiteikilkenesg~,,nsFhPtiFFhpOeOplAeAad,b,PotPRroFaEBttShoS,er,yfPPbiFeeFflHdoSSrafeoabnrnedidsnPaPgmRFsOpOhlSiiSnpw~pweeerdrFe~toolartslswohoeaaatiedderdddes.daamTatpthle8aK~wknandotoewewsrninsgcnacoamontpncelecdenentab~rtoraad5tteiio1osndn were filled 0.8 200mL.volumetricfllineinthe fied. to tl~ boules in the laboratory before being shipped to the were filled to a 200 mL volumetric fill line in ~he field. field. Tl~e water sample bottles E"aTThcheehsosoieliltssiaanamctpphllueedsswewdeeroreencexxir~netaccgtteeddnitinnbflo~ arntykn-aone neds$ets1w,],oifrviveeeaogofefn~htbiclchahnc~ oknstfao~ irnteifdire~-deeaxttxrck~tniooonw~sn. sic~xonthche~ snoti~rlat~ tsit~o.nc,lsu. odT~ h~netio~f~asoturi~ t~hsina-rtmfypei-flviedvebse.sloT~ ~ihle s~ste~tdsch~ o~notiai~ nerd t fioyivvieelssb -e~ atm~ cploslenetssa~ vci~ anecedh.oT-ax~ ht~reattc~ ~ tiihtoyn-s: o`o~ Tfhffefotouir~ rensy~ am~ npinlt~ e. hsa.n T0~hf~ eeotrh~ ~timnh-y-~e osii1ligsh~ ~ ettsss.cmia~lic]hsc~to~ nctoanit- o naeid~ n~ reed-re~ ox-t~eaix~ clrtai~coo tnis~ o~ nosrfo~ivrrets~ ha~ rmepel~ sea~sm.o ppllTe~ ~hse.. duff~porl~etiyc~ -afrt~eeto-o~ fi~ tl h~ seet~sc~ adomnt~ palieneadnaad~ ~ ot-ews~ xot~lrso ab~coirn ohanlf~ oo~rry oomae~tsr~ aimx~ pslpe.i.x keFFso~wr~ ce~archehfaosl~rs~ao1vce~ax~ aaapci~belodro .eaTl~o~ h,reey sPhorsF utrdy 'OCkPeFsAOweAreforiwithkaown concenvedionsofPYBS, PFE,FFOS, PFOA ~ ~C PFO~ Somes nesta | TnThhoeevgegrrsootum.nuEd!wawac~tht_se~est~aiamnmpcpllleuesdswewedroeerneeexertxertaargacectnteetddilinnafnfkoouaurarsdseettswsoamrnedltahtgiee~nrtriibnnlssaeenbbkllsaifnnokkrstswiwfeireerdeeexetxkrtnraaoccwtteendd gcirnoonoo uo~nc~ da.iswrenti.eo~ rnEssa,.cthTTshcheotenirtrniiacnnilsauneeedbdbetldlaha~okonkssemesr~tuetanc~gpooelnnnetIasnibnitleaesd~s.kmaamTmnph3dlpeetlswessefoc~ rooenadggeegnrightohtbutlenasmdnawmkpaslptfleoerrsls~isitefteiteesd..cToaTnhtthkeaeniofn~wressdntt |i {`boogrnnreoeesusssnaaadmmmpwpplllaeetesesisrititseteeastan.cnTdodthnthtehaefienodeudedretcdhco~g'onertoruaa~nztmdaiiwopanlnetawestwiestieaersotte..nrc.oT]n'hhTteaheiestnethechidoirrntdddwgogrgrorsoouauumnnnpdddlwewawstiaaettleermsrs,sesoeetttncczogonowntntaia/itainnhhee~add sattrrmhiirpppelebbells,aaannmkkaapfalnineeddlsd~trdtrieiupsppb. lblTilaachnnaekkfsosaptneridtkhsetsgcwcroooolumlllnaecdtzttreweiddaxfftfeoiorrcrtlsthedhetesgcprgoironkoueutn~snwddewedwartetawceteoorrlslssaeaamcmmptlppeeldles.~.s.FiFtoeFosr,r~:ecdaocahcna,ghswcdiittiee~,h,a,aaa | slapslabaibnok~oreparsaltwtoo,errrayyedfu&iapl~lisditoicecdaxautttpeerloaiccoftafetted~ h.aeFnpodprrirtitmwmhaoorayrmytswa~aotrmmilxpaplblfoeeireawlwdtaoarsssypemiexkaxtmttrrraaiwccxtteeesrddep2kcac0onsdld,lettctwwwteoood4l. l0aabbFmoooLrrraspetoooarrrgtyyhimomsanist~aerr,oixfx atnhtshlpeeyipkrpewrisiezmwraeaerPrryyesBasaSabmm,oppePlexFcto~rSalolc,LetlecPedtcR.eteOddFSfoofaorrnrtthdhthePeetsFwisOitoteAelwaawabdaosdsrpeapodtooiurunryretemhddofaftorraoixmbmotsr1htsh~eoebr$ybo,optttrwtileooara4nf~0oddefmxoftroLrtrailpicffotiireietdodio..nNn,bNsouootttf i PaaolF~nsBslooSy,Ctw3PCeFrPePHFFPSOFO,EAAISPww,RaPaOsFsSHaaaddSndd,edePddF..POFTTSOhhAaeensaaddpddPidiFtiktiOieooAnniaanalltdo1'dt3CeChdPePiFnsFOaOthmAAepllwwaeabassoswaraadedtdordereeyddkpbnbreoiecowcaranutuostseeoetxthetherxeaclcleeteivevoedenltl,sshbooeufit" ii `were adjusted to rogue he same dilution astheother analytes. ccPaall:ilBibbrSraa,ttiiPooFnnHrraSann,ggePesF~OaanSnddmwwe,zert rePenFnoOottAaannsapalliyykzzeeedddwiwnittiothhootuirutetdsdialilmuuttpiioloenns;;twthheeerrreeeffookrrneeo,,wJ"n3CCtPoPFFeOOxAcAeleedvetlhse were adjusted to req~e the same dihtion as ~e o,her analy~es. |i Ex~m I~sem'eh Page 21 of ! 77 | 22009955..00227722 33MMAA0011555522004499 InWatteerrnSReelpets#4 -Anaya of oteGroveSoi and BonenSandyNo. P0001400 Exygc~ Study No.: P0001400 8.0 RESULTS AnAsanluayltymitcimcaallarre~rsisunuliTtltasszfbfoleorertIdthh.eeaAannnaaalllyyystsiiisscoaolfrfePPsFuFlOOtAAs,,fPPoFrFtEBhSeS,a,PnPaFFlHHySsS,i,asoannfdd PPPFFFOOOASS,iPinnFssBooiSil,l PssaaFmmpEpll,eessaranrede PanRPsamOFlOynSsmSiiasinronigzfgerrdPoouFiunnnOddTAw,awabtalPeteerFrIsS.sa,amAmPpnFplalHeelysSsat,iarcaraoenlsu~ dremP~mFlatO~rSifizoenrdrtihi~enonsaTeTnaaabblbylaIse~niIskIIsIo.a.fmAPpAnFlanOelasAylyt~a~ircPcoaaFsIlBurrSemes,musaPl~rtFsiHfzfoSoer,rdattinhhnede Table. analysts of Table IlL PFOA, PFBS, PFHS, and PFOS in rinse blank ~m~ples arc summarized in FodFrotlirtefiifdiccaaittoiioonnTrereaccoovbveTerVrilieeassenffdoosVrr.FPFTFOOhAAe,a, PvPeFFrSaBg,Ss,pPePrFFcHHeSnSat rnacndodvPPeFFrOiOScSiinnsttthmhedeasrosdoidfltesvsaiamsmtpiploleensss afarorcre "2PdP0eFFd~OO8aAiA5l,e,dP+PFiFnB1BS6TS%,a,bPrPelFFesHspHeSIScVatainnv~dednldPPy.FFVFOO.oSSritTiihnfteithchaeaevtseiosoroianflgtseesacapmomevpreplcrleeiecnssswtwferoeercrreeo8Pv86eF6rOieAs,11P77F%%sB,t,~8S8d,44aPr++Fd9H9%d%Se,va,8in8a88tdioP=n1Fs1O00fS%o%.r rieainncntod[hvhee8er5gigrerosou1u+6nn%ddst,wwarnaaedttsaeper~edscdstaeaivmvmpipallyltee.issoaFnarsoreferdtoiedfrteicatPaiaFlitlieOeoddAni,minnP:FoTTBvaaSebb,rll~eeessPsVF/V'HIoISraaPannFnddOdVAPVIF,ILIPO.FSTBiThSnhet,ehPaaFevvHeegrrSraaoggaueenpnddpewerParcFcteOeennSrtt sampleswere 98.2 17%,97 10%,103 18% and recoveries + standani deviations for PFOA, PFBS, samples were 98 + 17%, 97 10%, 103 18% and 99P11FH1S177a%%n,d,rerPesFp~eOec~Sttiivvineelltyyh..e ground water ovation oC PFOA i hi sine bakspewr785 5. FoaFrvtoeirrftaiifcgiacetapiteiorononernre~tcorovveeecrrioieevsseffroorsr"~3CsCtPaPnFFdOOarAAdiindntevhthiesetssioooinillssfsaaommrplpUelesCsaParFreeOddeAteairainilleetddhiinsnoTTialabsblaleemVpVlIeIIIsI.w.TeThrheee 7ta79v9er+iag1e12i2~ l%%n.T. aeFboFlroetrdrIietfXicif.oicvcaT~ethrioioeennasrvereeccorsovtaaevgnreeidrpeiaeesrsrdfv/deo'oenrrvtri~aeCctCiooPvneFFsrFiOfOeoAsArit3sniCtnatPnthhFdeeaOgrgArdrodoiuounvnnidtdhtewiwaosantotsieelrfr~ sosara[m'mepCplslePesswFaOaerrrAeee ti2idnnegttteahhioebleggldrrrooinkuusnnTaddamwbwpalatleteeeIrsXrssa.adrammTpehpleleetsasvwweearerarigoeie8n8p5T5lea+"n,b-:e33le(n0eP%tXdAr.ecFFToohvreeotrifiaeivcsreatriaotsgntaerepnieecdcroaocrvfvdeeenrdrtiieiresvsfieacfotoricroa"n~o3sCCvftoPP~eFF+i~OsOrCtAAaiioPninFndeatOn~rshAede rinse blar~k samples are de/ailed in Table X. The average percer~ recoveries standard deviations for 13C PFOA in the rinse blank samples were 78 + 5%. IInnccaasseess Wwhheerreebbootthh tthhee llooww aanndd tthheehhigi~hmmatar/ri~xssppiikkee~swweerreennoottrreeppoorrttaabblleedduuse otoh~ igh lealvecvceuelrlsasocyof.een8nddsoopgpgeeenanorouussthaaantnaaallynytitenev,tethrhseee P~c3CoCrPePiFFaOtOiAAonrme~ sauyltesxwiwsetrebreeetuwuseseeeddnttotohccarslelcccuonlv!ae~treeiaeassssosefestsssheeedd QaI1Cc3CcCrmPPe-FFasOcOyuAA. saIawntnedadrpttphehememamm'seduateths,atmu~orr~eaeddnnlslei~unv'rveve~le!to~ohfefaPPctoFFtrOOhreeAAlidai~nancs~~omImms eeoasyfsaaekmmxpnilpsoeltwesbsn..etqwCCuaaearerleenfifutulryilataeanssrssdeeoctmsohauvemneemreninaettshss iooofcfftatthhhleee s cToecQnpocConercntreteenrdstuardlatmutiieoownntsseowrwqeeueramreleiantdnoyeotcttuoounandedoenelrsr-ufrrareeeipplooturhrriraee~t.dl..tThSSheeevevdeserarap~allioisoeffostthffheaekianlaneonadwalblyayezzcqeeauddus~ssiooteylftthsaesan~mdrFrp,Fptl.OhleeeAss.wawtenrenared~ecn"naooC~tt lPProFeFpOOwoAA~assdsusuoedrrsugoeeasmaite~oenet~sospmpifiklkmieetays~twrcweioerxnritoernotttleoorooffaleilolrouewwrnec.releoalTaFtthbiievveeecs1aatooum(spthehleteehseeenf~yaddfioloaeggdalcm~ebo:emuchsaseluelseevelveiegltilhbeiiinlPittt~yhhOeecsAisaaemmarpnipldaleeftzo3toCor |i reporting (explainedbelow). allow assessment of matrix reporting (explained below), interference or becm~sc they failed the eligibility criteria for i `TsTahhmeepflofeolsll.looFwwiiinnrgg,ataphppperrrooeaasccuhhlwtwaoasfsuPusFseOeddAffsooprrittkhheee,aaswsshseeessrssemmteehnnettcoonfftdthohegeaeaca~cou'usrraaacm~yoyuffonortrtithhseenionindtdigivvriieddauutaearll i hsaamntpleese. iFmire~ t~he srepsiuklet oafPmoFuOntA, wspasik.~v,awbahtee~d.thFeoernsdogeanousmwhameropounhtelisenndoeotggernesoatues~ i w`aaannsaalleyyvttaeelwwuaaastsemmdee.aaMssuoursreetddasaat~mlpellevevesellswseggrrreeeafatoteerrrttithihac~ndtw~hihrtreeehe tt"iiCmmeePssFt~hOheeAsaspptiikk4eepapammboo.uuTnntht,,ettlhhoeew"~aCCndPPhFFiOOgAAh | spikes included was evaluated. spike~ included 'C PFOAat40ppb and400ppbrespectively. Most samples wer~ fortifi~[ wi~h 'JC PFOA ~t 4 ~3C PFOA at 40 ppb and 400 ppb respectively. Baoncsonveersatdions ppb. The low and high Based on convemations | BogenReset PaPaggee22220o0f117777 i 22009955..00227733 33MMAA0011555522005500 Inter Repors#4 -Asalysi ofCottageGrove Soiland `WaterSamples `~.~ygE~-nSSxtVuaddyyyNNoog:.; POeOO1n400 `wwuisitethhdtt0hhaeesSsStetuusddsyayDc~ icruercab tcoyfraoarnnsdda3m3MpMllealsabtbohorartaathtomardyyammnaanalanygategeemcmoennectne,tn,tttrhhaeetit'o3CCnsPbPFeFlOOoAAwr4er0ess0uulplttpwwbasasosotonhnlalyty `utthchso~eend'cel't~noCtCraaPstPiFsoFeOn~O.AAaScccao~umnorpcnaleccneeyrtnfertosraruatltsitiaoosmnonwvpewlaeraas4st0haaa0tttphpaaabdr(maawinienantilimywmteueuimcmgohnotocf)efanrt11re00an%%toiootnrofsefbptoethhrleotewehdhiu4gis0ghi0henepsg~ptQbaCans~odallatyyhtttaaeet. acatottnthhceee4n4t00rapptppiobbns.sppiSikkaeemllepevvleeellr..esults over 4~0 ppb (we~ weight) are not reported using QC da~ 99.00 CCOONNCCLLUUSSIIOONNSS `Thesoil andgroundwatersamplesweresuccessflly extractedandanalyzedfor PFOA, PPrTFeFhBspBeSeSc,st,oPiivlPFeFlaHyIa-.dISSagTrnahonedudrnPedPwFFweOOarStSeearnca~occmoccroiprdr,~ilc;enunsgmswtfteoaornaecanseamulstyleythcdieacc~taafmllifmalmleyytehethhaxootvdrdaesscatfeVVfd00e0c0a0t0n1e1d7d7ta88nh11aaeldanyanzdedtdVaqV0fuo00ar00lP10it1F7y7O58o0A0r,,, ~ intevgrietyl. y. There were no droumstano~ that may have affected the data quality or 1100..00 RETREETENNTTIOINONOOFFDDAATAAND SAMPLES A`Awlilllloobrrieisggihinniaapllpppeaadppteeorrtdhdaeatstaatgugedeanycdeariaartteeecddtbobyry.ETExhyxigysegdno~eRRseoessoeetaairrncochhtlhtuhadatetfpeparetrcatailinnsistttootyhth-iisssinirpntateweerddciarmtairarefsepupiocorcrhtt o2fwassitiLihlnebnsietnrst~seheritipt~mtloa~onrrratlottyeuetatmh~ipepcmeacsrrltaaraeuedtupryroednolrirotloaegtgcnssto.d. Era,ExlaxlToachrctiitcsgcoidopnopiaeileesfsscnoioofltftaiaynll-lclsrlrpuaaedwwceiddffaatiacacta,ilr,iaatayswswd-swaeptleeaIlcl,sifwaissicl#arslabiswigegndnree~~dilac~siooanppsehdyy iinonfttthhheeEmEx,tyxeyg~gemvna mRReuvsdsc3caradrreccahhl ararercpvhokirivtveacsnsfdfooarrltlthhoedepspeinerr~iioloddfaoeofiflittWiimm-e~sespepeifceiicfifriiaeewddiiann__E~,F_~P,_P, wAAiTlTlSSbCCe AAreGGro~oonod~d LaLbaobroartaotorryyPrParcatcitciceeStSatannddaarrddss4400CCFFRR779922.. `EExryyggeennRRees,eeaarcchh 22009955..00227744 PPaaggee2233ooff 117777 ii 33MMAA0011555522005511 ------------------------------------------ IWnateeroSaRmepploerst:84. ArabiofCottageGroveSoil od. ExSeyad Nao:Pe0001nA00 E~yg~m Study No.: PO001400 TABLES EExxyygge~n RReesse~aar,~chh 22009955..00227755 PPaagge~ 22480o1f117777 || | i i ii 33MMAA0011555522005522 -- eee ------A -- ---- -- ---- -- -- FIc,t~otereriS~R~ eepoprt #4#4-AsifCota Gov Analysis of~ottageGrove Soil and SeSlyNdo PeOOInA0 ~..,tygea Stud), TTaabblleeI.. SSuummmmaray~ooff PPFFBBSS,, PPFFHHSS,, PPFFOOSSaanndd PPFFOOAAiinaSSooiill SSaammpplleess por BRBBEREE 1 TEER EEE T Em ma mmE 8nm 1: r 8BR IIE m B 3En EEZE J I II GREREERE MO: o:= om 3m 3 TaEmwE % 1 RF 1 RIE 2 pg LEE BREERE. SUL EEmmm if FE oP 8 : EB peg TREEEERER STEN eerammaveeemisascmmisssassanrasars ExygenReseach PPaaggee 2255 0o6f 117777 22009955..00227766 { |i i| 33MMAA0011555522005533 _--_---- i-- np Wat~ ~l~ LCoeGesa t Bag SyYoo:s orem Exy~n Study No.: POOOI4(X) TTaabblleeIl. Continued SSuummmmaarryyooffPPFFBBSS,,PPFFHHSS,, PPFFOOSS aanndd PPFFOOAiAinn SSoofill SSaammpplleess Con~ued E on comecomewsw 3 E mEzEomE2EBmE8 SHSEES 2 IR 3m IRS SULEER 3OMS OSOT BIE 2 3 SmWmLEoEmmEEEEmImmEomoS IPoo:E OPIoonX o:ofoomZ o: of SSuunoEgmmETmmemmsoRgoo:p oo@x ooff oRBR oo::oo@moo:f Cue mmowsam lw 3 ow 8 wm 8 oe 3 om,ZEIImOS OP MO: OE :o@ 2 TL, ESI OW OI OE PS Zo: : RE -- 22009955..00227777 rae2600177 Pa~26 o~" 177 i |i i 33MMAA0011555522005544 IWoreiSRoegper 4 ArtofComgeGroeSond A-- Baye SadyNo:Pootac0 Study No.: PO00140U TTaabblleeI.. SSuummmmaarryyooff PPFFBBSS,, PPFFHHSS,, PPFFOOSS aanndd PPFFOOAA iinn SSooiill Sammpplleess `CCoonnttiinnuueedd SEL SMESOW IMO: o3 oD Oo: Sum ohm EO: ON IR ION OZ Sm Thm 2 oN IZ 2 om oI SELSNES 2 1% PW 3 ES SEL SmEmE 2 FP 3 2 $3 OS STL EEE 2 IZ IoD oIomol SEL ZaETmme EOI oI 3B IE 3 EEE iiig: Sun,Gummi zo 3 OR OZ OB i om,SeESEEOM OZ om 3 OZ 3 omof i SELGnEene In 3 OM ION ozo % 2 | Smgame Rom 2 IF :om 2 SO Omens 2 7% ROD oMmo3 | SR 1s nt toQn 3i 4h 0 | E~xyyg~emaRRes~emar~chh. PaPaggee 22770off 1[ 7777 | 22009955..00227788 33MMAA0011555522005555 ---------------------- frrinRoep)4 AnyiofCoage Grove Sd. xy Sealy No:POOLED TTaabbleleL SSuummmmaarryyooff PPFFBBS$,, PPFFHILSS,, PPFFOOSS aannddPPFFOOAAiinnSSoioill SSaammpplleess CCoonnttihnmueedd FcaLne CEammcEomaeamw 8BE3 F BR2I E0m 3EFom 3I HR mwas Ww EF 2 f EE RE EL. Emu W ER 3m IDOE EnL.omme= = FP BOP EE OEE LEE } 8 3 RE FE oo, GEER Wm 8 2 2 3 PR 3 Sm mmeemes % oxo ozo 3B 2 EEL EEwaE 8 FP EP % 3% OB cSanna ECammmwm mgsfm iB 2 mZR 32 RwEm 3EIFa8RsS3 | TI commasmommaarta | EExxyyggeeneRRees~ema~chh PPaag~ee 2o8 off 117777 | 22009955..00227799 33MMAA0011555522005566 --- swman ACS Interim Report #4 - Analysis ofCoua8 Orove Soil and Water Samp~ Trg ro Ex-ys~:n Study No.: P000140O TTaabbllee lI.. ms S Samummarm yoefafPPr FFBBy SS,, PPFFIH-[SS,1 PPFFOOSS aaandd PPFFOOAA itnnSSoolill SSaammppleless Contiaued Smmmme= wz om 3 8 2 ED Sue commconems 203 OW O03 om oF 80% mmcammriectm 2 3 i 3 ow 3 om X EnGmmaenm woz om of Ro: om: mm emmmwem 33 2 3 om OS om 8 Srmoemm: 3B oPomofomo: Ee -- Exygen i at | Psse 2g of ITI 22009955..00228800 33MMAA0011555522005577 ---------------------- IeniRrepo 4 sfCogGreil Eye yoPLD TTaabblleeLL SSuummmmaarryyooff PPFFBBSS,, PFFHIS'S,, PFOS and PPFFOOAiAinn SSoeilSll aSmamplpeless CCoonnttiianuueedd Smig2mzomf z=efnom=ok SO ShE mmmE i= Iof T3 r PEmPmoE:o: Con mma m5 3 m3 em 2 S SE ELo m 2oi m m zE=m m o3zm 5 om : oezow= = Bo:3 SuLG oz E 33EB=os : Emf S S E tweom2g:ofr m t 2oz r :e ozocog2m pi3 mmn :ozoz SmomEmm= co: os os Bf oE oi GEny eEnmemmia BWB O:3 E0B P3 O1E3 i03 oom o3f i SSomlmmmmemmimm r2 olioo:f:romLoo:oomzoo:z | SeLEmEmimoor o2 Eo: oE oO: | FEEEmumon os ntormmsrt | `BogenResearch PPaaggee33000o6~'117777 | 22009955..00228811 33MMAA00115555220058 ftieKtpe1 oti Coops Ge Send Wat~ yg SyNosFORLIOD Exy~rn Study No.: Table L Table L Summary of PRBS, PFS, PFOS and PFOA In Sol Samples Summary of PleBS, PF'HS, PFOS and PFOA in Soil Samples CCoonnttitnnuueedd 512 SmmnEmmmmm % l3 yof 3P%EIINS:OD po Lt BEEERE.E 14~ S Eu Eg 2E 3m 23Bm oERIEm EE:R ISETAEOE Of 2 3 om 3 OB 3 gSmEommEEmmEmoozT Oo:IoEE 3B oro: O38: op ool || jg ERB EREREE | EE I comatose strsasirtrnts ! EonRees rae 1a177 | Page 31 of 177 22009955..00228822 33MMAA0011555522005599 _-- p4r AoC e Go Sollind WIra~tte~rmSaRmcpploe~s #4 - Am~lysk of Cott~ G-rove Soil Eryn yo ora TTa~bblleeLL SSuummmmaarryy ooff PPFFBBSS,, PPFFHHSS,, PPFFOOSS aanndd PPFFOOAA iInn SSoolill SSaammpplleess CCoonnttiinnuueedd EE EEEEE CSomue gGinmommee 2 or3 o1om r3oommo3rwomomz3 gmoogRom pmmzomroI fMm o mnognmme= REozo oro Oromo muogmesmm gDoloD oH OXoOZ EpRess Exygen Res~ch 22009955..00228833 || res200177 Page 32 of 177 J| 33MMAA0011555522006600 FE -- fToanbe. Table H. Samar ofPFD, NFERS,FFOS ad-- PFOA in Grad Summary of PFBS, PFHS, PFOS and PFOA in Groumd oe eon Water Samples C~8~411 ~W*~4MNO~I~ 11880 30 ~7~ 4~ 8SO ~0 ~ ,tO FS amt Exy~n R~.h mesa i Page 33 of 177 22009955..00228844 33MMAA0011555522006611 InW~tatet~reiirmmSRReereppploetrts##44 - - Analysis Amdysis of CorageGroveSoil of Cottage Grove Soil sad mtd Water Sampl~, Exygen Study No: P0140 E.xygen Study No.: TTaabbllee HIIII.. SSuummmmaarryy ooff PPFFBBSS,, PPFFHHS5,, PPFFOOSS aannddPPFFOOAAiinn RRiinnssee BBllaannkk SSaammpplleess p-- ommmn citmar onrdSoSmUsESi cre cons commen 0 - wo JUIN 22009955..00228855 i raes4ot177 | Page 34 of 177 33MMAA0011555522006622 -------------------- SnrsNeeer 4 - AiCsosa Grove Sind Intcri~ Re~'t #4 - Analysis of Cot-tag~ Grove Soil ax~d Wa.ter Samples ErynSyNo: OO1400 Study TaTbalbleeIIVV.. MaMtartirixxSSppiikkeeRReeccoovveerryyooff PPFFBBSSaannddPPFFHHSSiinnSSooiill SSaammpplleess | oe mal Em sme lle wm afew om x mm ot - o - ~ : . - - mmm |e om we] w ow ow ~~l ~ l~ ~ ~ ~ 0.41~ 3LO 01 ~i~ ~~ ~ ND ~2 ~ ~ ~ ~ 312 ~ pr~1~1~ |~ . Boge Rosh 22009955..00228866 ra3501177 Page 35 of 177 33MMAA0011555522006633 IWcatie SRueppols#4 -AnyiofCoteGroveSiland Ex~ yne SSttuuddyyNNoo:.: PPOO0O0O14I000 TTaabbllee IIVV.. M Maattrriixx SSppiikkee RReeccooCvvoeenrryty.ioonffuPePdFFBBSS aanndd PPFFHHSS IInn SSooiill SSaammpplleess Continued -- Bo WI re rey it Wien ot Sear ENTE am a wee ow mmm LD DDD ID meme 10D LIS TL mmse [ID 0 CD D0 ExypenResearch Exxon Re,~r~h 22009955..00228877 Pugs 3600177 Page 36 of 177 I3MMAA0011555522006644 --_------ friuReng AroCotsGoveSlad Inmrim R:port #4 - A.rmly3i~ ofCottag: Grove Soil and Water Sample:, Eoos 2m 0100 Erygen Study No.: P0001400 TTaabbllee IIVV.. M Maattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSS aanndd PPFFHHSS iinn SSooilll SSaammpplleess CCoonnttitunuueedd -- ee Ts tant Moser oa Whang Mond Ror EEER lo oT AE Tol kW | cm uz a r---- | w]e NST | w|i wr " | "| we -r wr a wom om ww wm mw ZsEeEreE | || e ow fam ww es 2s a ---- 22009955..00228888 nesta i Page 37 of 177 33MMAA0011555522006655 S-- e -------------------------- fEEEioSC St IntCt-6~ R~l:X~t #4 - Ar~lygis of CoRage Grove Soil and Samples Dts Exygea Study No.: P0001400 TTababllee IIVV.. MaMtartirixx SSppiikkeeRReeccoovveerryyooff PPFFBBSSaanndd PPFFHHSSiinnSSooiflt SSaammpplleess CCoonnttiinnuueedd gr THESE i vee TE SE 1o~ 141. lOO SE le ow fem1~ m~ owM mes || mart lle - = o- l= ejman =- = SEE |] |~ meme || DL Ah Jaf - a Il . @ 2 4M BEE 4e~ le uw afidw @ = ra wn wm we om ww i nn ---- Exygen Reseaxch pe 8177 Page 38 of 177 22009955..00228899 33MMAA001"155552200666 l aIWnattteeerrirmsSRaPem.pepoplroetrst #4 #4 - Ansiyss Analysi~ of ,of CorageGroveSoil Cottage ~ro~e Soft and and Water Samples Exygen StudyNo: POX1400 Exygen Study No.: P0001400 TTaabblleeIIVV.. MMaattrriixx SSppiikkee RReeccoovveerryy ooffPPFFBBSS aanndd PPFFIHISS iinn SSooiill SSaammpplleess CCoonnttiinnuueedd so EE VUE NS eTe h Ve em ice swe crv a wm om "| = ww TR [m0 om we camsecomon | om ow = | Exygen Research Exygen Research 22009955..00229900 PaPgagee 3399o0f117777 ! 33MMAAQ011555522006677 e rereee. InWtaetreirmSaRmeppelrets#4 - Analysisof CartageGrove Solad `EExxyygge~nSSt~uddyyNNoo:.: 1PO~O0D1I4A0N00 TTaabbllee IIVV.. M Maattrriixx SSppiikkee RReeccoovveerryyooffPPFFBBSS aanndd PPFFHHSS iinn SSooiill SSaammpplleess CCoonntl~innuueedd oes To IOE wre Soi ia tomsScam SNELL [mm we nm wm a cmomiscaonmsomi [a0 me we]| ow won comssconesse | mT Jae ws wee wm ow mee LDU TI WI EExxyyggeennRReesseeaarrcchh 22009955..00229911 PPaaggee4~0,00o0f117777 ! 33MMAA0011555522006688 -_ WerinSRumpee4 yi of ona Ge oan [EE -- TTaabblle IVV.. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSSaanndd PPFFIHISS iinn SSooiill SSaammpplleess CCoonnttiinnuueedd a ET A mee i TIS im ter J o wi ow |e|m om os SSE. ow om afew ow r mmeaed STE pm, e m mw owwwe|wom =om - oe afew I EE EERE mmm, Le we es ww mew ww EunRevs E~ygcn ~e~aych i Peston? Page 41 of 177 22009955..00229922 33MMAA0011555522006699 ------------------------------------------------------------------ rnRept 4 -Analysis ofCong GnSfad In~,-im Report ~ - Analysis of Cot~ge Grove Eoil Vir Sanpls Water EenSudNo01400 Exy~cn Study No.: TTaabbllee IIVV,. MMaattrriixx SSppiikkee RReeccoovveerryyooff PPFFBBSS aanndd PPFFHHSS iinn SSooiill SSaammpplleess CCoonnttiinnuueedd EE gr rs ww ErynResearch Erygen Research 22009955..00229933 PPiae~ 4220o0f117777 ; ; 33MMAA0011555522007700 tpmeette cssrf Cogvesiind Eos---- Exyg~n Study TTaabbllee IIVV.. MMaattrriixx SSppiikkee RReeccoovveerryyooff PPFFBBSS aanndd PPFFHHSS iinn SSooiill SSaammpplleess CCoonnttiinnuueedd gh, IEEve LE or wy 41.1 SEER aw ow wf mw ow ~e EER SmEmEmR TE Em EET fae. LlIeL OaL Jule wm (ale wr [mle = ee = wufeelfe owow w[afw nme mw ow ow ow lpi BogenResarh Exygen Research 22009955..00229944 Ped3otin Page 43 of 177 33MMAA0011555522007711 T Ii r Reet Ais of Cota Grove Sand Interim Rel~'t #~. Ar~iysis ofCottage Grove l~oil and Water Samples xn SoyNo: FODIA0 Exy~-n Study No.: P0001400 TTaabbllee IIVV.. MMaattrriixx SSppiikkee RReeccoovvee~ry"ooff PPFFBBSS aanndd PPFFHHSS iinn SSooiill SSaammpplleess CCoonnttiianuueedd sr ET i we TE ie wr =5EEs (ale ow eam ow a conavsacar on > AUTEN mf mm wm) wr - BE HE To === 0 - HE - RETR rr ores | opmRs Exyg~ Research 22009955..00229955 -- | Page 44 of 177 33MMAA0011555522007722 IncrerSReaponrt 4 -Any ofCotge revSiland Water Samples ExumSudyNo 001460 Ezyg~n Study No.: PO001400 TTaabbllee IIVV.. MMaattrriixx SSppiikkee RReeccoovveerryyooff PPFFBBSS aanndd PPFFHHSS iinn SSooiill SSaammpplleess CCoonnttiinnuueedd -- EETU EEE fMee NO EET le 4e mena | - 0 Smet Jule Zen leeNO i] "| wo Smet ma SEIZE NO lee ale || 0 N~ 4t ND ~ ND EEE ae EE aU e E te om fale = new ww >. w || om we wef wo a fwfe =o - "| won om new mw | w|w wwe wm -- ow ow ow a El - ow ow ww mw = |=: om. oot tin) | | 0 wn oo. -- | ExygenRerarh 22009955..00229966 PPaaggee d45ooff117777 | 33MMAA0011555522007733 II WmacrerSRuerpet#4 -AnalysisofCotageGrove Sand Exp Exygen SSutuddyyNNoo..: PPOo000112~030~ TaTbablleeIIVV.. M MaattrriixxSSppiikkee RReeccoevCveoernzytyioonfufPePRdFBBSS aannddPPFFHTSISiinnSSooilll SSaammpplleess Co~ttiaued -- TE EE ryJE VE Te ter --ei. | EE I ==: - = " wow i amo, | | -------- R w ww nme m= on IIE jae = Hn ww EprEiRorEy Bll w ew fe| ] mom ow | ExygenResearch i Pagedof177 } 22009955..00229977 33MMAA0011555522007744 ----------------E-- E ---- ---------------- ------ -------- IVnersReuess Ay CotogeGroo veSilnd. Inmr~m Ro~r~ #4 - Analysis ofCottns Grove Soil Water Samples xyes SyNo PO0D1A00 Exyg~n Study No.: TTaabbllee IIVV.. MMaattrriixx SSppiikkee RReeccoovveerryyooff PPFFBBSS aanndd PPFFHHSS iinn SSooiill SSaammpplleess CCoonnttiinnuueedd my C~I~N -~9-W PAI}'I -{:)O-O I GO EEE Cawu EET SEITE, (aw ow afafw ow om ZI um we om |afm ow ow mr | a| ~ - -= - - C,GM~; -B KGO 1-4),,015Q Sommer Exygen Research 22009955..00229988 Pedra Page 47 of 177 33MMAA0011555522007755 tinRep 4 Anyiof oneGrove Si 0d Lnterim Rel~n ~ -Ar~ysis ofCo~ G~ove So~! and W Waatteerr SSaammpplleess EanSty No: 01400 Exyg~m Study No.: TTaabbllee IIVV.. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSSaanndd PPFFHi]SS iinn SSeoiill SSaammpplleess CCoonnttiinnuueedd ET TL eT i ter 4e NO 4M ND Jon iE I = ZI H a(a. - 0 1: -a rm, ale me nee ww PR | BogeResch Exygen Reseaych 22009955..00229999 Peder) Pa~48 of 177 33MMAA0011555522007766 WeriSnRumep p4 ysis of CoteGrove etd Int~im Rvport #-4 - Analysis ofCollage Grove Soft ~md Wste~ Samples Bren SdyNo ROD1400 Exyg~ Study No.: P0001400 TTaabbllee IIVV.. MMaattrriixx SSppiikkee Continued RReeccoovveerryyooff PPFFBBSS ContLnued aanndd PPFFHHSS iinn SSooiill SSaammpplleess El EE we i Es po | mmm (ole om wee om ow EEE we om wm] ow SERRE es. 3 JE ~ = one ne te (wf we nfm] e we i Bon Reseach Exygen Research 22009955..00330000 PPaege d9oof177 ; 49 177 33MMAA0011555522007777 IWhntatmteze~rrrnSnRaPem.ppqoixcr~st ##44. --AAnnaallyyssiissooffCCoottttaaggeeGOrroovveeSSoo1i1aanndd Water Sampl~s EExxyygg~enn SSttuuddyyNNoo..: PPOOQ0Q0I1440000 TTaabbllee IIVV.. M Maattrriixx SSppiikkee RReeccoovveerryyooff PPFFBBSS aanndd PPFFHHSSiinn SSooiill SSaammpplleess CCoonnt1i~puueedd -- rd i f - fe EE RII TIT ITINT eer em i i ExygenResearch PaPaggeeS5000off117777 22009955..00330011 33MMAA0011555522007788 ---------------------------------------------- Iteer AyoCons Gres ~tcrim Report #4 - Analysis of Cotlag Grove Soil and Water Samp]es Exypen Sud No. FOOD Exygcn Slucty No.: P00014.00 TTaabbllee [IVV.. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSS aanndd PPFFHHSS iinn SSooiill Sammpplleess CCoonnttiinnuueedd sot Er hr ----. 1 3.81 200 4;I 37'7 SSsE , ~i.o.oooo (LID | | =m~.~ ND fom Ica e40le = w}fefeDoum EET [| 6 mn mw ow om in wi mnin) | [0 a" NO 313 wl -- i E ETe Te LL vrei || ExperResah F.,xyge~ Research Page stof177 i 22009955..00330022 33MMAA0011555522007799 rin RA e ic CoteGeo eSlind WInamterirmSaRmp~l'e~s #4 - Analysis ofCotmg~ Grov ',~o~I and gnSay osFDI0 `TTaabbllee IIVV.. MMaattrriixx SSppiikkee RReeccoovveerry; ooff PPFFBBSS aanndd PPFFHHSS iinn SSooiill SSaammpplleess CCoonnttiinnuueedd EEE meBOTEE ie me ER. |: a wfmlm moa RET T [[afee wowu aa]jea|)w w= wa S a ER[alE e wD r wa IL]IOTom ow T am a y a"|l1 ew o=n e (lwoalesa =ur - it = | Bop Reh 22009955..00330033 i ge 20177 ; Page 52 of 177 | 33MMAA0011555522008800 FE -- I mSr Ruep 4 Ayisf Comp Grove Sil [nwrim Report #4 - Analysis ofCottas,~ Grove Soil and Wate~ Samples Engen SyNo: O10 Exyg~n St3~dy No.; P0001400 TTaabbllee VV.. M Maattrriixx SSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PPFFOOAA iinn SSooiill SSaammpplleess Ew SERIE (aw I: Pa ----E [| em - -- 2 aw ma fe| wa ! Pr | EExxyyggeen~RR eseeasrec~h 22009955..00330044 PaPgae~ S5330o0f117777 { 33MMAA0011555522008811 WnIamiaceirrimSuRRreeppgooerrstt ##44 -Analysis ofCaiage - Ana]ys~s of Cot~ GroveSol Grove Soil nd Wa~er Sample~ ExypenStudy No. PIOOI4O0 F_.~ygen Study ~&~.: P0001400 TTaabbllee VV.. MMaattrriixx SSppiikkee RReeccoovveerwy ooff PPFFOOSS aanndd PPFFOOAA iinn SSooiill SSaammpplleess Continued Continued sy BnTA Ss me i Wine po mere 42.9 Z;*40 444 Smee (100 eM MEE 440 wi 4~ J 4~ NM MR EExxpygr~RReesseeaarcchh 22009955..00330055 PPaaggee S5440o1f117777 ! 33MMAA0011555522008822 WoInartteierrimSRRaeeplpi~eorst 4#4-- A Armlysison offCCoo'ringgy GGrroovveei SSioillaanndd Wate~ Samples BogenStyNo FODIAD) Study No.: P0001400 TTaabbllee VV.. M Maattrriixx SSppiikkee RReeccooCvvoeenrrtyyoionffuPPeFFdOOSS aanndd PPFFOOAAiinn SSoolill SSaammpplleess Continued SaE co I ef SEITE ew ,61 ~ ow a| few wwe]w 4a.l ew =a E emi Ea | ewlee 334O | w we cmefe wwwwow = Exygen Research a i 22009955.00330066 PaPaggee S55Sooff 117777 i 33MMAA0011555522008833 - n lieRie Anisaf Crag Govan Interim Rq~xr:t #~ - Ar~y~s ofCollage Oro~e Soft and Wa~r ~Sarnplc~ esy y No:Pe 0100 Exygen S~udy No.: P0001400 TTaabbllee VV.. M Maattrriixx SSppiikkee RReeccoovveerryyooff PPFFOOSS aanndd PPFFOOAAiinnSSooiflt SSaammpplleess CCoonmt.itinnuueedd a Te rc I080 AE ZEEE mmos [uf | 2 il WE74.0 wm few ow EE = pA m. = EE| zo PwR------ la]. w Iw mw ;0~ | FE mm ov alafs 2, | EL i EpRah Peeseer } Page 56 of 177 22009955..00330077 33MMAA0011555522008844 mse Aso sont ortynos nth Exy/~n Stucty No.: PO001400 TTaabbllee VV.. Continued M Maattrriixx SSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PPFFOOAA iinn SSooiill SSaammpplleess Continued a EE mesE. EEE : To - TI 130 NR NR 221 282 545 See 1 fz A meme DD IID I EEE lu ow afejm ow pe EE MI FEET ------------ | Eenfv Exygen Paster | Page 57 of 177 22009955..00330088 33MMAA0011555522008855 -------------- gp~-- -- ne Be 4 Ansa CogsGovan Bye Sty No: R100 In~-im Report #4 - Ana3ysis ofCottage G~ove .%d and i Water Samples Exygen Study No.: P0001400 TablVe. MatrixSplkeRecoveryof PFOS and FFOAin Sil Samples Table V. Matrix Spike Recovery of PFOS and PFOA in Soil Samples CCoonnttiinnuueedd mm EE iveeBE a we 191 310 178 Br | SomRen Exygen restr | 22009955..00330099 33MMAA0011555522008866 ~Waattt~eiirmnSaRRmeppleoerstp##44 -o-AAnanrlaylystsiissooffCCoorttaaggeeGGrroovvee SSaoiflt aimndd W~ter Samples E`ExxyyggeennSSttuuddyyNNoo..: IP~O00O0I1A~0)00. TTaabbllee VV.. M Maattrriixx SSppiikkee RReeccoovveerryy oeffPPFFOOSS aanndd PPFFOOAA iinn SSooiill SSaammpplleess CCoonnttiinnuueedd po a Tio ied maSoi rWhyen Me Ree rinsel fo wm 242 nh w www 2310 147 371 810 RENE ew om SEE | mm SU || ww ee eee caw81.8 wn en wow [Tp -------------------------- | ExEyxyggeennRReseseeaarrcchh 22009955..00331100 PaPgagee 5$990o7f117777 33MMAA0011655522008877 VicerriSmRRaeperoporsrtt 4#.4 -AnsysofCota - GrowSol and Exygen Sd No:POBOIA0 Ex-ygen S~udy No.: PO001400 TTaabbllee VV., M Maattrriixx SSppiikkee RReeccoovveerryyooffPPFFOOSS aanndd PPFFOOAA iinn SSooiill SSaammpplleess CCoonnttiinnuueedd -- rT sm 2 VEA mor PciI SEIT, aw SEE (aw I ww be oe www won ow on EmE camE se (ew mee | mw oe alww afm ow ow : B B IST E earnreraemeanarran i | EExyxyggeen~RReesseeaarrcchh PPaaggee 66000off117777 22009955..00331111 33MMAA0011555522008888 m VnisKeia4pyof ConGrnSolnd Interim Report #4 - Analys~s of Cottage Grove Soil and Water Sample~ Ben Sty os: POA Exygen SmdyNo.: P0001400 TTaabbllee VV.. MMaattrriixx SSppiikkee RReeccoovveerryyooff PPFFOOSS aanndd PPFFOOAA iinn SSooiill SSaammpplleess CCoonnttiinnuueedd pe ml Emm EE ~) pA | EERE (alm x TTEEED [L| annwow EEL [| wm SErEa R| L w| -e- meael|ee mw] aw=i w eCelle. ==NR NR wm MR NR me 7~ =- .- EEEERRRE BxpoResen Exygen Research 22009955..00331122 i Pala 177 Page 61 of 177 33MMAA0011555522008899 _--- nnrrRepon 4 -Aniiss ofCageGrove So and Fo: ye Sudy No: 20001400 Exygen Study No.: P0001400 TTaabbllee VV.. MMaattrriixx SSppiikkee RReeccoovveerryyooff PPFOOSS aanndd PPFFOOAAiinn SSooiill SSaammpplleess CCoonmt~itinnuueedd -- lL 290 sme La LDL hI N~ N~ SEINE af we i: - . mm fa. ow fe] m = 2~ Ta pra eitt, |e] [ew w ow wwwi|wp "woww 599 7~ i I L BE r------ ExygenReser Exy$m Resea~h FugPag~ 20f177 62 of 177 | 22009955..00331133 33MMAA0011555522009900 0 srotrmiris ie interim Report #4 - Analysis ofCottag Grove Soil and Exygca Study No.: PO00140O Wa1~ Samples TTaabbllee VV.. MMaattrriixx SSppiikkee RReeccoovveerryyooff PPFOOSS and PFOOAAiinn SSooiiSll aSmamplpeless CCoonnttiinnuueedd -- TI A me 0 TUR oe nee =m Ln Donn Ee Is iE =| so 4: ww ri LE --T2ER | w | comamcruscen wow zl ww ow on | PoeRear Exygcm Research 22009955..00331144 PPaeges633oorfi17T7 | 33MMAA0011555522009911 oWraiSRrppt4 Arps ofCoteGrove Sand Ey StyNo. P0001 Ex~gen Study No~: PO001400 Table V. Table V. Matrix Matrix Sjike Sl~ike RReeccoo`vvCeeorrnyytoiofnfuPPeFdFOOSS aad aad PFOAinSoll PFOA in Soil Samples Samples Continued |%) SET ene ow nea ow oe = " afafu a ZwIiE ale ow aa|lw SO Eom E~gen Rear Rt~arch Faso? eagr 64 of 177 i 22009955..00331155 33MMAA0011555522009922 Wnaetce SRuerppoirets 4-An fCoragy eGroveSi oiland Exyaen StdNo. 20001400 E~ys~a Stray No.; TTaabbllee VV.. M Maattrriixx SSppiikkee RReeccooCvvoeenrrtyyioonffuPPeFdROOSS aanndd PPFFOOAA iInn SSooilll SSaammppllees~ Continued Po oa VAR ER me TU TT SEE ww wm we wow ow SmmEeaIamZtEesD |*([aw1 mmwme femlma a ow moa EIEN | - | wom IEE [we we R scy a 4 wo ow | wl um wow lei uwlainm [21 ww ow om Ww a Zmmemee| 0 inTEE [w]e afew ww | - ow a ee SFREEETSEI, ||.u|l ww i| s "oe | 2 ------------ | ExgnResech PaPgagee66550a0ll17777 22009955..00331166 33MMAA0011555522000933 -_-- t Ti nr 8 Aars f Cote Grove Sod Interim Rqx~t #4 - Analysis ofCottage Grove Soil and Water Saa~l~s xySty No:OO1G0 Exyg~a Study No,: P0001400 TTaabbllee VV.. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PPFFOOAA iinn SSooiill SSaammpplleess CCoonnttiinnuueedd yr EE A mn GT Es er sm (Lew | Lo = ZEEE a. w a eualea mToEw renin lle a MY on of Jo " alelm ow ow gman, lala wo fw mow | ETE fm we nfm ow 1 Errmeeame aeons i :. ExygenResearch PPaaggee6666.o0f117777 i 22009955..00331177 33MMAA0011555522009944 - fioeoepdatbh Asiof CompsGroveSaint xenSty ocFont Exygen Study No.: 1~001400 TTaabblle V. Contos MMaattrriixx Sppiike RReeccoovveerry of PFOS and PPFFOOAiAinn SSooillSSaammplpeless Continued EEE mn EE. seme |. ET [wl mE (LT EweEnRsE, Lfoab. mmm le a : NEVE mw mmm ow :: no Co Jil -oomw ow | vm EMME NP | pn Reh Exygen Research 22009955..00331188 Perot Page 67 of 177 33MMAA0011555522009955 EirnvRiorn4Aris of Cota Grove Sand. BySygNoeP01n00 Exygcn Study No.: PO001400 TTaabblleeVV.. MMaattrriixx SSppiikkee RReeccoovveerryyooff PPFFOOSS aanndd PPFFOOAA iinn SSooiill SSaammpplleess CCoonutfilnnuueedd dv TREE i ve BE a may ,.,~..II~ (%) 2~4 40 SE (aw om ee 5Z7 piimigl al 52.7 4~ rene | | 13.1 we ow 32.4 BmEE,a2m:28.2 womo wwf|aal|we w- o.a SEER m Le we3)'5 wa] ow 2LT Arn, Al ee en 18,5 EER [ive = wm] = 4 Sm[mw ow mle]a ww ' Aemma Faye Resch Exygert Re~ ~rch Fagor177 | Pag: 68 of 177 22009955..00331199 33MMAA0011555522009966 IfnentRiepdt 4 A of Coupe Gove Silk Interim Report #4 - Analysis ufCottage Grove Soil and Water San~les FSly y No: n 0001400 Exygen Study No.: P0001400 `TTaabbllee VV.. Continued MMaattrriixx SSppiikkee RReeccoovveerry ooff PFOS and PFFOOA iinn SSooiill Sammpplleess Continued wr EEE i vr TE a wpe FeETtE (wm wm w|al| m TT FHaEn T i(a mw ; om i w]e] ". om ow Zo. | " wm owfafm ow oa EE |] moeem ew EER ue ow alee ww po | . lz) oe mee LLL | Seow 40 4O0 ~ 1~1 Be erirero---- Ege Reach Exyggn R~search Pa 9ar177 Page69 ofi77 22009955..00332200 33MMAA0011555522009977 InterimReport#4 -AnalysisofCottage GroveSoiland. `EExxyyggeennSSttuuddyyNNoo..:: PPO000001I440000 TTaoblme.eMatrix Spike Recoveryof PEOS and PFOAin Soil Sumples Table V. Matrix Spike Recovery of PFOS and PFOA in Soil Samples CCoonattilnnuueedd wt EE en TCE re. wa maa. | we ow |e] wm ow ow 2 uw we we w own EET (fw ow www ow ow : Bm Roms Exygm Re.~ar~ 22009955..00332211 Pe000177 Page 70 of 177 | 33MMAA0011555522009988 IIWnnatcteerrrimSRiPem~ppeoplroertst 4#4 - - Analyse Analysis of of Cong Grove Cottage Grove SilSoi! and and Exysen Std No: 0001400 Exygcn Study No.: P000t400 "TTaabbllee VVII.. MMaattrriixx SSppiikkee RReeccoovveerryyooff PPFFBBSS aanndd PPFFHHSSiinn GGrroouunndd `W Waatteerr SSaammpplleess SEER ow mf mow mame ole ow wee ow ow Seresvee, : wo om ame om ow EEL mw wm www ow ow TEITUEE wv SE (mle ow SIE m| wm w | mm ow em we ow [w]e = BogenReseach 22009955..00332222 PPauggee7Ttraonf 117777 33MMAA0011555522009999 _-- IInnr~reri~rmmSR~ uemppt##44 -Anyi - Ar~ysisofCota of Cottage GGrroovveeS~ooiil aanndd W~t~- Samples ExyyenSuNdoy: i100 Exyg~n Study No.: P000 | 400 TTaabbllee VVIL. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSSaannddPPFFHHSS iinn GGrroouunndd W Waatteerr SSaammpplleess CCoonnttiianuueedd = Ear EE eae "Ee = Doz : ToT Sos, me SEE ele ow [A= elo -- B ET EEs "fmf 2 ee wmf e E aEmREmTE IaI,E |i emww m| ofe DL ow ow w om w megs || w - -|- - ExygenResearch 22009955..00332233 PPaaggee T7220off 1! 7777 | 33MMAA0011555522110000 rrrroer---------- IIIIIIIII I VtianaRespa4 Ary fCotageGrove Sland kstm4.m R~-/mrt ~ - Analysis of Cot~ge Grove $oil and Wat~ Sarr~lcs ExonSud Nos i160 Exygen Study No.: PO001400 Water Samples TTaabbllee VVIILI.. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PFFOOA Iin GGrroound Water Samples w Eme me OI| D OL IID on) J~2~ == - TESIEE ew ow Hzlz we 712 Jr. i oeSl wi Jo ! EonReseach Exygen Research 22009955..00332244 Pa3ogr1e77 Page 73 of 177 33MMAA0011555522110011 _-- InIWntaettmreirmmSRReup~iorrstt 4#4 --AAnnalaytys~issooffCCoottmagge~GGrroovwe:SoiSoil aanndd FExxyyggeenn SStuydyNNoo.:: POO P0001400 Water Sarrr~les Table VIL. Table VII. Matrix Matrix SS`ppWiaikkteeerRReSecacomovpvelerreyysooCffoPPntFFiOOnSSueaadnndd PPFFOOAA iinn GGrroouunndd Water Samples Continued (%) 1~ 110 ExygenResearch Exygen Research 22009955..00332255 Page to 177 Page 74 of 177 33MMAA0011555522110022 _--mm WItnreteirrimSRRaempppolorertts##44 -- rays Analysis ooffCCootttaagseGGrroovveeSSoofit aanndd Water Samples BEoxryggeennSSu~ddyy NNoos.: PP9O9000114A00~0 `TTaabbllee VVIIILI. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff 13CC PPFFOOAA iinn SSooiil Sammppllees -- S--= SCcvc c_eooomaav--avvnt ntnea--aeees ccrooaCSmmosemmomsEseossironoonurNnrneicoceeneoToeonms:ss a fT&mo:..:e CEesac3=Ea3dodnmrnon Reu"5i5umT 359Re sem SSsasmcraorroe o bg 5 C008135~ Spk E ors a = 2 ~1~ ~ F ceovve msseicom . = " ~13~0 S Samts SfCmoesmseibceacds 5i @3 5 C0~1360 3~ 0 comm caomliasssorrooadms &` = =2 CO)~1~ C00~1381 Rep SSoome f mE a = 5 C~3~ ~ ~ ried a = 3 C~0~361 ~,~ J roeoanis cSounssommosme ` so 000~13~ CGMN-SS.D I01 -~0~ CGMN-SS-OI01-D8-~15 GCqv~N-~I01-~ CGMhk,..qS,C~ f -0.0000 CGMI#-S~B'20~ -O~X~ CGMN-S.S-O2O~.O.O005 CG MI/-S~D201-GO)05 CG~.SS-DL~I-O~X~ CGklN~.-D201-~0~5 CG~N-SS-O202-O-0000 rcS aaromemtnEle cSSBoaumnmRmsssTtsIeooRmmeEoaeeoteRe &:".i ii=2=nw 382 C0~13~3 R~p SURES SSursatacmes as =Ed 22 C00~1363 ~ ~ cocrrme camssovaom . am " cooals74 Game s Carshieet ` i 5 374 Rep fet sonso o FY 2 C00~1374 Spk E e SNE, - ne 2 C0081374 Sp~ F CGbIN-,~D~02-0~ C~I~r202-0-00C5 CGI~-~%~D~ ~-0.0000 CGMN-SS-D101~-0000 CGMN-~DI01.~ CGM~-SS-~I01-0-~XX) 4 3.34 40 34.3 ~ ~ 4, 3~3 ~1 40 3~.3 78 4 3.~ ~ 80 4 3~Tt 82 40 29.6 74 400 293 73 4 3.17 ~g 4 3.1'0 78 4~0 3~7 79 4 307 77 4 3. I0 80 aO 30.8 77 ~ z~r0 ~ Csa cCacoeomaotnmsaniesaessasn cffOCTonmmerasssessrEsawttcmseietaaocsrescc:u]dss &a-::.PoEE2aFkuSmdS 22-5-i iiii| C00~13s0 Gfoeneint msioom o 38 5 C~0813~ ,Spk K _-- Dns oom a = ii C~0~13~ S~ L C~MN-b~-81501.,D.CO~ CG~t4-SS-815~1-O-O000 CGI~,;-S~P815~1.4~-0000 4 3.5/ 89 40 34.5 88 400 30~ 70 EExxyypgeenn RReesseeaarrcchh PPaaggee 77550o1f117777 i 22009955..00332266 33MMAA0011555522110033 _------ ---. -- InWIntiteeerrriimmSRaRemCpploXlraet-st ##44 --AAnnaaldyyssiissooffCCootttaaggeeGOrroowve=SSiolil1nd Wat=r Fem Exyge-n Study Study NNoo:.: PPO0O00011440000 Continued T`Taabbllee VVIILIIL. SSuurrrrooggaattee SSppiikkee RReeccoevveerryy ooff ~*3CC PPFFOOAA iinn SSooiill SSaammpplleess Coat[aued --_-- --_c--oger GcccS macaoooovrmmnmRemesese C~081184 cite C0~1 ~64 Rep Smee C~0~1164 Spk G saan C~11~4 ,,.~k H cous C0081165 C008t !65 Rip Gast C00~1t~5 ~ I Gceoot ~0~11(~ R~O EES C00811~ Spk K amine C008"V~ Sp~ L comer co581 re7 ames C~]1157 R~p Grae C~1 f67 ~ C Gero C0081167 Spk O conn C~0el 1M Scaainmaen C008t t88 Rop esomn e B fScScoaCroMmmommsSsmeE EaeoIicEcsooaEmmimIoocodmotunmsm CGMN-SBC.O'2~O0SO Sls C'G MI,~SI]C-D20~-.O-O0~O Caneomiss CG~ Gimsocom som ~X~ikl~2~ consecomoan CGI~N~,5~eC.0203,0,0100 CGMN-$BC-0203-0-010~ amiaimaon CG~N-SI~,-~Z0.3-O~010~ fcSoomrcM escsoE mteeends C(~N-~203-0-~ 15~ BmE I R CGMN~SC-D2034)-015~ CGMN-S~203-0-0150 comascomsonm C~v:~SB~T~0~2~ Smsarmac C~MN- ~C-D203-O,O2g0 pressed] CGM~BC-D~0200 CEI CGMN-SBG-O203-0-0200 comsocomonm ~8C-O203-0-0Z50 S omammcemIoos CGMN-,~?,-D~-0-02~0 smeovean ba Tmewya TmeT &-55`:.` -ii2=iuaos o"""5n 4 I ~ 49 : in " 4 I.T~ 44 5 a .40 2~.S 59 a = 7 400 2~ 67 . = . 4 1.90 48 4 t.90 4~ s jf a 40 24.2 61 &i. im7 2=a 4 2_00 50 &o E=S *2 4~ 23.3 58 400 ~ 7S . 2 = 4 2.12 53 i i a 4 2.02 51 " = 5 40 23.1 - = 400 252 . = 4 2J~2 6~ s: ikdn H8 4 2,58 68 C008t I~ Spk F on counsscomszon : = C0O811~ Rep Sams BRED 5 2 2 | C~I ~ S~ ~; Sanaa Caine omsen FH Su - C00811~ Sp~ H C(3#~N-~-D203-O-02~O CGMN-S~_~D203-0-0300 CG~N-SBC-D203-0.0300 CGi~-0-0300 Cacacammoaimonrrimoe,ses R cCcrooomuieenssn nagscccooeammisR eonnneesc]nu a4.i` aFIi"s=Hn u5-5" is C_~__117~. ome ECE : fl 5 C0061171 ~ ie Canines 5 kd C0(~1171 SI~ K ama Soimiocomssens & = 171 P>pk L CGN~*SI~)2~0-0350 CGM~I-~C*D2O3-0-0~ CGMI~.SBC~203.0,0:~5~ CGUN-,S~C-D203-0-0350 400 331 83 4 2~0 ~0 33.7 400 342 4 ~ 74 4 2.88 72 40 34.5 ~ 400 347 87' och ny5 hv ie i,ie myAy ne i EExxyyggeenn RRees~erarcchh Page Page 7~ 0of1117777 i 22009955..00332277 I3MMAA0011555522110044 rIanttieerrimmSRaRelgppoeorsrtt #~4 --Ansys Analysis of Cote of ColtageGGrroovveeSSoiiladand Water Samples EyeStayNo. P0100 Exyg,m Study No.: PO001400 T`Taabbllee VVIIIIIL. SSuurrrrooggaattee SSppiikkeeCRRoeencctoolvvaeeurreyydooff UCC PPFFOOAA iinn SSooiill SSaammpplleess Continued ---- CS SaconoeanprgntmT s-- nea ScaBE cSomnmfsoascsiocR oucmomomsmnsoscaS eocrsneenn 0~0811;'3 ci, SNES CO~1 t 73 R~ coos emt C0~11T3 St~ E Coo ar Canoes C0081173 S0k F C G &~I-SBC,-D21)34~0450 CGMN-~..~D203-,0-0450 CG,MN-SBC-D203-G.045~ CGMN.SBC-D293,.I~4.r~ C0081t74 cms C~001174 R~p Sori C0081 f 74 SI~ G Sonesn C0081174 8~k H cons C00~1175 a, C0081 t75 Rap C00@1175 5p~ I San C00~t 175 Spk J SE C0081176 I~ C0081176 Sgk K Sama C;00~117B Spk L C"GM N-.~@C-D~2-0.(~0 Comsatom oom CGMN~BC-Q2O2-0-00~) fee] CGMN-SBC-D202-0-00O0 Conseco CGMN-SBC--D2O2,.O-00OO comsocozo CGM~BC~D202-O-0~50 meme CGMI~SSC.02Q2.0.0~ CGMI~-0.-0~@0 fees] CGI~,.,.~B~D202.0-0~ omEER CG MI~ -,9BC.1~202.~-0100 CGMI~SSC4T202-~-0100 BREEN CCM~-S~202-0-0100 C/~81177 cnn C0~1177 R~ Same 177 Si~ C mms C~177 Spk D conn C00~1178 cdeC0081~78 R~ Samar t78 Sok I::: amma 170 ~ F CGMN,,~202-0-0150 Comncomasos CG M~-SBO-D202-0.,0150 om comoom CGM~.~-D202-0-0150 SERRE GGkB~,--~R~C-D202-0"0150 cosocomcomm C.GM~202,.(b0200 fired CG MP~-6BC.-D20~-O-0200 SmmRerNmRoen CGMN-SBC-D~32-O-0~00 CGMIN-SBC-D202-O-0200 Cscooammmsas f CoEmr mRoI] orm saoron Toae nmeo si+ iaunn a- .4 o:4, 223.2?" H3i]3.22 &4.0 =30.8 4430 338 4. : = 4. & = 40 - =" 400 . = 4 i = 4 40 a = 40~ OL OF 4 40 a = 400 1.82 1.64 ~5.9 243 1.97 1 94 22.8 ~ ;.42 2~.8 28~ 4 t.93 i i] 4 1 .Tg =- == 40 2&8 40~ . a 4 : on 4 o = 40 5 = ~ ~ 2.26 2.06 :29.7 300 &s: EEiddn e5y =: 5n8822 4~ i"4.1 a~, a~1 "49 4~.9 57 i5~ OQ81 65 571 &:48 4,5 67 "i2264 58 52 7,4 T~ =u" fSraemeid nnCaomtroerm &o =rd ii i| C0~511B0 S~ J aun comvsmomans . TM n i C00~,t18t cumin Somvancomacons i 9 3 Sc~oa~18n~ ~aL CGMN~SC-D292-0,.0300 C~S1~.D292-0-03~ NEE ce ~N- SeC-O 202-O-03,SO 4,00 326 82 4 z~ 73 o = " ~00 331 ~4 tc 5he cderwia7 a EExxyypgeennRReessee.a.mr'cchh PPaaggee T770o0f 11777 22009955..00332288 33MMAA0011555522110055 inap Aki fo Go Sod Imam Report #4 - Amdysis ofCottage Grove: Soil and Water S~unplcs Eno:140 Exygen Study No.: P0(X}I400 T`Taabbllee VVIIIHL. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff 1~CC PPFFOOAA iinn SSooiflt SSaammpplleess CCoonnttiinnuueedd Ea e= py = em EEs--y:=i-- <i --., FESgoTuhmuEmn., mgZBagmmEmmmmEeemEmsmeEmmRss E.2m 1fm@mOz E op3o3s CO~1183 Suk EEEm 0 [8% C0~tt~3 R~ CGM~40~ CGMN-SBC~202..O-0400 4 2.81 70 4 2.72 68 18,3 ~ E 1~3 sp~ F a EOi onmf. C0~1 t,~ ge 00~t,1~6 Rep iz C0~1185 Spk I C.,GMIV,-SI]C-D2~-0~(00 CGMN-SBC-D2O2<).O400 ZSmZEEEERmEEEmmEEEm CGMN-.SBC~2~I-O.0000 ZEEE C,3M N..~C.D201.0.000~ 2mEE GQM~Z01-0..0~09 40 31.,,5 79 400 337 84 :I11 . %08FBB &i32i 4 2,90 73 [I 7 4 2.71 6~ i I} 4~ 31.5 79 C008t t 8~ Jin ~11~ Rep gEEeC C0~flMI SI~ K ZSEEEmEE C:~BC-D2OI-4~OG0 CGMN~I~/-DZ01-4)-00~ CGMN-S~,-D20f-0-00~ A|Oi 8OB 1i 4 2.0~ 52 4 2.0~ 52 40 25.4 ~4 C0961186 ~:~ L Ah C0081 !87 187 Rq> EZha C~81187 r:~ C GGMN-S/~-..-D201-~4~)50 Som CGMN-8 BG-D201-0-011X~ Emm CG~80.D201-O-01~] EEEER CGMI,~SSC-D201..0-0100 40~ 26~ ~7 i gf 1% 4 3.56 ~ ORO} 4 3.46 87 i 87 Of 4O 38.2 ~ SIh C00e1157 S@k D C0081188 C00~11~ I~ C0(~1188 ~ E COOe~l 1~8 Sp~ F BZIoTem CGM~SSC-D201-0-0100 GGMN-SBC-D201.OS.0100 C~D201 -D~3~,100 CGMN-SSC~201-OB-0100 CG~4::)~0~00 1L 3BE 1 400 374 84 4 4 3.OS 78 40 33.9 85 Su EEEEE SE22 JoTErnhx%..E Em DSZEmEEuEmEmm mmTmmEEEEmEm::2[IiI: 23O2E 0F% f1%i3i , C0081191 E7 EE SEEEEEE fi OoF iI i C0~1191 Re~ GGNN-SI~D201-0-~250 CGM N-S BC.D201 -.0-0250 1 BF 317 79 4 1 ,~ 4~" 4 1.82 46 191 8,ok K CGNN~BC.-D201.<)-~250 40 29.4 74 Tr---------- C~O~ 191 S~ L CGMI~BC-D201-~-02SO 400 312 78 ; -- Exyge~ Research rer Page 78 of 177 22009955..00332299 33MMAA0011555522110066 IW]nnactetr~emSRRaemepppolorertst##44 - AAnnsaylyssiisooffCCoottamgge~GGrorvovee SSiolilaandd. Water Samples ExStyudyNgoaPeOOCIn400 Study No.: PO001400 `TTaabbllee VVIIIHL. SSuurrrrooggaattee SSppiikkee RReeccoovveerryyooff "13CC PPFFOOAA iinn SSooiill SSaammpplleess CCoonnttiinnuueedd -_-- exm coz S Simn ms atcseantta Comms mn PSiannd C0~)8119<. ~ C00811 g4 Sp,~ H oselnsie comsocomranm CSnREc en pScoe oumssssee ccoommod aoonss eres comsacomisae S Se EoI so CC4dN-SBC.O201 .O.0400 CGMI,FSBC-02O1-0-0400 ee oToa wrehe e=en . - &5 i3 =5 &`. EB2r "4" > ul " . mn - &o4 o HL=E82 s1.1 40Q 354 89 cn C~8119~ Re~ Sf onidm C008119~ ~k J ciara C0051198 R~ Smmierat 198 SI~ L never C~0GI 19i' Pr197 R~I~ Snares C0~11 g7 SI~ C fia ~1~97 Sp~ D cern C0~811~ Et C008119~ R=~ ~1198 ~ E Sse CG~I N-SBC.,D I G,I-0.4~00 fCormaceorsaeodou CGMN-SBO.D 104-Q-0(~) este] CGMN-SBC..D104.~3050 SoBmNssEcoiocosms CGMN-S~.,-D~04-0-0~0 camsacononae CGMN=SI~DI 0~-DB-00~0 mei] CGM~0&.I)B.-00~ nota CGMN-SBC-D104-DB-00~0 NESE CG~N.-SBO.D104..DB,00~ comsmconor CG~IIN4)..0100 SORRANR CG MI~.SI~,,,-D 104-0-0 I00 CGMN-S~!~_.-D164.~3-0100 i = = 4 NR NR && =- =- 40Q NR NR i I 8 4 I_aI 4S -- 253 8is 400 ~/S e,9 ` In = 4 2.18 5~ ` 2 : 4 2,42 I~I 5 Fr u ~O 3~.5 ~4 & = u 40~ ~ 84 ` ws " 4 1.75 ~I 54 40 =1.81 ~1.2 -45 ;'6 cSSooawmsrman fcoSSrmnsioeecnoomtcaioia]nnm a".io 2=i=20n &8o 00081200 cabins Comseoiacocm i in s coo~12o~ I~ SCiomnmsas SCoollnaaoboirooceooicm -& a= a2 C0081200 ~l~ J on cams ` m " CI)081201 C001~1201 Reg GSoomiot EinM ComR iorEms &o F=o =5 ;i C~381201 ~k K L'~l,IN.~.~ 104-0-~!)0 CG MN-.S BC-O 104-0,.(~00 CGMN-,,.,~BG.0104-0,~20~ CG~104-04)2511 CGMN-SBC-D104-O'0ZS0 C(31~g.SBG-D104-0-0250 4 ~..~1 ~ 4 1.7~ 45 409 ~2. ~1 4 1.74 44 4 1.7g 45, 40 28.0 70 a vrtot pee tyom ka i EExxyyggeen~ RReesseeaanrc:hh PFaaggee 77990o7f117777 i 22009955..00333300 33MMAA0011555522110077 VIncalcrlrieimSmReRerpeipoeorrstt 464. Ansys Analysis fCote of Cottage GroveSoil Grove Soil sad. and Samples ExeSudy No: P0310 Exygen SIudy No.: P0001,~00 Continued `TTaabbllee VVIIIHL. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff '13CC PPFFOOAA iinn SSooiill SSaammpplleess Comtinued er Snpe=e, esmr [SSuarsz-- re TTeadm Tmeomls TmReC s.: F2iiw0 "88 203 Pry C00S~203 R.p fred C00~1203 ~ E mar C~0~1203 Sl~ F C008t20S cSoamrins C00~120S r~ O Scaomnni C0081206 C008120~ Rq~ Son C00e12~ ~1~ i RE C00~206 Sp~ J CGMN-SEC-D 104-0.035(} Saco CP..MN-SBC,,O ~ 0,~-0-03~ Canc: CGMN-,SBC-D104-0-03~ CENESIEE CGMN,.SBC.O104-0.0350 CC-MN-SBC.O104J~}40~ SfrEenEteR) CGM~$BC-D104-O..04~ coEmsaceooroeons CGMN-,SB~.D104-0-04~ CGMi~-SSC~104-0-04~ pried CQI~m-SBC-D~ 04-0-04~ ERED CGM~1044:).~LS0 4. 2~2 ~6 : in a 4 2J~ ~ 5 in 8 40 ~4.1 ~gt & = 5 400 365 91 4 2.97 74 5` i2 72 ,4O 3S~ ~ a:o 5= s 4 3,12 TB 4 3.0~ 77 5 = 2 4O 3~.a ~2 a EH 5 400 3~1 ~ C00~1~:~7 cman C~081207 Rep Samak C0081207 SpP, K SSacSoroioEmnoneEns C0~81207 Silk L C~M~k~__.DI O4-1~3-04,~ fie CGMkI.SI~-Dte4-1~B.0450 Dmecomosn C(3MN-SBC-D104~B.0450 fceS omrmeemeU sointimI oe]nyn C~MN-S~,-DfO4-DB-0460 4 3.09 77 i bl 5 4. 3.0~ 7~ & @n 2 40 3.5.8 90 a w 2 ~ 375 ~4 s. 2@0 a= 40 ~..7 82 5 = 3 400 365 91 a aera aSnaenne ai i5 s2 S55 SESE Poon C0011210 C0~B1210 Pep C~0~12t(~ Spk O Crore smn neocon = EY & C0(~121~ Spk N cane po-- ` 2m u C00~t2t t C0~81211 R~ Sai, SNR o ES 1 C008121 t Spk I a DRIES & W 5 C~0~1211 ~J can comacomscom . sm " C0081212 Pei Sno : = 2 i C0081212 R~ F(rEiitn frnsee e] - 2= 57 i| C00~1212 ~K CGIVI~3~I;;~ 1~ CGMN-SSC.D 1~,,,~.~00 CG~ ~.0a,-G4~ CGMN-3~,-C104-~.4)600 CGk~,SI~D l (~4-0,~0 CGI~..SBC.DI~ CGMN-SBC-0104-O-0650 ~MN-5BC,~)I Q4- ~4~50 C~/1~$8C.D103.~-000~ CGllg'6,,~BC.D 103-r.0000 CGMN-SSC-D103-0-0000 4 2.74 US 4 2.72 88 40 35.7 89 400 330 ~3 4 2.~ 54 4 2.~8 ~Z 40 33.7 84 40~ 33~ 85 4 3,03 T6 3.29 ~ 40 30.S 76 C0081212 $p~ k CQMI~SBC-DI03-0-(X)00 400 306 77 tteyhe ct i spey geom ce Exygen Revaeh Exygen gesearch PPaaggee 8001o1f 71777 { 22009955..00333311 33MMAA0011555522110088 _ Illlll I i i Fst e re $4 Aor fCopei GoveSs and. interim Kcpor~ .#4 - Analysis ofCottage Grove Soil and Water Samples Bp Sty No: FOLD Exygen S~udy No.: PO001~O0 Continaed T`Taabbllee VVIIIIII. SSuurrrrooggaatteeSSppiikkeeRReeccoovveerryyooff t*~CC PFFOOA iinn SSooiill Sammpplleess Continued cTaIpO 2 otoneEn7re S cBBZ e SomoE maI=pr o maemZne ~=~0~1215 TFJrs. FE DEonEu C00~1215 ~ G CGMN~B~D103.0.-0150 CGMN,-SBC-O103-0.0"15~ C0081216 Spk H C,GMN~I~,-D103.,0-~I~ pHIEr E MS Ei mseEm i iE yEFE2% iii 2BEB I1 iiiT4 oooaB2%3.88 33o73n2 40 32.2 8! 400 35,4 8~ C00,~121~8 COG~1216 R,~ Zr C00~1216 Spa I gr C00~12t6 S~ J OS2 csrh C0~12t9 2 C0081219 R=p COD81219 ~ C EE C0081219 ..~ D CGMN.~C-D 103-D8.0 ! 50 CG,'W,I.~ BC-D !03- D B-O 150 EEmm CGMN-SSC-D103-OB,.0150 fHEmg C~3MN-.,q~C.Dt03-Dt~--0150 coDgFmauEnomamEsns CG~'103-0,0250 Smo CGMN..~BC-0 t03-0-0250 CG,MN-S BC-O 103-0-025~ EEE CG~-Ol B3.G.0250 4. 3,03 i 8 i 4 2.98 ;'5 40 33_7 84 2 400 363 91 4iT ioe BE .3I3 4 NR NR 1 5 oz 4 NR NR 4O NR ~R 4 400 M~ NR Eo i EB i 4 2.~ 4o 37.2 C0O81221 an, ghee Pons C0(~1221 R~ EE i ZZ i C006122'1 ~ G =r BEE i 7 3 C01~122t Spk H FJcor.m usmoomwas: i f Po B Ensof ] C0061Z22 ,~ok I gr ns i 5 3 ! C0<)8t22~ S~ J Tn conacomens Cm on C~0~I:L~J8 JI, Zs ! 3 I C0~12~6 Pep o2n5 = Ba=x 81 BBF 1}i ! C00~1238 Sp~ g CG~IN-S BC-D 103.,0-635~ C G&IN,~BC-D 103.~,-0050 CGk~,-SBC..D103-O-0350 ~103-0-035~ CG~-,,,~R~.,~103..0-0400 CGMN-~BC,4~I~-0-040~ CG~q-SI~.~.~ 103-0-~450 CGI~I-89C-D103-&-04~ CG'~N~BC-010~,.6.6450 4.00 ~ 4 2.77 4 2.86 72 40 36.1 400 3t3 40 38.0 400 345 4. 2.63 4 2.88 72 40 35.8 C0081238 ~ L CGMN..8BC,-D103..O-04~ 400 3~8 SSTNLINTIMSrrwwimprpipemeinnos resomn ; J Exyg~ Research Pest r177 Page 81 of 177 22009955..00333322 33MMAA0011555522110099 WnInaetceiernSRReuepppolorsst4#44 -- AAnnaalylyssiissooffCCoottta~gseeGGrro~vvee:SSoioflt ndand Water Snmp|es ExyeenSudy Exygea Study No: No.: PPOOS0O0I1A4O000 Continued `TTaabbllee VVIILIIL. SSuurrrrooggaattee SSppiikkee RRevc:oovveerryy ooff ~3CC PPFFOOAA iinn SSooiill SSaammpplleess Coatinued o=m cEonDairnmnes C@01123~ Ccoamnme C00~12~ $1~ E Gamer C00~123@ ~ F cmeC00~'f240 coone C00~1240 R~p See C00~'~240 S~ G Saran CU@81240 S;~ H osatroen StScamemesateoinavmorenussn CG MN -,..~G-D 103..6.055~ Smmseetous ous ~:;GMI,~0-O10~-0~0 nna, CGk~q.SBC-D103-0-0550 comsocomsuon CG~I-SBC-Df03-6.0600 me bram, CGMN-SSC-D103.4)-080e SmErem CGMN-SBC-D103..O.0600 Dmscomaams CQMN-~B~.-D103-(H:~ seoman Tpool ormlmys = &54i mu3Blo -28 4 2,80 70 5: i3n -3 40 36.4 S~ a = z ~ 386 g~ " 0 o 4 2.89 67 : i s 4 2.68 67 - 5 u 40 35.6 89 & = 400 357" 89 G0081241 C~08~241 I~p Sms C0081241 ~1~ I Sam C0~1241 Spk J conC~(~1248 C/X~ 124B R~ Soma C0~1248 Spk K E cont se C~081249 Sn C00~124g R~ Sone C00~24~ .S~ C amas C@081~40 S~ I~ aoe (~125~ C0~'~2~ P4p mSmiere C~;~1~ ~. W ocvoensrt, CGMN-SSC-DI03-O.06~ CG MN-SB.C-D 103.0.06~ Coen bree CGMN-~BC-D1034)-0650 Soman CGMN~SC-O~03.0-06~ commonsows CG MN-~BC-OS~ 1-.0..0~0 CGMN-SBC..DS0 t -0.0000 Comsacow cae CGMN-SBC-G801..O-0~00 cSoomsmscaonm ooosne CGM!~SBC-D~0~..0-0050 Emam CGMI~-SBG.DS01.0~50 frre P-~ M.',I.-S BC-D~01-0-0~50 free CQMN-SBC.+DS01-O-0050 comscomacon CGMI~-SBC-DS01-~01O0 CGMII~DC-D~0~ -0-010~ aSnMgEeSnTS CGM/~-~BP_.-i:N~.,0-01Q0 SSE cnccus os 4 2.72 68 4 2.71 8~ " 5 = 40 37.8 94 a = % 400 35~ 90 . 0 a 4 ZS~ 67 4 2.~1 67 % Er u 40 37.4 94 a` 2u0l o& 4 2A~1 81 : in " 4 2-59 ~ 5 Fr = 4O 34.2 ~ a ES 2 400 370 93 ` Po " 4 Z~ 64 4 2.38 60 =5 =El z2 400 347 ai EBdS 85 cana cansacouroam o m n } r--J~t252 fy ao C00812~2 R~ Sova) maipmsg ai: EuBl 2 i| C0~12S2 81~ I CGMN.~(:-DS0t-0-0200 CG~IN-SSC-OS~ 1-0-0200 CGMN-SBC-O~0t-O-02O0 4 2.90 73 4 2.~ 40 38.1 C0081252 SI~ J con comsacouroam o a " COG~1274 camn mano om i bo H 274 R~ SGoiorma frEnetted -5 E3d & ii CJX~I.-%'4 Sl:lk K CGMN*SBC.DS01,.0-0200 CG kt~h..~]C.D'[ O 1-0..0000 CG keF,S6C-D I01..0.~00 CGkW,.-SBC-0101.,0-0000 ~ 4 4 40 344 3.51 3A1 34.5 C0~12074 8!~ L CG~I01-O-~XI~ 400 327 A ------ EvExgyga~tRReesseeaarrcchh PPaaggee 88220o0f117777 i 22009955..00333333 33MMAA0011555522111100 fcrmeepd Amt Gvesoud Bo y os P10 Exygen Study No.: P0001400 `TTaabbllee VVIIILI. SSuurrrrooggaattee SSppiikkee RReeccoovveerryyooff 1'~CC PPFFOOAA iInn SSooiill SSaammpplleess CCoonnttiinnuueedd EE = = -- =a o-- e re meeER eelBeer emDe. EaCgIomHih. EB= TmmEmaEEmmmRE Si|OiEL B B EBF Ef i E]8 C00~1Z76 Sm. omEmamm Gm 8 C0081278R~p Gsarm SZaEmEe E:i #8B0 O4 C00~1276 ~~ CG~I01-DS-0100 CGM N-SBC-D10~ -OB-0100 CGMPF.SSC-O101-DB-010~ 4 2.71 4 2.86 67 40 33.8 85 C00812T6 ~ H C0~!27g & 2279 ~ EEE C008t279 ~ I BBEEEE CG~DI01-DB-~0100 C:GM N-~-D 101.0-0150 C;~,-MN-~I~.~)101-0-0150 CGMN-SI~C-O101-O.,0150 ii 2 i 400 ~ 9t 4 3.38 ~5 4 3.36 84 40 35.~. gO C0081279 St~ J gSaw.2re C0081281 af5 C008128S Rap m C,~081281 Spk D CG~N-SI~C-0101-0-0150 m Zm ZEEm m EmEmm m: .OIO: CG MN-S~.-O102-O-0000 CGIVlN-SBC-O~02-0-0000 ZZZEmmEE;i CGMN-SSC-D102,0,0000 400 4 4 400 338 85 OOBE B3i NR. NR kl;~ NR 8OF 33 NR ~R SE ZEEE OO, OE i C0~81283 a 2 Sw. EEEmEEEEEEmE iL 1 F 7 C0081283 Re~ 8 i C0081283 ~ G ~o8~ 283 ~p~ H an mmm: om op C0~81284 & Se mEEEmEEr 1BEf O} ! C00~1284 R~p BE =EEE i: Of : C~O8~284 3p~ I CG M~-SBC-.O ~02.~.0100 CGMN-88C-D 10:2-0-01D0 C~M!~-~0102-0"~100 C~N-$8C~102~1~ CGk~,~.~8~ 102-0~150 CG~N-~IC~ 102.0,~150 GQMN-,SSC~102-0-01~ 4 2.~ ;'2 4 2.87 T2 40 33.9 ~5 ,~0 ~4~ 87 4 3.38 4 3.20 40 3~.5 C008t284 S~ J CGMN,,,~SC~102,.(~0t~ 400 SE omEms 5 3 | coC0o0n8z12s8s5 couesec oom CGMN-~,-OI02.0-0200 4 sa3.02 7~ i C00812~5 ~ CG~tfN.S~C~ 102..0,~2~ 4 3.t4 7g FEEgE ZBEE EEE:[I Z#I % C0(~12'8~~K CGMN.~E~,~I02-Q-Q200 40 35.8 ~0 Erm C0~2fl5 ~ L CGMN-,S~C,,,OIQ-0..Q200 400 370 ~3 ; sh Exyg~ Rcsc~ch en Pagr 83 of 177 22009955..00333344 33MMAA0011555522111111 _-- binph ifoteoGv Sd ht~'im Report #4 - Analysis ofCottase Grove Soil and Samples sty\o: Ponto Exygen Study No.: P0001400 T`Taabbllee VVIIIIIL. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff '13C(~ PPFFOOAA iinn SSooiill SSaammpplleess CCoonnttiinnuueedd --p_e-- = = e-m --_-- eee Sgaa smEweeeE E mETmmEmEmmmeEEemmm:[ [f0 o3mBEwOEwGEo&n C0081343 CO0~1343 ~p SgwEarE, GEeEmmReeE= 1 B 8 fi C0081343S!~E CG M~.B t501-0-0050 CG M~N-SI~-_~B 1.~1-0-00~) CGMN-S~:-Bt$01-0-00,~, en egw 4 2.91 73 4 2,80 T0 40 35.8 ~0 STaEmeeR oOSmZmewmeesEnsEmO:+foxaOmE oono C0(~13~5 ESnr BEE CD0~I~R~ E Bf C0061.IdS ,..gpk [ A A C~08t34~ ~ J ome mesmem gm gn C00~1346 gC0~1346 P.a# oem ZGEhEee 1 BF C00~134e S~k K E i 7 Of C0~1348 SCk L SS2owe%e BZmaEEmmmEeEm i1 om om C0081242 EE BEE [0 3FO 3 242Re) E E C0081242 Spk C of 3 C0081Z42 ~ O COMN.SBC-B150/-0-0150 CG,Mt~SSC~1501-0-Ot 50 CC-W,N.,~]C-o t ,~0~,O.O~ ~O C~W~,.~...81501.~0t ~) C~1501.,0-02~0 ~&IN-SBI~B 150 F~2~O CGMN-SBC-B1501-0-0200 CGMN,.SBC-B150|4>.02t]O CGMN-SBC-D~I-O-0000 CGMN-SBC-DS01-0-0(X~ CGMN-SBC-DS01-0-0000 C.GMN,,~BC-OS~I-~.0000 4. 2.96 ?4 4 3.00 75 40 34.2 88 400 33~ 86 4 2.55 84 4 2.80 ~S 40 3~.2 ~ 400 332 83 4 NR NR 4 M~ NR 40 NR NR 400 NR NR Sa 2i E% EDZmmEemwEm i 0&5: C0081243 ~ z 0L: BB 83 C0~S1243 Spk F C~1.$ BC~) ~0 I..0-00~, CGMN--gl~C-0501-O-O~50 4 40~ 2.93 Sw EEmI C~)0e1244 ERO: OB Ob C~0~1244 R~) En Z 244 Sp~ (3 EEE OO: i C~8~244 ,?~)k H CGM N-SSC-DS0 'bG~F0050 CGMN-SSC-DS01 -D8-0050 CGMN-SI~C-I;~01-D8-0~50 C:GIMN-,.~C-i~I-DB-OOSO 4 Zg6 T6 4 2.82 71 40 30.;" ~'~ ~ 318 ~0 ome mmmmem wn C~08124S SgEEE @BEEEE OF i C0~124~R~ CG/~N-SBC-DS01-0-~tO0 GGMN-SSC-0601-0.~100 4 2.M 72 4 Z.~ 74 m ; i C0~!24,5 ~ J CGMPt-:~SC,.DS0~-G.0100 400 341 85 SSrumn EmmmEEmmRmEEtE 110: 38 O2f | ComaSaK. Cavsscomnaa Be = i (;~.,0~12~ C00~124~ R~ C0(~.1246 Spt K CG ~'~S8~..-O501- 0-01~0 CGMI~.SSC-0501--0-0 '150 CGMN-SSC.OSgl-0-0150 4 3.~ 90 4 3.3~ 85 40 35.@ 88 re Son esh ~.xyg ~ Rcs~rch -- i fa !| Page 84 of 177 22009955..00333355 33MMAA0011555522111122 --_---- IWInnattteereriirmmSRReupeppelorrsst 4#4 -- AAnnaalyi~si~ooffCCootataggeeGCrrorvoveSSooiilaaondd Water Sampl~ BEaxyyggegnn SSttuuddyyNHoo..: PP00000114000 `TTaabbllee VVIIIIIL. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff ]a*CC PPFFOOAA iinn SSooiill SSaammpplleess CCoonnttiinnuue~dl -- comoanTTTcoemsssT ctmowmeiomT m C0081247 on Smee CO0~1247 R~ core Somat coms C0(~1~47 ~ C Sines ferresatted] C00~1247 Spk O CG MM-SI~.43501.0.,020~ GG Mt~ ~BC-D~O 1..0-0200 CGMN-,~BC--DS0t-0.-0200 CQblq-SBC.,DS01-~.0200 aGGemoianve sge cScormEosNmseSceoErmiRuzEornss C0~1254 cm feria C0(~1254 RII) Sas feat C0~125 S~k G etiot Can crssmoms C01~125~ Sp~ N CGM~A0~--0-00S0 CGI~ N-SSC-FTA0~-0-0050 CGI~ N-SB~--FrA02~-0050 CGI~-SSC-FTA02-0-0050 eSa.a4 :4 "40 a400 5.:4, i4 540 -400 ewm"ec2eaogmnrso 2.~5 mn2. 70 i,%3.5 =329 2===:3.2* bd3.4~ He3~.8 ES343 Eso"Tn7"~ u~ "~4 =~ =uo82 :88 s~0 =80 C008125~ conte prenren] i on 5 C~0~1255 Re~ Goma, CommeCacao 5 EA 5 C00112:55 5~ t Sarvmsin mar arcr & = C~12~,~ ~k J CGM~AD2..,DI~0100 CG MN-SBC -F-~A02.O~-0100 GGMN-~v-~AOZ-DD-0100 CG~,t02-D8-0100 4 3.5g ~0 4 3.7"4 94 40 34.g B7 400 35g 90 C00~125~ Saamivmaax C0<~1~ Spk K Saas C0~812~ ~ L C~81 ~.57 cer C00~1257 Rip Sms C00~1257 SI~ C Ek C0~61257 ~pk D came C0O~12Yo~ cnn C0681258 R~ =:En cooat25~ S~k E CG&~I-SSC.-FVAO'2,~-O 100 Smnsocrrareeom CGMN,~BC-e"TA~2-O.0100 BS er CGMI~S~-~,FT,,~u~-0.,0100 C ~N-SBC--FTA0~-O.,0150 ESET CGMN-SBC-FTA02-0-0150 Cameras C~MN~I~I-FT~T2--0-0150 SMEENESE CG~N-SSC--F'I'AO2-0-,0150 cosa uszomn ~FTA02-0-0200 Some CGMN-~ ~C- ~"T,~H)200 SEI CC~N-Slk?.-~'A~-0-0~O 4 3.64 ~1 -` oii u 40 49.4 101 o = 4~ 3,56 ~,O 4 3.3~ ~ i > 5 4 3.3g ~ a we 8 40 37,0 93 & u i 400 33~B M . su . 4 3.44 86 : = 5 4 3.~,0 86 - = H 40 3&e 8~ 00~12~ GcE oovmma ast C0081259 RI~ ~ N-5 =(;..FTAO'3 -O-Ol~OO fCeanseacsrtresessr CG~N-S BC-FTA03-0-0(~O &54:4 iu=2.51 2. 5~ -=863 85 | i es C008~255 Spk H comomuscom ~FT,~3-0-e000 .4.00 au342 n~ | Ceomvai) SfRsEa ao == "2 } aGmcniuaese Saal ScBaaRmsecSrmiuTssoessm foes) o`.44 an3,31 oie)3.40 *8~ 8~ -w5 i: i 40 37.4 ~ 400 348 87 Sey shor dss, i $Frv 2 i EExxyyggeenn RRe~sseeaarrcchh PPaaggee 8855o0f117777 22009955..00333366 33MMAA0011555522111133 -_-- ttmnntg redi tCCuntOeeste Interim Report #4 - Analysis ofCottage Gro~ Soil and Ems en Exygen Study No.: P0001400 Water Sacapl~ Contract TTaabbllee VVIILIIL. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff u"CC PPFFOOAA iinn SSooiill SSaammpplleess Continued -- orgT = -- = = = -- CEYr A wm SEE oEEmEO: &8 ESno #EEMEREEs ;1 B 3of 000~12'~ C00~128g Rap (~f~ ~ G EaSgEE.ioSmnEmEsmm 10 3 C0081270 k ZE oa 2 C~o~12m R~p EZ BEmEm 0 nf CO0e1270 ~ I S O: 3 C00~1270 ~ j ah @m C0081271 SSHoEe SEEEMmErE= L: O om of C0~t1271 R~ EEEEO:OB 3i C0(~1271 SI~ K CGM~-~B~,FTA01.0,.0000 CG~N-SBC,.FTA01.0.000 O CC~AN..SI~C..L'TAC, I.O.O00D CG~'~-~ BC-FTAO t -0.-~ ) C~3MN-~BC-FTA01-0-.n~ 3 C,P..,MN~SBC-FTAO'~.0...~) CGMN.~BC-+"TA0~-0-0~) CG M N -SBC -F'TA~I-0 -010(~. CG MN.8~=-FT~0t -0-010<! CGMN..S~C..I~A0"IJ).,01~I 4 2.81 4 2,~8 40 31.7 4 3,te 79 4 3.22 e~ 40 33,1 ~3 ,400 3~ e7 4 3.46 87 4 =.~7 ~ 40 341 8~ 271 Spk L P..,GMN-~;~..~FTP~I-O-~lnI 400 ~ 84 C00e~2~'3 mm, gmmmess fom ox C00~1273R~ C001~1273 ~ ~ SEm EEEm Oo: x C0061273 Sl~k F Sm mmwees C00~1329 om os ~13~ Rm~ C0~1329 Spk G SEE sEme=m 2 0 f C0{~1329~ H Sar maoem x i Cooa133o EFSSIumEFm.kE @EEBEEEspmmEmmwSmeeA e:AO:o: ooB 8mm f %oofk ,| C~1330~ CGMN-~gC-FI'A 01 -;3-~200 CGMN-,SS~r"TA01-0-0.200 CP_.MN-SSC.,~'A0,1.0.0200 C.OM~SI~.-FTA01.O.0~200 CG M N -,SSC-WPA~ 1.0-0000 CGM~-~BC-WPA01 ~ CG MN <.RBC-W P~ 1,0AX~0~ CGMN*SI~C-V~P~14~00 CGI~.,.~SP-.;~,~ 1.0.0050 C~N -~~&q)~31-0-~0 NR NR 4 NR NR 40 NR NR 400 NR ~R 4 3.33 ~3 4 2.8,3 71 40 32.7 82 4~ 2~4 71 4 3.40 4 3.3~ [-- Exyg~ Research Pessorin 86 of i Pase 177 22009955..00333377 33MMAA0011555522111144 --e--e-------------------------------------------------- liWnactt=eiirmnSRaRemqppxolare-tst ##44 --AAnzal~ylsyis~oofCGootamggeGGrorovveeS;Sooiilaanndd Watea" San~lm ExSeyadyNgos:FeO0OIn400 F.,xygcn Study No.: `TTaabbllee VVIIILI. SSuurrrrooggaattee SSppiikkeeCRRoeencctooivvneeurreyydooff ''~CC PPFFOOAA iinn SSooiill SSaammpplleess Continued ~---------------- --en-- g = Ta Meomls o ET po counaacumoroacrn . P SSuarmem CSoMEsEmToEEcoNmmSs &5 FH 5| cGPoowrnmssat O:~0~13:~ $1~ O fcoCoGrCm~Nas-eSmsSsCccc-WuwaFm)u,~rsn0~si-tOooBnt-]0snt00 a.i40~ Iai3H2zS on7 Sum INI|WMEE & EH n c00~I ~34 SR, C,~0~1334 Rq) GSoAaNt C008~334 SM H coms C~0B1335 Sai C00813,~ ~ I SeC00~1335 S~ J SSccE Gcaioommnm nS eanne C00~'133~ Spk D SShaneen CO01133g C00~1~3"B P,4@ CQ0~1@3~ Sp~ E SRBC G3~IN-..,~n:,A01.0.0200 CG,'rdN~..-~'PA01 .-0-~200 fCoommnowstto]an C~3~SBC-WPA0t-O-02~ couvsocaa oom fre] CGk4~G01-O-00~ CG~-~-~E~t -0-0~0 SNTREEE CG,M~,.SKG0~,-0-O0~O fcSpCoSooouo rmnmnmsmcaceeecoe asmtamaenmoeoas] naoodns C6t~I--,qSC~K@01-O-01OO CBaamsccmmonioaeieds CC?=MN.,g~C.~m,~0'r,og.~ 00 CC,~4~01-O1~,o100 CP.~MN-~C-~KG0'I-DB-.0100 : = = 4. NR NR 4 NR NR a == == ~0O hR hlR . an & Er 5 4 3.31 85 40 30.0 75 & = n 400 305 7~ a`: siFsoo 2& 40 Z2.3 a Ed 4OO &". s=w=m 582 400 328 ~ :` 4= 8 4 :Z.41 4 ~,2,2 40 32.4 8t C~1340 como Snsscanzon i a 8 C00~1~10 Rep Enenas EBmRaEiElZsE a5 i= 2a i 600~1~40 ~ G CG~.'~S~.3-1~'GO1..~.O 1 ~0 CGklN-SBC-BKG01..0-0150 O3M~SBC-~G01-O-01~0 4 3.59 ~0 4 3.65 9t 40. 34A ~ C00~1~40 ~ H C~k~-SI~..-BKG~I-0-01~ 400 34~ 87 S acmomumR sse a acS ommsnaE cmaemaanS osam as.` Fa2"Ys 2-.: }} C00~1~,47 , anger : in : } 34'7 Rep fi Gontos S comR mcaaE nses &o H=q 52 i C0~1~7 ~ L CG MN..:~.,.BK302,,,0-00~ (~,S~-~,-B~,G~2.-(~ CG~I~-86C-B~G~...&000~ 4 3.85 g6 4 34 91 400 :~ 82 SETI, -_ mem EExxyyggecnn RRees.eaarrcchh Page 870177 Page 87 of 177 22009955..00333388 I3MMAA0011555522111155 -_--mm--ee InWtaerrimSRR aemepppolorerstt ##44--AAnazl~yyssiissooffCComtilasggeeGGorovve.-SSoolilaanndd Exygen StudyNo: PO0OL400 `TTaabbllee VVIIIIIL. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff "CC PPFFOOAA iinn SSooiill SSaammppileess CCoonattiinnuueedd --o_rg----TT sor a Ta a S~-oPrFrOoAn erm --_-- SacoCoa0n0m8sn~a3i4,~ Sconnuseaseeecmaanoodoa,nc CGMN-SBC-BKG4~2.-0-00~, ma Th 5+i~. o325,%06t0I RD aa90 Ean C006t~B I~ Canim. CGMN,~SBC-~KG~-0-00~ &, =3,4i' "87 ccoosncan, C00~134~ C0081~34G I~o CCohduern COO8~349 s,~ E fcoma acionon C6MN~G02-0TJ-0100 CCr aammmmce cmecaini cmsoems C:GMN- ~AJKG02.. DI~.O 100 54 4 .i am3.S4 Eirg3.45 &= =89 5:8~6 CGMN-~G02-DB-010~) 40 3,~.7 89 f cmier ss rasan BBcSmmmseamocce araceeesronn o.i - 23F6%d = s5 s : fCeccormaiosiei,d nScf aomnasme eaccganon neeonnss &`: 3i5a = 5o28 cvosea Cg~lSeO Re~ SSaonmn C0~1:352 Spk K SScCnoOoRMmmJmaq-TSmeBoCm-Gma~oeGr0r2eo-n0o-ro0~ma,0s0s o4:. = 233b0.o4%]5 = 5o5 = CO~%'-SBC-B~O02<)-0200 40 35.1 cons C0081353 C0081353 Reo Saas C00~1353 Sp~ C Samos C0~1353 Sl)k D css C0~1354 coS ariiE neg C00~1354 ~ E C00e.13s,~ Spk P comsmons CO~O,v~01.0.0000 CG MI~SS-I~G01-0-O000 msm CGMN.,.~-BKG01-0-0~0 Comas mansion CGMN-~S-BKG01-0-009O cownss can ccos COIvB~S~.BI(G01-0-O005 aCoonmeeztSmIeanzonne CGMI~,SS.EZKGOI-0..O005 CG~S~-B~O~--O..000~ . su 4 3.14 ;re 4 302 76 5 Er 7 40 30.6 77 a = n 400 2~3 71 a 4 $.19 ~0 &s: i8= 25 40 32.0 ~0 = 2 40~ 30~ 78 CO(~lSS5 dcrisis eo : i P-,008135~ Rep p ee Smaouetaom 5 on C00~135~ Spk(3 ce] famine] a @ : CO0~13,,%5 Spk H CGMN,.S~i~O1-O.DOCO CG&IN-Sg,,D601-0.0000 CGM N-SS-D60 I-0-0000 CGMN-~S-D601-O-O00;) SCcaocuovmnsiasnesnrst) fcocCoomumoemssssseoosiwrsnooreoomdnnds &o`. EmwSmmen aia" }i C4)0~1357 coon stro : iu a C(~0q"t3,,='/R~ oSrasak fmst s ronous = - i C0~81357 Sck K L --_-- S 5 -- on -- 5 i|i co<~f3s7 s~: L CG MI~.~S,,D601 ..OB,000~ C~MI~,S,. De01 -DB-0005 CGMN.~8-D601.-DB.0005 CGMN-SS-OeOI..DB-000~ 4 2.72 58 4 2.gi 73 40 ~.8 ~0 400 248 r=2 4 2.74 8~ 4 2.65 66 40 2'8.9 87 4OO 2/8 70 EExxyypge~n RReesseeaarrcchh | 1P~aaggee 8888o0f117777 | 22009955..00333399 33MMAA0011555522111166 ------------------------------------------------ IeWnattreerrmimSRaRempeppolorertst ##4~ -- AAnnalaylyssiiss ooffCCootttaaggeeGGrroovve~SSoolil aanndd BIixygacnSSavyaddyNNsou:.: PePOO0O0On1I4A000 `TTaabblleeVVIILILI. SSuurrrrooggaattee SSppiikkee`RRCeoecncotovivneeurreyydooff ~"CC PPFFOOAA iinn SSoolill SSaammpplleess Continued ge C00~1365 cates C0081385 Ra~ C008 t 385 ~ C Suns C008~ 3~5 Sp~D SaSaormmianrt sem CGMN-SS-Bt 0201 ~ reise] CGMN-~10201-.0-0~00 CG MN-,~.~-BI0~01-0~0OO0 LaziEmm CG MN-S~B 1020~ -0-000o fSReaSseIi S=~eM+ =itocori 4 3-~0 ~: i = H 4 3.35 84 40 30.8 77 a = % 400 :320 ~ aoi 3ES 58a Scecorotmnmtse COQa1368 corn C.O0~ 1388 ~ SSammse C0~1~ 5p~ I C01]8136~ Sl:~ J mae C0081~8~ C0~13~g ~ ov C..~081369 ~ K Scoammoa C0081370 carom C0~81370 R=p SSaoemBess C00~1370 ~ C SRR ccamn C0~1370 ~ o fcfoeremesersermrroeoends CGI~SS-B~) 1-0,.0005 mm C.G MI~.,~ BZ201K~.0~05 Dm COMN-SS,~2201-0.0005 SasEmIS CGMN-S~:,~8~I-O-0~0~ a Ct3tt~,,,.R,.R,B2201 .D~OOC5 C.gMN..SS,,B220"t,.OB,O005 Cams oan CG~.DB--goO5 BcoSmssEemromn CG~N-S~-B250'~-O-0000 SEER CG~N-ST~.B2501~-0000 frNeSEee] CG~IN,-,~.q.-~__~_ t.~.0000 EERE cmC a~mMes~Ic,,xnOm.rOoe0s0m0n 4 4.02 10t : 5FS u2 4O 35.5 gg & = 2 400 371 93 . 3 4 3_50 : = 2 3.87 a5 = =5 40 3~'.@ 400 389 . ww . 3.6t ~0 4 3.00 ~2 - Eo 2 40 ~S.8 gO o` s=a 2 4 3.42 : br 2 4 3.44 s Ey 2 40 3~'..~ s &.: wsi=m O55F 400 355 Cca omin ffrrreed ai =i za i| cass comms sa00100008 so = i C0~B1372 R~p C008t 372 ~ G C006~ 372 5~ N P-~2~ 1-0-0000 CGMN-SS-B2S0~-~-0000 CG~N-SS-B2~O~-O-O~ 4. 351 88 40 36.7 S~ ~00 ~a ~0 cSScaoaamniinesn) cCEon ommmmsssSse sameamoe oae: a.a: aE==y u25a ii| C0~137~ cSamsoesal fErmhEeiten 5i 3552 2" ii C(X~1375 Sf~k K _ F oe--r-- oy os meet, eec a e=e & | C~081375 ~ l., OG MN-~>-8180~.0.0000 CGMI~SS-81602-0-00go CG~N-~3,.BI B0:2-0-0000 4 40 400 3.28 3L3 327 EExxyygpeenn RReesseeaarrcchh PPaaggee 8899007f117777 22009955..00334400 I3MMAA0011555522111177 _--m-------- IWtnatetveriirmnRSRaempeppolorertts##44--AAna~laylyssiissooff Coottatagge~GGrroov~e;SSooiill aanndd Exygen Exygen SSttuuddyyNNoo:.: PPO0000011440000 Continued T`Taabbllee VVIIIHL. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff L"~CC PPFFOOAA iinn SSooiill SSaammpplleess Colztinued -- cS--cS _cca m--comeaEo_oearm--nrin r amr,aSae C0081378 C00~i137~ Rap Grae C008137~ Spk G orn C00~1378 ~ H peC00~13~ C,~08137~ Rep fd C00~137~ ~ I Gnas C0~137g SI~ J cam C00~1 ~ PSrmo C00813~0 S~ K Sen C0~13~0 ~ L comC0081381 cate C008138J R~ Saas C0~81381 Spk C SGcaaonmmnsee C00~1382 SDI~ E exam ~1:3~2 ~ F fferccEccoeSuommtemussnsveEsEssss= ttsaaiaetorririmmanmesaosnoonns| monsds CC4ull~k,~o:).8 t t:201.0.00~ CGMN-3;~-611201-0-0~ SEI CGMN-~,.~-B11201-0-~05 Simscarimsous CG~11;201~ coms monoamn CGMN.,$~-FI"AOl-O-00OO C~MN.,SS.,F'TA01-0.~]0O0 sre ~MN',~-TA01*O.0000 ANS C~MN-...~A~I-0-0000 comsmoans CG MN-,.~S-FTAD 1-0,0005 CSoSomsmmsmriearstosomm CGI4N-SS-FT~I-O-000S CGMN-S~FTAOI-~4X~5 comsemoranans C~MN-SS-FT~ ~ -D B-0005 En CG MN-SS-FTA0 I-O B.000~ nSFan soc CGMN-,.qS-FTA01-DB-000~ S fcoeuE nsnsensE zou]e CGMN-SS.F']'A02.0.O000 fies C<I=~--SS-FT~:~Z-O-~000 e"emeon oSwm emmda fWeTy a:. - iE2e = 7n .: i=az 5o" a ES a . 20 &o4 4 40 3=3.0~ 3.1~1 33,8 -=7~ 79 84 ..400 Pe357 n89 &s4 4 4~ in2.~ 301 27.8 772 75 7"0 5`.400 4 sba3~ ar.1u4 &40 Ed 70 7757~ Z~,8 75 400 314 ?~ . 32 o 4 323 : 53 8 4 3.26 5 5 i 40 33.8 aa. E2=r9 ""5 40 ~0,4 ;'6 2 = 2 4~O 272 68 ase Cams met : a C0~13~3 R~ Se SANE & FH 7 COD813~, ~ G Sovmoan Sassen & Eo 3 000~t3B3 ~ H COMN-SS-FTA02.O-00~ CG&IN..S~.-FTA02~-000~ CG&I~.G,O0~ SccSRooserEorsnesen cocCSuoasmEssssssaaRaummorIorsooaEamon &5`` P2A=an o-v i: C008138~ cSoame reser] : in a i ~1;~6 Re~ EEnRe SSonmEmnan oosses =5 i= 2a {i C00~1388 ~ K CGM N..~-B6801-OB-~000 CGM~t-OB..0000 CGMN-~-f16801-DB-0000 4 $.08 77 40 30.2. 7~ 400 314 79 4 2.67 6"7 4 2.46 62 40 32.~ ~2 C00~13~ ~ k CGMN-S~86~1-.DB-0000 4O0 328 82 eneye ee rdes, rem er br i re i EExxyygge~n RReesseeaamchh | PPaaggee 9900o0f117777 22009955..00334411 I3MMAA0011555522111188 WrermSRaempplre#4 -Ansysof ConageGroveSt nd ExygenStudyNos PO00IS00 F~y~n Study No.: PO00140O T`Taabbllee VVIIIIIL. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff lSCC PPFFOOAA iinn SSoolill SSaammpplleess CCoonnttiinnuueedd EtT oga fisSS cac00~I~? ~ Ccoonnoo C008t3_q2 cist C0081392 R~ cams C00~1392 Spk E sas C00~;1392 Sl~ F cm C00~1393 cars ~1 ~ R~ mmasn C00813~3 ~ It C~0~13~6 coma 395 Re@ Sos? C00~1395 Sp~ ~ Sm C0081395 ~ J C008139~ cSoomta C00~t3~6 S~ K Sma C00813~ ~ L cm C00~1397 C~)81397 R~fl Gnaks)s C00813S7 ~ C s-- or SO fem CGMN-~1-0-0005 cfomrsrsoevtortoeands CGMN~.~-81601-0-0000 fen CGMN-SS-61601-0-0000 mista ooms CGMN-SS-81~01-0-0000 freatte CGMN-~S~1601-0-0000 comssoorooms C~N-5~1601-0.00~ Snes ous CGMN-SS-B~e0~-0-1~5 CCoonnsoannssooumss CGMN, SS-BI~I.,0-0(~S CO MN-~3-IC04-04)000 NSE CG~ nse CGk~,-8~-IC04-O,~O0~ Cans CG$&'~.IC04.0.0~ ~S-K:~04-O-0~5 SSSmaEiions CGI,,~(-SS-IC04-0-00~ NSE CGI,~SS-~04.O-G~ camesemsaa COk~-S~.lC~3.0.O000 ~0.0000 SSnmReSesTon CGM~IC~I-0..0000 a Sa m"acocreosn ~~SrWl i in 4 2,82 &. 3%m 4 3.50 i = 4 3.58 " wn 40 38.9 & = 400 368 . sm 4 3 2~ : 5 4 3.30 -o 5= 400 353 4, 3-12 : pH 4 3.42 5 "5 40 34.0 a ul 40e 324 4 2.gg o: iNen 4O 31,0 & = 400 320 . TM 4 3,70 4 3,38 -5 F=d 40 39,0 corr 7-71 u~ s9~ 97 "9! ~ 8~ 2~ 78 586 8~ 86t 75 28 ==s2~0 cooa~3~9 Pr Samssioon i = 2 C00~1~9 R~ C0061399 S~k G Scoammam fcomrssiieseross &` a4 " i CO)81400 commie Cams ons ` is 8 | C00~14,00 RBp am RMSE a HS 7 | C~08!400 SI)k I CG~N-SS4CO~-0-0000 CGt,~-~I..0-0000 CGI~i-S~-IC01-O-0000 OGMN-SS-IC0 I-0.00C5 C~MN-8~-IC0 I-0-01X~ ,CQUIN-SS-IC~I-0-0005 4 3.90 9e 4 3.60 90 40 37.7 94 4 3.2~ 81 4 3.33 ~3 40 33-3 ~ C00~1401 cote Sms i a 2 i C00~1401 R~ cSro sSah OSmTcEonn 5s 5= 52 if _r.J~-~1401 ~ L C,,~.~I-~ K~2-.O-OO{~ CGMN-,S~ K::~2-0-00~ CGMI4-S~:02oO-0000 4 3.22 ~1 4 3.42 ~ 400 :~ 67 Exypen Rescarch Exygen Research 22009955..00334422 PPaaggee 9911000f117777 i I3MMAA0011555522111199 _----m---- Ir!nnteteerrriimmRSReapeppoiorertnt##4~t-.AAvmaylys~ims ooffCCoottitzaggeeGGrroovveeSSooiilsmnadd Wat~ Samplt~ BogenStudyNo: POGOL400 Exygrn Study No,: P000 !400 Continued `TTaabbllee VVIILII.. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff *'~CC PPFFOOAA iinn SSooiill SSaammpplleess Continued a --_--eoz osa Sae Tnhea eo m"coowress orewy SCccaooonmennitnmaho f[oEo rn-- rea Enns ..: & i33n = ==5 5 C~X~1402 SI~ D CGM~SS~2OEq~-O00S ,tO0 ,~0 ~ crise C0061403 CO~Sf 403 Rep aCcCGacomonnvanaaiiinsnianaet C0~,1403 ~ E nee COM N.-SS-DSO3-O.O000 CGMN-SS-DS03-O-00~0 CCcCmoooommmueemnsssssssSnoeasuensseossasooonnnnsss CGb~%-~503-/~Q(~ a":4 4 40 3.9~ 383.43 Ewr=37.2 -86 93 ".i aF3no o5 u2 Scowomrinan| Eo[rrMerErEeed 4 3.30 ~3 a: 28 5. 40 35.9 90 a a 2 400 314 70 CSaooamnneornx CcoSmnsso aSmrtoo ecemn &o. aaum "a5 C0~1407 C0~14~7 Rap t arr free] = 5 C0061407 ~ C t feat] 5 a a C00~g'I4,O7 ~ D caomnianne acommnssaemnasons .: uwwn "7 nner comvein comes moons . mn 2 CO0~1409 nts mnie i i 5 F_,0V~409 Ra~ Counts LmSTnit " Er n CO0~t4Oe Sp~ G Simian Soni son & EA a C00~.1 0~ 5pk H cave coumssomoas ` ar e CO061410 Gcaoowon up Smee : in 5 C0~81.410 I~ SRaRos , frMeEReEd a5 == 2a | C~081410 ~ J C,Q~d~4..SS-B~01-0-0000 CG MI~.SS .I~'1 ~).00~0 CGMN.,~,8~I,O.00~0 CGMN-S$-8~01-.O,O000 REIS C'G MN-S~D~02-0-O000 CG~-<H:~00 CGMN-SS-DS02-0-0000 ~A3MN.,SS...I~k,~2.0-O0~O CGMN-~D002-0.0005 CGMN-S~DS0~.O.0005 C~MN,.,.R.,~-DSO~.O,.0005 4 3.23 01 4, 3.03 75 40 32.1 80 400 2/4 6~ a = " 4 ZT/ 4 3.C,7 71' 40 28.3 71 400 310 78 4 3.27 4 3.81 400 omSee rr enet, ------ 3 Omit ee Exypen Research Page Page 9220o0f117777 22009955..00334433 33MMAA0011555522112200 --_-- eee IWInntticrreummSRgeacppomorertt ##44-. AAnanlysia~oolffCCayoitatagsgeeGiGrroosvvee SoSo~l aanndd Water Samples Eran Exygert SSttuuddyyNNoo:.:PP0000001i04000 Table IX. Table IX. SSuarrrrooggaattee SSppiikkee RReeccoovveerryyooff ~C3C PPFFOOAA iinn GGrroouunndd W Waatteerr SSaammpplleess e orn osleTraT T ATB noaint t mseeovson fay Ccciaoirnmman.ss Coon cSSoamEmmooemnnvSevinnrenocoonImmmmeEree freed = 2w ww m e owa8u 2 = om aConm ff msia =momom oo2un commekt C0081228 e,pk E foStis C01~1226 ~ F CSC Cooc~Gma-MM mmoW a~mwn8-m-M 0aem-W 0on5ro0~ on51 ss~a6s6 m= 60O oum2o8w7 28o~e8 f~ ~7 ~ nd ~1~ GEanEn SERnSsaio Ra ~I2~ Comonmyorse ~w~P~l~ ~W~~ 1~ == a ~ ~ ~ 1~ 274 ~4 ScwEmeEas Schamaouwsnnmsoossy w = wa ouwn C00~,123~ 3pk G esn wom i" C0081232 S(~ H 60081232 ornps" CaS m mRaEST ES " C0061232 R~ ai rerow nurs outs ow = " C~081233 = rec F-~ C0081~34 Cnr ny wa oim" C...KD~1235 ~-MW1~17 CGMN-OW-MWI~-O-050517 C~-MW19-0-050517 C~.MW~{~O.O'-~ 7 C~MN-GW*MW ! ~4:;) P-.0~i0517 C C-~IkLI3WJMW 1%-J.S-0505 ,I 7 CG M k~--~/-MW 1 g.-H S-050517 t000 NR NR 1500 NR NR ,500 NR NR S00 NR NR 500 NR 500 I~R t000 NR NR ccoCTccm oomoTosooearnranmssaseaec CCCCCooavciannoenAnnowonooonnoMnnnovneoeacaossorEorooronoonsroLsunsvcossmeS:nmm,a @-==B a 2 m E = 5=om 2 w W =22 amar ow noprs mo or Eo fe mon 22 =@ 2H Saas WannAas wm H Cars ovo CcoCoo0an0t~tat4it1ne~Sg~ opuh0CC wWW oOBkINVo~G,w-R2R22-.000-.000555000~881122 101155000000 wo0 1380 2"~.t ii cCoSomvnaet eWEonHonsroomte A == aom o2w i ~1417 Corn 3 Crs wm C~141~ 1--64_m--rs_cor--eyo--tr vetoat ntm eoey fo emween ii ~1419 ~MN~~12 ~~12 W~-~12 5~ ~ 101 t~ 1~ 1~ ~ ~ ~ Exygen Exygen RReesseeaarcchh PPaaggee 99330o0f117777 i 22009955..00334444 33MMAA0011555522112211 ------------------------ WIInttae~rxrh~SuRRrerppipoetrst 4#4 -- Asli AnalysisooffCCootttaaggee GGrroowve:SSooiftsod. Water Sar~les ExygenSdNo. POO0IA00 Exygen Study No.: F0001400 Samples Continued TTaabbllee IIXX.. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff ~"CC PPFFOOAA iinn GGrroouunndd W Waatteerr Sample; Continued come sure TE YS med uo -- Spzs _ mame -- oohm Te ao@y THofT c"CiSEoonerHitaez> jWSOMinSGaNrRaN3r0a5GS08s17 wE8awE S==r 22 TcSiomrmeaen Ta eoriE mRSeoEnmEe fcBot mreeinng Gover cSEcomoiEesnsTexe ra Se conn C0~1436 fraihed C0081437 P VmEaRr oSautAsess fA inonveods E ynmmooownE ncCooursmaE sessnsetn oooonvvSSocmre oos pmmrwmaeaoomvmuaoowawmoorrrooesrtsoeerst:z ty on cao Sans soon WI~tt~N-GW-TRIP-O-050511 EfoSmE entS) W BM N-GW-TRIP-LS-050~111 PE =s om =m 328 w FI sSe o8n = m 2wm w m= oo88nw e m2 os=w8 P 2 EE02m% 808h 2002 8 o Boe uow 5ow -om 500 434 100 104 ow~,7 104 ---C00,B|438 TT WBM N-GW-TRIP-HS-05~511 1000 = 899 90 ce hrs ec ee ie 7om ni ) Exypn Exygen RReesseeaarrcchh 22009955..00334455 Page S4ar 177 Page 94 of 177 i 33MMAA0011555522112222 -_ ermRepert bt AnyiofCoage roveSil and Intea-im Report #4 - Analysis ofCottage Grove SoB and Wate Samples Water Samples EyeStd Nos POD01I00 F..xygen Study No.: PO0014.00 TTaabbllee XX.. SSuurrrrooggaattee SSppiikkee RRSeaecmcoopvvleeerrsyyooff 13CC PPFFOOAA iinn RRiinnssee BBllaannkk Samples og --_p--r come arr pr canon cnn cone corn = mre saree [Ee--w--e-- camsscos ez ------ coun sac corawe conssou sam comes emia cs Comics oom commer reos @&J------- "coro Toma ree my weu womn 9 " 6 ww " ww PE-- " ww n wow om ow @ ww --c--T 7 `EExxyyggeennRReseeseaarrcchh 22009955..00334466 PPaaggee 9955ooff 117777 i 33MMAA0011555522112233 _--_-- --_--_---- InIWtnaettereriirmmSRRuemprppolroetrst##44 - AAr~sallyyssiissooffCCootttaaggerGGrroovvxe:SSooiill asnndd Water Samples ExEyxygge~nnSSutuddyyNNoo:.: PPO000001L440000 TTaabbllee XXLI. TToottaall PPeerrcceennt! SSoolliiddss ffoorr SSooiill SSaammpplleess Exgenm. Ciootsample 0 Totsongs09 Tot~l Soll(k costes C0081163 Con-sBC.0205.00000 sr constias comnseconsomso na81.70 C0081164 73,84 cooattes (30081185 comnsecoma m0 2007 60.97 conattes coumsazomaoonio ws 00O81166 4t consrrer C0081 t67 [Ee sas ry 00081168 CoMN.5802900250 22 costes Ct~08116g counsecomsamo wn verti ComsaC 02a080300 oan consti (30061170 comsecozmoms EX 91.81 C0081171 wostir2 C00811~ ComsBCom0000 0 cxsiirs C0081173 CoMNSBC0z 00450 one g7.14 cCo0n0a~r1i1n7e4 coMSBCOzrz00000 ns caters C00811~3 `counsec oan ots 21 52.15 ry `com-sec.oRz.00100 na ~8.~ coettrr cou sac.0mz00150 sete Er C0081 commsacomzono 750 t78 coosrire C~081179 coun sBCOmMZ00250 0s cost1s0 (0081180 Coun58002200%0 ws coset coumsec ona000 os C0081181 sri counsaCoz080350 ws COQ81182 ~.57 cones C00~1183 CouS86.0202.00400 a0 : 97.10 coostrne COOB1184 cowvsacomz ois EY , ~0 costiss Coe580020100000 wae ! C00~1185 EExxyyggeenn RReesseeasrcchh PPaaggee 9965o0f117777 22009955..00334477 33MMAA0011555522112244 a -------- I`nIWtnaettereriimmSaRRmeepppiooerstrt #~4 o-AAnanlaylyssiissooffCCoottatagge~GGrorovveeSSoolilsnd Water Samples ExygenStudy No. POODLIO0 E~yg~n St~y No.: PO001400 TTaabbllee XXII.. TToottaall PPeerrcceenntt SSoolliiddss ffoorr SSooiill SSaammpplleess CCoonnttiinnuueedd Egan. cose cosriar coneniss tartsample comsacomt0s counsacomn 010 Comsec-ozn.0a0100 TotaSoc (1) Er mz Ea coisa CoMNSACOD100150 am costco `couns80a1.00200 ssa caoerios CoMNSBCom0080 on comnizz `com.seCoan.000 a2 coors comsBC02 0030 En [er cowms8Coa.0040 ss costios CoMm-SBC 010400000 ma cxeise CoMS80010400050 59 coatior COUN SBC010408.0080 as corse CoUN5BC 010400100 ost cxetisn couns8C 10400150 0a cosiz0 counsBC 010400200 so connor coumseCo0800250 uz coosrz CoMN-SBC010403 sas coos120s counsacomOIE onis : coos CoMnsBCO10400400 ua cans CoSBC010K0048 rss i cossizor COUNSECD104080450 na | ery CoMsacO1040080 sm coors CoMmSBC01000550 wi Exygen Research Exygea Research PPaaggee 9977o0f117777 22009955..00334488 33MMAA0011555522112255 --_----ee--_-- Wahntleeerrr~SRaRemepppolorersst#~44-- AAnnaaiiy:yssiissooffCCoottitaaggeeGGrroovveSSoolil aanndd. Water Samples EExxyyg~e'nn SSttuuddyy NNoo:.: PPO00000I1440000 TTaabbllee XXII.. TToottaall PPeerrcceenntt SSoolliiddss ffoorr SSooiill SSaammpplleess CCoonnttiinnuueedd Exgenio Cloct sample Tou Soc0) warzio CoMNSBC010400000 on consrzn COUNSBC010400850 EY cosrziz CoM5B0010300000 as cosrz13 COUNSBCO103.00050 wa consi CoMNSBCOBO00 onar costars comsecomois we consrzre. CoMsBC010089150 wr casera coMsBCoN 000 oar coerzne CoMesBC0105.00250 us cover Co BC-01030000 we conmrzzt coumsBco300380 Er) care COMSBC.010300100 er cos1z8 COUNSECD1030.0450 ones cuosrase COMBE01000500 zr xerzn comnsacoiesaom so comrzi0 COMNSEC ONE00600 2 oa2es COUN SBC 010300850 os oxen cousac0%010000 24s comes CoU80.050100050 ae ora CoM-SBC 0801080050 soe coos1aes COM$8C-0801.00100 EZ i coer2ie Cou SBC.050100180 ER coerzar CoMsBC 050100200 aso i Exygen Research Exyg~ { PPaaggee 9983o0f117777 i 22009955..00334499 33MMAA0011555522112266 A rrrrrreece-------- sionh 4 sof ComeGoreSotsod Wa~-r Sarnpl~ Borsa Sty No Bobi F.xygen Stay No.: 90001400 TTaabbllee XXLL. TToottaall PPeerrcceenntt SSoolliiddss ffoorr SSooiill SSaammpplleess CCoonnttiinnuueedd aoJ a -- vann cccJoo-- on--smsmm--ooomon--e mo-apreon C0081251 ph J ne Ct~081252 cas P---- " C0081253 cae comma an C0081254 wns commernmmons ws C0081255 coms amar ve C0081256 comer comsesrmzson wr C0081257 J amsmrmzons wo C0081258 on comms wor C008125~ oem comsmnmesoets ws C0081260 ee comsscrmosaom - C0081262 ce coms mcsaon va C0081263 corn comma wn C0081264 pon coumnses iran nas 00081269 py comets ns C0081270 cam coer an C0081271 coer comocrmzao ho C0081272 J comascrzo - i C0081273 ain comsscomonmn an i C0081274 coms p---- we | C0081275 CGMN-SBC-DS01-0-0150 CGMN-$BC-DS01-O-02:00 CG MN-SBC-FTA02,-O-0000 CGMN-SBC-FTA02-OH]OS0 CGMN-SBC-FTA02-Di~-0100 CGMN-SBC-FTA~2o0,~100 C G MN,-~BC- F'fA02*0-O 150 C(~M N-..RSC-F]'AIO2-O-0200 CGMN-S BC=FTA03-0-0000 CG MN-SBC-FTA03-0- 0 It 00 CGMN,-SISC-FTA~3-0~0100 CGMN-SBC-FTA03-0-0150 CGM~A03-0.0200 CGM N-,SBC- FTA~ 1-0-0000 CGMN-SBC-FTA01.0-0050 O3MN-SBC- FTAO 1-0-0100 CG MN.-SSC-FTA02.~.0t 50 CG MN~SBC-F3"A02.-0-0200 CGMN-SBC-D101.0.0000 CGMN- SBC-D 101-0.-0050 75.84 77.16 86.80 95. 75 95,,54 95.68 9~. 12 97.02 81,97 96.30 97.64 g 1.72 78.28 96.03 95.77 97.07 ~,64 83.44 90.4,9 Sophos rues9otinr | Page 99 of 177 22009955..00335500 33MMAA0011555522112277 -_ InIWntaettereriirmmSRaRemupp~olrre~ts ##44 - - Analysis Analysis of CageGroveSoil of Cottage Grove Soil snd and Water Sampt~s `EExxyyggeennSSttuuddyyNNoo:.: P0O00104140000 TTaabbllee XXII.. TToottaall PPeerrcceenntt SSoolliiddss ffoorr SSooiill SSaammpplleess CCoonnttiinnuueedd Egg coasrz C0flB1277 coasters C0081278 coontare C0081279 cooerzm C0081280 coverzet C0081281 cosrzez C00812~2 coorzza C0061283 constant C0081284 coustass CtX~1285 const C0081329 cones C00~1330 compris C0081331 coms C0081332 counts C0(~1333 costa C0081334 commas C00813,35 cones C008133~ countess C~081338 comma C0061339 coats C0061340 costs C00~'1341 mse C0081342 -_ cCo0n0m~r1o3a4s3 Ciesample cormseCo10010 CG MN-SB~,~10t.-G,O 1 O0 CoMN-900101080100 CGMN-$BG,,D101-DB'0100 CouSBCO100150 CGMN-,Si~I01-0-0'150 COMSBCO101.00200 CGMN-SBC~.D101-00200 Comusecotz0m0 CG MhI-SBC;-D102-0-0000 cousaconz 00050 CGMN.~B~:-D102-O-00S0 cowsBeo200100 CG MN-SBC-D102-D-0100 COUNSBC0102.00150 CGMN-SI~:-D102-0-0150 counseco20000 CGMN-SI~C-D102-0-0200 COURIC WPAL109000 CGlv~-SBC-WPAOl-0-0000 CounSBC PALI 0050 CGMN-SSC:NPAI)1-0-0050 COMN-SBCWPADY 0100 CGMNLSBC~WPA01"O'0"IIXI COMN-SBCAIPAL1 080100 GGMN.-SBC-WPP~01-DB.0100 CoMNSECPALI02150 CGMN~BC-WPA01-0-0150 COMMSBC-HPALI0200 CGMN-S BC-W PA01o0-0200 CoMN.S8CaKG010000 CG MN-S BC- BKG01-0--0000 CONSBC EGE 0050 CGMN-SBC-BKG01-0-0050 CounsBC Ese 0010 CGMN=SBC-BKG01-0-01O0 ou 5a0EKG0108.0100 CGMN-SBC-BKG01-DB-0100 CoUNSBC BHO 00150 CGMN-SBC-BKG01..0-0150 CBACBG0100200 CG MN-S BC- BKG01-0-0200 CoUN-S8C 120100000 CGMN~SBC,,Blff01.0-0000 cCoGuMNNs-S9SCC.B8t1S60011~ 00050 Toasods 3) 810 96.10 8x ~.~ on 07.23 oe 97,6~ 22 82.22 ws 90.33 arse g7_68 os 97.52 on97. 71 ss 85.53 @3 90,31 ones 66,85 a0 87,30 a0 87.10 7 79.75 aorg4.01 ss 95.58 ase 88.~8 a 88.19 wor 89.87 ws 92.88 we 93,16 wo ~4.0~ ExygenResearch Exygea R.e..~'a,rch PPaaggee 1100000o1f117777 22009955..00335511 33MMAA0011555522112288 InIWtnaettereriirmmRSReap~ropirontn##44 --AAnanlaylyssiissooffCCoottta~gge~GGrorovve~SSo~liIaanndd W~t~r Samples ExygenStudy No:PO01400 Exyg~n Srady No,: P000I ~ TTaabbllee XXII.. TToottaall PPeerrcceenntt SSoolliiddss ffoorr SSooiill SSaammpplleess CCoonnttiinnuueedd Exgean. cota cosrsas mers osraar coersis cose cameras coarse cera coarasa cooorass conerass conerasa rast cocaszsa conatas comets constant coersez consis conerans osarass coarser Stem supp. counsaceisnooo CoUNSBC 150100180 [Re COMNSRCBCI200000 commsao8200 CoM SBCBKGI2.08.0100 Commvs80-8x0200100 comsac sxc 001 comnSsCBKGE0020 coms aKGo1000 COUNSSBGO00005 COMESS.00100000 CoMN-SS080100005 Coun55.001.080008 CoMNSS010100005 cous0101080005 COMNSSOZ0109000 comess.020100008 CoMSS.020200000 CoMvss 02200005 CoMNSS 8102010000 comnssatotoms Cownss8220100000 Tot Sots0s wz uz anor um ey 0575 as EY "ss na zs ne no EY wo no ne nn [ES 040 sor om oa | Bogen Research PPaaggee 110011o1f 17777 22009955..00335522 33MMAA0011555522112299 hWta~etrheir~SR~aempppoolrre~ts#~4 --AAnanlaylysistssooff'CCoouttaaggeeGGr~oovve:SSooi~ll aanndd Wate~ Samples Exygen SSttuuddyyNNoo:.:2P00000011440000 TTaabbllee XXII.. TToottaall PPeerrcceenntt SSoolliiddss ffoorr SSooiill SSaammpplleess CCoonnttiinnuueedd Engen. Clon sompiion omsora 3) coostzsa CoMss-220100005 wz oa1369 CommsS.E220.00.0005 203s conatam CoMes3825010:4000 2x coosrs7s couNSS8250100005 EY conerarz Coun-5.82001 00000 005 sir Cou-s58200100008 wes coneraze ConNS.0101.0000 wos costars CoMN358160200000 ES costar comms 102.0008 sar rant commSS81120100000 ne coontars comnSS 1120100008 ss costars COMNSSTAD100000 ma cooeraso couNSSTAN.00008 wm cosast CMSsFTA 0.0008 ns csnarssz couNSsTAR00000 os pe cous TAZ00008 nm oats CoMNSS-0100000 2 coazss Cons8380108000 ou coosssar counssaes0r.00s outs coonrzse Counssero sar cunerone comes ernoos ws csstzs0 couns.e1801.00000 wn . oostzon cans arentoses ws i Exygen Reseweh Exygen Research PPaaggee 1[00220o6f117777 i 22009955..00335533 33MMAA0011555522113300 Wtaeteir:SReepmoertn#4. -AnlysisofCotage GroveSolaad ExF_y=gxey~nn SSttuuddyyNNoo..:FU001400 TTaabbllee XXLL TToottaall PPeerrcceenntt SSoolliiddss ffoorr SSooiill SSaammpplleess CCoonnttiinnuueedd Exgeno cooeroaz coaram cmersas cos308 osraor conarson conerass connte00 consran constace cosriaa conan coarans comiaos constaor costae cooerias comsiato Cte sample0. comnssa1m0000 coumssansn.00s CoMESSI000000 Couns Io000008 Couns 100300050 comms 100300008 Counssico000 comN-s3100100005 comnsSI00200000 ComsIC0200005 Counss.050300000 `CoMN5305050.0005 CouN.5S.05010400 Cau-SS.0%0100005 CoMN-SS860100000 counss.es010000s COuSS00200000 CoMN.550%0204005 ounsoda (5) waz ass 57 wn 0s wn wa Er ni oa ar on aust ED) war ns wn nz ExEyxypge~nnRReesseeaarrcchh 22009955..00335544 { PFaaggee 1100330o0f117777 33MMAA0011555522113311 IWnhattctereiirmnSRaRemp~poolrertts#g44 --AAnnalaylyssiiss ooffCCootttaaggeeGGrroov,~e SSooiillsandd Water Sar~l~ ExygenStudyNo: PO0O1400 Exygen Study No.: P0001400 FIGURES Exygen Research 22009955..00335555 PPaaggee 1100440o7f117777 i 33MMAA0011555522113322 f rs Rept. As of Coti geGrovs e 5 0d Exyen Say No: P0180 Intetzan P.e90rt #4 - Analysis ofCottage Grove Soil and t Water Samples Exygen Study No.: P0001400 Figure 1. Typical Callbracion Carve for PFinROeagAent Water FigUre 1. Typical Calibration Curve for PFOA in Reagent Water 7 ful wl EnResa Exygen Reseuch i 22009955..00335666 Fae 10507177 Page 105 of ! 77 33MMAAD011555522113333 ---------------------------------- ImmRe Interim Report5#44 -Any of Cota Analysis o~Cot~ageGGr:o'ovvee Sd Soil and Exosen Sud No:FOOL 00 Exygen Study No.: PO001400 Water Samples FFiigguurree22.. EaExnxtdtrr5aa0ccttneegdd/LSS,ttaaRnneddsapaerrcddtssioovfeflPPyFFOOAA IInn RReeaaggeenntt W Wataeterr,, 2255 nngg//LL and 50 ng/L, Respectivdy RTE ee ;| 2= 1141 WRT 2 3 4. 0 0 Spt E~tygen R~s~r0h 22009955..00335577 atone ; Psse 106 of 177 33MMAAO011555522113344 bWltnen~sRReeppsoo~r 4#4 -slyAnalysisofCoeGroveSisd ofCoUage Grove Soil and yg ely No: 20100 FA'yg~ Study No.: A,20d500 ng/L. Fortified Reagent SpikeB, Respectively FFiiggoarroe33.. PPFFOOAA Iinn RReeaaggeenntt CCoonnttrrooll,, ~500 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt SSppiikkee A, and 500 ng/L Fortified Reagent Spike B, Respectively WT me mee et f| Ln re |ile eran PR. 0 STE H8 e= T = WER 33 | an Somaz,er `EExxyyggecnnRReseesaeracrchh. { | PPaaggee 110077o0f117777 i 22009955..00335588 33MMAAD011555522113355 -------------- ee WtietrsmRSeaploerst #4 - AsliofCotiage GroveSoiaad ExEyxyggeenn SSin~addyyNNoo.:: PPO0000114000 FFiigguurreed4.. CPCFhhrOroAomm(aaEttoxogygrgraeamnm PFOA (Erygen IRRDee:pprCre,Oes0se8en1nt3fil5nn5gg, ID: C0081355, aa SSoolill DDaattaa SSaammppllee AAnnaallyyzzeedd SSeett:: 008822330055CC)) ffoorr BT myeeoe || EExxyypge~nn RReesseeaarcchh 22009955..00335599 PPaaggee 110088007f117777 | i I3MMAA0011555522113366 rim Report -AnalysisofCotageGroveSol aod Interim Report #4 - Analysis of Cottage Grove Soil and Water Saies Water Sarrrp|~a Exygen StudyNo: POOO140 Exygen Study No.: P000!400 FFiigguurree 5. ACCnhharrlooymmzaeatdtoofggorrraamPmFRROeeApprr(eeEssxeeynngttieinnnggIaaD:GGrCro0o0uu8nn1dd22W W8a,atteDearrtSSaaaSmmeptpl:lee 0A9n1a3l0y8ze4d) for PFOA (Exygen ID: C0081228, Data Set: 091305A) BC TEIR A ExEyxgyegn~RReseseeaarrcchh 22009955..00336600 PPaaggee 1100990o7f117777 I 33MMAA0011555522113377 Itrin Repor 4 -Analy ofCageGroveSola Interim Report #4 - Analysis ofCottage Grove Soil and WarSamples Water Sampl~ Exygen StudyNo:FO00140 Ex-'ygen Study No.: PO0~14~ FFiigguurrees6.. TTyyppiiccaall CCaalliibbrraattiioonn CCa.rrvvee ffoorr "I~CC PPFFOOAA iinn RReeaaggeenntt WWaatteerr yd ;| I al Exypen Research 22009955..00336611 PPaaggee i111000o7f117777 i 33MMAA0011555522113388 WneeiSReaposr 4 - Anisof otagsGrove Siand Into'ira K~rt ~4 - Analysis of Cottage Cn-ov~ Soil ~nd W~t~" S~npl~ EaywenSudNos PODIAE0 Exyg~ $~iy No.; FFiigguurree 77.. EExxttrraacctteedd SSttaannddaarrddssooff ~"3CC PPFFOOAA iinn RReeaaggeenntt W Waatteerr,, 2255 ngg//LLaanndd 5500 nngg//LL,, RReessppeeccttiivveellyy NTR ev eeeer Wm rm 2 fu) ee oeee SayeResch 22009955..00336622 | Page 11106177 Page 111 oft77 i 33MMAA0011555522113309 VIornSRtemppitsAsCoi teGrovef Solesd Interim Rrpoa ~. Analysis of Cottag Grove $oiI and ~~ Endy Yo. POUOLOD Exyg~n S'mdyNo.: P0001400 FFiigguurree8.. 1C3C PPFFOOAA iinn RReeaaggeenntt CCoonntrtrooll,, 5500 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt SSppiikkeeAA,,aanndd 550000 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt SSppiikkee BB,, RReessppeeccttiivveellyy 1 Seemmemsstamen WERE ee Sw HE 1 b= Bm eel 2 i BoypeaResearch 22009955..00336633 PaPaggee 1111220o7f117777 ! 33MMAA0011555522114400 nWInateteeririmSRRaeepppioeornt #44 - AAnnaallyyssiiss ooffCCootllaaggseGGrroovveeSSooiilaanndd Water Sample~ EExygxenSSttyuuddyyNNgoo.::PPeO00O(O}n1I44000 FFiigguurree 99.. CChChrrPoommFaOattAoogg(rrEaaxmmvgRReenepprIrDee:sseeCnn0tt0iin8ng1g3aa85SSo,oiiDllaSStaaammSppeltlee: AA0n8na2al3lyy0zz5ee0dd)ffoorr ~3C PFOA (Exygen I'D: C0081355, Data Set: 082305{2) Wm rarm e 8 EExxyyage~n RReesseeaarrcchh 22009955..00336644 PPaaggee 13113 aor1f 17777 33MMAA0011555522114411 IWtnartteeirirmmRSReeperopiroetrst 4#4 - - AAna~llyyssiissooff Conage GroveSi and Cottage Gro~ Soil and Water Samples ExyaenStyNo. POOOIAO0 Exy~'t Study No.: PO001400 Figure 10. Chromatogram Representing a Ground Water Sample Figare 10. AACnnhaarlolyymzzeeaddtoffgoorrram "~3CCRPPeFFpOrOeAAsen((EEtixxnyygggaeennGIIrDDo::uCCn0d000W 8811a22t22e88r,,SDDaamattapalSSeeett:: 0913054) 091305A) Bm Tn poi := 1=| ExygenResearch Exyg~n Research 22009955..00336655 PPaaggee 10177 114 of 177 t I3MMAA0011555522114422 - = otpi ost Interim Report #4 - Analysis of Cottage Grove Soil and Wat~a- Samples Sonne Exyg~ Study No,: P0001400 FFiigguurree 1111.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFBBSS iinn RReeaaggeenntt WWaatteerr = ps 3 . sau] = Zz neta Exygen R~sem'~h 22009955..00336666 nia Page 115 of 177 33MMAA0011555522114433 - SWra SaRmeiprri. lysisof CotageGrove Sil and ~nte~m R~ort #4 - Analysis ofCollage Grove Soil and Wat~ Sampi~ xg SyNos: O0OLAOD ~yg~n Study No.: P0001400 FFiigguurree 1122.. EExxttrraacctteedd SSttaannddaarrddssooff PPFFBBSS iinn RReeaaggeenntt W Waatteerr,, 2255 nngg//LL. aanndd 5500 nngg/!LL,, RReessppeeccttiivvedlyy WE EL o7 0 Fm EoLo Exp Reh 22009955..00336677 Fuge Lor 177 Page ll6of 177 33MMAA0011555522114444 _-- VeinSRupolts4 ysis f CoteGrove Sil nd. Interim Report #-4 - Analysis ofCottage Grove Soil rand Wate~ Samples Eryn SNi os acdo Exygen Study No,: P0001400 Figure 13. Figure 13. APP,FFB2B0SSdiin5n0RR0eeanaggge/eLnnttF oCCrootnintfrtirooeldl,,R55e00agnneggn//LtL SFFpoorirtktiieffiiBee,dd RReeaaggeenntt SSppiikkee Respectively A, and 500 ng/L Fortified Reagent Spike B, Respectively irms emt passe 8 oo hoale e i3]wrVL I WE Tevr ee H=Eof. EE - aNn S) `EExxyyggeenn RRecssseaar~chh 22009955..00336688 PPaagg~e t1I177o0ff117777 i 33MMAAD011555522114455 ori Repos 4 -Analysis ofCota GroveSoi od Ime-rim Report #4 - Analysis of'Cottage Gro' ~ Soil and Water Series Water Samples ExygenSayNo:POOIA0 Exygen Stmiy No.: P000I~00 FFiigguurree 1144.. CChhrroommaattooggrraamm RReepprreesseennttiinngg aa SSooiill SSaammppllee AAnnaallyyzzeedd ffoorr PPFFBBSS ((EExxyyggeenn IIDD:: CC00008811335555,, DDaattaa SSeett:: 008822330055CC)) WTRRS See a 2 RNNr Exygen Research Exygen Research 22009955..00336699 Page 11801177 Page I 18 of 177 33MMAA0011555522114466 IWnIitnateieerrrinSmRaeRmp.op~rxl~trst ##44 --AAnnea]lynsii-s~ooffCCoot~aagge~ GGrroovveeSSooillaanndd Wamr Samples EExxyyggecnnSSttuuddyy NNoo:.: PPO00O0O1L4A0000 FFiigguurree 1155.. CCAhnharrlooymmzaeatdtoofggorrraamPmFRRBeSeppr(reEesxseeynngtteiinnnggIDaa:GGCrr0oo0uu8nn1d2d2WW8a,atDteearrtaSSaaSmmetpp:llee A0099n11a33ly00z~5eA4d)). for PFBS (Exygen ID: C0081228, Data Set: Bram ve e = ExEyxyggeenn RReesseeaarrcchh 22009955..00337700 PPaaggee 1111990off117777 i 33MMAA0011555522114477 _-- es ---- WIInnattteeerririmmSaRRmeeppploeorstr##4t4 Ansys -Analysis ofCota ofCottageGGrroovvee;SSooiillaanndd Water SampIes EExxyyggeenn SSVdadyyNNoo:.: PPO0O0O011440000 FFiigguurree 1166.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFHHSS iinn RReeaaggeenntt W Waatteerr fod BEexypgpee~ RReesseeaarrcchh i 22009955..00337711 PPaaggee 1122000o0f117777 i i i I3MMAA0011555522114488 eee------e---------------- IIennttetererimrSRRaemepppoorirtst#~44 - - nals Analysis of of Cota Cottage GCrroovve~ Solan Soil and SysSudyNo: POWIA0 Exygen Study No.: PO00 t400 Wat~ Samples FFiigguurree 1177.. EaExnxtdtrr5aa0ccttneegdd/LSS,ttaaRnneddsaparercddtssioovfeflPPyFFHHSS iina RReeaaggeenntt W Wataeterr,, 2258 nngg//LL and 50 ng/L, Respectively WT Ceeet 5 oall T $i5 u Emme 31 fi a " -- Exygen Research Page 12106177 Page 121 of 177 22009955..00337722 33MMAA0011555522114499 _--m---------- WnaeinSReigs4. yi of Cage Grove Sil 2nd Interim Report #g - Analysis of Cottage Grove Soil Water Sables Eryn Stay No: 01400 Ex'~ygen Study A,and500 g/L Fortified ReagentSpike B, Respectively Figure 18. l~gure 18. PPFFHHSS iinn RReeaaggeenntt CCoonntrtrooll,, 5500nngg//LL FFoorrttiiffiieedd RReeaaggeenntt SSppiikkee A, and 500 ng/L Fortified Reagent Spike B, Respectively J gE ------------------ iP[i .o en af woTeTloTolnmoem i7" LE WE lS i ak Exp Resarh Exygen g,ese,arch Page1200177 Pag~ 122 of 177 22009955..00337733 33MMAA0011555522115500 _--_-- WIransReipm4 lysisof CoteGroveSind Interim Report #4 - Analysis ofCotlage Grove Soil and Water Samples Eryn SyNo: 01400 Exygen Study No.: PO001400 FFiigguurree 1199.. CChhrroommaattooggrraamm RReepprreesseennttiinngg aa SSooiill SSaammppllee AAnnaallyyzzeedd ffoorr PPFFIH-ISS ((EExxyyggeena IIDD:: CC00008811335555,, DDaattaa SSeett:: 008822330055CC)) Wn reees i= | 3 = EnRess F_,xygen Resea~rch PPaaggee 112233o1f117777 22009955..00337744 33MMAA0011555522115511 IencsReapor 4 Ants ofCageGrove Si nd Interim Report #4. Analys~s of Cottag Crrov Soil and Water Samples Exdyy No:sF0n00 Exygcn Study No.: PO001400 FFiigguurree 2200.. CChhrroommaattooggrraamm RReepprrevs~eennttiinngg aa GGrroouunndd WWaatteerr SSaammppllee AAnnaallyyzzeedd ffoorr PPFFHHSS ((EExxyyggeenn IIDD:: CC00008811222288,, DDaattaa SSeett:: 009911330055A4)) BSR Te-- 3: ErynResch Exygen Research 22009955..00337755 i Fae 12406177 Page 124 of 177 33MMAA0011555522115522 WerirnsRaeoe Aiof CotesGrove Sd Int~4m R~rt #4 - Analysis of Cottag~ Grove Water Eon Sud Ns F010 Exygen Study No.: P0001400 FFiigguurree 2211.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFOOSS iinn RReeaaggeenntt W Waatteerr pos ii 3on! ExygenResearch. PPaaggee 1122550off117777 i 22009955..00337766 33MMAA0011555522115533 EE --I ninRept4. Ais of Cogs OrvSol 30 ExSdyNo: FOOLAGD Inmrim Report #4- Analysis ofCottage Grove Soil and Wer Spi Water Sam~les Exygen Study No.: P000L400 Figure 22. Extracted Scandards of PFOS in Reagent Water, 25 ng/L Figure 22. aaEnnxddtr55a00ctnnegdg//LSL,t,aRRneedsspaperecdctstiiovvefellPyyFOS in Reagent Water, 25 ng/L WE eweeet do Le Nn | BoeResch 22009955..00337777 re 2600177 Page 126 ot" I77 33MMAA0011555522115544 rn Ree 4 AsifCota Gove Sd [a -- Interim Re'port #4 - Analysis of Cottag~ Grove Soil and froma Water Samples Exygtcx Study No.: Figure 23. PROS in Reagent Control, 50 ng/L. Fortified Reagent Spike Figure 23. 2AP%,FOaannSddi55n00R00ennaggg//eLLnFFtoCorrtotiinfftilreeoddl,RR5ee0aaggnegenn/Ltt SSFppoiirkkteeifiBBe,,dRRReesespapegececttniitvveeSllpyyike Eastmes a ron i . Te Tbe Tere R Ale Wiese [EE mmm 5 i ic! a [-- Exygen Research |i 22009955..00337788 Page 2706177 Page 127 of 177 33MMAAO011555522115555 ~ I II IIIII .-- ~__: I ~ III IIII IWneeiSRuples proCageGroveSiland EeygnSty No: P0100 Exyg~.n S~dy No.: P0001400 FFiigguurree 2244.. Chromatogram Representinag Soil Sample Analyzed for Cbromatogram Representing a Soil Sample Analy~ed for PPFFOOSS ((EExxyyggeenn IIDD:: CC000~89181335555,, DDaattaa SSeett:: 008822330055CC)) WSR T= :: Espen Reset 22009955..00337799 i Page Pag~ I122880of6117777 33MMAA0011555522115566 WiantteerrnSRaelpeors4- AnaloyfCsoitse Grove Sol and Interim R~port #4 - Analysis ofCottage Grove Soil and Wal~ Samples Exypen Sud No: 20001400 Erygen Study No.: P0001400 FFiigguurree 2255.. ACCnhharrlooymmzaeatdtoofggorrraamPmFRROeeSppr(reeEssxeeynngtteiinnnggIDaa:GGCrr0oo0uu8nn1dd22W W8a,attDeearrtSSaaaSmmeptp:llee 0A9n1a3l0y5z4ed) for PFOS (Erygen ID: C0081228, Data Set: 091305A) BTR , tt $m Exygen Resch ]~xygen Research 22009955..00338800 Page 12900177 i Page 129 of 177 I3MMAA0011555522115577 e--e -------------------------------------------------------------------------------- INTERLM,REP0]~T -~tS- Ap~Iysis ofCottage of`CSapmtptlaegse Grove Grove Sediment Sedimeut and and SSurfa=ce rfaee Water Water Samples AnalysisofPerluoroactanoicAScSTiTUdUD(DPYYFTOTAII)TT,LLPEEerfuorobutaneslfonse (PFES), PPeeSrreffldAluiionmoreaornlohythes,exisxaFaniosnefhes,Pvs=_uaIfnrffodolnCunaloatatreeoo((PcPtFFaUHHasSoiS)in)c,,gAaaLnncddCidPPM~e~SrF"ffOMlluoAoSmr)oof,oocPcttematrerhflseleuus3oulmlMffoobCrrumoattta~teneac((gsPePuFF]GfOOroSoSn)v)aetiiennM(WoW?naFaitBrtemSo,,)n,SSnoogiill., Sediment, Fish, and Clams Using LC/PMrgofgMaSm for the 3M Cottage Grove Monitoring EPA TSCA GooDdR]A~LETTabQAAorUaRtIoErOyRPUrEIaRcMiEcEMe SNEtNaTnTdSSards40 CFR 792 EPA TSCA Good Laboratory Practice Standards 40 ~ 792 JSuiSTsTUiUmDhDaYYKeDDsIaIRRrEEPCCETT.OODRREE Jai`WsWie1ems4stth0ooa0nnKWSSe~ooslsluatutrotiiinooPnn.WsEs,a,.,lIynDccE. E WWePesh1sott4ne0CC:h0heeWs6st1teee0rsrW,0, 1PPn-AAW3117a996y3318800 Phone: 610-7(~1-3761 INTERIM INTERIM RREE`NPPoOOveRRnTTbeCCrOO36MM,P2PL0L0EE5TTIIOONN DATE DATE Norm-abet 3C, 2005 PPEERRFFOORREMMxyIIgNNeGnGLRLeAAsBeIa~OrOcRRhAATTOORRYV. St5300eE55x88CyoRRgleeelsnsgeeeamR,r'ceePhh~ADDcr1rhi6ivv5ee01 Phone: 814272:1039 State College,, PA 16801 Phone: 814-272-1039 SSTTUU3DDMYYCSoSPmPpOOaNNnSSyOORR 33MM SBBtuuii3PllMdadiiinn,CggoM00m22N33p66a5.n-500y1114--4B8--1I 00 Phone: 651.733.6374 St. Pa~], MN 55144 Phone: 651-733-6374 ProtocolPPNRRumOObJJeEEr.CCPTTO001400 Exygen Study Number: PO0DI400 Protoco! Numbs. P0001400 Exygen Study Number:. P000140(3 TToottaal PPaaggeess:: 14114 L 22009955..00338811 I3MMAA0011555522115588 prepstt fs SpExygcn Study No.: PO001400 GOOD LABORATORY PRACTICE COMPLIANCE STATEMENT oeSt oroF105 ap eins RO Exygen Study Number P0001400, entitled "Analysis of Perfluorooctanoic Acid (PFOA), EnrgenSeus ote (1410 5iretsoefet mtt: 0A0)O= Perfluorobutanesulfonal (PFBS), P~rfluorohexanesulfonate (PFHS), and Perfluoroocmnesulfonate (PFOS) in Wamr, Soil, Sediment, Fish, and Clams Using EONS Ere Cosot ts Bop"cme 31 LLCC[/MMSS//MMSS ffoorr tthhee 33MM CCoottttaaggee GGrroovvee MMoorintitoorriinngg PPrrooggrraamm,,"" ccoonndduucctteedd ffoorr 33MM Company, is being pelformed in compliance with EPA TSCA Good Laboratory Practice Sng bag ti Standards 40 CFR 792 by Exygen Research. iFlaherty ~fEornam cipat Investigator Exygen Research BrOAeL Jaisimha Kesari P.E., DEE ESoe Study Dir~tor West~n Solutions, Inc. p=ealia2Al Robert A, Paschke n one Sponsor Represemadve 3M Company rotons Exyg~n R~search Si2b fof Dat* e9lzlog --_-- Page 2 of 114 22009955..00338822 33MMAA0011555522115599 InlAvnnetedrrtSrauRRreeeppoorWtar#5t5et-r-ASAranamabplyylse~ssooff CCoonttsaggeeGGrroovveeSSedediimmeenntt Astd Surftm Water Samples EExxyyggeennSSutuddyyNNoo..: PPU0C0O011440000 ALITY ASSURANCE STATEMEN QUALITY ASSURANCE STATEMENT EeExnxytyggeeednn, RR"eeAsseneaasrrcychhs''ss oQQfuuaPlaeilsittiyyoAArsossosuucrriaaannnccieecUUnAnicitit drree(\v4PieFewOwAes)dd,EEPxxeyyrggefennluSSotturuddcyybuNNruuammnbobeerearsrtuPePlO0C(0OP01F14B40S00)0,,, PPeSeneerdtrilfitlhlmueoeodrnr,otoh,"heAerFxnaiaansnlehyesssaiausln[ffodoofnnCsPaieticcrfs(l(uPPoFFUrHoTsoS)icn),,tgaaanLnnoddOicMPPAeeScrc/ffildlMuuo(SoPrroFofoOoocrcAtatt)na,hneePssuue3llrffMfolounnoCastroeeotba((uPgPtFeRaOOnGS~Sr)u)olfviionnenWWaMattaeoetne(rPri,,FoSSBiooSinil)lg,,, PPRSerresodoegigamrraaecmmhn""'t.,s FSiiAAsalhlnl,ldaarrrneedvdviiOeCewpw]eemerddnssippnhhUagasssePiesnrs'go1ceLwwdCieezra/eM'ees,SiininMtsshppeSeeccStfttvoeudrddytfhfooPerrro3tccMooocnnoddlCu,uoccattttnadgaaccelcclooGrrrddpoiipnvnlgegicMa1to0bolneEEixxtGoyyorggioencdngn RLaebsoeraarteohr'sy SPtraancdtiacred SOtpaendraatridnsg. ProAcleldtftirensd,intghse wSettrldeyrPerpootrotceod1l, antdheallEaxpypgleincabPlreinGciopoald Invesatnd iMagnaageomernt ntodthe Study Director Laboratory Practice Standards. All findings were reported Iavestigator and Management and to the Study Director. to the Exygen Principal Date DaDPtanetecRRieeoppooarrltetdettdoo DDaatteeRBReoeppororo~i-e,dd1~0oDikeReportetdo ae hosed Date !ttspcctcd emer Principal ~vesfi~ator ~ Mwm Eexgyegecnnmet StudyDior Date Reported to Study Director 66. aRRnaadwwFiDDniaetsanRReeevv-iJeeww AAaRvnetaudvlaiFlyeyiewntciacalallfnRRteeepproSormrtt: Review 1091105 11/09-11/05 12905 11/29/O5 1300S 11/30/05 113005 11./'30/05 Techbiycal i Lead, Quality Unit [safes Bate Date a"1nNNaolotytete:i:caAAlllllremipao-rrlltaabb2iinntsspepeecocttoiionocnnlnsuswwiioillnllobfbeethddooccsuutummdeyen.ntteeddThiiinsn QtthhAe QQsaAAtcsmstteaanttetemmieennnvttolffvooerrs ttohhneelyffiitnnhaaell raellvailyetwJocaflthreepionrtteraitmltte~pocrot/lacnkdisaisosnocoifattheed owdata study. This QA statement involvms only the review of the interim report and associated raw data. EExx3y,ggeenn RReesseeaarrcchh 22009955..00338833 PaPgagee 33ooff111144 | 33MMAA0011555522116600 ------------------------------------ LeorenRoie 5 Ams ofrageGomes Intern R~Oo~ #5 "Analysis ofCot~ge Grove S,~limmt And Sm~face Water Samples SeaNo:lOy14 Exy~n Study No.: 1~301~,00 T i nin se por, forBgSandy NaserPOW, + neadconpion CCEERRTTIIFFIICCAATTIIOONN OOFF AAUUTTHHEENNTITCICIITTYY. This interim report, for Exygen Study Number P0001400, is a trae and complet~ representation of the raw data. eretmie e `SSuubbmmitittteeddbby~: E`Exxyyggeenn RReesseea,arc~hh. 3058 Research Drive State College, PA 16801 (814) 272-1039 cpt vig Ex Principal Investigator, Exygen: apliLoznes" /~hn Hahmy Seice Px~sident Exyg~n Research Bog Ranh Fy Mange: Exygen Research Facility Management: ns tie, brhe President foe Exyg~n R~Lrch StyDig,Wen Seton, Study D~Solutions, Inc. TEEEkr pesTiE,,0 Iaisimha Kesari P.E., DEE Weston Solutions, pms Reps, 3M Company: Sponsor Repr~mtativ, 3M Company: TTRe PEie aM Robert A. Paschk ee Ene Programs Manager, 3M Corporate Envi~oim~ental Programs stb Date f ap-dov-oe S. Date ae1Zfzbs =\2jzlos Date sotant Exygm Research partis Page g of 1 I4 22009955..00338844 33MMAA0011555522116611 -------------------------------------------------------------------- InI`tnAenterdriSmurRRfeaepcpoeorrWtta##t55er-- AASnanamalplyylsseiisss of of Coiage Cottage Grove Grove Sedimeet Sediraer.l And Surface Water Samples ExygenStuyNo. POO01400 Exygen Study No.: PO001400 SSTTUUDDYY IIDDEENNTTIIFFIICCAATTIIOONN PerfiAAvLur~aoallhyyessxiiassnooeffsPPualeffrflolsnuoaortrooeo(occPtmaFnno)oii,ce AAacncididdP((ePPlFFuOOoArA)o),o,cPPteealrnfuelousrouorlbofubotunatan~eens(~uuPllfFfooOnn)aattieen((WPPaFFlEBeSS),),,Sil, PeS`rSefedludimiomere~onahtLe,,xFFainissehhs,,unalfnd'odnCCalltm~azm(m.s~FUUHssiSinn),ggaLLnCCd//PMPMerSSrof//lMguMaoSSrmoffooocrrtttahhneees33uMMlfoCCnooattttteaagg(PeeFGGOrrSoo)vveeinMMoWnoianttieotorr,irinSngog.il, Program PPRROOTTOOCCOOLL NNUUMMBBEERR:: EXEXYYGGEENN SSTTUUDDYY NNUUMMBBEERR:: TTYYPPEE OOFF SSTTUUDDYY:: SSAAMMPPLLEEMMAATTRRIIXX:: `TTEESSTT SSUUBBSST3AANNCCEE:: #P00000011440000 PO0OI00 P0001400 RReessiidduuee SSedeimdenitaanmnddSeSuurnrffaatccee WWaatteerr PPPeeerlrffullouurooorroooocbctutaannneoosiiucclfaaocciniddst((ePPFF(OOPAFAB)S),,), PPPPeeeerrrrfflllluuuuoooorrrrooooohhbceeuixxtaaaannnnccesessusuuulllfliffoooonnnnaaaatttteeee((((PPPPFFFFBOHHSSSS)))),,, and and Perfluorooetanesulfonate (PFOS) SSPPOONNSSOORR:: 333MMM CBCoiomkmpipananngyy.0236-01-8-10 3StM.PBauuli,ldMitLNg s5164 0236-01-B-10 St. Paul, MN 55144 STUDY DIRECTOR: STUDY DIRECTOR: SSTTUUDDYY MMOON1INTqTOORR:: lJWaaeiisssitlinomhnbaaSoKKleeusstaairroiinsPP,.EEI,.,.DDEEEE. W14e0s0loWnesStoolunfiWoamy, ~c. `1W4e0s0t WCheegsttoenrWPAay19380 Wetrt Chester, PA 19380 RR3ooMbbeeCrro~tmAAp.aPPnaaysscchhkkee 333StM MM.PBBCauuuoliim,lddpMiiaszNnggy445225-:1004224-.EE-2277 St. Paul, MN 55144 PPEERRFFOORRMMIINNGG LLAABBOORRAATIOORRYY:: AATNRNAMALEYLTYTAITBICLCEAA:LL PPHHAASSEE TIMETABLE: E3E0xx5yy8ggeeRnnesRReeeassrcecaahrrccDhhrive 3SSt0taa5tt8eCRColeolglJeeegageree,,hPPDAAri1v166e880011 ISSntttuueddryyimIInnAicntiamsltiyitooinncDaDlaaeStet::an Date: 000933//1020383/100055 III{mnantttmeeerrfiirmmenn AAARnennapaalollyryyttttiiicccCaaaolllmTTSpeltearerrmmttiilDnonanaattlDeiioa:otnneDD:aat~ee:: 0190/72287/10053 1101/3207//0055 Interim Report Completion Date: 11/30/05 ExygenResearch Ex~Research PPaaggee 5Sooff 111144 22009955..00338855 33MMAA0011555522116622 _--_-- llllllllll I III i i I I I II II III I I al _ . _ -- I nIAtmntedcrriSimamRrRaeecppeorWta##5t5e--AASnnaaalplyyisseiinss of of ots Cottage Grove Gr0v~ Sediment ~dinx~t And Surf~ W~ter SarapMs ExyaenSudy No:PODIAN Exygen Study No.: P0001~0 PROJECT PERSONNEL PROJECT PEI~ONNEL TfThohele:loSSwttiuunddgyypeDDrksioenrcnloetlr fffoorromtthiiEssxyppgrroeojjneccRtteiissseIasacsishiiimmwhheaarKKaeessssaaorcriiaaatttedWWewesisttmohnnvaSSrooiloluuuttsiioopnnsas,,sIIenncc..of TTihhsee intr pornof he following personnel study: l~m Exygca R~sc~ch Wel~ as~iated wflh various phases of this ~ntcrlm port~on ofth~ study: Nee John Jolm FFllaahhcerrttyy KKaarremaaRRiisshhaa CrCihrsisssyyEEddwwar~d&s Mick Ammerman BErriee EEddwwaarrd&s Amy Shechan Mindy Crestey Mindy Brinany Keavets Britmn~y Kmvets TTiittlee VicePresident Vic~ Pre,sidcnt LLaabboorraattoorryy SSuuppeerrvviissoorr TTeecchhnniicciiaann SSaammppllee Custodian Custodian SSaammppllee CCuussttooddiiaann AAssssoocciiaattee SScciieenmtiimst TTeecchhnniicciiaann TTeeschhinciciiaann Exygen Reseach 22009955..00338866 PPaugs~G6aorfll1414 33MMAA0011555522116633 ---------------- eee-- -- ------ ------ ------ -- A~ntt~edrr~SimurRRteecppeoorWrtta#i5e-rASaspylaes ofCotasGreSines And Surface Wa~-r ExygenSrady No: POOOLI0D TAOFBCONLTENETS TABLE OF CONTENTS. PPaaggee TITLE PAGEcomms ssssmn) TITLE PAG ....................................................................................................................... 1 GOOD LABORATORY PRACTICECOMPLIANCESTATEMENT creed ~D ~~TO~Y P~CE CO~~ STA~ ..............................2 QU~ ~S~CE STA~ .......................................................................... 3 CERTIFOFIAUCTHAENTTICIITOY N ors sccsmrmh CER~CA~ON O~ A~~Y ........ STUDY IDENTIFICATION. T---- PRO~ PE~0~....................................................................................................6 T~ OF CO~S .....................................................................................................7 Fr ------ ~ OF T~S ............................................................................................................... ~T OF ~G~ ..............................................................................................................9 LIST OF APPENDICES srovmomoes emeticl ~T OF ~P~I~ .................................................................................................... 11 1,0 S~Y ................................................................................................................. 12 2.00~~ .................................................. 12 30 INTRODUCTION commer emesis ld 3.0 ~O~ON....................................................................................................... 13 40 ANALYTETSTISACMPALESL cso ovrr treed 4.0 ~~IC~ T~T S~L~ .............................................................................. 13 5.0 REFERENCE MATERIAL cers cnnemssmioned 5.0 ~~CE ~T~ ........................................................................................ 13 60 DESCOFRANIALYPTICTALMIETOHOND... commence: 13 6.0 DESC~ON OF ~~C~ ~THOD ........................................................ 62PercentSolids ProcedureForSEAEnt mre O 6.1 ~fi~ ~m f~ S~u.......................................................................... 16 62 P~t So~ ~m F~ S~mt ................................................................... 16 66.43PErxeptarraactiioonnProofSvedtaf0nr2WnddAFIaOTrCadtison Se OWUEOe NS. r vesrtsee 61] 6.3 Ex~fi~ ~~ for Wat~................................................................................ 16 6.4 ~~ of Sm~ ~d F~fi~n ~lufio~ ............................................... 17 6.5 ~o~hy ...................................................................................................... 1 6.6TOSTUDEORSETSEVIY errroer 18 6.6 ~~t ~ififi~............................................................:................................. 18 6.7DescriptionofLC/MS/MSInstrument10dOperating COOHEONS. rrr 18 6.7 ~on ofLC~S ~t ~d ~g Con~fio~........................... 18 PT TaT ySr -- 63 ~fi~on ~ Exmple C~on..................................................................... 19 70 EXPERIMENTAL DESIGN creo oe ereet terrence 2h 7,0 E~~~ D~IGN ......................................................................................21 80 RESULTS... eens 2222 8.0 ~S~ ......................... 97.00.0CR ONCE LUST IOONFSEDAN TcAAT NoDSI AcMPO LESN -- comm 9.0 CON~USIONS ......................................................................................................... 10.0 ~ON OF DATA ~ S~S ............................................................. ExEyxyagecnn RReesseeaarcchh 22009955..00338877 PaPaggee T7aoff111144 33MMAA0011555522116644 A mi Rept 5 -ASaciss of Cotage GroveSeioest In.rim Report #5 - Auatysis ofCot~age Grove Sediment And Surfac~ W~te~ S~rnpl~s EinSy No:FROIH00 Exygen Study No.: P0001400 LL~IISSTTOOFFTTAABBLLEE~SI Tablel. SoomfPaBSy, PEHS, PEOS and BFOA in Sediment Semple ...P2ag6e 24 Table I. Summary ofPFBS, PFHS, PFOS and PFOA in Sediment Samples .............. TTaabblel~e Tab Mix Spike Recovery ofPERS and FHS in Sime Spies... 26 Table HI, Tle IV. Mati Spike Recovery ofPFOS a PFOA i Sint Semple ve28 Table IV. Table. Mavi SpikeReco of PFBS ndFESinSurface WaterSampie.----30 Table V. Table VL. Mari Sik Recovery ofPFOS nd PFOA in Surface Water Supls.32 Table VI. TTaabbllee VVIIIL. SSumummarmyouaffPPrFFBBySS,, PPFFHHSS,, PPFFOOSSaannddPPFFOOAA iinn SSuurrffaac~e Water Wa~er Samples.......2255 Sample~...... Matrix Spike Re~ov~'ry of PFBS and PFHS in Sediment Samples ............... .26 Matrix Spike Recovery of PFOS and PFOA in S~lim~nt Samples .............. 28 MaWix Spike Recovvry of PFBS and PFHS in Suffa~ Water Samples ......... 30 Matrix Spike Recovery of PFOS and PFOA in Sufra~ Water Samples ........32 SSeurrrrooggaatteeSSppiikkee RRe~coovveerryyooff''~CC PPFFOOAA iinn SSeudiiimmeenntt Samples.......... won33~ Samples .................... TableTX. Total PctSods forSoG SATPIC veneer38 TTabablleeVVIIILI.SSuunrgroagtateeSSppiikkexRRe~c,oovvee,rryy ooff '13CCPPFFOOAAiina SSuurrffaacceeWWataeterr Sumpls...........3366 Samples ............. Table DL Totad Pement Solids for Sediment Samples....................................................38 ExprResch Exygen Resea~h 22009955..00338888 PPaagee o8roft1i1e4 33MMAA0011555522116655 --T--T--T ------------------------------------------ i I I I III I III I ~ I I I I IIIIII I ...... `tAnrdiSmurRfeapcoerWt e45r-ASampnlesaofColta yGrosve Siedimsent Exype StdyNos POLIO EJtyg~ Study NO,; P0001400 Page LLIISSTT OOFF FFIIGGUURREESS Page Figure1. Figure I. TTypyipcicaall CCaalhl'brraattioonnCCuruvefrfoorrPvPFOOeAA iinnRRE~2ggeenntt WAL... dO Water.................................40 FFiigguurree22.. ExEtxrtaracctteeddSSttaannddaarrddssooffPPFFOOAAiinnRReaeaggeennttWWataeterr,, 2255nngg//LLaanndd S50O gL, ng/L, Figure3. Figta-~ 3. Figured. Figure 4. Figure 5. Figure 5, Respectively ................................................................................................... 41 PFOAin ReagentControl, 50 g/L. FortiiodReagentSpikeA, ind PFOA in R~g~t Control, 50 n~/L Fortified Reag~t Spik~ A, and 500 ng/L. Fortified Reagent SpeB, RESPEctvly..evreveer Al 500 ng/L Fortified Reage~ Spike B, Respectively........................................42 CiromatogramRepresenting SeimentSample AnalyzedforPFOA Chromatogram R~p~esendng a Sediment S~x~ple Analyzed fo~ PFOA ((EExxyygge~n IIDD:: CC00008855662244,, DDaattaa SSe~tt:: 1I0000660055C~)) .w...v......m..s..r..s..o.m..s..m..s..s.s..s..s..m..e..s.s..s..n..i...43 Chromatogr Representing aSurfice WaterSampleAnalyzedfor Chromatogram Representing a Surfa~ Water Saraple Analyzed for FROA(Exygen ID:COOD8it SSe:509928055D)c,o rrrrorrrescebh PFOA (Exyg~n ID: C0085595. Data Set: 092805D) ......................................44 Figur7e, FFiiggaurr~e 66.. Figure 7. Figures. Figure 8. Fiigagruere59.. Figure 10. Figure 10. TTyyppiiccaMl CCaalli~bbrraattiloonn CCaurrvveeffoorr "~3CC PPFFOOAA iinnRReeaaggeenntt WWatae~rr ......o....c..................4455 ExtctedSundardof "CPFOAinReagent Wetr 25nLand Extorted Standat~ of~C PFOA in Reagent Water, 25 ng/L and ria ve 50 ng/L, Respectively .....................................................................................46 CPFOAinReagentControl, 50 ng/L. FortifiedReageatSpikeA,ad ~3C PFOA in R~gent Control, 50 ng/L Fortified Reagent Spike A, and 500ng/L Fortified ReagentSpikeB, RESpECVElYerr ven A] 500 ng/L Fortified Reagent Spike B, Respectively..........................................47 Chromstogram Representing aSedimentSampleAnalyze for Chrumato~'a~ Representing a Sediment Sample Analyzed for 5C PFOA(EcygenID:CO085D6at24Se,t: 100605). AS ~3C PFOA (Exygen ID: C008562~, Data Set: 100605C)...............................48 ChromatogramRepresenting Surface Wai SempleAnalyzfeord Chromatogram Representing a Surface Water Sampk Anab,z~ for ICJCPPFFOOAA((EExxyyggeennIIDD::CCO00088555599S5,,DDaattaaSSeett::009922880055DD)) ...............c.r..e.m.o.v..e.c.v.e..m.e.e...949 Figure 12. ExtractedStdandsofPEBSinResgoat Water, 25ng/L.asd 50 gL, F Figu~re 1111.. TTyyppiiccaall CCaalliibbrraattiioonnCCuurrvveeffoorrPPFFBBSSiinn RReeaaggeenntt WWALaEteTr..............................c..u..w.w..v..n..m..n.s.5500 ~ 12. Ex~ Standard~ of PFBS in P,mgem Water. 25 ng/L and 50 ns/L, Respectively ................................................................................................... 51 Figure 13. PFBSinResgeotControl, 50 ng/LFortified Reagent SpikeA,asd Fi~e 13. PFBS in Reagent Contzol, 50 ng/L Fortified Reagem Spike A, and 500ng/L Fortified ReSapkegB,ReESPnecvtel. erm S2 500 ng/L Fo~ifled Re~gent Spike B, Respectively......................................~.52 Figure 14. Coromstogram RepreseanSetdiimnengt Semple Analyzed fPo FBS ~ 14. Ctwoma~ogram Representing a Sediment S~,-pte Analyz~ for WBS ((EExxyyggeenn IIDD:: CC00008855662244,, DDaattaa SSeett:: 110000660055CC)) ...c..o..m.v..e..v..n.c..s..n.n..c..n..m.m..m..o..m.s..s..n..s.n..s..e..n.S.533. FFigiu~ re115. CChrhroommat~otoggrraammRReperperseesnetni~ngg aaSSurmf'af~ceeWWata~e-rrSSaammpplleeAAnnaallyzyezdfefoodrr FBS(Exygen ID: CO08S595, DaaSc: S280SD). merc S4 PFBS ~ ID: C0085595. Data S~t: 092805D).....................................54 Figure 16. Typical CalCuirvefror PaFHSiinRoeagnent WE verre 35 Fi~ 16. Typic~ C~ibra~on Curve for PFHS in Reag~tt Wat~ .................................55 Figure 17. Extracted Standards of PFHSinReagentWater,25nL od 500g/L, F~ 17. me Extr~t~l Standards of PFHS in Re~ge~t Water, 25 ng/L and 50 ngiL, R0spe~tively .................................................................................................... 56 EExxypgeo~ RReesseea~cehh PPaaggeeSgooff1l1l44 22009955..00338899 I3MMAA0011555522116666 _-- rei Roe - Anas of Corage rove Sediment Exp StyNo 001400 Interim Report #5 - AnalysLs ofCottage Grove Sediment frog ast teleemont Ar~ Sttrface Water Sam#es Exygen Stud~ No.: LISTOFFIGURES (continued) LIST OF FIGURES ( onttnued) Page Figare 18. PFES in Reages Cool, 50g Fortified Regent Spike A, td Figure 18. PFHS in Reagent Comrol, 50 ng/L Fortified Reagent Spike A, and 500mg Ford Reagent Spe B, RERDOANel... rr revennenT 500 ng/L FoRified Reagent Spike B, Respectively.........................................57 Figure 19. ChromatogramRepresentinga Sediment Sample Analyzedfor PFS Figure 19. Chromatogram Representing a Sediment Sample Analyzed for PFIL.q (Erygen I.COO88624,DisSet: 100B05C) rrr (Exygcn ID: C0085624, Data Set: 100605C) ................................................. Figure 20. Chromatogr RepresSureicneWatteriSanmpgleAnalyzed for Figure 20. Ckromatogram Representing a Surface WaIer Sample Analyzed for FHS (xypen I COOBSS55, DataSet 09280SD) rere 59 PFHS (Exygcn ID: C0085595, Data Set: 09'2805D) ......................................59 Figure 21. Typical Cabbraon Cv foxPOS in REAgect Wale voces 80 Figure 21. Typical Calibration Curve for PFOS in Reagent Water .................................60 Figae22. Extracted Siandards ofPROS i Reagent Water,25ng/Land 50g Figme 22. Extractcfl Standards ofPFOS in goagcnt Water, 25 ng!L and 50 ngiL, l~espectNely.................................................................................................... 6 FFiiggulnr~e 2233.. PPFFOOSS ii~n RRe~aggemnttCConotnrtoroll,, 5500nngg//LLFForotritiffiieedd RReeaaggeennttSSppiikkeeAA,,aanndd 500 g/L.Forte ReBge:SpikeB, RESPCHVEYrrerorc G2 500 ng/L Fortified Reagent Spike B, Resp~.ively.........................................62 Figure 26. CiromaiogramRepresenting SedimentSampleAssyzed fo PFOS Figure 24.. Chromatogram Representing a Sediment Sample Analyzed for PFOS (Exygen To: CO083626,Dal St 100B0SC) rere :63 ff.xygen ID: C0085624, Data Set: 100605C} .................................................63 Figure 25. ChromsiogramReprsentingaSufi Wer SampleAnalyzed or Figu~ 25. Chromatogram Representing a Surface Water Sample Analyzed for F0S (Beygen I>CONESS35,Da Set 0928S) rere 8 PFOS (Exygen ID: C0085595, Data Set: 092805D) ......................................64 Exp Reset PaPgagee 000124 lOofl14 22009955..00339900 33MMAA0011555522116677 -------------- InIAntoteedrriiSmmuRrRefapecpoeorrWtte##i5$cr-- AASnanamlapylylssieisssooffCCootttaaggeeGGrroovveeS~eddiimmecnatt A~] Smffa~ Water Samples Exygen Suudy No: PX0OI400 Exygen Study No.: P0001400 AAppppeennddiixx A A LLIISSTT OOFF AAPPPPEENNDDIICCEESS ase Study Protocol PO0O1400(ExygenStudy No. PO0O1400) with Study Protocol P0001400 (Exyg~n Study No. P0001400) with Jr re A --_ Analytical MOlaods and Amendments .......................................................65 EExxyyggeenn RReesseeaarrcchh 22009955..00339911 PPaaggee IlIooffl11144 33MMAA0011555522116688 nN~ oediSaRtPea.pgo~rrtwt e#55r--SAAnaanlamylysesiissooffCCoonttgagtGGrorovwe Sint And Surfage Water Samples BExxyyggeennSStuydy NNoo.:PO001400 11..00 SSUUMMMMAARRYY EEdxxeyytigeeennntRReiesoseneaarmcohhf eepxxettrrrdaacuctoteerddosoancnaddnaoaninaeal1y3crzziecddd sse(edPdiFimmOeAen)nt,taapndedsrusuurorfrfaaoccbeeuawwanateteesrruslsaaommnpslpeelessf(PfooFrBtSht)he,e ExppdeeeyrrtgmfflleumunocirrnMooaehhtteeioxshnaaonndeeosssufuVllOffp0ooe0nnrIsfa7lttuee8o2r((oPaPoFFncHHdtSaSV)n),Oo,OicDaanInadd7c3ilp0d)e,ersrf(ul'eIaos)oFprreOoocoAotisu)va,teanlnpcyceesr(uufAlhlupeooponrenosnabtdt,eil_xt((-P~PAFeF)sOOuSSlf))onasaotcecoor(drPlFnigBn1Stg)0o, Exyge~ Methods V00017g7. and V00017gO, respectively (Appea~x A). "(TTvhheeetlwlieimmiigitthotof)fqaqnuunatnifahittatoliionmnitffooofrr dPPeFFtOOecAAt,,iPoPnFFfSBoS,P,PFPFFOHHASS,sPaFdnBdSPP,FFPOOFSSEiSin~saesnedddiiPmmeFenOnttSwwainasss0e0..i44mnncgg/n/ggt (wwwriafesstc00ew..22ewinngagthg/egtr) ((wawwraegestttwtw5he0eeinigglighhmt)..i.tTaThonhefdeldlehiimteeltcittoiioofftnqqfuouoftraadtPeinttFaeOttcitoAiino,nofPorFroPBxPFSPF,OOFPAOAF,A,H,PPSFFPBBFaSSnB,d,SPP,PFFPFHFIOS~HaSSaamnd1d2sdPPeFFdPOiOmFSSOeiiSnnnt isnms'faeue wwaratetrefwr waasas50c5ngg/LeL.and the limit of detection for PFOA, PFBS, PFHS and PFOS in surface water was 25 ng/L. AnPAaRlnOyaStlyitciicanasllerdresissmuule~snstaancndadspaeessssesassereeddsauaccmccmuuarrcraicieizesesdffioonrtTthhaeebaalnnaeal,lyyssiisAs ooffnPPFFaOOAA,lf,ePPlFyFtSBsS,ts,oPdPiFFaHHsScSe,s,msaaenddd PFOS in sediment samples are s~mmarize~ m Talkie 1.. Allaly~ic.al ~ and aggessed s2cdcsuoaciicastfeodrtfhieedQaCbesloefsPFrOeA,suPmFmBaSr,izPeFdEiSn,TanbdPILO.Sin arta watesamples accumoi~ for th~ anaJ~is of" PFOA, PFBS, I~FFIS, and PFOS in surface wate~ samples and assooiated field QC sarap1s are sammarizeal in Table H. dFFeoorrltiiffeiccitatiniooTnn rraeecc.oobvIveerlireas~nfefodorIPsVPF.FOOTAAh,,ePPaFFvBBeSrS,a,gPPepFFeHRrScSetnaatnddrPcPoRFvOOeSrSiieinsntthheestsaendddiiamcrdeodntetsvsuaimmcppellsessfaorrree detailed in Tabka HI and IV. The average percent recoveries standard deviatiorm for PFPP11FR0O0O%O%AASs,ai0nnPnddPFtFB88hB4S4eS,s4+,uPPr22FFf77HHa%%Sc,S,erareawnesnaspddtpeeecPPctrFFitisOvOvaeSeSlmliypyi.ln.netFtohFhreoaetrsinutfei)difddiciciasmamtoteiiecoonnninttsarsraeteamccemopodvplveelerGesriesieelwswsdefeQrfroreCe6r6sP4P4aFFm+OO+pAAl22,e44, s%%PP,F,F4B4rS9e9S,,dPeP8tF8F%s%HHi,Sl,Se9m9d6a6dinn+&d PPTTFFaBObaSlS,esPbiFnVVHlathSaneneaddnsVdasVrIfIPa..cRTeOThSwhieeanatteavrhveeesrrsaaanogg~feeiplepecsreecrwcaeaennntdtterraerssecsacooomvcvpeierlariteeieesdsswef++ireslsedata3nnQddCaardds1da8emd%ve,pivalie1tas0it2ioo.ann2rses1fodf6orer%taP1PilFFe0OdO9AAi+,n, P1L3%US1,2P0F9H8S&a1n8d%P,rFeOspSecintivtheelys.urface water samples were 93 + 18%, 102 + 16%, 109 13% and 98 + 18%, respectively. Fortification recoveries for C PFOA intheseimentsample aedetailed in TableVI. Fortification recoveries fo~ tzC PFOA in the sediment samples are detailed in Table VII. TThhee aavveerraaggeeple~r'lc~eennttrereccoovveerriieess ++ ssttaannddaarrdddedveivaiattiioonnssffoorr 1'3CC PPFFOOAAiinnthtle~ses~ddiimmeenntt ` sm~spleaswwemrereep666l 6++e1133s%%.. FFoorirtfiiliccaattiioonnr~ec,oovveerriiccssfoforr ~3CC PPFFOOAAiinntthheessuurrffaacceewwatae~r, Jamesandassociated iedQC sacaplesar deal in TableVILL Thesveragspret samples and associated field QC r~nplcs a~ deh'tiled in Table VIII. The avoragc ~ `rreercoovveerriieess ++ssttaannddaarrddddeevviiaattiioonnssffoorr u'CC PPFFOOAA.iinnththeessuurrffaacceewwaatteerrssaammpplleesswweerree8888 + i.11%. z2..00 OBJECTIVE TThheeoobbjecjtiveeoofct' ttthhee sim~l-avylyitciecaallppainnt ooffttihsis ssttudyy wasto dtemioe was to determine levels of levels of eppeerrffllftumorr~ouoocettaannocoiiec roaa(cciPddFbFS)e, ((aPPnFFdsOOpAAe)c)a,i, uronocppaeeenrrefflsutmiosfrmoobcbuauuattanene(sePosuuFllfOfooSnrn)aaittenessediime(](n)PFtFeaBBSnS))d,, Sfucewateraccording toProtocolPOODI400 (Appeadi A). lX:ffluorohexanesulfonate (PFHS}, and perfluorooctanesulfonate surface water according to Protocol P0001400 (Appendix A). (PFOS) in sediment and . `EExxyyggeennRgeesse~amrchh PPaaggee 11220o0f1l1144 i 22009955..00339922 33MMAA0011555522116699 EU -- IAoInnttederrSiimumeR~ feceptWe##5Sr--ASAnenamlapyllysesisiss oof fCCoomtgaGGro~vvecSSeedii~ni And Surfac. W~'t Samples Er SdyNy os FUOn OLA0D Exygen Study No.: P0001400 33..80 IINNTTRROODDUUCCTTIIOONN TeThnMidssPrreFqpOmoSrrtit ddneettasaicilldsittmhheeenrtessuiuslti~noogffththheeeaa~nn,aa~ll!yyyts~iiiscsaflfoorrmttehhteehddoeetdteeerrmmnineimadttii,oo"anoVoOffOPPOFF1OO7A8A,3,P;PMBFe]S~bS,b, oPPdHFo-ISfS LAOnAaanMnldaySlysPsiMFisOsSfSfo"orirantnthhsedeedDiiDemnteseetnuretrmfmiiunicsnaieantwtigiooanntthoeeoffauPnsPeair~lnylfgtluitucooharrleooamoonccaetaltahynnotooidiiccaeAlnActmictielieddtdh(,(oPP"dFFWcOOo0AA0t)0)ii1e7innd8,2SS":eeVdMdiOimmOeteIhenTontdtSb0boy:yf LC.OCIS/MS" and in surface water using Re analytical method entitled, "V0001780: LMeOtMhSodMSof.An"alysis fo theDeterminationof PeflorooctancicAcid(PFOA)in Water by Method ofAnaly~s for ~e Determination ofPerfluorooetanoi Acid (PFOA) in Water by TsThuhebesesutruddPyyOw0w0aIasAs0ni0n.iitiiTaitheddeoaonnnaMlMayrcaracdlh~0t03a3,r,t2d20a00t~55,,fowwhhteeinnstihthetesetsrtuuddyyrdedpioirrrectcwotoarrssi~Sgiegnpneteeddpm0rbvreoirto2oce8oo,ll. 20n0m5n,bsenr dPt0h0e0a1n4a0l0yt.icTailmteamniaclayitiocnaldsattaert odratehifsor ~ ri port interimwraepsoOrct twoabseS2e7p,te2m00b5e,r 28, 2005, and the analytical termination date for this imerim report was October 27, 2005. 44..00 AANNAALLYYTTIICCAALLTTEESSTT SAMPLES SAMPLES T(TwCweODne8ntSty5ys34sie)dweimenreenttrsesacamempiplvleeesdsaaatnnaddmfbofriotretyny sstuuermtrpugecereavtwiuareetrersomsaammApuplgleei~ss(t(BExx1y5y,gg2ee0na0II5DDfCoCO0Om0SC8Sh5Sa5Tr7Sl5es-= sYeYCop0oau0urn8nag5tg6e3aaa4tt m)WWpweleseestrtseooinnreSeoS.cloeTuiluvhtteieidofononasrstt,,lyainnmsccu.b.rifTeinTchteheweteamt~twwptee~nsrtnaaytmtyusprelseededisoimnrmeeenApntrutosgesauanmsmttpepl1dle5essi,r2eere0psp0rar5eemsspefernnlotemesditCtetwhwseaenarnxnlt~ydy bsaalesapssoacraipsateteeo~dsftf.icpieellTldeidhQQesaCisCteasstmas.pamTmlpeehlpseeldeswfs.eo.TrrtehTyrlhseoruegerefgawwecaeaittnweebrasytsaeamErmpxslpayelmgesesprnlreepepseprrrrsseecopsanr~tenteseeedldntnaaeddttrrpm iplpaebcbellasanakmkisparnlndeedsftwiwteeoors eatrrnidipdp sorege blank spikes. stolage. The samples were logged in by Exygen personnel and placed in refrigerated aSSaarmuspplleelsolowggioi-tinnhtacaiansddiccthheatariininoaeofrefcpoudcrustst.tooStddoyyriainngfefoorrrmmecaaottriidoosnwiiisslllolbocecaaktteeepddtiainnttEthxheyergreaaawwRdedsaaetaaarpcpahac.ckkaaggee assoCiated with this interim report. Storage records will be kept at Exygen Research. 55..00 RREEFFEERREENNCCEE MMAATTEERRIIAALL "ETTxhhyeeganaeannlaoylytntiiccDaall ssettaanncddiarerdd,,m0PP6FFbO,OAA2e,0,w0wra5as,sppuurTrcchhheaassseeuddmfforoogmmaStSeiisggpmmiakaAiAnlgdldrrisitccahhnaadnnadrddww,aassrrCeecceeilivavbeeeddlseatdt peEpre3xiryCfngloureomonrpooacoontcntnyaa.nDoieicccae3acMm~iJbdsdeurp((Ip3l0Cci8e,PPdFF2OOt0AhA0)e3),,.wswaaaasl~TyrirheececaielisvvusedrudrnodaagsftaErtExedxsyygsgPpeeFitktBoiSonnngmAApdsptearPlinldF1a155rS,d, ,.2200~00PZ44FCfBfiSo-loamwmbtealthehsdee Toer3necMe~Tiva~vmexeud~fmfrprooa2nmm0y,.332MM03a0Mat3tE,EPx~xRytytgpOgpe~SlnnieowdoanntshMMpeauaryaycnh1a1al3,ys,te2i2cd00af00lr55o..smtPaPFnFFldHuHaSkrSdawswCaoaPs~rFrpBroceSrcea.~itaiivvnoedddnfaPfrnrFoodHmmwSa3.3sMMraPeatFcteBEEiSxxvyyewggdeeaan~tn ExoyuApgi 2e,2n003 on January 20, 2003. PFOS Exygen on Al~i! 23, 2003. was purdmsed from Fluks Corporation and was rt~eived at TaThbheeiaevasva.tiialabblPteeFiBnrefSfo,orPrmmaFtaHitioSonnaffnordrtthh1eCrrPeeffFeerrOeennAct2ewmemeraeatesrliiaslrseiissdiflirssoetezddenbbeealloonwwd..PRFPFOOSFAwwawasaOs~ssstitoAertreteeddd armefbriiegnet.re.PFBS, PFHS ~nd ~3C PFOA were ~tored frozen and PFOS was stored ErygenReseach Exyg~n Rcr~arch PaPgagee 11330o0f111144 22009955..00339933 33MMAA0011555522117700 J prrps sms Sopa Intcrbn Eeport #~ - AnalysL~ ofCot~ge Grove S~Emcnt E~y~n Study No.: P0001400 Compound. cmt mma PFOA Gro mma tP~CCPPFFOOAA my mmm P~S momma P~S Expert lnventow No. SPS SO~ ~00314I88B~44 S~5726 S~I PFOS S~26~ lot, P00 ep Lot.....~# me gnaw ~3355100771--61199~55 mom am 101 ogmomc om SE036 Puri~ (%~ 97.~ 9977 ~.7 98.6 ~ 0013~320~989//0I0~59 1~ 10/l~ 430180~1 101.2 10~1/07 TThheemmoloeleccuullaarrssttrruuccttuurreess ooffPPFFOOAA,, u"CCPPFFOOAA,, PPFFBBSS,, PpFFHHSSaantdtd PFOS are givenon the PFOS are give, on the foflollloowwiinnggppaaggees~:: r9onpr pie PFOA Chemical Name: Periluo~ooctanoic acid S rrig Moleo_dm" Weight: 414 Transitions Monitored:444111333 --=~223116999(((fff'ooor~rcqcoounnafnfiirtmimfmaictafiitooionnn))) and se , F F r F PeF FEF T F UCPFOA Te vier Chemical Name: 1,2-13C perfluomoctanoic acid Molecular Weight 416 IA p om Transition Monitored: 415 -~ 370 Structure: aller lL F F F F F FIF ~ " F~t3C ue/" Co~OnH 10F F 1 re on Son MoMClheoecimeuvilucalaarlrNW Waemeiiggeh:htt:p:'e33~33f8l8usosuurpoppbpluliiteeaddaaeasssutlthfhoeetpmpoottetaassssiiuummssaalltt ((CCde~FSsOSO3y"KK'+)) Erm Tramitions Monitored: 299 --> 99 -- ste Exygen Resea~ 22009955..00339944 33MMAA0011555522117711 -_ III I i i iiiiill i i mmnm i i i iiii . - : T pb--s-L pmN: o t Structure: F F~/~,,~ O~ F F Boge: Exygen Study No.: rusPFHS msrapempomotens MCMoholeelmeccuiucllaaalrrNWWaemieigegh:htt:P: 4e4r33fl88usosruopuhpelxipeadnaep assstuthll hfeeopnpi oaottlaeae ssssiid uumm ssaalltt ((CCseFF~13:S8O03;"KK"*)) Sn Transitions Monitored: 399 -> 80 pe Stmctare: mF oF nF e mosPFOS 8pe: recone MoMClheoelcmeucilucalaarlrNWWe~ienigegh:htt::Pe55r33fl88usosurupoppoplcliiteaedndaeasssuttlhfhoeenppaoottetaassssiiuumms~aalJltt ((CCsiFF~iSnOSO3y-KK'*)) hea Tramitions Moni~red: 499 ~ 80 hes SUuctar~: phe: ]FJF|F|F _ F 66.00 D__ESCRIPTIOINN OOFF ANAANLALYYTTIICC;AL METHOD ES -- The analytictl methods %r0001782: Method o~ Analysis for the Determination of Be at Seer Pedluorooctanoic A~id (PFOA) in Sediment by LC!MS/MS" and 'W0001780: Metlmd of T eE eL eberacant. e370 5 i A~alysis for th~ Determination of Perfluoroo~tanoi Acid (PFOA) i~ Water by I.CiMS!MS" w~re used fo~ this study, SN. F~ygen netsoe Page 15 oflM 22009955..00339955 33MMAA0011555522117722 ---------------------------------------------------------------------- AInntderSiumfRuecpoerWt#ai5ee-ASnaamlpylseissofCotageGroveSediment EExygxenSSttyauddyyN~goo:.: PPeOOO0D0Ln1A40000 6~1.!EExt~rarc~toionnPPrroocceedduurreeffoorrS~eld~immeenntt `vBiegfoorroeutshlyesshaakmipnlgesbweecronetwaeiingerh.edA.Sf-ogrtrahmepeoxttriaocntoiofns,tehdiemyewnetrweamsiwxeeidg.hWeodriotuogh2lGyfbtyy`mmiLlloilfit1er%caecvettiifcugectiduibnewaorttehrweaexstardacdteidon1. Athfesramfpolers.tTihefsoiufmcpaalppetrsowiperiorsetnvesoarmtpelxeesd,un3d5. aflolro~w2s0d tmisnuhteekseao1n~3a0w0r0irsteamc.tiTohnsehsaukpeerrnfaotra~nt6w0amisntuhteensl.oTadheedsontao mwCesprSePcElenctaierfturgiseddg.e cTownedoittyiomniedlwtietrhso1f0mmeLthoafnmoeltwhaasnaodlsdenddto2t0mheLseodfimwaetnetrs.aTmphleeesleltinwuathseadciesncttarridfeeudg.e taubne. oT3ht0esmhianmeuptlerse.swTehresvaomrptleexsewdearnedceanltlroiwfeugdtedoasghaainkfeoorn~2a0wmriinsuttaecstaiotn~S3a0k0e0rrpfomr. Tcohlelescutepdeimnattoanta w$a0s0tmheLnlNoaaldgeedneoBnoltotlteh.e sTuhmeecCoileuSmPnEwcaasrwiadsghee.dTwhiethel4umateLwaosf hmuentdharneodlm.ilTlihleitwearsohfwwaaslceorlwlcacstdaidndtehdetsoatmheebobtotrleeass.tsTehcehsute.aAmppwerproexmliimxaeetdesbtlwyyo snhadki2n0gm andloofaL wdaetdeorn,toTanhootbcelrusCiyewSaPsEdciasrctarriddegdec.ondAiptpiroonxeidewuidtehly1f0imveLmoilflimleittehrasnoolf g`amdeuthsaineoldwa1s5madLdedp.tootlhyecparridogceepn.tryFifiluvgeeemtniulbele.erEsaocfh cslaumeplweawsacoslalenctaeld ynztboeyd2 LOMS/MS electrospray. 6:6.22PPe~rrc~eennttSSooliliddssPPrrocoeducreFeFoodrrSSeueddirimmeeenntt `PVP0ezr0ruc0ec0nn4tt2s7soo.lliiddAsswwezrpreeddeetpteerrmmrii2nnee0ddgo uuessiminnxsggottfhhseeippurroopcmcee~ddwumara'eseiwnindetdiiiccgaahWteeeAddiiintnloEExxayypyggaeznnn.mmTehettehhwoodedighotf tVt2ah1hte10e50s10s0a04mm~m0iup4~npl22:ul72eesp.Cpl.CA.lu.uEspTsatTphtchrhheohe~~nxpspiaatmtahhmnneaepwstwleasaelaasmywmsp2arrpl0~esleceogsostwrrrhwdaedem~erendrleswe..teoTrtTifrhaaghrnenu~hssmseffsadee~prmarlkrepgeeoealdwli1ee~n0asso:s,wi3wawandacd~esietsiog~sthdhihseieciennca~dgatdtodtiornrhriritaeoeeandwdvaedidinpinaa2aglalnh0lnl.otooowoTwvvfeeheedtdennhotw0eoovcpveeoaceimoongroinhl.lgitfgfhoTohothfrtre pe-pr1ecr5ce~mnnt~.Jsn~oulotil~idd.ffoEorraceehaaccshhasmsaapmmlpepl~ leewwaats~stethh~eewnnccciagalll~ccueudllaa=tee~dd..n, including the v.~igh~ ofthe pan. The 63Extraction ProcedureforWater 63 Extraction Procedure for Water fAAor4t4i0f0imcmatLiLoanlaoiliqfquuaopopttoroofpftrithhset~ewwsaaatmtezprrlse~asn,mpptllheewswaamaspsuluse~esedwdefrfooerrtlhtoheaedee~dxtrioarnactcfoitoonanpCprirosocceSedPduEurrceea..rtr~ Aifdgre c~f`ooAonrpndtpdiirftiiotciixaooitnnmieeoaddntewowliyfitftiahhpvpe11r00mompmrLiiLaotleoffslmamoemitefpthmhlaezeasstn,ohorltalhnesa2onnlsddawm5am psmlaeLs owofdefL rwtewao~tltdoetaearred..ceTeadTrhoihendedtgoeeel.uaaFlCtie~vswwueaSamsPsiEaddliisclsactciraatirrrddtieedeoedgdf.se. wceAalloupssapiatrcnowaxwlaiamysszacectodeolblllylyecfctLitevedOediMminnStitIololMiaalgSigtrr~aeadldoeu~uca"attmrteeoeddst1phIr5a5anmymo.LlLwppoaolslyaypd~rdroveppdyyltloeenntehececee~nnmfuii'diffiug~ggeee,ttbuFbeiev..eEEmaacicllhhislisataemmrpsploleef was analyzed by LC/MS/MS elecu'ospray. ExEyxyggeennReseach Pa~ggee1166 0o1f 11144 22009955..00339966 33MMAA0011555522117733 -------------- eee AInnderSinRuepetrWta5taeSAcunpyslisofCageGrove Sediment EEx~gxenSSttyuddyyNNaoo:.:Pe00n10 66..44PPrereppaarraattiioonnooff SSttaannddaarrddssaaonddFoFrotriftiifcia~tdioonn Solstioss ~olutions prAAempmiarxixee~ddlsststoaoccckoknsctsetanantnrddaaatrriddosno~looulfutt1ii0oo0nno0offgPP/FmFOLOAbA,y, d'ti~'CsCoPlPFvFiOOnAgA,,1P0PF0m~BSSg,,oPfPeFaH~ cShaon~fddthPPFsFOiOaSSnwdaward~ss p (2Go1~ o0rr0et~ pt~ egd~mf~.oarr~ fpopurnuriidcitWcy~aai~onodndnss~taoaktfncd1~ oa0rm0n d~esn~ o~tl,tiiifofnnn bewycae~ ~ ssspalrr) ~ ye)piagMnredmm 1be~tyh~amtnoaogklli.o.ngf1F~Fr0h~ommmoLf~~ohifessts~ h~ oelus1 ttioo~ cnk, mandd1nb~b Lri~fn~ ogr#itg in~fgict~~ ahteeievo~no~slluauomnmndeeeuus dppetnto~ od b11r0i~0nsmog~ Lilun.tgiwo~ tinht~ hvmom elt~ uh~amneooullp.. BobByy1y0t~ 0a~mkig Lnggw1i110t00h~ mm~ eLthoaooffnf~to~l,e,e~ a1101~00 fg~o/t#imf~Latffi~onofls~rtafntid~arid~ ssafdnd dbiraircnd~gwidanagb tsthpe~ riveog polaru~ nemde.uvpoBlyomte10~0aam.1wk1i0~tmih~ mLetnoh~ afntoglhm,e~&1m100oplpg,g/a/Lm1L.0. Safffonod~o~ aarrfodiotannndibs~ ~ rtfinagiidndgcw~ w ehaer~etb vpo~ rl~ ieupmag oere. wn~dp.etovBBo1yy0tt0~a~ mkeiLnugwpittio10h01mm~ ~eLth~ aoonffot~ l~h,ee2.110~ ...001p~ o gp/g/mlml,L.ffaoor1ri.i0feicsattiioonn bSrm inagdin~ngtwhwades~vpao~ rlourpmeedr.3. BfoByyt1a0~ k0minLg1w10i0th~ mLm.eotofbtafoh~le0,0..11 0~ u.g01fnlp.yfiofrmotLif~fiocfartiiii~ ocnast~ toanndsatradntd~ anrdd weesprepared. iAAnswesaetttoeoffrassttnaadnnddpaarrroddcsseccosonsntetadaitinhniirnnogguPgPhFFOOtAAh,,e e~xCCacPPtFFiOOoAAn,,pPrPoBFcBSeSd,,urPPFeFI,H-ISi~daeannndddcPaPlFF(OO0SSswawme~pr'leeepWsee.cppaaTrrehoded fifonolllwlo~owtwii,nnrggcacnoodncri~mmc~tcre,astnsieotdmwrwte~harrreo~tpuprgierhpeoat~rhnmee~ds::,xtract~on procedure, identical to samples, The "CCoomSnoerl.ouofifofFnoonrt VFoFloourrmtVe oFhortmVifoieleudmoSeafmopfle Solution gl0 ) . (twdm ) VGoli0u)m~ Fottifiod Sample (a0l) , (mL) 11100O0 211000000 ""44000 111100000 24"10000000 40"4000 1l11o000o00 22"01o000o0 40 ~0 1~ ooffPPFF1OoOoAA,, ~"CC PPFFOOAA4.o, oPBFFBBSg,, PPFFHHSSaan4n0dd PPRFOOSg CFauFliimnbairlaCtCoiononnecS.toodff. (o0g) Calibration gtd. 22505~0 2115500000 125S0O5000000 1ooo A2An0n4ad0ad.d1idtiigtiooinnmaalLlsfsttooorccbkkosto~tloluletusitioponinkoiofnfgpt"~uCCrpPPoFFsOOesAA.wwCaaossmppplrreeeptpaeadrree~tdaaaitl1s1c00a00nypbgge/ifmnoLLuanandndidndditillhuuettereaddw1tod1a1.t.00a package asocitih tahisestuddy. aad O. ! ~'rnL for bottle spiking purposes. packag~ associxt~d with tl~s ~tudy. Complete details ccm b~ found in the raw data s"tTohreessdttooiccnkksasttraanfndrdaiargrddesro~ulooulutrtiioo(4nnemn&dd2aallCl )foorwrithiifeiacnsanitiooonntaiannnddcuacslaeil.bibrraattDiioonon sscttaaannddmaarrddes~onlolutiftoisaonimsainwwdoearernerde preparation islocatedin therwdata packageassociatedwidhtis teinreport. ~tor~d in a refrigerator (4* 2~C) when not in use. Documentation of prepar~on is located in thc raw d~_t~ package ~.~ocia~l with this interim repo~ stamtard ExEyxpyge~nnRRe,sse~aarc~hh 22009955..00339977 Page 1700114 Page 17ofli4 I3MMAA0011555522117744 ------------------------------------------------------------ I11 L L I Mill I II II1| `IAtnnteedrSimumrRfReapecpoeorWrtta##t55e-r-SAAnanarlapyllysesiisss ofCotageGroveSeiment of Cotmg~ C-row Scdim~lt And 8urfa~ Water San~l~s 665,$CChhrroommatatooggrraapphhyy EExxyyggecnnSSttuuddyyNNoo:.: P0010 ?0001400 QuCQaluencaiinfrtioisfcipacrtaatyii.oonnTohofefrPePFtFzOOnAtAi,o,PnPtFiFBmBSeS,o, fPPFFPHFHOSSAa,annPddFPBPSFF,OOPSSFwHwaSasasnaacdcc~Po:FmopOmlSpiwlsishahes~dtb~b1yy0.LL5OmCiM./nMS.SI-/0MM.S5S mimeralny~insocsr,fr,~o~ts9h9pmrPariayeni.ansgs,T,eanhanntebddrl~~-a1r!n1rmk1.s.55iaommrniapntilinsmes,,sercreeoossrfppFreeecFctsOtipivvoAenel,ldyy.iP.nFPgPtBeeoaSatk,khsPseFaaaHbbnooaSvlveyaettnthedherePeLtFLeOOOntDSDiowwnweaertsireem-ne1no.0ot.td5demteeict~~te!d iinn any of the re.agent blank samples corresponding to the mmlym retention time. 66InstrameatSeasitivity cTohnceentsrmaaltlieosntofs2t5anndga/rLdofamPoFuOnAt,PiFnBjeSc,tePdFHdSurainngdPFthOeS.chromatographic mm had 66.77DDesecscrriippttiioonnInoosftfrLLuCCme//nMMtS:S//MMASSPI1In4ns0stt0rru0umBmeeinntotausaddoOOipeMperaeasrcatstiAuinnnaglglCyCazooenrnrddiittiioonnss AF] 4000 Biomolecular Mass Analyzer IInntteerrffaaccee:: TTuuwrbboolIoonSSprparayyLLiiqudid troducItntierofacne Introduction Interface CCoommpuptuetre:: DELLOpPlexGX400 DELL OptiPlex GX400 Software: WWinidownsNNTdT,,AAnonalaylymsstt1!s4.4..11 HI-P]PLLCC:: HHeewwleletHtttPPPaacQckukaaarrtddP((H]u-PlmP))pSSer~i'~eess 1100 1 I00 HHHPPPAVVua~oc;suuuuummmpDlDeeg~rassss~err HHP.PCAoulluomsanmOpvle~n, HPLC HP Colmnn Oven Colum:ThermoFlaophaseRP, 0mm 2.1men ICnjoelctuimonn VTeomlp..:153u0kC M`oMbobiilleePPhhaassee((BA)):; M2emthMaAnomlmoniumAcetateinwater TTiim0em0(reaian) 6~5%AA %%3#5BB 01.00 81.00 26I6555 337355 111080.000.0 2262355 777355 Tota runtime: 1I1~8181.,0800min 666555 335 35 FTlootwalRratmtet:i0n~3: m-1U8mni~n Flow l~te:. 0.~ ~n ExEyxyggeennRRe~s'eseaarrcchh PaPaggee 1188 0off 1!. 1144 22009955..00339988 33MMAA0011555522117755 e--e -------------------------------------------------------- _nn IIIIIII .... II IIIII . I ~1| .... ":':' _ I ~ ,.. AInhntndet~rS iimmRRe~p:e~w noWtrat ##t55e--SAe sapaalbyrsiisooffCCootttageeGCr~orvove~SSeedmimeennt And Sm'fa~e Water Sampl~ ToIon~smmiotteiorneedd:: ExSayd Ngo:2e0001n400 xygen Study No.: PCX]01400 AApppprmoxxiimmaa~te AnAanialt~ee PROPAPFFCOOfAAmIa PFOA ~ Ion Pras 'P5CC PPFFOOAA PPP~rRB~oESSsS PFOS MM od~e `n negcat~ ive mepive ne~fi~ neng~atviv~e. mgve neg~ve mv n,~v, mgve nerve TTrarannsistitiioonn Mo~nnititoore~d 441133~336699 4135219 413 ~ 219 44115 5~337700 29599 2~ ~ ~ 399580 3~ ~ 80 #9580 4~ ~ 80 ReRteetnetnitoionoTi~meimt ({mraiinn)) ~-I100..55 min. ~10Smin ~10~ -~1100..55 min. osm ~.5 ~. "min. -9 m~ ~llsmia -11.5 668.8 QQ~uaataltatnieaatusddiEExtxaammapplleetCCaliaclcuulolaattinioonn F"iTfhteepeensmictrroelsiwtaerssmoefassuamrpeldeaonrctahleibsrtaatnidoanrsdctusrsvdeadwwasegreenienrci (isntionthIexLiOtwMeSiIghMtSe.d cloinnecaersrtergarieosnswioans)bdeytAmnianleydsftosomfttwhareequuastiinognssbiexlocwo.ncentrationsofstandards. The pEqruoagtriaomn. 1cleus theamountof may found(in g/mL, based cmpeak are) ing thtEheqeusatsttaiaonnnddaa!rrddccaulccururvlvaeet(eld(ilitnnheeeaararmrreoegugrnenst~soiifoonanpnaaplrayartamemeftoeetuernrsds))g(iegnnenenrgera/matteeLdd,bbbyaystehtdheeoAnnApanrla~ylkysstatrs~~oaof)ftutww~aiarnrege Eati1n; Asatte found(ng) =(Pk re tect x DF Analyte found (ng/L) = ~.k area - inmrcept) x DF slope WWhheorlee:: DDFF ==DDililuuttiioonnFFaaccttoorr,,ffaaccttoorr bbyy wwhlificchh tthheeffiinnaallvvoolluummee wwaassdidliluutteedd,,ifffnneecceessssaarryy.. FuFosoerrdstsaaommpcaplllecesuslffoorrttiitffhiieeddpwewrictitehhnktknrneoocwwovnneraymm.oouunnttssooffaannalaylyttee pric prior t cxraction,Equation to extraction, Equation 2 2 was was used to calculate the percent recovery. ReEcqouvteirny2(;4)= Recovery{(a%~na~a).=l..~l~f[ouunndd((ns_o12ug~sfL)t,]s--iaandnaeladvlvt(teevii5nnc)coonntr!ol(In'ng/~L))) xx110000%% amotmt add~l NhNoeottpe:: FrFoorrtithheemisaearad~sllayremteprlyreeec.coovveerryyccaallaculalattoionn,, he the "copra" is "control" is the unspikedaliuot the urtspiked aliquot of of the primary field sample. EExxyyggeennRReesseeaarrcchh 22009955..00339999 PPaaggee 11990o7f111144 33MMAA0011555522117766 ---------------------------------------- AtInnrtderSeimRReupepoorWrrtat ##t5f5e--ASAcasnmapalleyyessis of of CogGroveSediment Cottage Grove Sediment Exygen SayNo: Poc01a00 Exygen Study And S~e Water Samples EqEuqautaitioonn 33wwaassuusseeddttooccoonnvveerrtt the the amount amount ofanalyte ofunalyte oundiang/mL.10 found in ng/mL to ng/g ng/g (7pb). (ppb). Eauafion 3: AaAanlalyyeteffoouunnddwweettwweieigghhtt((9pppbb))==[[saaaau]vttee ffoouunnsdda(m(nnpgzl~feLLw~)xexivgvoholtluu(mm8e)e eexxttrraacciteedd(1 sample weight (g) Equation 4vasthenusdtocalculatetheamountofanalyte oundinppb basadondry weigh. Equation weight. 4 w~ rhea used to calculate the amount of analym found in ppb based on dry `Eauatio:n E~uation.4;, AnAanlalyyt foooundd((pppptb))ddrryywweirigghhtt =--AAnnaallyytte ofouunndd((pppptb))xx [[110000%% /ttoottaall ssooliidds((0%))]] AAnne~xaammpplleooffaccaallccuullaattiioonnuussiinnggaannaac~ttuuaallssnampple ffoollllooww~s:: SweSidetidhmimPenFentOtsAsawamhmpeprlleee:EExxyyggeennIIDD CO08S617Spk C00S5617 Spk G(Sek: G (Set: 100SOSAR), t0050$AR), forified fortified at500og. at 500 ngtL with PpFeOpseAtaekkwrwcaheerepesrtae; =-= wa46ow98m22 sidisinollotpueptereicoenpft ate ==== 2120 aows 3150 dnDa/$itlL/uL.tiaioancanaalfloyaytctemetoaardedddeseddp((fosoorantmnelpevlvedeell)(i) oogg) =-== 5s11000w060 amt in corresponding sample (rig/L)* svaomlpulmeewceriaghce(5d) (1) volume ~xtra~t~d (L) ==-- tostaamlpsloe dwse(ig5h%t)(g) == s50oo1s .00a6a40 total solids (%) = 68.21 "Theprimarysampleresultwesusd forall calculations *The primary sample rt~ult wm used for all calculatiom FFrroommeeqqAuvuaaattiioonnf11o::und0p) Avalyte found Fromequation 2: From %Recovery equation 2: % R~c~ovcry == [[4466938823221-22501=220112xx10100 3150 - rensgs = 1485 ng/L == (1{11448805~nngg06l/LL0--m01g0600 nW5l.)x01100)00%% 500 ng/I. AFFrnroommyeeqqouuanatfidleouwn33:e: weGg7h) Analyle found wet weight (ppb) ="5855%% (= 0448855 0ngx/L50x004.041L)) 5~ ExEyxypgeemnRle~sseeasrr~shh - sp = 11,9 ppb i FPuaggee 22000off1l1144 } i 22009955..00440000 I3MMAA0011555522117777 -------------- ee-- e--e --r ---- e --. -- AIatntdeerrSiummrRfReapecoperotrWta##t55e-r-SAAennaaaplllyysesisiss ooffCCot~tttaaggee GGrroovveeSSeeddiimmeenntt And Sm'fi~ce Wa~er San'rples Exygen StudyNo:POOOIA0 F.xygen S0.sdy No.: P0001400 FFrroomm"eAesqqauluayattetiifoooanu44n::d(ppb)dryweight = 11.9ppb x (100% (68.21%) Allalyte follIld (ppb) dl'y w~J~ll = 11.9 ppb x (100,4 ~68.21%) = 1am = 17.4 ppb NNOOTTEE::TThhiLss vvaalluueemmeayybbee ~tiggfhlttllyyddiifffferreenntt tthhaann lhhaattoofftthhee rraaww ddaartaadduueettoorroouunnddiinngg.. 77..00 EEXXPPEERRIIMMEENNTTAALL DDEESSIIGGNN ~I3CCPPFFOOAA wwaassuusseeddaass &assuurrrrooggaatteefoforraalllltthheessaammpplleess., t'3CC PPFFOOAAwwaassaaddddeeddtototthhee a`ssdeedddeiimmdeentnottstsaahmmepspluleerssfaiancndedswsaaammtpeplrleesreraepmplpiliclcaeatcteeosslilinnectththeieollanabbbooortraaltteoosrryyiaafnfttteehrrcecoollllleaebccottriiaootnno..ry ~b3eCCfPPoFrFeOObAAewiwanagss, ssiasphdipkidppeepsed,~dltPot0FoOtthlAhhee,efPsifaFieterlBlfddaSfe,foeoPrrsFwsaHaamtmSpearlpilnsinnadggm..PpFFlFeoO~rScsowusleurlerrffcaeatcacioeesnwowabaatotedetrdtrleessdsaaammipnplleaetshskdenedoseliswaigbngnoncaroaatntteecoddernayatssrfbaieftiefieololrddnemmab0taterthirineixxg. `bbsobpotottitktllee~sss,wiePinnrFteOhthfeAeill,llaPaebbdFooBtrroS~s2t,oo.rPr2yyF0bH0bemefSfLooarvrneeodblbePueiFminnOeggtSsihswchie6ippr1pp~eedadnltsetoootiahttdhedheeedGfieeaeIldtld~da..TkThnhoeewsnsucurofanccreewnwaftrtaaetteuirorsnsacatmompetplhleee bottles wece filled to a 200 mL volumetric fitl liae in the field. `sTehteisnechduidmeednotnseamrepalgeesnwtebrleaenxktaenadctcwdoirnesaigxseentts,bolnanckosffworhtiicfihedwaatsKn&orow-ncxctornacecnitorna.tiEosncsh. Tchonetafiinresdtfi2vees-eedixmetntrsoefaioscncetosnaitmaoipnlneed.fFoourresaacmhpslaemspelaec,h2.laTbhoreatsoirxytdhupsleidciamteeontfstheet. fsoarmtipflieeadwnidtthwkonolawbnorcaontcoeraymtraattriionxsspoifkePsFwBeSr,eaPlFsHoSe,xPtFraOcSt,edP.TFhOeAlaanbdor"soCryPsFpOiAk.eswere E`TTahhceehssusurerfftaiict~encwrlauattdeerersdasoammnplpeelsersewawegerereenetexbxtltrraaancctkteesdd dn~ffitivvweeosseresets,a,ogonenneetoobfflwwahnhikiccshhfwowaraissfiaaedrree--~axxtawkcanicoitioownnn~. bEcclooaanncncohekcnaatsntreradatttiiriooninncpsslb..uTldaThenhdekesfoptiinirneksttessrsucetrtoarfflgialecceneecwttwaebtadleta(ernorkresetthatcncosdonuntrttafawiainonceeeddrwfeafoaotguuerersrnsatsaam_bmpmpllaplenleesks.ssiitteeT~ss,ho,aratlsfifooeienncdggownwiadttisthhukrn3afotawrriic~ppe wasbwitltaaeetnsre.krsTsae~htntdeccotfrnoioputaribtnnlheasdnuttkr~hfrrsaaeepceeieksiwsea~samnlnpcepollleeeslseeicsttitdteecesdos.n.ftToTahrihetnehteetdhli~osrtrphdd"esfsuasucrareffmaawpccleeaewtwseairtatestee~rrms1se0p~tdltecoso,oroneTa-taxihitnnereeasddecttcthhoirrnoeendeefsossamrammopfanplceleee: ssissaaitlmmeepspl.8tesTsasimhitpteeel..feTo,Tahrhaetehffifiseilufdr~fdassucuaperflffiwaacccaaeettweewaratrsaeetdet rtcseowetnottmwawaaianst~erdiaaxroroenf--iee<exxlsdiWasrmpaaiccpiktlioeeonsnsfwiftoeeorroaeonnncdeoesalslaarememcp-tpelldxee.tFrsiaiottcer.~. FnaFocofrohrrseioatnceh,e ssaapilitlaekab,eboasrowsaerat~rmoerrpyyaldelud,spuaolpciflicaiecatlatdatecedotueofpdfl.titchhFaeeotperpraritinmmhdaemtrtwwyyosos-lamaammbapoptlrrliaeextowwfiraeayslsdmeaexsxttpWrrikiaaexccssttpeewiddkeaerasne~,dlcttotwwlwloeooc4ltael0adbmb.olorrF.aapotooorrrreyytaicmmohantastroriifxx tohstnhepleipkyprweriseimmwraeamrry'yPsFasaBalmSsmop,plPelexFectHroaSloc,lltleeePcdcFt.teeOddFSfoofaorrnrtthdhtheePetFwisOtoitAeelwaawa/d~asdrsaeppmdooiurnuyrtermh~defafl~oraiomxbmotsrpathhitekeoebrbsoy,otptrttwlilleoeoara4ntn0dodmeffxoLtorrtparifcoitderitdoi.n.o,nbsNNuoottt ataolhlnsesllooyetv"w"3eCeclrsePP oFPfOFPBAF FSwBw,aSPasO ,sFaHaPddFSdA deE,edPS.~.F,OPIInSnFsOasoonSmmdaeePncFacdOasseAPessF,,~OttdhAheeesdap~didmdikitfetiihdooennolaaatllboo"~t'3rhCCaePtoPsFrFayOOmpApArliwoewarsastoswaaeeddxrddeterekaddncbtboeieocwc~a,auubstsueoet: ePxtehcFxeecOeelAeeddvlteetlhhvseezlcosafcwlaePilribFberBraaaStdti,ijoouPnnsFrtFraecLnd.Sngt,goeesPrsFeaqtOnauSdidrweawenchrdere~sPnaFnomOotetAdaairml~aupltliyyikozztnaeelddas~w~tnihtttoehhotoohuubettedsirdaliamulnutaptililooy~nns;e;wstt.hhee~rreekffaoororeew,, nCto PFOA le'cels were adjasted Io requ~ the same dilution a.s the o~er analyte~. ExEyxyggee~naRReesse~a1~rrcehh PPagea2211gooff1e11144 22009955..00440011 33MMAA0011555522117788 Inter Repor 5 -AnsysofCoa GroveSediment LE Interim Report #5 - Analysis of Cottage Ctrov Sediment RodSte WeSupls And S~rface Water Samples Ex-ygen Study No.: PO001400 88.00 RREESSUULLTTSS PRAAnOnaalSlyytitiinccasalledrrieeasmuuellnttsstssaannmddpaalssessesesassersdsauaccmcvmutaararacciiizeeessdffiornr Tthhaeeblaaenna1ll.yyssisAs ooffnPPFFOOdAA,r,yePPaFFlBtBsSS,a,inPFdFHaHSscSe,s, saaaennddd PFOS in sediment samples are summarized i~ Table I. Analytical results and sssessed aacncudrascoiccsfaorthiekalnQalCyssaimsoplfePsFwOeAs,umFeBmSa,izPeFdHin,TzaabdlePIF.OSin surfacewaeesamples accuracies for the analysis of PFOA, PFBS, PFHS, and PFOS in mwface water samples and associated field QC samples are summmiz~ in Table Ilo FodFrtoirfteiifcicaattitiinooTnnaabreleciecoosvve[elr1riiceassefnfodorrIdVPP.FFOOTAAh,e,PaPvBFeBSrS,a,gPPeFpFHeHrSScae~nntnddrPcPoFFvOOeSrSiiiennstt+hhesstseaedndidimamreednndtetsvsaiaammtpilpoelnesssafaroreer "1PPd0FeF%tOOaiAsAle.n,dPdPFiFnB8B4ST$,a,b2PPl7eFFsH%HSm S,aemnsadxapldePPFFcWOOiS.~ei.miantFethoheraeivsfeseierdcadiagimtmeieeponnnettrrcessecaanommtvpperlerlec,issoewvwseeefrrrioe~ers66P4-44F- sOt2Aa2n,44d%%Pa,rF,d4B49Sd9,ev+Pi8Fa8t%%Hio.S,n9a9s66fdo+r PPT1FR0O%OaSSaibniVnndtla8thh4pe~edssVua2sr7Iff%a.ccT,ee~whweaestapeateervcriesirvsaaeammlgpyel.ppelesFesoraranntnidftdicraaasetsocisocooinvcaeirtareeticedeodsvGeie~rslietlddsaQnfQodCCrarPssdaF~dmOempvAlpi,lenePsisaoFnarBsreSed,fde~otePratFaiPIi-lIlFeSeOddaAini,nnd PT1FF3aBB%bSkS2,~,2PPdVFF9HH8aSSaadan1nddV8%IPF.FrOOeTSsSphieecinnttiahtvvheeeelrsyaus.gur~rffaapcceecww~ aatxexrs-~a~mmopvplelereiss~wweerrese9ta93n3dard1188d%%e,,v1i1a00t2i2o2n+s11f66o%%r,,P1F100O99A+, 13% a~d 98 18%, r~p~tlvcly. "FFToohrertisiffvicceaarttaioognnsprreeercccooevvenertriireeesscfofoovrrert"3iCCesPPFF4OOsAAainnidntathhreedsdseeeddviiimmteenontntsssaafmmopprllee'ssCwarPreFdedOteatAiailileendditinhnTeTaabobldlieeVmVIeLIri.t. ss~T_h_emaapalvemsmewnrwaepdgerperse~lsp6ol6ec6r6eic+seeins1et1d33sre%%cl.o. dvFoeFQr,oitCeirstsfiifa+cimcaaptstitliaooennndraearrceredocdvoeedvtrea~iviielieasestdifofoinonrsrT~Ufao3CbCrlPeP~FVFCIOOIAPAL.FiTOinnhtAehthieeansvuseturhrfraefagacseceepedowiwmaaeteteentrrt samples and associated field QC sample~ are detailed in Table VIII. The average percent ro1c1o%v.eies standarddeviationsfor 'C PFOA inthesurfacewater samples were88 = r~coveries :i: standard deviations for t3C ]~FOA in the surface water sampl~ wrrr 88 + 11%. 59.00 CCOONNCCLLUUSSIIOONNSS TTPPVhOFFhe0OeOs0AAIes,e7d,d8ii0mPPm,eFBmnrBSetaSst,ap,anencPdPdtFsFiuHsHvrem SSflay~.caaennT,ddhwwaeiraPPtceFFerOwrOseSSaaramemaappcc6kclccsooscnrditwwiicenanurgrgemeastiiusooucaccnarercmnsaeaflssluyfytliuthlcilaclyatyalmelxeatxmmrytearehtactchathteooveddddessaaafnnVVeddOc0Di0aeOn0adIa1l7l7yyh88zze22eedddfaaoofnnoarddr quaolr nicgtriyy. V0001780, respectively. quality or integrity. There were no circumstanc,s that may have affected the d~r~ 11000.0 R RETE ENTT IONE OOFFDN DAATTT AAAANNI DDSSAAO MMPPLLN EE~S; AwAillllloobrreiiggsiihnniaapllpppeeadppteeordhOe_at~s_gtegunedenyredariartteecdtbobryy.TEEhxxyiygsgeednnoReResseoseetaairrnccchhltuthhdaaettfpapecreitrltaiaitinym.ss1pt0oetcitihfsiiscriimnwetdriaimtarreesppuoocrrhtt o4fwa0tsihlii)nebstenrusthmsiepeniptemoadonrartluottyeettmmhipmectemarsltaeaurttdeumyprnoeedrlitlrooetagcgnst.0, zEa.ExlxaToacrhctgitscicondopaopileicefsasncoooifltfiialtnyllcllsaruapdwewcedidffaaaiaccmi,rl,iat1ayws.dswwpaeeeltlcll,ifaawisscilaarslaiswbigegndrneaeadtdacicosnoupepcyhyd ionftthhee BinetyergiemnRaensaelyatriccahlarrecphoirvteasnfdoarltlhoerpigeirnialodfacoifltitiy-msepse,pceiciiicfiraewdindaEtaP, wATillSICx:AreGtaoionedd LaLibnoabrthaoet~otEorxryyygPPerrnaaccRiticeceseSeSarttcanhdaaarrndch~id4v40e0asCCfFrFoRRrdt77h99es22p.. eriod of time specified in EPA TSCA Good EgerResa Exygen Research Pugs207114 Page 22 of 114 22009955..00440022 I3MMAA0011555522117799 _-- AnInnrld~rSciumrRfRei=pcpoeorWrtta##5t5e--AASan~maptllyessissooffCCooxtataggeeGGrorovveeSSe~dliJmfaeenntt And $~ce W~e~ Samples E~x.yxyggeenn SSttudyyNNoo.:: PP0O~}O0Ot4I000 TABLES Exygen Research 22009955..00440033 PPaagg~e2233ooffi11144 33MMAA0011555522118800 atedriSRept rat5s-ASns aulyesiss of Cote GroveSediment Int~m Rqx~'t #5 - Analy~s o Cot~g Crro~ Sdiment And Sm-fa~e Watvr Sampls ExSyyNo:ePO0n 0LDD Ex'yg~n Study No.: P0001400 TTaabbllee lI.. SSuummmmaarryyooff PPFFRRSS,S,aPPmFFpHIlISeS,s, PPFFOOSS aanndd P PFOAF iinnSO SeeddiimmA eenntt Samples mn mmm = s| 3|% $|@w oI 12.4 ~D ~ so" t4~ ~,2 ~4 ND ~0 1~7 ~7 == HEIR SSom am oegso3zoziwZo|plm ~ CGMN-S~-EUO11,G.0~612 33d% ozoF Exp Reach 22009955..00440044 Page 24ot114 Page 24 of 114 33MMAA0011555522118811 TEimKe 5 Anis of Cotae Grom Seis Interim Repo~ #5 o Analysis ofCottage Grove Sediment And Sarfa~ Water Samples Ege Sid No: POHOLOO Ex3~gen Study No.: P0001400 Water Samples TTaabblleeIIIL. SSuummmmaarryy ooffPPFFBBSS,, PPFFHHSS,, PPFFOOSS aanndd PPFFOOAA IInn SSuurrffaaccee Water Samples B = mo E mwn L i30 n } L ilz 3 Bogen Exygen Research 22009955..00440055 Pease | Page 25 of 114 33MMAA0011555522118822 oItntdeerSriummrRfReaepcloexrWrtat ##t5$e-r- AASnuzammlpy]lysesiisssooffCCoottttaagge~GGrroovvee Sediment $~dimem Exygen StudyNo. F0001400 Ex'ygcn Study No.: P0001400 TTaabbllee HIllI.. M Maattrriixx SSppiikkee RReeccoovveerryy ooff PPF~BBSS aanndd PPFFHHSS iinn SSeeddiimmeenntt SSaammpplleess SEER J) ew1.78 eee xe 2.O2 44 4 4 ExygenResearch 22009955..00440066 PPaaggee 22660o1f111144 33MMAA0011555522118833 Ine Repo #5 Antiof Cote GroveSediment Intvrim Rvpo~ #5 - Analysis of Cottage Grov~ Scdim=m odSt waeSms And Suyf~ Wa~ ~ $~plcs ExygenStyNo: PO0OI0 Exygen Study No.: P0001400 TTaabbllee m Ill.. M Maattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSS aanndd PPFFHHSSiinn SSeeddiimmeenntt SSaammplpleesa CCoonnttiinnuaeedd sR om - afew - - 4~ 4 4 4~ 4 4# 4 4 4 4 41 ES ErU RR EE D (el w0e oam -wIa e|e- wowe EET Ju] 0 mw le]4 em ow a ErynReseach Exyg~n Research 22009955..00440077 PaPage 22770o0f111144 33MMAA0011555522118844 oInrntdciSr~eRRtep~soort-Wtta#5t5er-SAAnneayleysinisooffCCootntaggeGGrroovve~SSeeddiimmeenntt And Stwfi~ Wa~r Samples Ex SyNo: POLAND Samples TTaabbllee IIVV.. M Maattrriixx SSppiikkee RReeccoovveerryyooffPPFFOOSS aanndd PPFFOOAA iinn SSeeddiimmeenntt Samples B= -- - i REET, a] mm 0 "w mame oe ew "mow ow ExygenResearch, Exygee Rese'~h 22009955..00440088 | | Page2801114 i PaB~ 28 o~ 114 33MMAA0011555522118855 -------------------------------- cinRep 5 -AnsofCottage Geo Sim Exp Sty Nos POOOID In~r~n ~ #5 - Anxlys~s ofColX~g Grove Sedim=n; No.: prt Anti Surfac~ ~r~-r Samples TableIV. MatrixSpike Recoveryof PFOS and PFOA InSediment Table IV. Matrix Spik`eSSaRammepcploleevsserCCyoonoatftiiPnnFauOeeddS a~d PPOA in Sediment 4 4 4 4 4 97 4 4 =m L4 n a co= moman= scans | ww Jee we1.]0 ea we FExyxyggeennRReseeseaarrcchh PPaaggee2299o0f 111L44 i 22009955..00440099 33MMAA0011555522118866 LiIAt~netedrriSmurRRfeipecole~eWrtat t##5e5r-- ASAnu~amlayp|ysesisissoeff CCootttaaggeeGGrroavyeSime And $~f-~z~ Water ExygenSSttuuddyy NNoo:.: POI4OD TTaabbllee VV.. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPlFeBBSS aanndd PPIFTHHSS IInn SSuurrffaaccee W Waatteerr SSaammpplleess 127 t1~ 104 1t4 O1 - 111 :1 Exygen Research | 22009955..00441100 PPaaggee 33000o1f111144 33MMAA0011555522118877 eeeereem e eee------------ AIInnnetderrSiimmRuRepepororWrtatf#t65~e;ar--SAAancanmlapyllyesesiisssooffCCoottttaaggeeGGrroovveeSeSdi~mmeenntt And Surface Warm- Samples EExxyyggecnnSSttuuddyyNNoo..: PPO000O0I1440000 TTaabbllee VV.. M Maattrriixx SSppiikkee RReeccoovveerryyooff PPFFBBSS aanndd PPFFHHSS iinn SSuurrffaaccee W WaatteerrSSaammplpeless CCoonnttiinnuueedd CGNN-6W-~a !-0-0508~ " CEERI | eww -| SEE SENT lee ow mf ew wwe wm] oe - ow wm wm wow = w wie eve ow `BxEyxgygetnmReRseeseaarrcchh 22009955..00441111 Paaggee3d1oof~'111144 i 33MMAA0011655522118888 mum `nJAeentr:drSimuRRceepcpoorWta##t5~er-.SAAunnrapyllyesisisooffCCootCatagge~GroveSediment ~ Six'face Water Ergon StudyNosFO0I400 F.,x.yg=n Study No.: PO001400 TTaabbllee VVII.. MMaattrriixx SSppiikkee`RRWeaectcoeovrveeSrrayymoopfflPPesFROOSS aanndd PPFFOOAA iInn SSuurrffaaccee Water Samples Se Hs: af: 2: wm "> = ales To pom. Z|: - i - o. iii i): " 2F "oo. mmm |TV 0D L|TID TL FxygenResearch Eryg~ 22009955..00441122 PaPg~gee33220o0f1I1144 | 33MMAA0011555522118899 AIntnetdreirSimRuRepeoprroWtratft##55ear--SAAnucnaralglyyesesi~sssooffCCototttaaggeeGGrorovveeSSeeddiirmseenntt And Suri~ace Water Sample-~ `EExxyyggeennSSutuddyyNNoo..:PIP0O001041~0O0.0 TTaabbllee VVII.. MMaattrriixxSSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PPFFOOAAiinn SSuurrffaaccee WW ataeterr SSaammppleless CCoonnttiinnuueedd ERNE ewe we we] ww 0 SEEEREE ee rem | a mk J:9iB, S mle Lon 402 owe ExygenResearch 22009955..00441133 PPaaggee 3333o0~"111144 33MMAA0011655522119900 {aici Rep: #5 -Analysisof Coiage roveSeber Interim Report #5 - Analysis ofCottag, Grove Sediment And SurfaceWaterSamples: Aml Surface Water Samples ExygenStdyNo.FOO01400 Exygen Study No.: PO001400 TTaabbllee VVIILI.. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff ~*3CC PPFFOOAA ifint SSeeddiimmeenntt SSaammpplleess -- neovon --_--eo oe=m mTwa emopws rWeTy Greemmoinees SERS ScB oCmosmI osuunmoassoosmmmnn SAEED ii. siia = 5a SccomrmeeIs eins cSnomDho evnas commis i`i 5 oainn = 222 omy comsoureenosmn `= GGmreenr co~s~17 S~k G CCGoCMsaNr-SscDe-oMouR0mi03mm-0o.iOnSoeOman~ .4 : =2Zg~ 574 ce C0o&~ff~$ R~ Sees C0O~IO $1~, I SEE C0~5~'15 SI~ J comers C00M~IO came CO0!.~H 8 Rq~ Smnias C~X~85~IO Splt D fcGmco moimenmmrmeers aman BnSe CGMN,,...~O-~R002.O.O50~0~ Comounrosees COMN-SO-MR00~ SWISS CGMN.-SD.MR002.0-050809 coussoumaocusn COMN-$O-.MR001-0-0~0809 mon CGMN,.8~-M R001-0,,06~0~ comcummicoms CGMN-SD.4R~:001-0-050~0~ f ScocCm nmoossr mmpeseai onmwr zaameoossu voae nemmnsn Sana : i ,4- 3.50 Ot o: == za 4 2.67 67 :40 4 ia2~A 3.14 3~ 79 o4 =2.98 875 4ii.0 i2i=2:1a.4 85~"4 o ws a i. isur 3 " wn 5 care c,0,3~__ ~2 C0e&,'~2Z Rap CGeomats ~ Spk J cos C00~5623 comet C00*,.~$ ~ Gmmswe C00t~623 ~ C cSmmopmuemrgsiiaesnr coo~ss~ s~k o CGt~,SD-E-,C0'i 2-,0-0~40 frmeiestesen] GGI~D,,~t 2.0-0500~ 0 fCromseeaeremems CGMN-SO-ECO~2-O-OSOII 0 comspeaooumn CGMN,,~D- EC021,0.0~810 inCrom C~m~-SI:>~=C021-O-OS0~ 0 Commecmomm CGMN-I~'C021-0-O~a10 mcSm aomne oom mmceemsioo Estomms P_.~UN-SD-4P_.~ -O-O~al0 : 24 4. S. t 7 '1'0 t 2.~ 74 o: EiHn 33 40 19.7 40 ` 0 s 4 3A0 ~ : i 5 4 3.4O ~ i wn 8 4 2.'/0 6,~ 5&:.: sEiiiaHa 225=2 4O 2*.0 ~ EY i ExygeaReseach Exygea Research PPaaggec Hof 34 of 114 | 22009955..00441144 33MMAA0011555522119911 AItnnetedrrSiumrfRRaeecppeoorWrtte#55r--AASu~npallyesasisoolffCoyot~taasgeiGGr~asonve SSeeddiimmeenntt And S~rface Water Sa.mples ExygenStay No. POLO E.~ygen Stu~yNo.: P0001400 `Samples Continued TTaabbllee VVIHL, SSuurrrrooggaattee SSppiikkee RReeccoovveerryyooff 13CC PPFFOOAA iinn SSeeddiimmeenntt Samples Continued --_e-- p --_-- Gcrcoahusmaaswa Sma cmo~ mens Somes C00~626 Rm C01)85826 Sl~ I CCcomtemro:ns C0~a___:~_8 = CD0e5628 ~ C~._~_~S_ S~, E Samir C00~628 SI~ F cous C00~2~ cGraamare C~08~52~ S~k G Gmimian C008~29 St~ H cst C0~8~630 C008~30 R~ SmGcRoumnmmrnettmry)Spit I oSccoaonCmmomsswmeoossroeIueeccecamsmsnaoieonummeann CG~N-SD-EC032-0-~50~I 0 SmBsm CGMN-SD.EC032-0.050~10 SBR CGMN-SD-EC~12-0-050810 SCCamommmitwnoomoosoommmee CGW~-SD-WC012-~-0~810 Primm CGW~FSD-WC0 t2-,-0~0810 ~SD-WC~12~10 mw em O31W~SD-WC012-~-050~I0 cansowoareoume CGf~FF~-WC02 I-0-050610 fnCarmseowetnco]ms CGMN-SD-WC~21-0-060~10 commmamooms CGMN~D-WC021-0-0~0~I 0 fre eae CG~,~D-WC~22-~0~O~I 0 CGI~kSD-WC~22-0~I0 fcESaCrmNNosmoSSaruwRcNeaaeeEmostoRe)mmIEs CGMN-SD-WCC22-0-0~810 iw ersoomm woss mew oi: isiau o =n .i4 1i.3.08 o4 4 23. t8 2.46 o:i FiAsmn 4 2.61 4 2.51 | OB 4 228 o a 40 19.2 . mn 4 2.7~ :: iinn 4 2.0~ . wn 40 19.5 i i 4 2A2 4 2.43 io.:i Piii0oan 4 2.27 eWmo an2 s n2Tr 880 82 8a2 55 ~3 57 a*,8 "~ 8252 i4~ ao51 61 "i-285? CO~8S632 ci ~ I~ C008~632 S~ E EEE ~ SAt F mess C0~ coC04~.~33 Re~ GEuEm C008..~633 8pk G C00~5~3 Spk N coo C0085634 C0085634 F~ fi] ~ Spk I Semis C0085834 Spk J ~'~.8 D,WC~:~-O-O~t 0 SnSveE CGM~-.~D'W C0~2"0"0~0~I 0 CG~-~D-WC082-0-0~O~I0 GRSNEIES C~WC032-0.~:~810 canasnn CGMN-,SD-WU0f 1 -~12 BD CGM/d-SD-WUOt 1-0-050~12 e comewH msen CGMN<~D-WU011-0-050~12 CGMN,...~WU0t 1.0-0~'12 comsorionsosen C.GMN-,SD-EU011-0-~'12 CGMN-,SD-EU011-0-050812 Faas CCJJN,.SD-EU011-0-050812 commamremnt CQMN-SD-EU011-0-050~12 4 2.43 i i" & 4 2.48 4 2.~0 o in 3 40 17.8 45 ` 20 e 4 2.87 : ia 7 4 2,~8 i i a 4 1.79 45 5 EH 2 40 '~7.5 44 ` sm . 4 3.18 80 4 3.33 83 : io a 4 2.71 68 o = 40 25.2 ~3 ---- 8~ ExypemRescarch Exygen Research PPaagge~ 3355o0:f 111144 | 22009955..00441155 I3MMAA0011555522119922 IAnncdrSurRfeacpeorWtat#5er- ASnuamlpyiseiss ofCotageGrove Sediment ExygenSayNo: POOOI4I0 Exyg~ Study No.: P0001400 TTaabbllee VVIIIIIL. SSuurrrrooggaattee SSppiikkee RRe`ecScoaovmvpeelrreyysooff t"~CC PPFFOOAA IInn SSuurrffaaccee WWaatteerr Samples --_--eng ecout s SCC00CGwo85om5m"emEt5arSmpek C cSGcomoommmemeamxte SSeoaRms C008557S S~ F comm CGoommmeis:n SCoofmim PSSceoopmsmEe DTCoooemms cseae SP RS t C~-MRO~S.0-0~060~ C~W~ O3M"~,~V-M~ Seance CGMN-GW~ comcSormmwsomemSioimnincime CGMN-SW~ Dup Summa mein CGMN-SW~ Low 3plke 111 ~ CGMN,,SW.MR005~ High ,Spike cSSamwesiweanmooasroomuouss CGMN-SW-MR~ 1.~ PI~ comcioCv;mC3Mamo,~mo-'oWmw'-eMaRon0r0i4o-m0m-0ou~os)a~nroe SnmREmeENNR ~MN~R~ ~0,t ~ Cc~ onR onm~ so~ ae~ n 1.0 ~ cCc~ ~-oo aM .m- mRoM 0wmw0ui3,m mm0ec4m~o0 o3et 09 os~ CcC aomnoCtGiMM~ mNm-mb'nWe-tMs~ Ruof~ms03r-wO-oi0~ 5i0rem0g9eDaiuOi0c.1um~ es Cfc~ aGCmmr- noo~ wwSeuuHmm~ zoe RomHAnm~dmec~ en 1.0 ~ ScoWmcNSmwRmmRmionEmmSmoaSainmIotNmnoRwEs o= w o"mcw oruon w ow 500 420 ~4- 2 @ = 500 40e ~2 600 ~ ~ www om t~,00 t190 79 = 8 2 5OO +83 97 3 8 100 92.5 9:3 ow Wm $000 703 70 = wow 500 414 8~ 2 ow 8 500 4~ ~ OWw 2m Soow m aomam m0a8om I~ 111 1 ~1 1~ 11~ 112 a os os 500 424 85 w so omm ow 1~0 1220 81 www ~ ~ 91 Sm 8 8 1~ ~.5 ~ wm sw 2 1~ ~18 ~ PE4OO = 08 8 433 87 wm Emon 10g0 73 mom n 81g0 78 S w % w w 4 wW 428 fSCGeCC~o00Sau&aSa,~~iim91iSsRna~BrpE OC_Sfcmmnosier wmunmcoe osoornaomesdBmsosn SCowEen C00~1 S~F ScoNmNwaImSmaIceEmRimGiImoUiEs owes camovummoon GM"oEComRownEy caSnSAoaSnmiosehuesmseaaomuuesnn Sf RE i comBe mmcmmr irgeem 22 e m 5 m 8091% em m m o1 wW &4 = ow ow w 2Ww w @ w w ws tn iryhm hs, oe yyomen Exe Reseach E~cygen Rebirth PPa~gge33660o1f111144 } 22009955..00441166 33MMAA0011555522119933 --_--_-- InAIntnteod-rtSiiaumrarRRfecepetoorrWtta##t55er--AASnanulayleyssisissooff'CCootttaageGGrroovveeSSeeddiimmeenntt Exyaen Sty No. POOLED `Samples Continued T`Taabbllee VVIIIIIL. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff 1'3CC PPFFOOAA iinn SSuurrffaaccee WWaatteerr Samples Centinued --_-- --_--eer cme CCoanaCmsODmBs5s5S9n9voe CSommo! crGcemamamevariease Gowen coo~5eo,1 fGroen cooe,s6o4 Gon PGrcoooemmumanams SoSCvassasoan Gime Soocmaueertton cGCaoanmrdae C0085611 Spk J osmemwen cans seaman f PrSeome sanpcoeone romni ScoNmSAmSeoInNooSmtNiLmommUsiEm cCoCamamsmomovwwneweoaonnooonmacecnutsn comJ oCowmnace mowonoonr mommremnte Comewwanssmmeeorma comoneraoum CQ~N-~W-EU011~I 2 Scaommomaenontomam: CGMN-SW-EU011-0-0508 ~ 2 CGMN'b~eI-L=U 011"O'050612 Snowconcoats CGI~N-SW-EU0t I-0-050812 coCwSowERmIotmRemeannte CGMN-SW-EU01.1-0-050812 I[~up Cmohanneamiieseeim CGMN-,,.~W-EU011.-0-050~! 2 Low,Sp~ke O 1 pgb ScSommisswnaesomnassmss CGMN-SW-EU011-O-050812 Higtt Sp~e 1.1~ PI~ Tt ~i-MkRTr0oo~6m-S2ea-1005 0~ 05500~ escroren mTnw wanus Racy = wr =wowm oha W mW y 58 &== @-= 5a ww o o43m o8=a om wm ==500 500 4oo~ 7wmf o91 z=94. 600 wom 1500 == 500 592 13t0 430 aoa87w' Ww100 we108 lw108 5-=1000 =@@10~0 o28106 iw PoE -wEw 1500 1250 ------ Ne llhmedwd, eyi YS be ibe EExxyyggeennRReessecatrrcchh 22009955..00441177 ! PPaaggee 33701of111144 i I3MMAA0011555522119944 _--_----m IArIntnetderSriiummrRfReaepcpoeorrWtta#t#5c5e-AS~nuea~nllpyylsseiisssooffCCoottttaaggecGCrhoovreeSSeed.idm~emenntt And Surface Vv'atcr Samplrs ExF_y,xg-yegennSSttuudd3y,NNoo..:P0001400 TTaabbllee IIXX.. TToottaallPPeerrcceenattSSoolliiddss ffoorr SSeeddiimmeenntt SSaammpplleess Egon `conesets ests Conese coossste -- conssezn covssezt cossezz ooesezs oasazt cooaseas. csasezn cvsszr coossize cosssz9 cues cess cosas cossssa cooasess oatsamp COMN.SDMR0050.050600 (COUNSDR 050800 COUN.SO-UR002.0.050808 COUN.S01R0020.050800 CoumsDuRoD10050800 COMNSD4R006.0.50600 CoMSOE110050810 CoMNSDECH2 0050810 Coumso-EChz1.0050810 COUNSDEC220.05810 COMN-SD.ECHS10050810 couso-eciza050010 comSDWCDI1.0050810 COMYSOWCDIZ 050810 coMNSDWI21.0050810 CoM WIZ20050810 COMSOWCI0050810 COUNSDWCIZ0050810 comoWLH.0050812 com soa010050012 Ton Sond 3) aio nes 021 9 as EN ns ws ne mu ss we EX as wn sas as sr 0 wm i EExxyyggeennRReesseeaarmchh 22009955..00441188 PaPaggee 33880off 11144 33MMAA0011555522119955 ArniSmutRepVo#ot5er SArmass ofCong GroveSediment Bygen StdyNo FOOI400 Exyg~n Study No.: P0001400 FIGURES Eryn Reseach Exyg~ Research 22009955..00441199 Page Page 33990o0f 114 114 | 33MMAA0011555522119966 -_ in Ret 1 Af uta GoveSein Een Sty No: OME /~tcrim Rcpozt #5 - Andysis ofCottage Grove ScdLm~t pki And ~urf~c~ Water Samples Exyg~n Study No.: P0001400 Figure. Typical Calbason Carve forPFOAInRegentWater Figure l. Typical Calibration Curve for PFOA in Reagent Water 2 . | re JEExyg~n Research 22009955..00442200 eer 114 | Pag~ 40 of 114 | 33MMAA0011555522119977 odriSnoRretpeoa5r Seymienn ofCoeGroveSit And Surfac~ War~r Samples Ta Sindy Ny o: ORe OLAOD Exygcn Stay No.: P0001400 FFiigguurree 22.. EExxttrraacctteedd SSttaannddaarrddss ooff PPFFOOAA iinn RReeaaggeenntt WWataeterr,, 2255 nngg//LL. aanndd 5500 rnigg//LL,, RReessppeeccttiivveellyy NET 3: ww i. 1 _-- Bm 1f2o Exygen Research Exygen R~,earch 22009955..00442211 PP~agg~e 4d1looff1l1l44 i 33MMAA0011555522119988 _--_-- m i esAtis I~t=rJm R~rmrt #5 - A~)ysis ooffCCootota~ege ~ Grove SSicdmime~ Eonsy a:: Poort Study No.: P0001400 FFii~gaarree33.. PPFFOOAA iInn RReeaaggeenntt CCoonntrtrooll,, 5500 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt SSppiikkee AA,, aanndd 550000 nngg//LL. FFoorrttiiffiieedd RReeaaggeenntt SSppiikkee BB,, RReessppeeccttiivveellyy Nm pm eerie ei WI 2foTmL NER nd i ou] T me ee ExysnResa Exygen Research 22009955..00442222 | Pas 201114 Page 42 of 114 | i | || 33MMAA0011555522119999 _--_-- IAmu~rewi~SmmuRRrefpeposorWrtta##t55er--AASnaa~mlapyllysesiisss ooff CCootttsaggeeGGrroovveeSSe~idimme~nntt !rod Surfac~ Wa~r ~mples Exyaem Su No.d P00y OI0 Exygen Study No.: P0001400 FFiigguurreed4.. CChhfrororommPaaFttoOoggArra(amEmxRRyegepeprnreeIssDee;nntCtin0ig0na8ga56SS2ee4dd,iimmDeeanntttaSSSaaemmt:ppl1lee00AA6nn0aa5llCyy)zzeedd for PFOA (Exygen ID: C0085624, Data Set: 10060~C) NRRL -- t ExygenResearch 22009955..00442233 1] || PPuagce d433aorf111144 | 33MMAA0011555522220000 tSieRepow5iAunissofCota GroveSlit xy SyNo PODIA00 Exygcn Study No.: PO001400 Figores. Figure 5. CCAhhrnroommaaalttoofgygorrrazaPmmFeRROedepAprre(esEseexanyttgiiennngg IaaDS:SauCrrUff0aa8ccSeeSW W5aSat,teDerar tSSaaaSmmepptll:ee Analyzed for PFOA 0928050) (Exygen ID: 09280SD) C0085595, Data Set: meRm se -- [pe 1too Ese Reseach Exygcn Xzsearch 22009955..00442244 $ PPaaggee 4d4hooft111144 33MMAAD011555522220011 --_--_--mm---- nAl~aet~di-iSnmurRRaentp-spoWortrat##t55e--ASAnaanlatylyessisissovffCCoot~tagev GrorovveeSSeeddiirmmeznntt ExygemSuadyNo: F0001400 P.xygcn Study No.: P0001400 FFiigguurree 66.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr ]C~C PPFFOOAA iinn RReeaaggeenntt W Waatteerr ay 3 io EyeResearch 22009955..00442255 PPaaggee 4d5Sooff1l1s4 i | I3MMAA0011555522220022 _----m lRootrSiRnepso o#e5 ASnmass of CateGrove Sims. Intern Report #~ - A~ly~is ofCottage Grove Sedimem And S~fa~ Wat~ Saml~[~ Ben Exyge~ SyNo Study No.: PO01400 ng/L and 50 ng/L, Respectively FFiigguurree 7. EExxttrraacctteedd SSttaannddaarrddss ooff "~3CC PPFFOOAA iinn RReeaaggeenntt W Wataeterr,, 25 ng/L and ~0 ng/L, Respectively ERT eneen 1 1 ETT ree ffomi! Eos EcypnReach EA'ygen Research 22009955..00442266 | i i Faedoor 114 Page 46 of 114 i 33MMAA0011555522220033 J RordiSRee nWa#5 -ASneiss ofCoteGov Sediment Interim ~ #5 - Ar~lysis ofCol"rage Grove Sedi~efit And Surface Water Sarr~les ExSeydNposDeUOInA00 Ex'ygen Study No.: FFiigguurree88.. Respectively ~3CC PPFFOOAAiinnRReaeaggeenntt CCoonutrtroelt,,5~00 nn~g//LL FFoorrttiiffiieedd RReeaaggeenntt `SSppiikkeeAA,,aanndd550000nugg//LLFoFrotritfifiieeddRReeaaggeennttSSppiikkeeBB,, Respectively .BE I1 an hrs ypen ms ee are - rm an (0 Bon wan :gy WT wee 3 T W ST R |Po 4 EnResces Exygea Research 22009955..00442277 Pie 4700114 : Page 47 of 114 33MMAA0011555522220044 _--_---- InnIntteerrriimm RRe~ppperr:~5#5 -ArnaibsooffCCortagas Grove Sediment' ExyaenSudyNo: 20001400 Exygcn Study No.: PO0014~O And Surfac~ Water Samples FFiigguurree99.. CChhrroommaattooggrraamm RReepprreesseeanttiinngg aa SSeeddiimmeenntt SSaammppllee AAnnaallyyzzeedd ffoorr 1*3CC PPFFOOAA ((EExxyyggeenn IIDD:: CC00008855662244,, DDaattaa SSeett:: 1100006600~5CC)) WS s: EExxyygpeenn RReesseeaarrcchh i 22009955..00442288 Fuge 43r114 { Page 48 of 114 3IMMAA0011555522220055 ............ ep---- ~1 I,~ r I | III - Inter Report 45 - AsolfCoitge Grove Seen interim Report #5 -Analysis o_t'Cottage Grove Sediment AndSuri Water Supls And Surface Water Samples Even Study No. Fo001400 Exygcn Study No.: P0001400 FFiigguurree 1100.. CChhrroommaattooggrraamm RReepprreesseennttiinngg aa SSuurrffaaccee W Waatteerr SSaammppllee AAnnaallyyzzeedd ffoorr "CC PPFFOOAA0((E9E2xx8yy0gg5eeDnn)IIDD:: CC00008855559955,, DDaattaa SSeett:: o928o~) BRO mo wT ee an 5: EExxyyggeeanaRReseseeaarrcchh 22009955..00442299 | | PPaaggee d499ooff111144 i 33MMAA001"1555522220066 _ _in ItAnnrtdeiriSmmuRrRfeoepcpoeoWrrtatt##5e5r--ASenaralplyyisesiisss of ConageGroveSemen o!'Cottage Ctrov Sediment And 8m'fi~e Water Samples ExyaeaSudyNo: 000140 Exygen Study No.: P0001400 FFiigguurree 1111.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFBBSS iinn RReeaaggeenntt W Waatteerr 2 BExxyyggeenn RReese~arrcchh 22009955..00443300 Page 00114 Pa~ 50 of 114 | 33MMAA0011555522220077 taritReep o5e StpiisofCongGrrSint A~d Surf'acc V,~a~ Sar~i~s BeyeSyNo PODLIO0 FFiigguurree 1122.. EExxttrraacctteedd nd 50 gL, Respectively SSttaannddaarrddssooff PPFFBBSS iinn RReeaaggeenntt and $0 rig/L, Respectively WWataeterr,,2255 nng~/jLL. LR td 1iiad]. LE i== fo. - ExEyxyggeennRReesseeaarrcchh 22009955..00443311 PaPgagee S5L1ooff 111144 | r 33MMAAD011555522220088 ---- ee ------------ IeniSRegeWrieSAnatiisof CoteGroveSims Interim Retxm #5 - Ar~iysis ofCottage An~ Sm'~e Water Samples syn Sly No: 2001400 ExTgcn Study No.: "~0001400 Figure 13. Figure 13. PFBS PFBS in in Reagent Reagent CCoonntrtrooll,, 5500 nngg//LL FFoorrttiiffiieedd RReeaaggeenntt SSppiikkee AA,, aanndd 550000 nngg//LL FFoorrttiiffiieedd RReeaaggeennttSSppiikkeeBB,, RReessppeeccttiivveellyy I -------------" i hen sgIA LE tf i NEE ------ t= foil #o 48 4"; Berm Resch Exygm 22009955..00443322 | i i Fae S201 || Page 52of114 33MMAA0011555522220090 ---------------------------------------------------------- Inoid SRecpoWr#e5s SruamyisofCong GroveSem yenSeyNo. P0140 ~yg~ sm~y No.: POOOI 4o0 Figure 14. Fignr~ 14, CChhrfrooormmaPatFtooBggSrra(amEmxRRvegepeprnreeIssDee:nntCtii0nn0gg8aa56SS2ee4dd,iimmDeaentntat SSSaeatmm:pp1ll0ee0AA6n0na5alClyy)zzeedd for PFBS (Exygen ID: C0085624, Data Set: 100605C) WISe = = 'z | EpResant 22009955..00443333 Peestotiie | P~g~ ~3 of | | 4 33MMAA0011555522221100 `AtaedSiunrRfecpoerWa5te-rASalmypslieasofCottage GroveSeder Exygen StudyNo.POLO Exys~'~ S~u~y Ho.: PO~OI4~O FFiigguurree 1155.. CChhrroommaattooggrraamm RReepprreesseeanttiinngg aa SSuurrffaaccee W Waatteerr SSaammppllee AAnnaallyyzzeedd ffoorr PPFFBBSS ((EExxyyggeean IIDD:: CC000e885555995~,, DDaattaa SSeett:: 0099228800b5'DD)) Le td Exypen Research Exyge~ Rese'~r~h 22009955..00443344 i PPaaggee 5S4aorf i~ |d4 | 33MMAA0011555522221111 _AEInterim Report #5 - And Surface Water Sample~ Exygen Study No.: PO001400 FFiigguurree 1166.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFTHIS$ iinn RReeaaggeenntt WWaatteer 3 of -- . || i -Page 55 of 114 22009955..0044335 3MMAA00115555222212 otsi tepe#o5 -SAnoamlyessisofCotage Grove Scien Interim Report #5 - Analysis ofCottage Grove Sediment And S~rface Water Samples BygenStyNo: P0140 Exygen Staah! No.: P0001400 FFiigguurree 1177.. EExxttrraacctteedd SSttaanndd2aanrrdddss$0ooff3PPg/FFLHH,S$ReiisnnpeRRceetaaiggveeennltyt W Waatteerr,, 2255 nngg//LL. and 50 ng/L, Respectively WIaR .J eeeet | BERT 5- [= f Eryge Ree 22009955..00443366 | Pugs ssorle i Page 56 ofl14 33MMAAD011555522221133 nr Rep 5 Ayof CoteGroveSc Br SndyNy o:BOm 01S00 Imrrim R~port #~ - Analysis ofCottage Orov~ Sediment Rod Sates weerSeis A~d Surface Water Sm~ples Exygen Study No.: Figure 18. PFHS in ReagoutControl, 50 ng/L. Forefied Reagent Splke Figare 18. PAF,IIaSnidn5R0e0angge/nLt CFoeratitrfioel,d$R0eangge/LntFSopritikfeieBd,RReesapgeecnttivSepliyke A, aad 5~ ng/L Fortified Re~geat Spike B, Respectively [-- WRIeT e iL=E I - 0 WE i3 = T f=. Soper Exyg~n 22009955..00443377 | Pues7114 ] Page 57 of 114 33MMAAO011555522221144 -------------- nrAnin~diiSmnoRRretpeoetxrW~ta##t55e-r-SAAneanlraylpyssieiss oof~CCoottimaggeeGGrroovveeSSeeddiimmeenntt And Surface Water SampLes EcEoxgygeennSSttudyyNNoo..: PP00000104000 Figure 19. Figure 19. CChhrfrooormmaPatFtoeHggSrraa(mEmxRRyegepeprnreesIseDea;nttCiinOngg85aa6SS2ee4dd,iimmDeaennttat SSSaaetmm:ppl1l0ee0AA6mn0a5alClyy)zzeedd fer PFHS (Exygeu ID: C0085624, Data Set: 100605C) WI mr eo et | oe ExygenRescarh Exygen Research 22009955..00443388 PPaagg~e 5B8 orf 111144 | 33MMAA0011555522221155 im m iii l llll I oIrdiSsRuap Wa5SepsofCoteGrove Sims In.rim Rcpor~ #5 - Analysi~ oCettag Crrove S~dim~nt And Surf-see Water Samples BEoxyye~sm SSthadyyNNoo.:: PP0O0W0I1440000 Analyzed for FES (Exygen ID: CO08S595,DataSet: FFiigguurree 2200.. CChhrroommaattooggrraamm RReepprreesseenntfilnng aa SSuurrffaaccee W Waatteerr SSaammppllee Analyzed for PFHS (Exygen [D: C0085595, Dam S~t: 0~9922880055DD)) NS -- ] | 7 =| \ M. a Bonen Exygem Research 22009955..00443399 | ---- | Page 59 of 114 33MMAA0011555522221166 -- oIantleiS~muRRreeappotorrWtta5#t5er--SAAarnmaalplylsiesooffCCootttaageGGrraonveSSeeddiimmeenntt Exyen StayNo:2000140 Exygen Study No.: P00014430 + And Surfac~ Waler Samples FFiigguurree 2211.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFOOSS iinn RReeaaggeenntt WWaat~eerr i Exe Resa 22009955..00444400 Page 0or11d Page 60 of 114 33MMAA0011555522221177 _--_-- _ IhnsRep w5a Saymse ofCota GroveSdn Inte~m R~or #~ - A~alysis ofCott~g~ Grove And Surface Water Samples Sxy ndyNo: O10 Exygen Study No.: P0001400 and $0 ng/L, Respectively RFiggnurree 2222.. EExxttrraacctteedd SSttaannddaarrddssooff PPFFOOSS iinn RReeaaggeenntt W Waatteerr,, 2255 nngg//LL. and 50 rig/L, Respectively REEeT e |4 mm--m -- [r-- 22009955..00444411 Pes orite Page 61 of 114 33MMAA0011555522221188 AN ----I---------------------------------------------- RrimE RepAt ALnyiof otoGroveSit ~terim Relmrt #5 - Analysis ofCottage Grove A~.d Surfac. Water ~ml~l~ synSeyNo: POWLA00 Exygen Study No.: P0001 FFiigguurree 2233.. PPFFOOSS iinn RReeaaggeenntt CCoonnttrrooll,, 5500 nngg//LL FFoorrttiiffiieedd RReeaaggeeantt SSppiikkee AA,, aanndd550000nngg//LL FFoorrttiiffiieedd RReeaaggeenntt SSppiikkee BB,, RReessppeeccttiivveellyy TD------ f3 u T iwyold Poes idx pag mam A on . mmm iE " fi= " on Bm ia `Exygen Research 22009955..00444422 PPaigge, 6622o0ffl 11144 33MMAA0011555522221199 --_-- noediSRuetonWes ASnersiyess of CotasGroveSmet ExygeNno:SFOa00d14y00 Study No.: P0001400 FFiigguurree 224&. CChhrroommaattooggrraamm RReepprreesseennttiinngg aa SSeeddiimmeenntt SSaammppllee AAnnaallyyzzeedd ffoorr PPFFOOSS ((EExxyyggeenn IIDD:: CC00008855662244,, DDaattaa SSeett:: 110000660055CC)) WITT . ol Exypenesech Exygea Reseaxch 22009955..00444433 PePage 363ofoiflll4e 33MMAA0011555522222200 --------------eeeeeeeeem rSRte W5ieASneyisiof Cotas Grove Sir InWrim lteport #5 - Analysis ofCotla.g Grove Sediment And Surface Water Samples EyeSdNos RKCH00 Exygm Study No.: P0001400 FFiigguurree 2255.. CChhrroommaattooggrraamm RReepprreesseennttiinngg aaSSuurrffaacceeWWaatteerr SSaammppllee AAnnaallyyzzeedd ffoorr PPFFOOSS(E(ExxyyggeennIIDD:: CC00008855559955,,DDaattaa SSeett:: 0099Z28S0055DD)) NT we -- 8 UA | Baym Resa F..xyg~n Rematch 22009955..00444444 Pastore Page 64 of 114 33MMAA0011555522222211 E-- e --------------------eeee REPOR#6T- Analysis ofCottage Grove Fish Samples INTERIM REPORT #6 - Analysis of Cottage Grove Fish Samples PerfAAlnunaoalrlyoyshsieissxoaofnfePPseeufrllffloournootmoeco(tcPtaFanHnoSoi)icc,SAAnTSccdTiUiddUPDD((ePYPrYFhFTOeOTrAIAoI)TTo),,cLLPPtEEraefnrfellsuuucoltrfooobbruuatttaaennce(ssPuuFllfOfoSon)nattieen((WPPaFFtBBeSS,)),,Soil, PeSSreefdlduiiommreoennhtte,,xFFaiinssehhs,,uaalnnfoddnCCaltleaamm(PssFUUHssSiinn),ggaLLnCdC/MPMPeSrrSo/f/glMuMroaS$rmoffooocrttathhneees33uMMlfoCCnooatttteaagg(PeeFGGOrroSov)veeinMMWoonanittietoorr,riiSnnoggil, Program EPA TSCA GoDodDRAALETaTbQAAorUaRtIEorQRyUrEIaRMcEiEMcNESNtTaTnSdSards 40 CFR 792 EPA TSCA Good Laboratory Practice Standards 40 CFR 792 JiSSsTiTmUUbDDaYYKeDDsaIIrRRlEEPCEC.TTDOORERE JaWiWsei1emss4tth0ooa0nnKWSSeeooslslaututrotiiinooPnn.WsEs,a,.,hnyDce.E. E WWePesh1sott4n0CCeh0:heeWs6st1tee0ers-r,t,7oPP0n1AAW-311a799y63318800 Phone: 610-701-3761 ININTTEERRIIMM RREEPPFeOObmRRuTTarCCyOO7,MM2P0PL0L6EETTIIOONN DATE DATE February 7, 2006 "PEPERRFFOORERMxMyIIgNNeGnG RLLeAAseBBaOrOcRRhAATTOORRYY St33at00Ee55x88CyoRRgleleesensgeeeRaa,rreccPshheAaDDrrc1rihi6vv8ee01 StPahtoenCe:ol3le1g4e-,2P7A2-110638901 Phone: 814-272-1039 * 3M Company SSTTUUDDYY SSPPOONNSSOORR 3M Company 33MMPSSBBhtutou..iniPPleladda:uiiulnn6l,g,g5MM100.22NN733366553--5.50061111344--744BB4--1100 Phone: 651-733-6374 PROJECT PROJECT EExxyPy`PggrroeeotnntoSocSctootululddNNyyuumNNmbutebtmmreb:rb:eePPrr:00:00PP00O01100440000I100440000 TTooutall PPaaggeess:: 113300 22009955..00444455 33MMAA0011555522222222 -- TotemRep#6o. Anrlystisof Cote Grove Fish Sples ~~ Exygn Sudy No. POOOLA0D Interim Report #6 - Analysis ofCottage Grove Fish Samples Exygen Study No.: P0001400 GOODD LLAABBOORRAATTOORRYY PPRRAACCTTIICCEE COMCOPMLPILAIANNCCEE SSTTAATTEEMMEENNTT EExxyyggeenn SSttuuddyy NNuummbbeerr PP00000011440000,, eennttiittlleedd ""AAnnaallyyssiiss ooff PPeerrfflluuoorrooooccttaanncoiicc AAcciidd ((PPFFOOAA)),, Pedluombumesilfonste (PFS), Perfuorohexanesulfonaie (PFE), and Perfluorobutanesulfonate (PFBS), Perfluorohexanesulfonate (PFHS), and Perflorooctancsulfonate (PFOS) in Water, Sol, Sediment, Fish, and Clams Using Perfluorooctanvsulfonate (PFOS) in Water, Soil, S~liment, Fish, and Clams Using LC/MS/MS for the 3M Cotage Grove Monitoring Program." conducted for 3M Company, is LC/MS/MS for the 3M Cottage Grove Monitoring Program," conducted for 3M Company, is bbeeiinngg ppeerrffoorrmmeedd iinn ccoommpplliiaannccee wwiitthh EEPPAA TTSSCCAA GGoooodd LLaabboorraattoorryy PPrraaccttiiccee SSttaannddaarrddss 4400 CCFFRR 792 by Exygen Research. 792 by Exygen Research. /Fl,aherty PPErxriiynngcceiippnaalRl eIIsnnevvaeesrstctiihggaattoorr Exygen Research TaJSatsiusdimy Dh7 iarKecetsoarri P4.E.,DDEEEE SWteusdtyoDn iSroelcuttoirons, i. Weston Solutions, Inc. RobeS rt A. so che.loA RSS3ppoMoobnneCssrootomrrApRR.aePenppayrsreecssheeknneatattiivvee 3M Company Dues/o Date he zfuelalot Date Exygen Reseach Exygen Research 22009955..00444466 PPaaggee220o1f113300 33MMAA0011555522222233 ---- 00000 IInntteerriimmRRepepoorrtt##66 -- AAnnaallyyssiissooffCCototttaaggeeGGrroovvee FFiisshh SSaammpplleess E`Exxyyggeenn SSttuuddyy NNoo.:.: PPO0000011440000 QQUUAALLIITTYY AASSSSUURRAANNCCEE SSTTAATTEEMMEENNTT `Manaadg0theeStmudeyDinrecttor, EExxyyggeenn RReesseeaarrcchh''ss QQuuaalliittyy AAssssuurraannccee UUnniitt rreevviieewweedd EExxyyggeenn SSttuuddyy NNuummbbeerr PP00000011440000,, eennttiittlleedd,, ""AAnnaallyyssiiss ooff PPeerrfflluuoorrooooccttaannooiiec AAcciidd ((PPFFOOAA)),, PPeerrfflluuoorroobbuuttaanncessuullffoonnaattee ((PPFFBBSS)),, PPeerrfflluuoorroohheexxaanneessuullffoonnaattee ((PPFFHHSS)),, aanndd PPeerrfflluuoorroooocettaanneessuullffoonnaattee ((PPFFOOSS)) iinn WWataeterr,, SSooiill,, PSSreeoddgiirmmaeemn"nt.t,, FAFilisslhh,r, evaanineddweCCdllpaahmmasssesUU'ssiwinneggreLLiCCn/s/MpMeScSt//eMMdfSSorffoocrrontdthhueect33aMMccoCCorotdtttiaagntgeego EGGxrryoogvveeen MMRoeonsinetiatororcrihin'ngsg Program". All reviewed phasesI were inspected for conduct aeeordirtg to Exygen Researeh's SSttaannddaarrdd OOppeerraattiinngg PPrroocceedduurreess,, tthhee SSttuuddyy PPrroottooccooll,, aanndd aallll aapppplliiccaabbllee GGoooodd LLaabboormattoorlyy PPrraaccttiiccee SSttaannddaarrddss.. AAllll ffiinnddiinnggss wweerree rreeppoorrtteedd ttoo tthhee EExxyyggeenn PPrriinncciippaall IInnvveessttiiggaattoorr aanndd Management and to the Study Director. Phase. Wo RawDuaRevew 14. Raw Data Review and Fira Anais and Final Analytical Report Review Report Review 15 TowDashes 15. Raw Data Review andFinalAnaly and Final Analytical ReportReview Report Review DucDate InInssppeecctteedd, VI62I0S DateReported 0 Date Reportetdo Date Reported to Date Reported to Pcl Fxg DaieReporedio Principal 12205 12Ms 1s IInnvveessttiiggaattoorr Exygen MMaannaaggeemmeenn!t Date Reported to SSttuuddyy.DDirireeccttoorr 02006 0~03~6 G06 02107~6 02006 02~7~6 020706 02/07~6 IA Rfo7[0 Bae Date `TTeedqh~piecaall LLeeaadd,, QQuuaalliittyy AAs~ssuurraannccee UUnniitt 1"NNoottee:: AAllll iinr--llaabb iinnssppeeccttiioonnss wwiillll bbee ddooccuummeenntteedd iinntthhee QQAA ssttaatteemmeenntt ffoorrtthhee ffiinnaall aannaallyyttiiccaall port a the conclusion of the study. This QA siatement invalves only the review ofhe report at the conclusion of the study. This QA statement involves only the review of the `teri report ndassociated rawdata. interim report and associated raw data. Exygn Reseach Exygen Research 22009955..00444477 PPaaggee330off113300 33MMAA0011555522222244 ---------- IntiReport#6 AnalysisofCota Gro FishSamples ExygenStudyNo: PORO1400 Interim Report #6 - Analysis of Cottage Crrovc Fish Samples Eygen Study No.: P0001400 CCEERRTTIIFFIICCAATTIIOONN OOFF AAUUTTHHEENNTTIICCIITTYY represeonf hteartaidoaan. TThhiiss iinntteerriimm rreeppoorrtt,, ffoorr EExxyyggeenn SSttuuddyy NNuummbbeerr PP00000011440000,, iiss aa ttrruuee aanndd ccoommpplleettee representation of the raw data. Submitedby: Submitted by: Ex3E0yx8yg8geeRnneRsReeeassreecaahrccDhhrive 3058 Research Drive SSttaattee CCoolllleeggee,, PPAA 1166880011 (8(S1i44)) 227722--Z100~399 Principal Investigator, Exygen: Principal Investigator, Exygen: Jon ce PFFrelalshiaedrentnyt EExxyygge,~nneRRseiesdseeeanartrcchh DueSpe Date ExygenResFacielityMaanacgemehnt: . Exygen Research Facility Management: Jload, RPircehsaidrednAt. ExypenResearch Exygen Research 7- feb-66 DDaattee "oni Ie. Study Director~eston Solutions, Inc. I1~ WTJaeeisssitmmobnhaSaoKKleuestsaiaorrinsPP.EEn,.c, .DDEEEE Weston Solutions, Inc. pe SSppoonnssoorr RReepprreesseennttaattiivvee,, 33MM CCoommppaannyy:: Ra= beAr Paschke|a MRanobaegrteA,.3PMascChokrpeorate Environment) Programs Manager, 3M Corporate Environ_mental Programs B2as/4[ot Date ExygenReseach Exygen Research PaPgageed4ooff113300 22009955..00444488 33MMAA0011555522222255 DE ------ Initneterriimm RReeppoorrtt ##66 -- AAnnaallyyssiissooffCCoottataggee GGrroovvee FFiisshh SSaammpplleess EExxyyggeenn SSttuuddyy NNoo:.: PPO0O0O0L1440000 SSTTUUDDYY IIDDEENNTTIIFFIICCAATTIIOONN PerfAAlnunaoarlloyyhsseiixssoaonfefPsPeuerlrfffloluunooartrooeoo(ccPttFaaHnnoSoi)icc, AAacncididdPe((PrPfFFlOOuAoA)r),o,oPPceierarfnflleuusoourrloofbbounutataatnencc(ssPuuFllffOooSnn)aattieen((WPPaFFtBBeSrS),),,Soil, Sediment, Fish, and Clams Using LC/MS/MS for the 3M Cottage GroveMonitoringProgram Perfluorohexanesulfonate (PFHS), and Perfluorooctanesulfonate (PFOS) in Water, Soil, Sediment, Fish, and Clams Using LC/MS/MS for the 3M Cottage Grove Monitoring Program PPRROOTTOOCCOOLLNNUUMMBBEERR:: PPO000D011440000 EEXXYYGGEENNSSTTUUDDYY NNUUMMBBEERR:: ~~ PPO0000011440000 TTYYPPEE OOFF SSTTUUDDYY:: SAMPLE MATRIX: SAMPLE MATRAX: RReessiidduuee Fish Fish TEST SUBSTANCE: TEST SUBSTANCE: SSPPOONNSSOORR:: PPPeeerrrfffllluuuooorrrooooobcuctttaaannnccoisicculaafccoiinddat((PePFF(OOPFAAB))S,,), PPPPeee~crrflfflllluuuuoooomrrrooobhohaceettxxaaaannnnceeessssuuuullllffffoooonnnnaaaatttteeee((((PPPPFFFFBOHHSSSS)))),,, aanndd Perfluorooctanesulfonate (PFOS) 333MMV CCBuooimmlpdpiaannngyy0236-01-B-10 3SMt PBauuli,ldMinNg 55144 0236-01-B-10 St. Paul, MN 55144 SSTTUUDDYY DDIIRREECCTTOORR:: SSTTUUDDYY M MOONNIITTOORR:: J`laaWiiesssiitmmohhnaaSKKoelesu~taairdonPP,..EEI.n.,c,.DDEEEE `W11W44ee00ss00ttoWCWnheeesSsstottooelunrnt,iWWoPnaAasyy, 1In9c3.80 West Chester, PA 19380 RR3ooMbbeCerrottmAAp..aPPnaaysscchhkcee 333StMMM. PBBCauuuoiliml,lddMpiiannNnggy445225--1004224.-EE.-2277 St. Paul, MN 55144 PPEERRFFOORRMMIINNGG LLAABBOORRAATTOORRYY:: E3E0xx5yy8ggeeRnnesRReeeassreecaahrmcDhhrive. 3SSt0taa5tt8ee RCCoeolsllleeeaggreec,,hPPDAAri1v166e880011 TAAINNMAEALTLYAYTBTILICCEAA:LL PPHHAASSEE TIMETABLE: ISSntttuueddryyimIInnAitntaiaatltyiiotoinncDaDlaatSteet::ari Date: 001330///001338///000555 IInntteerriimm AAnnaallyyttiiccaall TSetarrmtiDnaattei:on Date: 1010//1287//0056 IIInnnttteeerrriiimmm RAReenppaoolryrtttiCcCaoolmmpTlpeerlemttiiioonnnatDDioaatnteeD:: ate: 000221///002777///000666 Exygen Research, Exygen Researeh PPaaggee 5Sooff 113300 22009955..00444499 33MMAA0011555522222266 InItneterriimm RRepeort#p#66 o--AAnarnlaylystsiiss ofCottageGrove of Cottage Grove Fish Fish Samples Samples PPRROOJJEECCTT PPEERRSSOONNNNEELL EExxyyggeennSSttuuddyy NNoo:.: POOOI400 P0001400 TTfohhleeloSSwittunugddyypeDDriisrroeenccntteoolrr fffoorrromtthhiiEssxyppgrreoojnjeeccRttesiisseaJJraaciihssimiwmehhraae Kesari Kaesssoacdi aaatttedW WweeissttthoonnvaSSroiololuuutstiioopnnhssa,, Inc. seInsc.of The Tthhies ifinonttleleorriwimminppgoorrpttiieoornsnooofrmftthhlee fssrttuoudmdyy:: Exygcn Research were associated with various phases of this Name NalTle JJoohhnn FFllaahheerrttyy KKaarreenn RRiisshhaa ChCrhirsisssyyEEddwwararddss, MMaarrkk AAmmmmeerrmmaann Amy Sheehan Amy Sheehan MindyCressley Mindy Cressley BBrriitttaannyy KKrraavveettss Christa Gallant Christa Gallant Eric Edwards. Eric Edwards TTiittlee VViiccee PPrreessiiddeenntt LaLbaobroarattoorryy SSuuppeerrvviissoorr TTeecchhnniicciiaann SSaammppllee CCuussttooddiiaann AAssssoocciiaattee SScciieennttiisstt TTeecchhnniicciiaann TTeecchhnniicciiaann TTeecchhnniicciiaann SSaammppllee CCuussttooddiiaann Bxygen Research Exygen Research 22009955..00445500 PaPaggee G6ooff 113300 33MMAA0011555522222277 Intteeriimn RReeppoorrtt ##66--AAnanlaylyssiiss ooffCoottataggeeGCr-orovveeFFiisshhSSaammpplleess EExxyyggeennSSttuuddyy NNoo..: PPO0G0O0L1440000 `TABTLEOAOFFCCBOONNTLTEENNETTSS PPaaggee TITLE PAGE ...................................................................................................................... 1 GOOD LABORATORY PRACTICE COMPLIANCE STATEMENT ...........2 GOOD LABORATORY PRACTICE COMPLIANCE STATEMENT ............................. 2 QUALITY ASSURANCE STATEMENT... eee3 QUALITY ASSURANCE STATEMENT.......................................................................... 3 CERTIFICATION OF AUTHENTICITY... d CERTIFICATION OF AUTHENTICITY .......................................................................... 4 STUDY IDENTIFICATION. 2 STUDY IDENTIFICATION ............................................................................................... 5 PROIECT EEMEON BL cmmmmmmmmmmmmmmmmommsmmmmamm's PROJECT PERSONNEL.................................................................................................... 6 TABLE OF CONTENTS... errno] TABLE OF CONTENTS .................................................................................................... 7 LIST OF TABLES wn . my LIST OF TABLES .............................................................................................................. 8 LISTOFFIGURES........omemsssseersmeromssnseonsd LIST OF FIGURES ............................................................................................................. 9 DST OF APPINDGES cones 11 LIST OF APPENDICES ................................................................................................... 11 10SUMMARY. - n-- Le 1.0 SUMMARY ............................................................................................................... 12 0) OETEOTIVE mannose 33 2.0 OBJECTIVE .............................................................................................................. 13 30 INTRODUCTION. B-- 1 3.0 LMTRODUCTION...................................................................................................... 13 40 ANALTEYSTTSAMIPLECS..A. L 13 4.0 ANALYTICAL TEST SAMPLES............................................................................. 13 5.0REFERENCEMATERIAL coors 14 5.0 REFERENCE MATERIAL ....................................................................................... 14 60 DESCRIPTIONOF ANALYTICALMETHOD... 16 6.0 DESCRIPTION OF ANALYTICAL METHOD ....................................................... 16 6. Extraction Procedut ft Fishers one 16 6.1 Extraction Procedure for Fish .................................................................................. 16 LT SPIEPIGQABION errors 16 6.1.1 Sample Preparation ................................................................................... 16 612 GIaSSWIC PIGPAON. ors ssn 16 6.1.2 Glassware Preparation ............................................................................... 16 613 ColumnPreparation BT 6.1.3 Cohmm Preparation .................................................................................. 16 614 SampleENRON... 1 6.1.4 Sample Extraction ..................................................................................... 17 62Preparation of Standardsand ForificatonSOions ovr 17 6.2 Preparation of Standard~ and Fortification Solution~ .............................................. 17 63 COTOMRIOBIIPRY sss 18 6.3 Chromatography ...................................................................................................... 18 Le ------'| 6.4 Instrument Sensitivity .............................................................................................. 18 6.5 Descriptionof LOMS/MS InstrumentandOperating Condon... 19 6.5 Description of LC/MS/MS Instrument and Operating Conditions .......................... 19 6.6 QuantiaiionandExampleCaloatio. vv 19 6.6 Quantitation and Example Calculation .................................................................... 19 7.0 EXPERIMENTAL DESIGN... oso 21 7.0 EXPERIMENTAL DESIGN ...................................................................................... 21 8.0 RESULTS .................................................................................................................. 22 90 CONCLUSIONS SE Tn 9.0 CONCLUSIONS ........................................................................................................ 23 10.0 RETENTION OF DATAAND SAMPLES... 33 10.0 RETENTION OF DATA AND SAMPLES............................................................. 23 ExEyxgygeenn RReesseeaarcchh 22009955..00445511 PPaaggee 770o1f113300 I3MMAA0011555522222288 ------------------------------------ Interim Report 6 - AnaloyfCsotiagse rove Fish Samples Bxygen Sy Nos O01400 Interim Report #6 - Analysis ofCottage Grove Fish Samples Exygen Study No.: P0001400 Tablel, Table I. LLIISSTTOOFFTTAABBLLEESS Summiryof PFBS, PFHS, FOS nd PFOA in ish SAmpe............ 25PPaa~ge Summary ofPFBS, PFHS, PFOS and PFOA in Fish Samples ...................... 25 Table IL. TTaabbllee. Table TTaabbllee 1IVV.. TablVe. TTaabbllee VVL.. TTaabbllee VVIIL.. Table Matix Spike Recovery of PFOS ad PFOA i Fish Spe... 35 MMaattrriixx SSppiikkee RReeccoovveerryy ooffPPFFBBSS aanndd PPFFHHSS iinn FFiisshh SSaammplpesl.e.s................c..............r......... 2288 Matrix Spike Recovery of PFOS and PFOA in Fish Samples ..................... .. 35 SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff 1"3XCC PPFFOOAA iinn FFiisshh SSaammpplleess ...............................o.c..v.r.u..... 4422 Summizyof PFBSand PFOAinComposeFish SADIE... 49 Summary ofPFBS and PFOA in Composite Fish Samples........................... ,*9 Matrix Spke Recoveryof FBS an PFOA inComposite Fish Samples... 50 Matrix Spike Recovery ofPFBS and PFOA in Composite Fish Samples..... 50 Sumogat Ske Recovoefr*yC PEOAinComposite Fish Samples... 51 Surrogate Spike Recovery of 13C PFOA in Composite Fish Samples........... 51 `EExxyyggeennRReesseeaarrcchh 22009955..00445522 PPaaggee880o1f 13300 33MMAA0011555522222299 -------------------------------------------------------------------------------------- Incr Report #6 - AnalysisofCotiage Grove Fish Samples Interim Report #6 - Analysis of Cottage Grove Fish Samples Exygen Study Nos POOOLA0D Exygen Study No.: P0001400 L LISTI OOFFFFS IIGGUUT RREESS PPaaggee FFiigguurre1e1.. TTypyipcicaallCCalailibbrraattiioonn CCuurrvveeffoorr PPFFOOAAiinn MMReAthDaOnoLl cee ........................................ 5533 FFiigguurree 22.. NN1o.on0n-n-egex/xtmtrrLaa,ccttReeeddspSSetcattniadvaenrldydsooaffPrPFFdOOsAA iinn MMeetthhaannooll,, 00..55 nngg//mmLL aanndd se 1.0 ng/mL, Respectively ................................................................................ 54 FFiigguurree 33.. PPaFFnOdOAA10iingn CCgoonntFtrorrootllifFFiiiessdhhCBBollnaatnnrkko,,l22F..i55snnhggS~/pggkFFoBor,rttiRiffeiiseepddecCCtooinvntetrlrooyl.l.FF.iisshh SSppkk AA,, 55 and 10 ngig Fortified Control Fish Spk B, Respectively .............................. 55 FFiigguurreed4.. (BCCxhhyrrogommeanatItooDgg:rraaCmmORRee0ppr9reess6eenn7tDtiian1ngga0Sae,FFti:isshh10SS2aa6mm0pp5llAee)AAnnaallyyzzeeddrv.ffoorr PPFFOOAA 6 (Exygen ID: C0096710, Data Set: 102605A) ................................................ 56 FFiigguurree.5. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PC13C PPFFOOAA iinn Methanol... Methanol .................................. S5T7 FFiigguurree 66.. NN1o5onn5-E0Ex1xtrt0raa,cctRteeddASSttaaDnnddaaIrrddsswoooffn"13mCCsPPmFFmOOnAeAiiinmn mMMeretmthhmaanonoaolln,, m00..m55rnnmgg/m/mmmLLm.naannnddn 58 1.0 ng/mL, Respectively ................................................................................ 58 FFiigguurree 77.. 1Ca3nCdPP1FF0OOnAAg/iignnFCCoorontntitfrriooelldFFCiiossnhhtrBBolllaannFkki,,sh22..S55pnnkgg/!Bgg, FFRoEorSrtPtiiEffCiieHedVdeCCloyon.nttrrcooll FFriisshhoSSpprkk AAe,, 59 and 10 ng/g Fortified Control Fish Spk B, Respectively .............................. 59 FFiigguurree 88.. CC(BhhxrryoogmmeaanttooIggDr:raaCmmO0RR9ee6pp7rre1es0see,nntDtiianntggaaaSeFFtii:sshh10SS2aa6mm0pp5ll4ee)AAnnaallyyzzeedd ffoorr ~3CC PPFFOOAA 60 (Exygen ID: C0096710, Data Set: 102605A) ................................................ 60 FFiigguurree9.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvveeffoorr PPFFBBSS iinn Methanol... Methanol ......................................... 6611 FFiigguurree 1100.. NNOoonn-S-EExxrGlaracctBteedd SSottaannddpaarrddssoofmfPPsFFmBBSSmmiinnmMMemetsthhaannnoeoll,m, 00s..55mnnmgg//mmmLmL.--aanndd 1.0 ng/mL, Respectively ................................................................................ 62 FFiigguurree 1111.. PPaFFnBBdSS10iinnnCCgo/ongntFtrrooorlltiFFfiiissehhd BBCollnaatnnrkko,,l22..F55isnnhgg/S/ggpkFFooBrrt,tiiRffiieeesddpCCeocontntitrrvooelllFFyii.ss.hh.SSppkk AA,, -- and 10 ng/g Fortified Control Fish Spk B, Respectively .............................. 63 FFiigguurree 1122..(ECCxhhryroogmmeaanttIooDgg:traCamOmORR9ee6pp7rr1ee0sse,enntDtiianntggaaaSEFFti:isshh1SS0aa2mm6ppl0leeAAA)nnaallyyzzv eedd ffoorr PPr FFBBSS s 64 (Exygen ID: C0096710, Data Set: 102605A) ................................................ 64 FFiigguurree 1133.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFHHSS iinn MMeeththaannolo.l ......................................... 6655 FFiigguurree 14. 14. NN1.o0onnD-EGExMxtrtLraa,ccRttEeedSdPSSEttCaaInnVddaEarLrddYss ooffPPFFHHSS iinn MMeetthhaannooll,, 00..55 nngg//mmLL aanndd nes66 1.0 ng/mL, Respectively ................................................................................ 66 FFiigguurree 1155.. PPaFFnHdH1SS0iinnngCC/oognntFtrrooorltliFFfiiissehdh BBCollnaatnnrkko,,l22.F.55isnnhgg/S/ggpFkForoBtr,itifRfiEieSepddecCCtooinvntetrlroyol.l.F.F.ii.ss.hh..SS.pp..kk..AA.,., 67 and 10 ng/g Fortified Control Fish Spk B, Respectively .............................. 67 FFiigguurree 1166.. C(CEhhxrryoogmmeaanttooIggD:rraaCmmORReeOpprr9eess6eennD7ttaiitn1naggS0aaeFF,:iisshh10SS2aa6mm0p5pl4l)ee.AAnnaallyyzzeeddffoorrI PPFFHHSS -- (Exygen ID: C0096710, Data Set: 102605A) ................................................ 68 FFiigguurree 1177.. TTyyppiiccaall CCaalliibbrraattiioonn CCaurrvvee ffoorr PPFFOOSS iino Methanol... 6 Methanol ......................................... 69 FFiigguurree 1188.. NNLoOonn-M-EEGxx/ttrLraa,ccttReeddESSSttaannPddaEarrddCssooffr PPFFOOSS iir nn MMeetthhar annooll,, 00..55 nngg//mmLL. aanndd TO 1.0 ng/mL, Respectively ................................................................................ 70 EExxyyggeenn RReesseearrcchh PPaaggee 990o1f113300 22009955..00445533 I3MMAA0011555522223300 Interim Report# - AnaloyfCsotiagse Grove Fish Samples Interim Report #6 - Analysis of Cottage Grove Fish Samples Exygen Study No. PO00I400 Exyg~n Study No.: P0001400 LLIISSTT OOFF FFIIGGUURREESS ((ccoonnttiinnuueedd)) FFiigguurree 1199.. PP`FaFnOOd SS10iinnngCC/oognFntotrrrootllifFFiiiseshdh BBCollnaatnnrkko,,l22F..i55snnhggS//ggpFFoBorr,ttiiRffEiieeSddpCCEoConHntVtrrEoolLlYFFiisshh SSrpprkk AAr,, 71 and 10 ng/g Fortified Control Fish Spk B, Respectively .............................. 71 Figure 20. Figure 20. C(CEhhxrryoogmmeaanttooIggD:rraaCmmOR0Re6ep7prr1ees0se,enntDtiianntggaaFaSeiFt:sishh10SS2aa6mm0pp5ll4ee)AAnnaallyyzzeecddvffoorr PPFFOOSS n (Exygen ID: C0096710, Data Set: 102605A) ................................................ 72 EExxyyggeenn RReesseeaarrcchh 22009955..00445544 PPaaggee 1100o0f113300 33MMAA0011555522223311 Interim Report 46 - AnsysofCotage Grove Fish Samples Exyaen Study Nos POO1400 Exygen Study No.: P0001400 Interim Report #6 - Analysis of Cottage Grove Fish Samples Appendix A_ Appendix A Page LIISSTT OOFF AAPPPPEENNDDIICCEESS Page StudyProtocol 0001400 (Exygen Sudy No. POOOI00) with Study Protocol P0001400 (Exygen Study No. P0001400) with ADSI] Methods 0d ATIDATEDS rrr 73 Analytical Methods and Amendments ...................................................... 73 Exygn Research Exygen Research 22009955..00445555 PPaaggee 110130 11 of 130 33MMAA0011555522223322 InterimRep#6o-AnralytsisofCoGrtoveFaishgSampeles ExygenStudyNo: POOOLAD0. Interim Report #6 - Analysis of Cottage Grove Fish Samples Exygen Study No.: P0001400 11..00 SSUUMMMMAARRYY ExpEeyxrygfgleuenonrRooeRcsteeasnaeoarirccchhaceiexdxat(rcPatcFteOeAdd)a,napndedraflnauanolarlyoybzzueetddanfeisfiusslhhfosnusaatmmeplp(lePeFssBSf)fo,orrpterthhfeeludoerdtoeehtreerxmmainnicnasatutilioofnonnaotofef p~a-fluorooctanoic acid (PFOA), perfluorobutanesulfonate (PFBS), perfluoroh~xanesulfonate ((APpHpSe)n,diaxnAd).perfiuorooctanesulfonate (PFOS) according to Exygen Method VO00IT83 (PFHS), and perfluorooctanesulfonate (PFOS) according to Exygen Method V0001783 (Appendix A). gT"Trhhaeemslliiammmiitpt looeffsqqauuanandnttiittaa2tf5niiogonnlgfffooorrrPPtFFhOOeoAA,n,ePPgFFrBSaS,m,sPPaFmFpHHlSSesaa.nndd PPFFOOSS iinn ffiisshh wwaass 00..55 nngg/gg ffoorr tthhee ffiivvee gram samples and 2.5 ng/g for the on~ gram samples. iAAnnnafaliylsythtsiicacaamllprlreeesssuullattrsseasanndudaasmsssemessssaeeddriaanicccTcuzuarrbaaelcceiideeIss.ffoorrtthhee aannaallyyssiissooffPPFFOOAA,, PPFFBBSS,, PPFFHHSS,, aanndd PPFFOOSS in fish samples are summarized in Table I. TFFoaorbrttliieffiisccaaIttiiooannnrrdeeccIooLvveerriiTeehsseffooarrvPPerFFaOOgAAe,,pPPeFFrBBcSSe,, rPPeFFcFHoISSveaarnnsdd +PPFFsOOtaSSndiinanrttdhhedeeffviiissahhtsisaoamnmspplfleeosrs PaarrFeeOddAee,ataiiPllFeedBdSii,nn PrPTeFFasHHpbeSlSceatsinavInedIldyPa.PnFFdOFOoSISriItIiin.fnitcTtahhhteeiefoifnasisvhrheesrcsaaoagmvmeeprplpileeeessmswfeweonrertre"ere9'cC95o5PvcF=nO-i11Ae66si%%n4,-,ts77ht66ean++fdias11 rhd4s%da,em4 9vp99il9ae*tsi% o8an8rs%%e f, adoaenrntdaPdiFl11eO0dA0i+n0,_PT22Fa220Bb%%lS,e,, IwrIeVVes.r.peeTTc9thh3ivee+aeavly1ve9.e.rraaFggoeerptpiefericrccaeetninottnrrereecccooovvevereriireeiesss++_fossrttaa1nn3ddCaarrPddFdOdeeAvviiaainttiiotohnness forfish for "C PFOA in the fish samples samples are detailed in Table t3C PFOA in the fish samples were 93 _4- 19. `fTTowwreenantttyyloeoafsfttthhoeensesiixcxtotyym--pttwowuoonsdsaa.mmplpUelpessosnsuubcbmlmiietintttteedrdefqfouorersatan,naalslyaysmsipissleidsiddnCno0ot9tm6me7ee3te0tqqu--aulaCilOtity0y9cco6no7tn3rt2roollwcercririteteerrreiia-a loeefoxxwtrtrrsaaaactcttmleeepddalasaentnddomanaanesnaaslcloydymzzueepeddotfufooonrrdtPP.hFFeBBUsSSipzoaaennnoddcfl"tit3eCChnetPPirFFenOOqdAiuA.ve.isdt,IuinastilataimsallpprerleeecsssiuulmClttess0n0fsrr9doo6imm7da3an0nnaoal-ltyymsCseee0sse0oo9tf6fs7sPaa3mFm2pOlpAwelesessrwp~wiiktriteehh-. rrlhoeeocwcmooovvgseeaerrmnyyapcctlrreeiitteemrrfiioaaars..s rCCdeoaounnnesaseleyqtqosuiuesetn.hnteltlyys,,iSzccaeoommmpoplfpoeostshsiitetCeeOinss0aad9mmi6vpp7ildl3eeus5sawlwe~esrrpeeeCcppOirr0mee9ppe6aan7rrs3ee9ddd,iffdrooCnmmOo0ttt9hh6mee7err5eee0tmm,aPaiiFCnnOiOinnOAgg96ttsiTispsSsis3uku,eee (shCiCo0tDme0O9ao66ng7d7e55n5f5ai,,tseh0C0s0fp00oe99rc6i67e7rs5e5,a88n,a,an(Cldy2O0s0ri0es99-.66e7x7t88r1S1aac---mteCpdCl0eOa0snT9d6CEa70n8S0a8l9y6wwz7eee3rdr5~efoccr-oommPbCbFii0Onn0eAe9dd6a7innn3tdt9,o,"gg'rrCCoo0uPup0pOs9s,A6,b.7ba5as0see,FddoorCotn0nh0ess9aa6emn7xp5aplc3leet, groupings,secthecomesposecntiodn oefnthceraedata package. site and fish species, and re-extracted and analyzed for PFOA and grouping, see the correspondence section of the raw data package. 13C PFOA. For the exact AAsnunamalmlyyattriicicaazlledrreeissnuulTlttassbfflooerrVtt.hhee aannaallyyssiissooff PPFFOOAA aanndd PPFBBSS iinn tthhee rree--eexxttrraacctteedd ffiisshh ssaammpplleess aarree summarized in Table V. TFFoaorbrttliieffiiccVaaItt.iioonnThrreeeccooavvveeerrriiaeegssepffeoorrrcPPenFFtOOAArecaaonnvdderPPiFeFsBS+S siintnantthdeearrrdee--deeexxvttirraaatccittoeendds fffiiossrhh PssaaFmmOppAlleeassnaadrreePFddeBettSaaiiillneeddthiinen rTea-bclxetrVctI.edTfhieshavsearmapgleepserwceernet ro1c1o1vories11%sta(n@d=1a2rd) daenvdiat8io5ns+fo6r2P%FO(A=3a)n,d rPeFspBeSctiivneltyh.e FVrFeoIor-LrettixifftiirTcachaacttetieioodannverfrreiesacchgooevveseprareimireecsspelnfefotosrrrwe"~c'eCoCrvePePrFFi1OeO1s1AA +iinnst1ttahh1need%arrreed(--needx=xetl1vzri2aaa)cctttieeaoddnndsffiisfsghoh5rss"aa4mm-Cpp6lPl2eeF%ssOaaArr(eeni=ddne3ett)ta,haieillrereededs-piieennxcttTTriavaacebbtlleyleed. VffiisIshIh.ssaaTmmhppelleeassvwwereearrgeee99p99~.r+ce11n77t%%r..ecoveries + standard deviations for 13C PFOA in the re-extracted EBxxyyggeenn RReesseeaarrcchh PPaaggee 11220o1f113300 22009955..00445566 33MMAA0011555522223333 InterimRe#p6-Aonaly:sisof CotageGroveFish Samples Interim Report #6 - Analysis of Cottage Grove Fish Samples 22.00 OOBBJJEECCTTIIVVEE Exygen Study No: POOOLA0) Exygen Study No.: P0001400 "The abjeciveofthe analytical part ofthis study was to determine levelsofperfluorooctanoic apTacechirieddfloo(b(rPPjoeFFocOOctiiAAva)en),,cosfupplteehfrreofflnlauaonotrareooly(bbtuPuiciFtaaaOlnnSeep)ssaiuurnltlfooofninsafahhttteeias cs(('tPPucFFdBSyo)Sw),rt,aosdPpprteeoiorrtfdfnloeulctoogoerrrloomhhPieenOxxea0annl1ecev0sseuu0llfsfo(oonnAfaapcptpe.eernfl((duPPioFFxrHHoSAoS))c.),,tanaaonniddc perfluorooctanesulfonate 0aFOS) in fish according to Protocol P0001400 (Appendix A). 33..00 IINNTTRROODDUUCCTTIIOONN TTPhFhiiOssrSreepiponorrtftidsdehetatuaisillisntgthhteehrreeessaunualltlssyotofitfcathhleemaannoaalldyyssiissefnfotorirttltheheded,ed"teVetOerr0mm0i1ni7na8at3tii:oonnoMofeftPPhFFoOOdAAo,,fPPAFFnBBaSSl,,ysPPsFFHHfSoSr aatnnhdde PDDeFetOteeSrrmmiiinnnaafttiiisoohnnouofsfiPnPegefrltfhulueooraroonooaclctytaatinnccoailiccmAAecctiihddo(d(PPFeFOnOAtiA)tl)eidinn,FF"iVsish0ha0a0nn1dd78CC3lla:ammMssbebtyhyoLLdOCoM/MfSASM/nSMa.lSyTM.s"is for the PThOheOeLss4ttu0ud0dyy.wwaaTssheiinniaftnitaaalteeytddicooannl MMsataarrtcchhda00t33e,, f22o00r005t5h,,iswwhihenetnnettrhhnee rssettpuuoddryyt ddwiiarreseccttOoocrrtssoiibggennreedd18pp,rroo2tt0oo0cc5oo,ll nnanuudmmbbteherer analytical termination dte for tis interim P0001400. The analytical start date for analytical termination date for this interim reportwas January this interim report report was January 27,2006. was October 27, 2006. 18, 2005, and the 44.00 AANNAALLYYTTIICCAALLTTEESSTT SSAAMMPPLLEESS (SSCiixOn0tytS-6yt7ww5oo0, CffiiAsshOh96ss7aaSmm3pp,lleeCssOO((9EEGxx7yySgg5ee,nnCOII0DD967CC5O08D0,9G6CS6OO9DS5I6T---SICC--O090C96O67O7494227,,88CC)O0wU0eS9r66eT744r44e,c,eiCCvOe0dO099o66n7Md4Tr7,y, Ciiiccn0eec0lSS9ued6epep7dtt5ee0mam,bbfCeeir0rve0119o446,r,7225si003x00, 55cCh0ffar0rroa9omc6mt7eCC5rh5has,arreCllee0sws0i9YYt6hoo7uut5nnh8gge, Caafittr0sW0W t9ece6shs7tat8oor1annct-SSeoorClluu0dtte0iiso9ocnn6rss7i,,8bi8Ionnc)cg.w. tehSrSeeaammsrepapcmllepeeilv[eIeDDdloccocoonaddtiidinnorggyn p((inPuRc.neelcauaiccdahhendsl1,,a3{3,fS,ihva55e)n)noeffrolollsllocixoawtwfeeciddhsha]bbr,ayyctMttewDwr.oosecc=thhawaMrriaiatccchtrteeotrrhpssetddrfeeuisrssscctrriidcbbohiilnanogrgmaicttcthheueer s~d{ppseeemscecaiirleeilsbsminooougfftffhthiissehbhass((a]sIlm~)P p=a=lneIfdcclotiLacallaMuutrirouu=nss (pLLFueenpp=cootmmfailtiusseammtia[asccscrhuroeao,cnchnWhieirrl=uusscwah[[tbbfoilllsuuheee]ggb,iiolllMdssyDuutnniffs=iissusheMh])]).icTaarnnhoddptalaesrffuootsuutrrttwdhhooclccohhhmaaarrriaaaecccuttteee[rrrssmddeedasselcclsmrrciirobbiuiibntneJggactthbheeaiztysyt]pptheeeanoohsdffpesseLacamM immprpell=nee nin(Fnuudmm=ibvbifeeidrlrueat((lt00i1s1ss--au00me55p,))lWeffsoor=rcwiionnmhddpoiiovvlseiiiddbtuuoeaalddlyssftaaoimsmrsppurlleeeea).naaalTnnyaahslleiyysssl.aeessst Atoowrr wo2ahcohcclaooermmapcpWotohseiisrsittteiednegsssaacm(rmiFpbpalelmeeieli((ytChC:)e)rGccatohodnenissdisiaspstcteii)cnniggmwaeoosnff piipnuusdrhriccvhh(iaaEdssxueeyaddglfefrsnroaommImDpalCe0llsoo0cc5eaa4lolg3mgr9rop1oco)ce.seirrtbTebdhyyefEEodsdramCCrpeaalammenssasoloywnnesirDsDe.eeclceoAegmmgbwebedehrro2in2l0be0,y, W22E00xh00yi44tgianaengnndd(wpwFeaarasmssuoiunlsysnee:ddlGaaasasntddthihedpealcecao)ocnentwdtroaoilsnl fffrirsoohzzee(nnExssttyoogrreaagngee.I.D C0054391). The samples were logged in by Exygen personnel and placed in wSSiaatmmhppltlheeisllooiggnitinenriaamnnrddepccohhraatii.nnSootfforccuuassgtteoorddeyycoiirnnffsoowrrmimlaalttiibooenn kiiseplltooaccEaaxtteeyddiginentthheeRerrsaaewawrdcdahat.taappaacckkaaggee associated associated with this interim report. Storage records will be kept at Exygen Research. ExypenReseach Exygen Research 22009955..00445577 PPaaggee 11330o1f113300 I3MMAA0011555522223344 StRepoA CogGo Faker Interim Report #6 - Analysis ofCottage Grove Fish Samples Epp FON Exygen Study No.: P0001400 55..00 RREEFFEERREENNCCEE MMAATTEERRIIAALL The anlyica snd, PFOA, was purchased om Oskwood Products, I. snd was The analytical standard, PFOA, was purchased from Oakwood Products, Inc. and was rreecceeiivveedd aatt EExxyygge~nn oonn M Maarrcchh 1177,, 22000044.. TThhee ssuurrrrooggaattee ssppiikkiinngg ssttaannddaarrdd,, :"3CC llaabbeelleedd `ppeerrffluluoorrooooccttaannooiicc aacciidd ((:3CC PPFFOOAA)),, wwaass rreecceeiivveedd aatt EExxyyggeenn oonn AApprriill 1155,, 22000044 ffrroomm tthhee 33MM `CCoommppaannyy.. 33MM ssuupppplliieedd tthhee aannaallyyttiiccaall ssttaannddaarrddss PPFFBBSS aanndd PPFFHHSS.. PPFFBBSS wwaa~s rreecceeiivveedd ffrroomm Sr Bronyaya15,n205 EHSwareed pom IM a Faye on Janay 70 3M at Exygen on May 13, 2005. PFHS was received from 3M at Exygen on Ianuary 20, 22000033.. PPFFOOSS wwaass ppuurrcchhaasseedd ffrroomm FFlluukkaa CCoorrppoorraattiioonn aanndd wwaass rreecceeiivveedd aatt EExxyyggeenn oonn AApprriill 2233,, 42003. ambient, PFBS, PFHS and C PFOAwere storedfrozenand PFOSwasstored refgerated. TThhee aavvaaiillaabbllee iinnffoorrmmaattiioonn ffoorr tthhee rreeffeerreennccee mmaateterriiaallss iiss lliisstteedd bbeellooww.. PPFFOOAA wwaass ssttoorreedd ambient. PFBS, PFHS and ~3C PFOA were stored frozen and PFOS was stored refrigerated. CCoommppoouunndd owt PFOA ~*3CC PPFFOOAA ProsPFBS jiPFHS Fos PFOS EExxvyggeennIInnvveennttoorryyNNoo.. mimes SP0005444 SSPP00000044118844 Swos SP0005726 Sooo SP0002401 Tost SP0002694 ~~ LLoott ## Gn203 33550077--119955 ao101 ses SE036 sow 430180/1 PPuurriityty((%%)) ExEpxipriarattiioonnDDaattee heed Bam 99 03/31/07 9977 0033//2299//0099 ser ioe 96.7 12/04/06 be loses 98.6 10/18/06 wiz lovey 101.2 10/31/07 "TThheemmoloelceuculalarrstsrtruuccttuurreess ooffPPFFOOAA,, t"3'CC PPFFOOAA,, PPFFBBSS,, PPFFHHSSaanndd PPFFOOSSarareeggiivenvoonenttnhhee Bikini following pages: on PFOA [ ---- Chemical Name: Perfluorooctanoic acid M Mooleleccuullaarr WWeiegighth:t: 441144 "TTrraannssiittiioonnss M Moonintitoorre~dt:: 441133 ----> 336699 ((ffoorr qquuaannttiiffiiccaattiioonn)) aanndd. 135305 or contin 413 --> 219 (for confirmation) Smee Structure: riPeofreoEle F F H pS rN iNrITN F F F F C IsC PPFFOOAA a. 1-13C peneid Chemical Name: 1,2-13C perfluorooctanoic acid Nima weg 16 Molecular Weight: 416 Eon Ress Exygen Research f-- Page 14 of 130 22009955..00445588 33MMAA0011555522223355 bn oeimGss Interim Report #6 - Analysis ofCottage Grove Fish Samples iD Exygen Study No.: P0001400 frmTransition Monitored: 415 --~ 370 Structure: SRL F F F F F|F/F| I FLIFLF | ; o " es on # F F msPF~S BSeVrIetnamnions ms crs Chemical Name: Perfluombutanesulfonate Molecular Weight: 338 supplied as the potassium salt (C4F9SO3-K+) EN Transitions Monitored: 299 ~ 99 hives Structure: ror Ler F F F NNrelTe F F F osPFItS Bim eters `MMCohloeelmeccuiucllaaalrrNWWaemeiiggeh:htt::Pe44r33fl88usosumuppphplelixieeaddnaeassstuthlhfeeopnpoaottteaassssiiuumm ssaalltt ((CC.~FFlssSSOO53KK"+)) RN Transitions Monitored: 399 ~ 80 meStructure: {F F F |F|F|F _ SH F~S03 F F F Brosee reemin PFOS MoCMlheoetcmeueilucalaalrrWNWeaimegigeh:htt::Pe55rf33l88usosurupoppoplclitiaeenddaeasssutlthfhoeenppoaoltetaassssiiuummsasalltt ((CCssFFI1T1SSO03y-KK"+)) Transitions Monitored: 499 --> 80 = Structure: sens Exygen Research ear Page 15 of 130 22009955..00445599 33MMAA0011555522223366 -_ sens acs Interim Report #6 = Analysis of Cottage Grove Fish Samples aExygen Study No.: P0001400 " F F F F |F|F|F|F _ F F~03 F F F F 66..00 DDEESSCCRRIIPPTTIIOONN OOFF AANNAALLYYTTIICCAALL MMEETTHHOODD Sp The analytical method "V0001783: Method of Analysis for the Determination of PPeerrfflluuoorrooooccttaanncoiiec AAcciidd ((PPFFOOAA)) iinn FFiisshh aanndd CCllaammss bbyy LLCC//MMSS/iMMSS"" wwaass uusseedd ffoorr tthhiiss ssttuuddyy.. eta 6.1 Extraction Procedure for Fish or ogee 6.1.1 Sample Preparation SL EA Ts TST Before the samples could be weighed for the extraction, they had to be am ts processed. To process, the frozen samples were placed into a food processor CEI nee and homogenized with dry iee. The samples were Iransferred to one-gallon Ea Ziploc bags and placed in frozen storage with bag left open to allow the dry ice EAT tfforrooszzueebnnlissmttooerr.aaggeAe uuftnnettriillsttuiibmmlieemooafftaianonanla,ylytshsiiess..saSSmaapmmlpepllbeepaprgrosoccweesessrsieinngsgreearelcecodorrddasnsadarrrceemllooacciaantteeeddd iiinnn FREE Ts the Sample Information section of the raw data package. 42 Bases 6,1.2 Glassware Preparation ee seiy s ee The 125 rrlL pear-shaped flasks w~re silard~ed by first rinsing the flask with 3300%% ddiimmeetthhyyllddiicchhlloorroossiillaannee iinn ttoolluueennee ssoolluuttiioonn.. TThhee ffllaasskkss wweerree rriinnsseedd oonnccee TREAT with toluene followed by three rinses with methanol. The fl~sks were allowed BE to air dry before use. 143 Chom 6.1.3 Column Preparation SST ---- The 20 mL columns were packed at Exygen in sequence with 2 grams florisil, 2 grams silica gel, 2 grams of carbon, and 1 gram LC-NH2. The eoltmms were SE raTrm ccoonnddiittiioonneedd oonn tthhee ddaayy oofefxetxrtaraccttiioonn wwiitthh 2200 mmLLooff mmeetthhaannoollffoolllloowweeddbbyy 2200 mL of acetonitrile. All washes were discarded. These clean-up columrus were ST EERE uusseeddttoorreemmoovveemamtartriixxiinntteerrffeerreenncceeaannddnnoottttoorreettaaiinnPPFFOOAAaanndd ~C3C PPFFOOAA.. tn Additional details about the coltmm packing mateitals can be found in the raw SH data package associated with this report. Exygen Research ror Page 16of130 22009955..00446600 33MMAA0011555522223377 _--_--mm IInntteerriimm RReporet##66-p-AAnanlaoylyssiissooffCCootttaaggee GGrroovvee FFiisshh SSaammpplleess EExxyyggeenn SSttuadyy NNoo..: PP0O0O0O114A0000 66..11..44. SSaammppllee EExxttrraaccttiioonn uAAb5Se-fgoorarrmtah*eppooerxrtttiiroaoncnotiofofn.ffiisshhAssafammpplfloeertwwiafasiscawwteieioinggohhfeeddapinnpttrooopaariitiaffttyye-mmsiaimllplillleiitse,r cc3ee0nnmttrrLiiffuouggfee aawtuceiebetestoonnfiaoitctrrrtiiitllhoeenewwseaahxssatrkaaaedcrfddtieooddnr.too~et1hAtd5hefetmessiraanmmufptoplerelstesi.fs.i.caTTTthhihoeeensssaoaammmfpppallpleeepsssrwowwepeerrrrieeaeataepllllsoaawclmeedpodlnettowost,soshe3haa0adkkfmeereLooenzneo3raf pwffroorerriispt~-i11taacttbhieooo.unurr.Ts.hheaFFkrrseeearcemzzfpiionlnreggs~1oow5fefrmetihhieencuetnsseaatsmmi. puplgTleeehssdefaaosllrallmo~owpw1lee0eddsmiwtthnheueerteeffspaattlassatce2aadnn0dd0in0tpporrpooamttee.fiirnnesseTzht1eoe0r t`hpssureueppceseimpmiaatltataatenn.tatwwpTaeahnsasetrthsshiaehemnnazppllloeoeaadseddfweelddeadosroeknn.tctoTehtnthhtereeeicflcuouongandetdidetiwtfiioaoornns-eec1ddo0lcclllmeeecaaitnnne-u-uduteppnsccaootthllu-u2msm0lnna0n0ffiiitrzteepeddmdpi.inenssTaiirdhd-eee smtshhhieaalppsleeielddarrffdsllazasseokkdf.. paTTceheahtiriossnpsihprtaroropiccleeeedsswssflararseeskmma.oodvvdTeeehdddetttheholeutfafhaatetetssswaaananmdspdlcppeorrsloolteelecieitnntessdiffnirnotmhterhtethcheesenoieltexartxnirtifmarzuacegtcde.t.ptuTeTbaeeernn.TmTshehiceleolnirrldeistm.eerasimnToihfnaegascisteaastmmosnupnpmilitierizilineennrtwtghhweaeassttuaurbdbieedneswwdeaadtssowhhitoohtmmheootsggaeemennnipmizzlieeelsddlluueesfritnssignaoatfthitseaisscscuenuetmmnoitnzirgtzieiferulrgeff.eoorrtuT~~bh33ee00. wtrrsiiiennscssoteenwawdcasta.sisoanaTdddhsdheeeaddtktiestoosrtuthfmhoeeirzassenaarommwtpphlaleesertrtubin1be0sem.e.idTnTuhwtheieetshss.aatmemTpnlphelmeessislwlwieleirtraeeerasalllmolwoofewwareepededetpto0lolnssichstrheaiadelkeike.enoosoTnnha3ea ~wffrr2ere0iees0zzt0eearrfpcftomoiro.rn~~11sThhahheokoueusrrru..pfeoTTmrhhaeaetsnasoanatmtmhpewplralees1ss0wtwhemerenirelneouatccedeesnen.tdtrroiiTfnfuhutgegoeedsdtahmaaeggpaasliieannsmfefoworcer~lr~ee1a1p0n0-laummcpieindcnuoutlitneeutsmsonaa.att -TTw2ahh0see0heee0llduuraapwttmeiet.wwhaTas2sh0eccosmoullLlpeleccomttefddataaciinnentttooownittathhrseeilthess,aeamnmceoelpolleapedeaceatrdri-nssoghhnaattppoheeetddhweffallsasaasshkmk..iencTTlthheheaeencc-puooeplalurucm-mosnnlhuawlwpnaeansds. wffflluaaasssskkkhs...edAAppwTpphrirtoehoxxis2imam0amatpmteleleLlysy 3o3wofeorraec44eetddovrrnooaippptsrsoiorloefaf,e11dc--oooculcltsetaaicnnntogionllwgawartashosetaaaddrwyddaeeseddhvtatoopinottrhhtaeehteeeoxxrtptrreaaataccrtrt-sseihdinnautpctheheddee ppsfrloraeelsssvksseusunr.tree.e.TvaTThphheoeerastaIle-m-odo.pccltteaTasnnwoowoll ehhmreeeilllddelvttehahrpeesoaoarannfatael2ldyy%tteeusssaisniicnngortthabhieeprcoepateacaarirrdy.-issnhehvaampapepeetoddhraaffntlloaoasrslkkawtwwahsrhieiladleedudctteehhddee 1tts0oohelttvhhseeanfmtflplaealsvsekka.ssptotoTormahtmaeedaks.keaeTmfwfpiilonneaamllvwvioalollsiluluimttmeerr.eas.nsoTTffheh2ere%feldflaaatsssockkowawrabHasicsPswLaswicCiridrlvleieindadlmttouedstdiihsinassgnsoooalllvvdweeisasanspnoddasmdamdbielixxed tpphiippeeetst..aEmEapaclcehh.ssaaTmmhppelleesawwmaapssleaannwaallayyszzeet~ddabbrmyy fLLoCrOre/MMdSStIo/MMaSSI-eeIPlleeLccCttrroovssipparrlaayyu..sing a disposable "(*CDOuD0e6tt7uoo5l3laae,cckk00oo0ff9ss6aa7mm5pp5lle,e,,Ca0o0on9n6ee7--g5g8rra,ammCppOoo0tr9tiiGoon7n1ooff-ssaaCmmOpOpl9lee6ss7CC880w0Oe9r607e39u5s~e-d6C.CO0U7A0Sl9Gl367o7335e99,r, CCsOa0Dm09p96l6eT7sS500w,e, re wwCe0eii0gg9hh6ee7dd5oo3uu,ttCii0nn05-9-g6g77r5aam5m, porions. C0096758, portions. C0096781 - C0096788 were used. All other samples were 66.22 PPrreeppaarraattiioonnooff SSttaannddaarrddss aanndd FFoorrttiiffiiccaattiioonn SSoolluuttiioonnss AAata mcmoiinxxceeeddntsstrtooacctkkisostntaaonnfdd1aa0rrdd0s0osolulgut/tiiomonLnobofyfPPdFFiOsOoAAl,,vi1"n3CCg PP10FF0OOAm A,,oPPfFFg BBaSSc,,hPPoFFfHHthSSeaasnntddanPPdFFaOOrSSd (wwcoasrsrppercreetpepadarrefeoddr p2patuu1rari0ttc0yyonicgaaeinnnmddLtr.atfisoosraantlkitofifc1acc0tooi0nno0ttneeIsnn~tt,g,a/nmdaLiirffbdysnndoeelicscuesetsosisslovaanrirnyyw)g)as10pii0nrnempagmmreoeetdfthheabanaynocloht.la.okfitnhge 1FsF0trraomnomdmLaordftstthhh(iicsseorsrestsoocolctleuuktdtiiaoofnnond,r, babforrrii1ntn0igg0fiiinnc~gagttgitt/ohmhneeLsvvtfooaonllrudtuimamfrieecdauutaippnodnttoobstrai11nn00dg00airnmmdgLLstohwwelmiitvtihhoolnmmuewmetetahhsaaunnpoporlel,t.poarB1Be0ydy0 baykitankgin1g0 tamkLingwi1t0h 1m0LmLofotfhethe10s0tocpkg/amnLd. mmeLthaonfolth,e210100 p~gtg//mmLL. afffnooordrrtttbiiifffiiiicccaanatttiigiooonnin tnssshtttageaannnvdddoaaalrrrddudmwwaeanaussdpppbrrree0ipp1naag0rreie0ndd.gm. LthBBeywyivtttaoahkkluiimnmnegget11h0u0apmmntLoLoaloo,11ff0.t0t0hhepemg11L/00mwL~ptigfgto/h/mrmtmLLifeifftcooharratttiinifofoiniclc,asatttaiiaoonnn1d0assrtta~dantngwdd/eaamrrrLedd and bringing the volume up to 100 mL with methanol, a 1.0 lzg/mL fortification standard were EExxyyggeenn RReesseeaarcchh PPaaggee 1177o0f113300 22009955..00446611 I3MMAA0011555522223388 Intsim Report #6 - AnalysisofCotiage Grove Fis Supls Exygen Study No: FO001400 Interim Report #6 - Analysis of Cottage Grove Fish Samples Exygen Study No.: P0001400 p4prrpeeppta0arre1ed0d.0. BmByLytatwakikitinhnggme11t00hmamnLoLlo,offa0tthh.ee1 11g../00mg~Lt.gm/mforLtfifoforicrtatiitffiiioccnaattsiiotoannnssdttaaarnndddwaaarrddsaanpndrdbeprbairrinengdg.iinnggBtytheetvavkoiolnluugmm1e0e mummepLLtthoaoonfft1o0lthh0,eem000L...110w1pIi~tpghg/g/m/mmLmL.eLthfffaooornrrttotiiiflf,ificicacaaatt0tiio.io1onnn~sssttttgaaa/nmnndddLaaarrrfdddorwaateinnfrddiecabbptrrrioieinpnngagriisnetndagg.ndtthhaeerdvvwooallusummpeerepuuapprettdoo. 100By 100 mL. with taking 10 mL with methanol, a 0.01 lag/mL fortification standard were prepared. 0. pginL for spiking purposes. Complete details can be found in the raw daia package AAnn aaddddiittiioonnaall ssttoocckk ssoolluuttiioonnooff ~'3CCPPFFOOAA wwaass pprreeppaarreedd aatt 110000 ppgg//mmLL aanndddidliluutteeddttoo 11.0 .a0 nandd 0.1 Ixg/mL for spiking purposes. Complete details can be found in the raw data package aassssoocciiaatteedd wwiitthh tthhiiss ssttuuddyy.. prepared in methanol. The following concentrations AAsesett ooffnnoonn--eexxttrraacctteeddssttaannddaarrddss ccoonnttaaiinniinngg PPFFOOAA,, prepared in methanol. The following concentrations were prepared: 'C 13C PPFFOOAA,, PPFFBBSS,, were prepared: PPFFHHSSaannddPPFFOOSS wweerree "CCoonSneoel.owofifoFFnoort VVo(olmluuLm)mee Solution m1L0)' (~gm~)I (mL) 50 ~111..00o0 2251..50o5 00001.00.20555 111100.00 0000...0000201155 11110000 0.005 10 ! ooff PPFFOOAA aanndd ~"3CC PPFFOOAA FFiinnaall VV5oo)lluummee (mL) 1~00o00o 101I1000%00 11I1O00%000 111000000 CFFailinniaablrl aCCtoioonnnee.Stoodff Cali(burga/timoln)Std. (~000'0r.00n2555~) 0000.0.000021155 0000.000.00000221555 000...00000000155 "The stock standard solution and all fortification and calibration standard solutions were toed The stock standard solution and all fortification and calibration standard solutions were stored iinn aa rreeffrriiggeerraattoorr ((44 +-+ 22CC)) wwhheenn nnoott iinn uussee.. DDooccuummenetnatattiioonn ooffssttaannddaarrdd pprreeppaarraattiioonn iiss llooccaatteedd. inthe rau dats package asociated with tis ner report. in the raw data package associated with this interim report. 63 Chromatography 6.3 Chromatography QQuuaantnitiffiiccaattiioonn ooff PPFFOOAA,, PPFFBBSS,, PPFFIH-ISS aanndd PPFFOOSS wwaass aaccccoommpplliisshheedd bbyy LLCC//MMSS//MMSS eclleeccttrroosspprraayy.. TThhee rreetteennttiioonn ttiimmee ooffPPFFOOAA,, PPFFBBSS,, PPFFIH-ISS aanndd PPFFOOSSwwaass~-1I11 rmaiinn,, ~-22..55 rmaiinnss,, 259 mins, and 11.4 mins, respectively. Peaks above the LOD were ol detected in ay of -8.9 rains, and ~11.4 mins, respectively. Peaks above the LeD were not detected in any of {he contro blank samples comesponding othe analyte retention time. the control blank samples corresponding to the analyte retention time. 66.44 IInnssttrruammeenntt SSeennssiittiivviittyy "TThhee ssmmaalllleesstt ssttaannddaarrdd aammooxunntt ninejecctteedd dduurriinngg the the chromatographic chromatographic un run had had a a concentration concentration of of 00..55 n ng/mgLo/ offPPmFFOOLAA,, PPFFBBSS,, PPFFHHSS,, PPFFOOSS aanndd '13CC PPFFOOAA.. EExxyyggeennRReesseeaarcchh PPaaggee 11880o1f113300 22009955..00446622 33MMAA0011555522223399 InItneterriimmRReeppoorrtt##66 -- AAnnaallyyssiissooffCCoottttaaggeeGGrroovveeFFiisshh SSaammpplleess. ExEyxyggeenn SSttuuddyy NNoo..::PP00000011440000 66..55 Instrument: APY 4000Biomolecle Mess Ansyzer DDeessccrriippttiioonnooff LLCC//MMSS//MMSS IInnssttrruummeenntt aanndd OOppeerraattiinngg CCoonnddititiioonnss IInntsetrrufamcee:nt: TAuPb14o0l0o0nBSipormayolLeicquuliadr nMraosdsuAcntaolynzterrfce ICnotmeprufatceer:: DTuErLbLoOIpounPSlperaxyGLXi4qu0i0d Introduction Interface Computer: DELL OptiPlex GX400 SSoofftwwaarree:: WinNdT,oAnwalysst 141 Windows NT, Analyst 1.4.1 HI-PILPLCC:: Hewlen Packard (HP) Seres 1100 Hewlett Packard (HP) Series 1100 EPHHPI' QQVuauacatut PPuumummDppegasser EPI-tP vAuacousuammplDeergasser HPI-IP tip Column Oven Autosampler Colunm Oven HHPPLLCCCColoulummnn::TThheerrmmooFFlulophoasepRRP.P,h, 5300ammnmsxxe22..1 rmmm MICICnnooojjbleleiucuslmtmiieoonnnnPTThVVeaeomosmpLle..:p::(.:A11)553:3~s00tL2LCCmM Ammonium Acetate in water MMMooobbbiiillleee PPPhhhaaassseee ():(A): (B): Methanol 2 mM Ammonium Methanol Acetate in water T00m Time (rain) %%&AA %#3s8B 0811.0.000 2&6655 3733s55 1118001.0.090 222655 7377s555 1115.00 o6s5 33s5 18.0 65 35 FTTlooomtwailRrrauutnnett:iimn0ee:3: m-~118i8 rmnaiinn Tons monitored: Flow Rate: 0.3 mL/min Ions monitored: AnAsniavlyetee PFOA PFOA PPFFOOAA CCoonnffiirrmm Ifoonn ~B3CC PPFFOOAA PrBS PFBS PRES PFHS PFOS PFOS MMooddee nneeggaattiivvee nengegatatiivvee nengegatatiivvee. negaive negative wegaive negative regaive negative TMToronamintssiotorioennd 413 369 Monitored 413 --~ 369 441133-54221199 44121595 59~539377900 234399999999--55-~~88980090 499 --~ 80 RetAAepppnpriroooxxniimmTaaittmee e Ret<en~ 12tiom)ninT.ime -11 rain. ~~1111 mrainin.. ~-1111 mrianin.. 25min. ~2.5 rain. "89min -8.9 min. ~tlmin -11.4 rnin. 66.66 QQuuaanntitittaattiioonn asnadd EExxaammppllee CCaallccuullaattiioonn ExExyyggenn RReesseeaarcchh PPaaggee11990o7f113300 22009955..00446633 33MMAA0011555522224400 ---- -- ---- TT ------------ Interim Report #6 AnalysisofCotuage Grove Fish Samples Interim Report #6 - Analysis of Cottage Grove Fish Samples Exygen Study No. POO1400 Exygen Study No.: P0001400 pFFeiiaffktteeaeernnemmaiciwcramolsliimtteecrrasssuoorffessdaamampnpldleetohorercsactlaailinbbrdraaatrtiidoocnnussrttvaaenndwdaaarrsddgwweencrre~eraiitnnejjeedcc(ttueesddiniinngttoo UttxhhefeiLLt CwCe//MiMgSSh//tMMeSdSl..inTTehahere drpreeeeggtarrekeerssmassiriienooaennd))wfbbaryysoAAmmntnaehalaelysysusetrtqeussdaootffaittnwowdnaasrrteehbeeuulsssoiitwnan.gngdssaiirxxdcccoounncrcveenenttwrraaattsiioognnessonoefrfassttteaadnndd(aaurrsddisns..g TT1h/hxeefcciotonnwcceeeningtarh'ataettidioonnlinwweaaassr determined from the equations below. sEEtqqauunaadttaiiroodnnc11urccvaaellcc(uullilaanetteaerddretthghreeeaasmmsiooouunnpntatorofaafmneaatnleayrlystt)ee gffeoonuuennrddat((eiindn bnnygg//tmmheLL,A,nbbaaalssyeesddt oosnnofpptweeaaarkkeaaprrreeoaag))ruuasmsii.nngg tthhee standard curve (linear rggr~sion parameters) generated by the Analyst software program. `EEqquuaatitoino11n:: AAnnaallyytteffoouunndd ((nngg//mmLL)) ==((PPeeaakkasarlreoeapae.- iinnttecrrcceqpatt)) xx DDFF slope `WWhheerree:: DDFF == DDiilluuttiioonn FFaaccttoorr,, ffacatorcbbyytwwhohiicrchh tthhee ffiinnaall vvoolluummee wwaass ddiilluutteedd,,iiffnneecceessssaarryy.. EqwEeuqiaugtahitti)oo.nn 22 wwaassuusseeddttoococnovnevrertttthheeaammoouunnttooffananaallyytteffoouunnddiinnnngg//mmLLttoonngg//gg((ppppbb,, wweett weight). EEqquuaat`tioAinnaol22n:y:tefound(ppb,wetweight) = [Analytefound (ng/mL) xfinal volume (2 mL)] Analyte found (ppb, wet weight) = `sample [Anal~ found sample (wwneegii/ggmhhLtt )((55x 8final g)* volume (2 mL)] *OOnneeggrraamm ffoorrssaampmlespffoolrrwwhekiicschh 1lgg wasusedfor was used for extraction. extraction. For samples fortified with known amountsofanalyteprirtoextraction, Equatio3n was used Fttooocrcaasllaccmuullpaatlteeestthfhoeerpptieefrrieccedennwtt rirteehccookvvneerorywy..n mounts of analyte prior to extraction, Equation 3 was used `EEqquuataitonio33:n: RRececoovveerryy((%%)) ==((aannaalNytteeffoouunnaddmo(r(uignn/tg)ag-d-sd/aneandlgayl(t~)neegi/isnn)ccoonnttrrooll ((ng~/g))) xx110000%% amount added (ng/g) p`NNrooittmee:a:FrFoyrofritethlhdeesaaannmaaplllyyett.ee rreeccoovveerryy calculation, calculation, the the "control" "control" s is the the unspiked unspiked aliquotofthe aliquot of the primary field sample. AAnn eexxaammppllee ooffaa ccaallccuullaattiioonn using using an an actual actual sample sample follows: follows: EBxxyyggeenn RReesseeaarrcchh PPaaggee 22000o6f113300 22009955..00446644 33MMAA0011555522224411 trim !nterimRReeppoor:t##66 -- AnaallyyssiissooffCCooattaggeeGGrroovvee FFiisshh SSaammpplleess EExxyyggeenn Sty Study NNoos.: PPO0O0O0L1A4D00) FPFiiFsshOh Assaawmmhpeprlleee: EExxyyggeenn IIDD CC00009966669955 SSppkk DD ((SSeett:: 1100118800554A)),, ffoorrtiiffiieedd aatt 110000 gngg/g wwiitthh PFOA where: pienptaeeakrkcaaerrpeetaa === sldsinilooltpeupetrecioenptfactor ==== nandggmil/t/uggitinaaoncnnaoalfnyaletcyestopaaroddndddeeiddnf(gfoorsrtatmleepvvleeell))(gl) ==== fiafsinmanamatlplivlnvoeocllwouuremmreieesgp((mohm@nLLtd))ing sample (ng/g) --== sample weight (g) = 7rm4a208m92s6 22709922100000000 0110.008008 0.808 322 5 FFrroomm eeqquuaattiioonn 11:: AnAanlayltyeteffoouunndd ((nngg//mmLL)) FFrroommAneeaqqluuyaatttiifooonnun22:d: ng/g (ppb,wetweigh) Analyte found ng/g (ppb, wet weight) From From eeqquuaattiioonn433R::ecov ery % Recovery = [[47248289292926260=-0207991100001] xx 1100 292000 =- 225522nngg/mmLL. =@(2S522nng~/mmsLLsx22mmlL)) 5g = 101 nglg pb) == ((110011 nng1~ /0g0--n00g.8g80088nngg/g)0 x 110000%% 100 ng/g =- 110000%% 77..00 EEXXPPEERRIIMMEENNTTAALL DDEESSIIGGNN s*C~aCmpPPleFFsOOiAAn twwhaaessluaubssoeerddataaossryaaasfstuuermrroohggeaattesaffmooprrlaaellsll wtthheeeressaawmmepilpeglesh.se,d"tf3oCC PPeFxFtOOraAActiwwoanas.s aaFddoddreeddfisttoho stthaheempffliiesshsh kdsdaeenmssoiipwgglnnneaasttceeoiddnnacateshnetllaralbabatoobirrooaarnttaootrrtoyyorymmthaaaetlttriesixxramtssphpileikekesseassmiPnPpFFtlOOehsAeA,w,laePPbrFFoeBrBaSwSt,oe,riPPgyFFhaIHe-fdSItSe,,rfoaatrnnhddeexPPstrFaFamOcOptSSiloenwws.eerwreeeFroaaerllssfowoiesaahiddgddsheaeemdddapalfteoaasr extraction known concentration extraction. to the samples in the laboratory after the samples were weighed for sTTheheeiffniicsslhhudsseaadmmppollneeess wwcoeenrrteeroeelxxttirraascchtteemddatiinrnicexiiggbhhlttaecneeknn asseentsds,,tfiwivvoee coooffnwtwhrohilicchhfwisweherrmeerareet--exxbttrlaarcnatkisotnisfsoeoerstnis..feEEdaaccahht kksenntoowiwnnnclccuoodnnecdceennotrtnraeattiicooonnsns.t.roTTl hhfeeishffiirrmssttaletrleiexvveebnnlassneekttss aoonffdffiitsswhhoccoocnnottnaatiirnnoeeldd ffifsiivhvee mssaaammtrpiplxleesbslaeeanacckhhs.. Set lve fortified at Set twelve ExEyxyggeennRReesseeaarrcchh PPaaggee 2211 0o1f 113300 22009955..00446655 I3MMAA0011555522224422 tmRep#6o-AnralytsisofCouageGroveFish Samples Interim Report #6 - Analysis of Cottage G-rove Fish Samples Exygen Sudy No. PODOLAOO E~ygea Study No.: P0001400 ccroeon-ntetaxaitirnnaeecddtfifooonuurfsosraamompnpleleesssaamanpndlde.seettSttehhiitrrtt1ee7eenn-1cc8oonncitoaaniiannieedndtetidhrrteeheessaramemp-pllexestsa..ctSSeeedttssa1n14d4--c11o66mpceoaasccihhtcceoodnntstaaaiminpenldee&sda rtethhexaa-ttterxawwtce~rtairrcoeetnisooorrniifggofiironnraatllohllnryyeeennsooatsmarrpmeelpppeloo.errsttSeeeddatnsddduu1ce7e-ftx1oot8rqqauuccaaotlliniiotttnayyinocceoofdnnttttrrhwooelol rffecaa-oiiellmuxuprrteoer..saicttSSeeeedttasssaneemdvvpeelcnneosttm.eepeeonnsiccSotoennetttdaaeiisinnageemhddptlefmeeo-sncecxootnnrttaaaciitnnieeoddnseexxttfreoaarcctttiihoornnesseffoosrafmfoopuulrresccoomampnpodsoisetxietrssaaacmmtppilloeenss..of two composite samples. Set eighteen AcAaccccchuurrsaaaccmiipeelssew.wereTreeheaarssesseewssesseredodftfoowrroaelacachhbrssaaatmmaprplyleesbbpyiyrkreeevrveiiecwoeviwenrigytnthrhgeeesuiilntdnsivadidivuavlaiQOCCidrforeulecasaualalcltsshbosobabltmtaapiielnneeeddtffhoaotrr wsweeaaercmrhepeulsuseasemedtdph1alte0to. aawTssesshreeeessrssetathwlhseeeoaracecuctcsuwuerrdaoaccyltya.ob. oaTTrsahhcteoesrrrseey wswtpeheirerkeeeaffcroecouucurroaviicnneyddr.yiivvriieddIsuunuaallltcs~a"3as"CCevsaPPilFFwaOhbOelAAerefrroeerctcoheoeavvceehsrrayymsrrpaeelmsseuup.lllttessletpphveeealrrt nsssaioiggmtnipfbiflieieccaacntnahtltlalcyytuleeawxxteeccrdseeeeaddnaeedlddsoasssppusiikeskseiinsndgegdtlloeeavvceeacllsusr((e>a>scsy33twthtiaiemmseeassbcacttshuaeerdacssopypii.nkkii'nnIgCgn llPeecvvaFeesOlle),sA, aawrccecchcuueorrrvaaeettreeyt.hrreeeccToowsvvaeemearriipieeylsseoccflooeuuvtlhleddel nscsiiooxxmtttpyybo--etutwnwcodoa.lsscaaummlaUpptlpeleeodssnassnuucdbblimmeainistttstteeersddesfeqfodouerasaantcnacaluslyryasasmicipssyleddwsiiddasCnnOoobtDta9smme6ede7ee3ot0nqquu--a~alalCiCittOyyPUFccDooOGnnTAttr3oo2lrlecccwrroeiivttreeeerrriiyaar.effT-ooerrwxaatettanlctlyeieeasdosttfaoantnnhedee caamonnaamasllsypyzozdeeuuddndfft.ooorr tPPUhFFepBBosSSinzeoaafcnntlddiehn~"t3eCCrePiPqnFFduOOievAsAit.d,.uasIIlannmiisttpipiaaelllecsrriemesCesun0ulst0ss9cff6drr7ono3mmo0taa-nnmaaelClsyy0tss0eePss9o6Fof7Of3sAs2aammswppplielekreeessrewrweici-totehhvxetllroroawywcctesrsdaatmmrpaipnlalede. r`mCeCoaoannnsasssleeydqqsuuiuesee.nnttotllyySt,,ahmeccpooslmmiepzpesoosoCsiifOtteeDth9ess6aa7immn3pdp5lileve--sisduwCwa0eel0rr9eesp6pp7errc3eei9mpp,aaerrCneeOsddOdff9irr6doo7mnm5o0ttt,hhmeeCerOr~eeOmtm9Pa6aiF7inn5Oii3nnA,gg sCttpiOisisUsks9ueu6eer7ehh5cooSomm,vooegCrgeOyen0nca9arl6ittce7e5rffi5ooa,rr. rrC(eeC0acO0nx09ta9rl66ya77sc88iis11e. d-- SCCaaOn0m0d09p96la6e7n7sa88l8C8yw0zwee0edr9re6ecf7ooc3ro5mmbP-ibFinCOnee0Add09nian6tnto7do3gg9r'r,ooCuCupp0sPs,0F,9bOb6aaA7ss5.ee0dd,ooCFnnos0rsa0a9mtm6ph7pel5lee3esx,staitCecet0aa0nng9drd6of7fuii5pssih5hsn,psgpeCsc,e0ic0eise9ses6,c,a7a5tnnh8dde, crceo-rerxoetsrpaocenteddesnacnesdpseecactnitoioaonlnyozonfefdtthhdefeoamr wewPdFdaOanaAtappacaacnckdkaaegg~e3eC.. PFOA. For the exact groupings, see the 88..00 RREESSUULLTTSS Analytical resultsand ascsscd accuraciesforthe analysisofPFOA, BFBS, PFS, and PFOS infish samrpe sulmmaerizsedin Table. Analytical results and assessed accuracies for in fish samples are summarized in Table I. the analysis ofPFOA, PFBS, PFHS, and PFOS TFFoaorbrttliieffiisccaaIttTiiooannnrrdeeccIooLvv.eerriiTeehsseffooarrvPPerFFsOOgAAe,,pePPrFFcBBeSnSt,, rPPeFFcHoHvSSeraainnesdd +PPFFsOOaSSnidiannrtdthhedeffviisishahtssiaomnapflmeorsaPparrFeedOledAte,eataiilPlseeFddSii,nn PHTPreFasSbHpelSectsaianvHneddlya.PPnFFdOFOoSISrHitiin.fnitcTthahhteiefofinaissvrhheesrscaaagommevplrppeileessrswcfeweonrretreCerec995o5PvF+e_rOi11eA66s%%i+,n, 7st7t6h6aen_2df+ias11rhd4s%adm,e4 p9v9li99eatsi+%oa8rn8%es%f,doaaernntaPddiFl11eO0dA0i&,0n+PT22Fa0%2Bb%lS,e,, rIwIeVVe.sr.peeTTc9ht3hieveaeva1lyve9.e.rraaFggoeerptpiefericrccaeetnintotnrrereccoeovveecrireiesos+fsovstrtaatnne3ddCaarrrPddFdeOdiveAivaietainitioostnhnes forfish for "C PFOAin the fishsamples samples are detailed in Table t3C PFOA in the fish samples were 93 + 19. Analytical resuls fo the analysis of PFOA and PFS in the re-extactd fish samples are summarized in Table V. Analytical results for the summarized in Table V. analysis of PFOA and PFBS in the m-extracted fish samples axe TFFoaorbrttliieffiiccVaaItt.iioonnThrreeeccooavvveeerrriiaeegsseffpooerrrcPPeFFnOtOAArecaaonnvdderPPieFFsBSSstiinannttdhhaeerrrdee--decexxvtitrraaatccittoeendds iffiossrhhPssFaamOmpAplleeassnaadxreePFddeBettSaaiilileneddthiinen TrrFeooa-rcebtxxiltfetrimacVeacttItee.ioddnTfhfriieesschhoavvesseraarimamegpspleleefpssoerrwwc"eeeCnrretePreF11c11Oo11Avie++rniets11h115e%:%srtea((-nn1e=dx-t11ar2r2ad))ctdeaaednnvddifaits88iho55nssa+mfpo66lr2e2P%s%aFrO(e(Annd==e3a3t)n)a,,dilrrPeeeFdssippBeneSccttTiiinavvebetlllhyyee.. VFVfioIIsIrLh.tsifaiTTcmhahpetleieoassnvvweererreaarcggoeeev9e9ppr:eei2rerccsee1nfn7ottr%rreet2ccCoovvePerFriiOeessA_+inssttatahnneddaarrredd-eddxeetvvraiiactttiieoodnnssfisffohorrs~Xa3mCCpPPleFFsOOaAAreiindnettthhaeeilerrdee--eienxxttTraaaccbtteelded fish samples were 99 17%. Exyaen Reseach Exygen Research PaPaggee22220o1f113300 22009955..00446666 I3MMAA0011555522224433 InIntteerriimmRRepepoorrtt##66 -- AAnnalaylyssiiss ooffCCottaogeGGrtorovveeFaFisishhgSSaammpelpleess Exygen Study No. POOOIA00 Exygen Study No.: P0001400 99..00 CCOONNCCLLUUSSIIOONNS Ta`TchhceeorffidissihhngssaatmmoppllaeenssalwwyteeirrceealssuucmccecetesshssoffduullllVyyOeeOxxOttLrraa7cc8tt3ee.dd aannTddheaarnneaallyywzzeeerdde ffonorroPPcFFiOOrAcAu,,mPsPtFFaBBnScS,e,sPPFFtHhHaSSt aanndd PPFFOOSS may have affectedthedata quality orintegrity. according to analytical method V0001783. affected the data quality or integrity. There were no circumstances that may have 1100..00 R RETE ENTT IONE OOFFDDN AATTAAT AANNI DDSSAAO MMPPLN LEESS AbAlelllsoohrriiipggpiinneaadllptpaoappteehrreddasatttuaadyggeednnieerreraacttteoerdd. bbyyTEhEixxsyyggdeeonnesRReenssoeetaarriccnhhclttuhhdaeat ppfeearcrttiaaliitnnyss-sttpooecttihhfiiissciinrntaeewrriimdmatrreaepposorurtcthwwiaillsll biiinnneststetsrrrahiurimpmnepeannentdtaooytrottiteetahmmlepperesrertapuatotduurytrreedallinoroedggcsst.a.ollrEE. xoxraaTiccgthtiincscaooldppioifeeeasscsioolnfiafotlatyll-lisnrprcaealwcwufdiddceaattrfaaaa,,cwaaislsiwdtwayet-leas,llplewaacisilaflaibcsseiirgagrnwneeetddadciacontoapepdyysouiofcnfhttthhaheees PEiEnrxxatyeycgrgtiieemcnne aRSRnteeaasslneeydaatarricrccadhhls aa4rrre0ccphhCoiivrFvteeRssan7ffdo9o2rr.attlhhleeopprieegrriiinooaddl ooffafctiiilmmiteye-ssspppeeeccciiifffiiiceeddraiinwn EPAdata, EPA TTwSSiCCllAAbGeGooroeodtdaiLLnaeabdbooriarnatototrhryye. Practice Standards 40 CFR 792. EExuyggeenn RReesseeaarcchh 22009955..00446677 PPaaggee 22330off 113300 33MMAA0011555522224444 Interim Interim Report Report #6 #6 - - Analysis Analysis ofCotage of Cottage Grove Grove Fish Fish Sarples Samples ~~ EExxyyggeenn SSttuuddyy NNoo..:: PP0O0O0O1I440000 TABLES Bxygen Research, Exygen Research 22009955..00446688 PaPgagee22440off113300 33MMAA0011555522224455 IInntteerriimmRRepepoorrtt##66 --AAnanlaylsyisissooffCCototttaaggeeGGrorovveeFFiisshhSSaammplpeless EExxyyggeennSSttuuddyyNNo.o:.: PP00000011440000 TTaabbllee II.. SSuummmmaarryy ooff PPFFBBSS,, PPFFHHSS,, PPFFOOSS aanndd PPFFOOAA iinn FFiisshh SSaammpplleess ~ Fo~md Assessed 322 30 t9.8 40 1.10 30 1.07 30 10,5 3O 0,712 45.2 30 31.8 ~ 137 ~.4 ~ ~ EEE| iE I ili : ~ ND ND EExxyyggeenn RReesseeaarrcchh 22009955.,00446699 PPaaggee 2255 ooff 113300 33MMAA0011555522224466 rst | Drs Interim Report #6 - Analysis of Cottage Grove Fish Samples Exygen Study No.: P0001400 TTaabbllee lI.. SSuummmmaarryy ooff PPFFBBSS,, PPFFHHSS,, PPFFOOSS aanndd PPFFOOAA iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd ND 40 NO 3.21 30 ND 2.4~ 30 NO 2.4~ 30 N0 === NR iNR NO 2.2~ 30 NO NO 3O MO ND 3O NI3 ND 30 N~ ND 30 MD 21E 0,004 :30 3O 0.~40 30 3O 3O 3O 3O 30 30 30 30 3O 30 1.~ 30 3O 124 3O 3O 137 3O iE: 5O 3L0 30 3O 3O 3O 40 4O 3O 30 3O 3O 3O 3O NR NR 40 40 3O 3O 3O 4O 4O 30 30 .30 3O 3O Exygen Research 22009955..00447700 Page 26 of130 33MMAA0011555522224477 InIntteerriimm RReeppoorrtt ##66 -- AAnnaallyyssiissofofCCototttaaggee GGrroovvee FFiisshh SSaammplpelse.s E`Exxyyggeenn SSttuuddyy NNoo..:: P00000011440000 TTaabblleelI.. SSuummmmaarryy ooff PPFFBBSS,, PPFFHHSS,, PPFFOOSS aanndd PPFFOOAA iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd NO 4O ND 40 NO 30 NO NO 3O ND 3O ND 30 ND 3O SomND 30 C00g~7~3" C GM N-r-01-3,.MP02-0-050812 ND 30 C0~83 Ref~ CGMN-F01.3LM F0~-0-~50812" NO 30 3.42 30 HEE 30 542 3) ~52 50 E SEER3,24 HE 30 ND EEE 30 892 NO 30 334 C0096787 Re~ CC-MN-F01-SLMFDI~)~0812" Ni~ 30 ND 30 3~ 3O ND 30 3,B 3O Nn lid Somme Exygen Research 22009955..00447711 memati Page 27 of 130 33MMAA0011555522224488 Intern Re#p6-oAnralytsisofCotageGroveFishSamples ExygenStdyNo:P0001400 Interim Report #6 - Analysis of Cottage G-~ov Fish S~mples Exygen Study No.: P0001400 TTaabbllee IIIL. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSS aanndd PPFFHHSS iinn FFiisshh SSaammpplleess so GMt~F01 -IIPWO I.O.O60~12 i VIa mee Sam Whew fe heer (%) (%) CGMN-F01 -I)PW~2-O-0~0012 106 78 CGMN-F0 $-IIPW06.0,050~I 2 CGMN-F01- flPWOG-0-0E0812 CGMN-FO 1-31PW01-0-~0612 BR JE o~ 77 101 07. o7 80 111 68 104 fale om w85 ile oo. .109 | 108 64 108 Exygen Research Exygen Research 22009955..00447722 PaPaggee22880o7f113300 33MMAA0011555522224499 IInntteerriimm RReeppoorrtt ##66 -- AAnnaallyyssiissooff Cotage Cottage Grove Grove Fish Fish Samples Samples Exygen Study No: POOOL400 Exygen Study No.: P0001400 TTaabbllee IIIL. MMaattrriixx SSppiikkee RReeccooCvvoeenrrtyyioonffuPPedFFBBSS aanndd PPFFHHSS iinn FFiisshh SSaammpplleess Continued CGMI~-F01 ~ PW01-0-050812 CGM/~-F01-5/PWD2-0-050~ 12 CGMN-F01-StF~N02-O-050612 Amount ~ Found Amoum S~ke~ In Sample Recovered Recovery (%) (n~ff) (n~/g) (nff/g) (%) 65 10 ND 11.2 112 NO go.0 90 10 {).884 1Z0 111 0.884 g6,0 ~5 CG MN.-F0 I-5/PW04-0-0508 f 2 CGMN-FO 1-51PWO4-O-050812 CGMN-F01-51F~N05~t2 CGMN-F01 - 11PF06-0-050812 CPaMN-F01 - 11PF05-0-~12 ND 10.2 102 63 59 ND 9.48 60 10 ND 6~ ND 60 10 ND NO NO t0 ND 88 ND 10.3 91.6 87.8 8.84 ~0.0 11.1 84.4 103 ~ 8~ 98 gO 111 84 Exygen Research Exygen Research 22009955..00447733 PPaaggee 22990o0f113300 I3MMAA0011555522225500 Interim Rept 46.AnalysisofCotageGrove FishSamples xySygNo:eP000n1400 Interim Report #6 - Analysis of Cottage Grove Fish Samples Exygen Study No.: P0001400 TTaabbllee IIlI.. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSS aanndd PPFFHHSS iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd CGMN-FO f-~W-01 ~)r~081:2 Zar CGMN-F0 l-3tPF0"2-0-05~l 2 CGkt%-F0 ~ -31P F04-0-05~812 CGk~01-3~PF04-0-0~812 CG MN-FO 1-31PF05-0-05~ 12 ew wae ww 11.2 112 86.0 10.0 106 g4.4 04 ~.8 11.0 110 10.6 08.8 H BEAE EEL ER l|{uellaee owwmwe xaweu|f]] im =ooww ow CGMN-F01-51PF03~O-,05~812 10.2 88.0 10.@ 924 102 88 106 ~2 10.5 106 CGMN-F01-~R PF05-~,050812 ~0.3 103 89.e 90 EExxyyggeenn RReesseeaarrcchh 22009955..00447744 PPaaggee 33000off 113300 33MMAA0011555522225511 IInntteerriimm RRe~p3~oorrtt##66 -- AAnnaalylyssiissooffC Cotto ageGt Grroovt veeFFia isshhSg Saammple peless EExxyyggeenn SSttuuddyyNNoo.:: PPO00O0O1I40000 TTaabbllee IIII.. M Maattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSS aanndd PPFFHHSS iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd =m CGMN-FDI-1 LktW05-O-05O612 C4 ~l~nate PFB$ (rig/g) (n~Cg) Ce ~ulftmale PF~ (%) 10 4.04 15.0 110 10 NO 9.52 95 log 4.04 87.2 83 100 Hn 106 106 10 2.48 10.0 75 ~.~ ~7 10~ 78. 78 1~0 ND 110 110 10 104 2_20 2,20 ela 10 1.12 100 1.12 10.2 80 06.8 85 we 844 73 10.0 1oo ow ow 10 NO ENTE EE E Zrt : CGNN-F01-3LMW03-O-O~U1Z CGI~N-F01-3LMW03-0-050812 C,GIM N-F=01 ,.3LMW04.,0-050812 TL CG M N,-F01,,3LMWO4-O-05O6 12 CG/~N-F0 ! .3LMWO6-0-.05;~ 12 CG~N-F01-31.MW05-0-0~ 12 wJl ule 100 NR ulm 10 fee oomw wow wew e /~R NR 10# 4.~ ow m Teeles wwe w woww 116 111 we ow ew 100 2,22 88.0 84 ExygenReserch Exygen Research 22009955..00447755 PPagea3311ogoff1e13300 33MMAA0011555522225522 InterimReport #6. Analysis ofCottageGroveFish Samples Interim Report #6 - Analysis of Cottage Grove Fish Samples EExxyyggeenn SSttuuddyyNNoo..: PPO0X0O011440000 Table IL Table II. MMaattrriixx SSppiikkee RReeccooCvvoeenrrtyyioonffuPPedFFBBSS aanndd PPFFHHSS iina FFiisshh SSaammpplleess Continued CGMN-F01-,SLVNV01-0-050612" CGMI~F01-~01-0-05~812^ CGMN-F01 -SLMW02-0-05~812" Ro~wemd 55.O 51.0 ("~) 54.0 t08 530 106 44.8 3e8 CCJA~-F01-1MDF01-O-O50812 CGMN-F01 -IM[~014)-050812 S26 4~0 CGMN-FOl .! MI~O2,0.OK~8~ 2 SERIE mol w ow e me ow ow 9.64 gO,4 92,4 92 C~-F01 -tM~F03-0-0~12 CSM~-F01-1MDF03-O-0~12 C(3MN-F01-1 MDFO4-O-OF~8~ 2 ~4,0 9.88 ~ 884 Exypen Research Exygen Research 22009955.,00447766 PPaaggee 3322o0f113300 I3MMAA0011555522225533 InItnetreriimmRReeppoorrtt##66. - AAnnaallyyssiissooff CCootttiaaggeeGGrroovveeFFiisshhSSaammpplleess Exygen Study Nos POOOI400. Exyg~n Study No.: P0001400 TTaabblleeIIIL. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSS aanndd PPFFHHSS iinn FFiisshh SSaammpplleess Continued Continued ~) 72 CGMI'4-F01-3MDF01-0-050~12*" (COOI4T~ a mLn EnnsI CC~IN-4~O 1-3 LM F0 I-0-050812* NO 38.0 76 ND 352 70 ND 38.2 70 NO 34~ 74 ND 37.5 75 ND 363 74 ele mom mle wm ow ND 51.2 102 wlio ow =m] oe - - HD ~84 97 pe TEI 1.0 g O~ lampl0 wed fo* osb~ctio~ Instoed ors.09, 3.40 ~4 104 ERIE NO 43Z ~ fee ow on fee ow ND 36.0 72 ND 37~ 75 EExxyyggee~n RReesseeaarrcchh 22009955..00447777 PPaaggee 33330o1f113300 33MMAA0011555522225544 IInntteerriimm RReeppoorrtt ##66 -- AAnnaallyyssiiss ooffCCootttaaggeeGGrroovveeFFiisshh SSaammpplleess Exygen Study No: POG01400 Exygen Study No.: P0001400 TTaabbllee IILI.. M Maattrriixx SSppiikkee RReeccoovveerryy ooff PPFFBBSS aanndd PPFFHHSS iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd CGIdN-F01 -SLMF02.0-0~0812'~ ND 36.4 73 S0 ND tad 378 78 tOO bid 46.4 470 Exygen Research, Exygen Research 22009955..00447788 PPaaggee 33440o7f113300 33MMAA0011555522225555 - etm GS iS Interim Report #6 - Analysis of Cottage Grove Fish Samples Exygen Study No.: P0001400 TTaabbllee IIIlLI. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PPFFOOAA iinn FFiisshh SSaammpplleess t0 EEE CGNN-F01-11PW05-0-050812 Sr rtv-- CGklN-F01-31PW03-0-050812 amma, RL CG~N.F01-31P~,~)812 SmEEEm CGMN-F01-31PW05-0.050812 !o I ron: : |= 115 10 10.5 I06 10.5 N ww 552 ew wl oe 10 45.2 100 45.2 wwe17.0 17.0 10 31 .O [mim 1o4 Ln 100 ome |: 142 ow wwfow ~.6 10 ww fm wn alm] em =: we - -o -- -- ow om I Exygen Research 22009955..00447799 a Page 35 of 130 33MMAA0011555522225566 _--_--m------ IInntteerriimmRReeppoorrtt##66 -- AAnnaallyyssiissoofi'CCoottutaaggee GGrroovvee FFiisshh SSaammpplleess Exygen Study No.: PO001400 Exygen Study No.: 1)0001400 TTaabbllee IIIILI.. M Maattrriixx SSppiikkee RReeccoovveerryyooffPPFFOOSS aanndd PPFFOOAA iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd CP~MN-FO1-SIPW01.O-OSO~I 2 CGMN,-F01-51PW02-~-0~0~I 2 CGMN-F01-SiP~OO-O-050812 ~N-FO1-lWF02-O-O~812 to 54.4 ~4.4 140 lO 124 14-3 124 225 lO 313 384 t00 313 126 9.44 82 10 2.~ oo,0 97' too 2.55 ~2.8 1o In lOO 10 2.0~ loo 11.6 ND 10.6 108 NO g~.0 96 IO 2.43 11.5 91 ND 10.6 to 10 8.72 17.1 84 lO too 11.8 t02 N~ 89.2 89 EExxyyggeenn RReesseeaarrcchh 22009955..00448800 PPaaggee 33660o1f113300 33MMAA0011555522225577 InterimReport46 AnyiofCogsGrove Fs Supls Expgen SayNos OOOIA00 Interim Rqmrt #6 - Analysis of Cottage Grove Fish Samples Exygen Study No.: PO001400 Continued TTaabbllee IIIlLI. M Maattrriixx SSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PPFFOOAA iinn FFiisshh SSaammpplleess Continued S~lkod Found Amount In ~-.m~le (ng/o) Recovered (nWo) Emm =m SERRE Fmt, EEE, t0 t00 95.2 10 IOQ tO0 t04 t0 - 100 10 t0 : "ww 10 tO0 10 t0 IO0 (an on ue*0fa 100 al 10 ow feI]0 we ulm ow own] ow ww ow eww La om. ww ow a BxygenReseach Exygen Research 22009955..00448811 PPaaggee33770o1f113300 33MMAAO011555522225588 ---- Irn Report. Analy of Cora Grove Fi Samples ExygnStyNo: PODDIA00 Interim Report #6 - Analysis ofCottage Grove Fish Samples Exygen Study No.: P0001400 TTaabbllee lIIIIL.. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PPFFOOAA iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd Sample CGMN-F0%l ~02.0-050812 $~lkecl CI ~ PFOS In,Sample Recorded Recmww ~t S~d ~4nK Fo~nd in Sample | A~ld I~ Amount RK~vemd Recov~y lO 1o4 lO 10 lOO 10~ 1M o EEm E CGMN-F01,3LMW01-~12* =n== CGMN-F01-3LMW02.O-0~ 12 34.4 140 1o 34.2 48.8 lOO ew 9320 ae. too 9640 IL t0 369 361 1oo 10 126 10.0 67 10~ 10 100 o| ooow 1~ 242 ie 10 812 onl ~4.8 e5 (~1~ 8pk a. t0 n~l L~b I~) lO 128 10 C GM N-F01-3LMWO3-O-~J(~ 12 CGM N-FO 1-3[JAW04-O-QS0812 EB p loE z = ole]:ET CGMN-FQ1-3LMWQS-~050812 ~0 53.2 ~0 t0 100 ~.2 I~ 97 t00 to 10 "ow ExypenResearch Exygen Research 22009955..00448822 Page38ar130 Page 38 of 130 33MMAA0011555522225599 InIntteerrimn RReeppoorrtt 6#6 --AAnanlaylyssiissooffCCooitataggeeGGr-orovvee FFiisshhSSaammplpeless Exygen Sudy No POOOIAGD Exygen Study No.: P0001400 TTaabbllee IIIlLL. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PPFFOOAA iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd SpUmd .~t FOUnO In S.sm~le Amount Recovered Recov~y NR NR NR gar 62O Jl 412.0 87 73O ~ Lee ~ NR NR ew NR NR CGMN-F01 -SLMW05-0-050812* Se CGMN-F01-1MDF02-O-050~f 2 CGI~N- F01 - 1M DF03-0-'050812 ele98.8 ow114 10 lOO 51.2 10 48 0 121 so@ ; NR 0,916 0916 - 10~ lO@ O.~ t0 0.~ 75 NR NR 8~ 74 87.2 wow 7.~ 70 824 Exygen Research Exygen Research 22009955..00448833 PaPgagee33990o1f113300 33MMAA0011555522226600 InterimRoper:#6 -AnalysisofCotage Grove Fish Samples Interim Report #6 - Analysis of Cottage Grove Fish S~mplcs Exygen Study No. PO001400. Exyg~n Study No.: P0001400 TTaabbllee IIIILI.. M Maattrriixx SSppiikkee RReeccoovveerryyooff PPFFOOSS aanndd PPFFOOAA iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd CGMN-F01.1LMF01-O,-050~ 12~ CGMN-FO 1-3MDF03-O-05~ 12~ CGM N- FO I~MDF03-O*051~ 12" CGMN-F01-3LMF01.0-05~812 CGMN-FO1-StdDF01,~05~12" CG&4N-FOI -SMDF03.O-05~O 12. S~lked In Saml~ Recow~d R~:o~ry Spiked Im ~ Recovered Rm;ov~y 32.4 32.4 30.2 30.2 60O SO NO SO 110 110 1380 1300 798 7t.2 ~ 81,6 512 570 972 172 592 1260 106~ 754 84 50 101 103 96 124 96 ~0~ 10(} 5O 54,2 127 146 54.2 101 256 334 256 842 117 5160 5340 82 1030 80 892 1780 Exygen Research Exygen Research 22009955..00448844 PPaaggee 44000o7f113300 33MMAA0011555522226611 Interim Report #6 -Analysisof Cottage Grove Fish Samples Interim Report #6 - Analysis of Cottage Grove Fish Samples Exygen Study No. PO001400 Exygen Study No,: P0001400 TTaabbllee IIIILI.. MMaattrriixx SSppiikkee RReeccoovveerryy ooff PPFFOOSS aanndd PPFFOOAA iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd Sam~k C~,IbI-FOI-~LMF01 -O-~812~ a CG~N-FD1-SLMF02-0-050812" Sp~kml In Sm Itlc~emd Recm~ Spllr~l I. Sampk Rlmove~d Rlo~ry NR NR PJR ww wm ce ow - - SO 548 390 SO NR NR MR NR NR MR Exygen Research, Exygen Research 22009955..00448855 PaPgagee d4l1 ooff 113300 33MMAA0011555522226622 InterimRepo 46 -AnalysisofCotageGroveFishSamples Interim Report #6 - Analysis of Cottage Grove Fish Samples ExxyyggeennSSttuuddyyNNoo:.: PPO000O011440000 TTaabbllee IIVV.. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff 13CC PPFFOOAA iinn FFiisshh SSaammpplleess ngExygen wID coomeos C0096695 ovesisshn C0096~95 Rep Gmemowe C0096695 Spk C Commas C0096695 Spk D C0096696 oer C00S6596 Rep Comamsae C0096b'9~ :5p~ E Comat C0098696 Spk F C0096697 come C00S6~97 Rep omar awe C0098697 Spk G Comemian C00986~)7 Spk H coma C009(~698 PrC0096698 Rep Commit, C0096698 Spk I Comamens C0096698 Spk J conn C009~699 caesar C0096699 Rep Commeax C009~699 Spk K Goal C0096899 ~;pk L cars C0098700 cones C0096700 Rep freed C009~700 gpk C Smrosac C0096700 Spk D comer C0098701 prt C00gO701 Rep rode C00gO701 gpk E Common C0098701 Spk F CO096702 ome C0096702 Rep Gm se C0096702 Spk G Seman C0096702 Spk H comer C0096703 C0096703 Rep Smet C0096703 Spk I Commas C0098703 Spk J coon C0096704 cme C0096"/04 Re~) fede C009~704 Spk K Cl C00967D4 Spk L sm Sample omer Description coiror ewssosers CGMN-F01-11PW01-0-050812 Coumrorw Soste CGMN-F01-11PW01-0-050812 Corel osm CGMN-F01-11PW01-0-050812 Coron tom CGMN-F01-11PW01-0-050812 CGMN-F01-11PW02-0-050812 Somossous CGMN-F01-11PW02-0-050812 comeomsoum: GGMN4=01-11PW02-0-050612 Comsoramirorens CGMN-F01-11PW02-0-050812 CGMN-F01-1 IPW03-0-050812 frie CGMN-F01-1 IPW03-0-050612 Commo imeoouts CGMN-F01-1 IPW03-04)50612 Commuimweronon CGMN-F01-11PW03-0-05081~ comrorevooomen CGMN-F01-11PW04-0-050812 Cmrar awsome CGMN-F01-11PW04-0-050812 Comemiowocooons CGMN-F01-11F:~N04-O-050812 Comriewacoeuet CGMN-F01-1 IPW04-0-050812 cameorewsossn: CGMN-F01-1 IPW05-O-050812 fortistreet] CGMN-F01-1 IPW05.0-050812 comeieviocons CGMN-F01-11PW0~-0-050812 Comrariwiern: CGMN-F01-11PW05-0-060812 comsorspwnson: CGMN-F01-31PW01-050812 Cancer sown soot C~N-F01-31PW01-050812 Camron wonsors C~MN-F01-31PW01-0,~0812 Camronsow son: CGMN-F01-31PW01-050812 comeonsouzosez CC-d~N-F 01-31PW02-050812 forte CGMN-F 01-31PW02-050812 Camron sions CGMN-F01-31PW02-050812 CancroPwassont CGMN'F01-31PW02-050812 CGMN-F01-31PVV03-050812 CamirorSowosasoss CCaMN-F01-31PW03-050812 Stores C~MN-F01-311::~N03-050812 Camron smmosdsont CC:MN-F01-31PW03-050812 comsorsmmoasonz CGMN-F01.31PW04-050812 CGMN-F 01-31PVV044)50812 Ciro spwosoustz CGMN-F01-31PW04-050812 Cmroramosssnt CGMN-F01-31PW04-050~12 camronammosason: CGMN.F01.31PW05-050812 Snr Seer CGMN-F01-31PW05-050612 Simro mason: CGMN-F01-31PW05-050812 Sra spores CGMN-F01-31PW05-050812 TeAmount The Spiked a(rig/g) 10 B10 10 -100 t0 10 10 100 10 10 n10 -100 10 n10 Bot0 100 10 10 i10 100 10 t0 n10 E100 010 10 ji10 -100 10 10 10 -100 10 t 0 010 -100 10 i10 10 E100 esaeron Amount ews Recovered em(rig/g) 07.40 Ja7.12 =6,32 EA97.6 7.52 a7.96 =7.32 To104 7,12 %6,92 ES7,92 To107 a06.08 +18.20 Toe7.08 100 1007.60 oo9.04 a6.76 4105 po6.60 i6.44 rl5.00 =85.6 su5.48 br6.16 55.32 Eo88.4 7.20 537.72 I7.20 =98,0 1.7.84 7.72 Te7.96 we87.2 sn5.12 BA6.00 +5.56 =95.2 acon Recovery =(%) "74 n71 63 :98 75 580 573 ES104 71 s69 79 -107 o81 282 "71 100 n76 gO @68 io105 66 64 &60 286 =55 a62 853 s68 72 777 n72 a98 78 77 "80 "67 551 io60 256 a95 ^ 1.0 O of Sarape used for extraclton inslaad of 5.0 O. maestro Ti Sar oh acySart PFOA NR [] Not mpor~s~ 0ue Io qual~ ~ntml m~ult failures. See Table VII ~urroga~ Spike Recovery Summary of ~=C-PFOA in C,ot~oosim Fish Samples' for rea~aly"~.ed results. tS iey eho ae Er At1 KYHO 4OAI Note. 91nce this summaw table shows rounded results, ~.ovap# values may vary slightly from the values in the raw data. ExygenResearch Exygen Research PaPaggee 44220o7f113300 22009955..00448866 I3MMAA0011555522226633 Interim Report#6 -Analysis ofCottageGrove Fish Samples Interim Report #6 - Analysis of Cottage Grove Fish Samples EExxyyggeennSSttuydy NNoo..: PPO0O0O0I1440000 TTaabbllee IIVV.. SSuurrrrooggaattee SSppiikkee CRRoeencctooivvneeurreyydooff 13CC PPFFOOAA iinn FFiisshh SSaammpplleess Continued -- Eye _s-- amo _ Th-- moms e Rowy Exygen 8 on per - 5 IO caowms cousoseworooen ae u C0096705 cSiottree CCoiurrosspoownrosooswess itso 55 C0096705 Re) Sample Description CGMN-F01-51PW01-0-050812 CGMN-F01-51PW01-0-050812 Amount Spiked 10 10 I:C.PFOA Amount Recovered 8.36 9.48 Recovery 84 95 C0096705 Spk C CGMN-F01-SIPW01-0-050812 10 7.88 79 C0096705 Spk D comms C0096706 C0096706 Rep Comat C0096706 Spk E Comair C0096706 Spk F CGMN-F01-51PW01-0-050812 comrorsewerons CGMN-F01-51PW02-0-050812 CGMN-F01-SIPW02-O-050812 come iewasouns CGMN-F01-51PW02-0-050812 comeisoweceeen CGMN-F01-51PW02-0-050812 100 106 106 . wm a t0 10 i" - 10 - Wn i 100 9.12 8.96 8.44 119 91 84 119 C0096707 cin nee sovoscouss i sa 5 C0096707 Rep Gmeawe Come smorooum i i u C0096707 Spk G SIME RMIHNRNEE - = 3 C0096707 Spk H coum counesnsmnocons w ns = C0096708 ri CEE pvocoogas a = C0096708 Rep as Comer avocoouss i w C0096708 Spk I Gommsal Comneoswocsemms w = u C009670B Spk J camera comnessrnisoue: 0 ne a C0096709 caine Como owosacsons i i = C0096709 Rep Cosmsax Comeorspmsoaions I i C0096709 Spk K Commit Comoros " = = C0096709 Spk L camer couortproroson: wo - C0096710 comrone Coro teroroume ws bid C0096710 Re) Sma Ro @ u C0096710 Spk C Somuias commiromon ww a w C0096710 Spk D CGMN4=01-51PW03-0-050812 CGMN-F01-51PW03-0-05~812 CGMN-F01-51PW03-0-050812 CGMN-F01-51PW03.-O-0.50812 CGMN-F01-51PW04-O-050812 CG M N..F 01-51PW04-0-050812 CGMN-F01-51PW04-0-050812 CGMN-F01-51PW04-0-050812 CGMN-F01-51PW05-0-050812 CG MN-F01-51PW05-0-050812 CGMN..F01-51PW05-0-050812 CGMN-F01-51PW05-O-050812 CGMN-F01-11PF01-G-050812 CGMN-F01-11PF01-0-0,50812 CGMN-F01-11PF01-0-050812 CGMN-F01o11PF01-0-050812 10 10.2 102 10 9.52 95 I 0 8.36 84 100 99.6 100 I 0 12.5 125 10 12.2 122 10 9.36 94 100 88.0 88 10 12.4 124 I 0 13.6 136 10 10_8 108 100 94.0 94 10 12.0 120 10 11.2 112 10 t0.6 108 100 91.2 91 C0096711 corns Soanirarrerezoosnt Ek Ed Ed C00~6711 Rep Somer sae Cuneartorizoost 3 - C0096711 Spk E Sor sr Cora terizoe: w 20 C0096711 $~ F CGMN-F01-1 IPF02-0-O50812 CGMN-F01-1 IPF02-0-050812 CGMN-F01-1 IPF02-0-050812 CGMN-F01-11PF02-0-050812 10 11.8 118 10 11.9 119 10 10.3 103 100 90.0 90 COO96712 che C0096712 Re) C0096712 Spk (3 Soro C0096712 Spk H cers C00J6713 corte C0096713 Rep orator) C0096713 ~pk I Gomrssas C0096713 Spk J conn C0096714 core C0096714 Re) Gomer C0096714 Spk K Sa C0096714 Spk L CGMN-F01-11Pf:03-0-O50812 Coin eros CGMN-F01-11PF03-0-050812 CGMN-FOt-11PF03-~-050812 Cameo erisosson CGMN-F01-1 IPF03-0-050812 comm proson CGMN-F01-1 IPF04-0-050812 frrmsirdeseotd CGMN-F01-1 IPF04-0-050812 Cra torsion CGMN-F01-t IPF0~.0=050812 Cnr erorosn: CGMN-F01-11PF04-0-050812 comumprsosson: CGMN.F01-1 IPF05-0-050812 Como rerisossan: CGMN-F01-1 IPF05-0-050812 Comma prisosn: CGMN-F01-1 IPF05-0-050812 rerio: CGMN-F01-11PF05-0-050812 10 11.9 119 #3 bd 10 12.3 123 t0 10.5 105 - Ed w 100 84.8 85 wr w !0 11.7 117 pH m I0 12.0 t20 5 i 10 10.5 105 - ne w 100 90.8 91 w 10 12.3 123 I jd kd 10 11.6 118 is in 10 11.2 112 - = v 100 86.8 87 ^ 1.0 g of samt~e used for extraotion instead orS.0 g. eat ay ekhr So Ti Sr scr Some 4 GAFOH NR = Not re~3rt~l due to qual~J co~tr~ result failures. See Table VII 'Sunogate Sl~ike Recovery Summary of :=C-PFOA in CrorernSteemr it ra og PO et in oe Composite Fish Samples' fo~ reanalyzed result& Note: 81nee ~h~ summur~ table Mlov~ rounded reeulte, re~owm/value~ may va~, slightly ~om the value~ in the raw data. ExygenResearch Exygen Research PaPgagee 44330off113300 22009955..00448877 I3MMAA0011555522226644 trimRep#6-oAnralytsisofCoGrtoveaFishgSampeles Interim R~port #6 - Analysis of Cottage Grove Fish Samples Exygen StyNos PO0O1400 Exygen Study No.: P0001400 TTaabbllee IIVV,. --_--Corn Exygen = . IP , comris C0006715 camrisieg C0096715 Rep Soria C0096715 Spk C Goss C0096715 Spk D connie C0~J6716 provi C0096716 Rep Gonatote C0096716 Spk E Comriesr C0096716 Spk F cory C0096717 cme C009~71 ? Rep Sons C0096717 ~pk G Crean C0096717 Spk H comarie C0096718 carson C0096718 Rep fried C00~718 Spg I Cronos C0096718 Spk J coms G0096719 comer C0096719 Rep coms C0096719 Spk K Coots C0096719 Spk L comer C00~720 cameron C00S6T20 Rep Gomme C0096720 Spk C Commons C0096720 Spk D cuore C096721 cavern C00967"21 Rep arn so C0096721 Spk E Cor sae C0096721 Spk F cores C006722 cverzires C0096722 Rep Gmasae C009~722 Spk G Smmian C0096722 Spk H cover C0096723 crest C00S6T23 Rep Gamma C0096723 Spk [ Commas C0096723 Spk J comers C0096724 comrni CD096724 Rep Camo sok C0(~J6724 Spk K Comet C0096724 Spk L SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff ~3CC PPFFOOAA iinn FFiisshh CCoonnttiinnuueedd sanoSample oun De~cdptlon comnenneroraouers CGMN-F01-31PF01-0-050812 Comearseroraous CGMN-F01-31PF01-0-050812 Como rors CGMN-F01-31PF01-0-050812 commerce CGMN-F01-31P F01-0-050812 comnronaprozon: CGMN-F01-31PF02-0-050812 mre: CGMN-F0t -31PF02-0-050812 Sanremo oss CGMN-F01-31PF02-0-050812 Sanroraprossosms CGMN-F01-31PF02-0-050812 comroasrosoousr CGMN-F01-31PF03-O-050812 Emre srosaoins CGMN-F01-31PF03-1)-050812 Claes wrrors an CGMN-F01-31PF03-0-050812 Sammarressoues CGMN-F01-31PF03-0-050612 comrovarrorsaser: CGMN-FO1-31PF04-0-050812 Camro rrocaosms CGMN-F01-31PF04-0-0508!2 Camron rosso: CGMN-F01-31PF04-0-050812 Coniro srrocsomes CGMN-F01-31PF04-0-050812 camroarrossosm CGMN-F01-31PF05-0-050~ 12 Camrorsereesoums CGMN-F01-31PF05-0-050812 Conviosrs ons CGMN-F01.31PF05-0-050812 Snorer ome CGMIq-FO1-31PF05-O-050812 camsovssrorson CGMN.F01.51PF01-0-050812 Canrovsrro osm CGMN-F01-51PF01-0-050812 Camroismoicoms C(3MN-FO1.51PF01-0=050812 cmroramorcoums CGMN-F01-51PF01-0-050812 coms srreacomn C{3MN-F01-51PF02-0-050812 Smrorsrreacoms CGMN-F01-SIPF02-0-050B12 Simro srroscoons C~MN-F01-51PF02-0-050812 Conorsmn CGP~-FO1-51PF02-0.~5081~ coms ssresooon CGMN-F01-51PF03-0-050812 Coron sorosaeame CGMN-F01-51PF03-0-050812 Commsmwonm CGMN-FO1-~IPF03-0-050~12 Comrosessemn CGMN-F01-51PF03-0-050812 carorssoiacar CGMN-FO1-51PF04-0-050812 Snr Srrocacans CGMN-F01-SiPF04-0-050812 miro soon: CGMN-F01-51PFI)4-0-050812 Somrorserocaeans CGMN-F01.51PF04-0-050812 como ssrosossona CGMN-F01-51PF05-0-050812 Comersorocoms CGMN.F01-51PF05-0-050812 Chinen resosons C(3MN-F01-51PF05-0-050812 Snr serarocons CGMN-FO1.51PF05-0-050812 Amouat Si Spiked Ta{rig/g) 10 i10 10 -100 10 t0 10 100 10 t0 10 -100 10 i10 10 -100 10 310 10 100 10 10 B10 I)100 10 H10 t0 -100 10 10 10 -100 10 10 10 -100 10 10 I0 -100 a"cre ron ~ZG-PFOA /~)unt noms Recovered mnye11.8 ne12.1 oz10.2 a88.4 2012.0 pie1t.5 ios10.9 %89.2 2012.8 bo12.1 ir}11.5 =95.2 2012.0 bidt t .4 to10.2 EH84.4 no11.0 po12.4 at0.8 =90.4 0t0.4 we11.6 us10.4 695.6 Po12.6 i12.0 jit0.8 wo92_0 0110.1 or10.4 "9.08 103 ne12.9 jo12.4 ws10.9 EdgO.0 P12.2 rt11.5 i11.0 =92.8 SSaammpplleess moreng........ Recovery 118 n121 @102 w88 =120 hi115 109 =89 i128 win115 95 w120 bi114 bE102 w84 wo110 a124 on108 90 wo104 bil116 BY104 =96 =126 I120 in108 =92 wo101 4104 o91 wot03 "129 ji124 ont09 90 =122 bd115 pH'~ 10 w93 10gsstc safn505. ^ 1.0 g of sample used for extraclJon instead orS,0 0. AR Kt es mcecaes.SeTe VA Sar 5 ec Sre of "HFA NR = Not r@por~{I due to quatlly cor1~'ol result failures, See Table VII 'SiJrrogato Spike Recovew Summary of ~aC-PFOA In Conroe mem Corlcx3sile Fis~ Samples' fo~ manalyr.ed resu~, Se ey ro Aa RHP A N~te: Sine# ~ summary tablt shows r~und~ l results, recovery values may vary slightly ~ tl~ values In the raw EExxyyggeenn RReesseeaarrcchh PPaaggee 44440orf113300 22009955..00448888 I3MMAA0011555522226655 InIntteerriimm RReeppoorrtt##66 --AAnanlaylyssiiss ooffCCoottitaaggeeGGrroovvee FFiisshh SSaammpplleess EExxyyggeenn SSttuuddyy NoNo.: PPO000001L440000 TTaabbllee IIVV.. SSuurrrrooggaattee SSppiikkee CRRoeencctooivvneeurreyydooff ]"JCC PPFFOOAA iinn FFiisshh SSaammpplleess Continued ----e"p ScEoro-- ~ Ege samo Shei Rowe Roy Exygen Sample ow Gen eey MT ID .... D~scdptlon cusers comsronumorocs a o C00967:25 camaro Commo or ms on C0096725 Rep Gee Comtror tm oan ia o C0096725 Spk C SEs Cameowercomn - We we C0096725 Spk D CGMN-F01-1LMW01-0-050812 CGMN-F01-1LMW01-0-050812 CGMN-F0'I-1LMW01-0-050812 CGMN.F01-1LM'W0 I-0,.050812 Amount Spiked (n~/g) t0 10 10 t00 ~C-PFOA Amount Recovered (n~/g) 9.28 8.84 8.68 116 Recover~ g3 88 87 116 C0096726 `coonras Colmes siamese i ie = C0096726 Rep Gomraet cam inmooon bu " C0096726 Spk E Gia comroamessem: pH) Et be) C0096726 Spk F CGMN-F01-1 LMW02-0-0,50812 CCMN-F01-t LlvIW02-0-050812 CGMN-F01-1LMW02-O-050812 CGMN-F01-1LMW02-O-050812 10 8.60 86 t0 8.88 89 10 8.44 84 100 112 112 C0096727 comer Rep C0096727 Rep C0096727 Sl:)k G SERSL C0096727 Spk H cons C0096728 corres C0096728 Rep Sonn C0096728 Spk I Gta) C0096728 Spk J CGMN-F01-t LIVNV03-0-050812 COMNFIL ITS 082 CGMN-F01-1LMW03-0-050812 CGMN-F01-1LMW03-0-050812 NSIS CGM N-F01-1LMW03-0-050812 comonomer CGMN-,F01-1LMW04-0-050812 Comet tm sosons CGMN-F01-1LMW04-0-050812 Comes ametaemn CGMN-F01-1LI~flN04-0-050812 comeomoooms CGMN-F01-1LMW04-0-050812 10 8.60 8~ wo 0: 10 9.32 93 10 10.2 102 5 ES # 100 112 112 0 o 10 9.68 97 ia 10 t0.2 102 in 10 8.84 88 - 3 = 100 120 120 S cuoseram s og. CCamormoonOnMsCosooomnn io ai2a @" C0096729 C0096729 Rep C0096729 Spk K CGMN-F01-1LMW05-O-050812 CGMN-F01-1LMW05-O-050812 CGMN-F01-1LMW05-0-050812 10 8.88 89 10 9.28 93 10 8.12 81 G00(:J672~3 SpI~ L cuoeno C0096730 camrson, C0096730 Rep Gms C0096730 Spk C Gomi C0096730 Spk D coms C0096731 cams C0096731 Rap come C0096731 Spk E Gm C0096731 Spk F coonC0096732 cmon C0096732 Rep Griave G0096732 ;Spk G Soman C0096732 Spk H came C0096733 C009~733 Rep Goat C0096733 Spk I Sommins C0096733 Spk J coonC0096734 comin, C009~/3~ Rep Gomtax C0096734 Spk K Sammi C0096734 Spk L GGMN.-F0t -1LMW0.5-O-US0812 comosmerooen CGMN-F01-3LMWO1-0-050812 Comes Samer osm CGMN,,F01-3LMW01-0,.050812 comirsiumeiaesme CGMN-F01-3LMW01-0-050812 comrumersem: CGMN-F01-3LIV,N01-0-050812 comosumesozs: CGMN-F01-3LMW02-O-050812 comer moose CGMN-F01-3LMW02-0-050812 commas: CGMN-F01-3LMW02-0-050812 comsomemocm: CGMN.F01.3LMW02.0-050812 coms summon CGMN-F01-3LMW03-0-050812 conven CGMN-F01o3LMW03-0-050812 Comer sasmc e CGMN*F01-3LMW03-O-0,50812 Comrersamesmn CGMN-F01-3LMW03-0-050812 coms smsaon CGMN-F01-3LMW04-0-050812 CGMN-F01-3LMW04-0-050812 comrvamoioousn CGMN-F0t -3LMW04-0-050812 Comeo moon CGMN-F01-3LMW04-0-1350812 common umososson: CGMN-F01-3LMW05-0-050812 Comer msonet CGMN-F01-3LMW05-O-050812 comormoosen CGMN-F01-3LMW05-0-050812 COMES CGMN-F01-3LMW05-O-050812 100 120 120 oo 10 6.60 66 i 5 10 6.04 BA 2 10 5.48 55 - = 3 100 105 105 we 10 8.16 82 in & 10 8.20 82 Bo Tw 10 7.64 76 w kd . 100 116 116 a0 o 10 a 5 10 a 10 o ws 100 9.00 8.48 7.86 115 90 85 79 115 s os a 10 9.08 91 10 8.80 88 i 10 7.92 79 - iA ji) 100 114 114 as " t0 9.88 99 5 = 10 9.52 95 = 5 t0 8.28 83 3 i t00 114 1 t4 ^ 1,0 g of sample used/or extraction instead of 5.0 g. Atocmu aras BA.S8T38 oy 5 TRY 0 PEON NR = Not rel~orted due to quality con'a'ol resalt failures. See Tal~e VII 'Surrogate Spike Recovery Summary of Svowearormiss Composite FIS~ Sam0~es' for reanalyzea results. C-PFOA in tS ey eer hn ey ty po hn a Note; Sim;e this summary table shows round~ l results, recovery values Inly vary slightly from t~e values In the raw dlti. Exygen Research Exygen Research PPaaggee44550of113300 22009955.,00448899 I3MMAA001"1555522226666 InInteterriimm RReeppoorrtt4#66 --AAnanlaylyssiiss ooffCCootttaaggeeGGrorovveeFFiisshhSSaammplpleess EExxyyggeenn SStudtyNNoo.u:.: P00d000011y440000 TTaabbllee IIVV.. engExygen ID comers: C0096735^ como C0096735 Rep^ GomstaG: C0096735 Spk C^ Ce C0096735 Spk [P comers C0096736^ cone C0096736 Rep^ mse C0096736 Spk E* Sma C0096736 Spk F* C0096737^ cone C0096737 Reg^ Groene: C0096737 Spk G Snemime C009~737 Spk H'~ comers C00~6738" camer C0096738 Rep~ Gmemesan C0096738 Spk t~ Commas C0096738 Spk J* C00~T3~" chore C0096739 RelP Smmmeae C0096739 Spk K^ Seman C0096739 Spk LA C0096740 cmon C00~740 Re~ Goats C0096740 Spk C Comriosmo C0096740 Spk D C0096741 carers C0096741 Rep Gm se C009~741 Spk E Cmwiar C0(736741 Sl~k F SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff 1"3CC PPFFOOAA iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd saron Sample omcpn I:)escdptlon couneorsumoroaser: CGMN-F01-SLI~M/01-0-050812 commensmorocs CGMN-F01-SLMW01-0-050812 Comrarsumioiomme CGMN-F01-SLMW01-0-050812 Comrise: CGMN-F01-5LIV~N01-0-050812 comeorsumoasnn: C G MN--F01-5LMW02-0-050812 Comerimizoons CGMN-F01-5LMW02-O-050812 comeosmeoosnt CGMN-F01-SLMW02-0-050812 CmANEI CGMN-F01-SLMW02-0-050812 Amount pr Spiked a(ng/g) 50 "50 50 =500 50 50 550 &500 "cron Amount Recove~d ry ,(ng/g) wwNR inNR ioNR "NR =NR =NR =NR "NR -- Recovery =(%) -NR =NR aNR =NR -NR =NR =NR =NR CG M N,-F01-5LMW03-0-050812 comer mons CGMN-F01-SLMW03-0-050812 Coral mesomen CGMN-F01-5LMW03-0-050812 Corersmsoommn CGMN-F01-8~03-0-050812 comroramanoson: CGMN-F01-SLIdW04-0-050812 Comesomecooet CGMN-F01 -SLMW04-O-050812 Comeorsomocovuen CGMN-F01-5LMW04-O-050812 Comer mersomn: CGMI~-F01-SLIVI~N04-0-050812 50 NR NR 5 = = 50 NR NR 5 = a 50 NR NR = = = 500 NR NR = = 50 NR NR o = = 50 NR NR s = = 50 NR NR = = = 500 NR NR CG M N-F01-SLMW05-0-050812 COWESamSO0NE 5 a = CGMN-F01-SLMW05,O-050812 counoiaumesom: 5 Ne = CGMN-F01-5~05-0-050812 SNIINEEN a " = CGMN-F01-SLMW05..0-050812 50 NR NR 50 NR NR 50 NR NR 500 NR NR CGMN-F01-1MDF01-0-050812 omar errosits CGMN-F01-1MDF01.-0-050812 Commiororooes CGMN-F01 -tMDF01-0-050812 Comormoreisesmi CGMN-F01-1MDF01-O-050812 10 8.00 80 i 2 10 6.24 82 3 5 10 7.36 74 w ws = 100 84.8 85 CGMN-F01-1MDF02-0-050612 Som worzese CGMN-F01-1MDF02-0-050812 Comeoimoracoums CGMN-F01-1MDF02-0-05081"~ Comeonmoracoms CGMN-F01-1MDF02-0-050812 10 7.92 79 in a 10 6.72 67 wn To a 10 7.08 71 ig 100 , 74.8 75 cova ue. C0096742 C0096742 Rep Sms comunesom: oo o CO096742 Spk (3 Comiiomn coms morsomm: = = C00J6742 Spk H ceri coms morse: = C0096744 carina Smomorseosuet 5 a C0096744 Rep Goat Common Wo a & C00~744 ~pk I Cmts Comoro ont Bd - C0096744 S~k J carr cameo omsoossr: = n C0096747 wir Camron worsevous i$ To n C0096747 Rep Comix ComrolnEoess: on " C0096747 Spk K Smal Camroumoooes Sie a C0096747 Spk L Como MOrOY00s CGMN-F01-1MDF03-0-050812 CGMN-F01-1MDF03-O-050812 CGMN-F01-1MDF03-0-050812 CGMN-F01-1MDF03-0-050812 CGMN-F01-1MDF04-0-050812 CGMN-F01-1MDF04-O-050812 CGMN-F01-1MDF04-0-050812 CGMN-F01-1MDP04-0-050812 CGMN-F01-1 MDF05-0.,,050812 CGMN-F01-1MDF05-0-050812 CGMN-F01-1MDF05-0-050812 CGMN-F01-1MDF05-0-050812 0 om or 10 7.24 72 10 6.72 67 10 6.80 68 100 82.4 82 10 7.52 75 10 6.56 66 10 6.68 67 100 80.0 80 10 7.20 72 10 7.08 T1 10 6.76 68 100 71.6 72 N"100St C movr o ayt treasaceeee ecnhromrm aamtan ctasescoo.e.SonTi Sr Sacre SryGON WryeAyHo etbr Exygen Research Exygen Research PPaaggee 44660o7f113300 22009955.,00449900 33MMAA0011555522226677 InItneterriimm RReeppoorrtt##66 -- AAnnaalylyssiissooffCCoottitaaggeeGGrroovvee FFiisshhSSaammpplleess EExxyyggecnn SSttuuddyy NNoo..: PPO0B0O0I1440000 TTaabbllee IIVV.. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff ~'3CC PPFFOOAA iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd -- en sao -- Shei mSoorrson Recovery F..xygen G --_c--oors comscroee rupmoarocsorz n ww W=C C0096750^ carson Courorsiworocsons o a ~ C0096750 Rep^ mmaC Cowie: s n MW C0096750 Spk C^ Commo Comorurome: * " C0096750 Spk D~ Sample CGMN-F01-1LMF01-0-050812 CGMN-F01-1LMF01-0-050812 CGMN-F01-1LMF01"0"050812 CGMN-F01-1LMF01-0-050812 Amount Spiked 50 50 50 500 ~SG-PFOA Amount" Recovered NR NR NR NR Recover3* NR NR NR NR C0096753^ cores rug Comvroriueotoen: " in I C0096753 Reg* Gmmere Comouurmamen 5 i" = C0096753 Spk E^ GERM Comers = " - C0096753 Spk F^ comers counroruorrossers wm C0096755^ comersshas nthe = = C0096755 Rep^ Gre: ComomoroLaoms - = = C0096755 Spk G^ GR Comroororeome = = = C0096755 Spk H^ comers comerrosea: w = C0096758^ C0096758 Rep^ Gomatn Comermorcocus " " = C00967fi8 Spk I~' CTSA Coe WORE ose @ = = C0096758 Spk J^ CGMN-FO1-1LMF02-0-050812 CGMN-F01o1LMF02-0-050812 CGMN-F01-1LMF02-0o050812 CGMN-F01-1LMF02-O-050812 CGMNoF01-3MDF01-0"-050812 CGMN-F01-3MDF01-0-050812 CGMN-F01-3MDF01-0-050812 CGMN-t=01-3MDF01-O-05061~' CGMN-F01-3MDF02-0-050812 CGMN-F01-3MDF02-O-050612 CGMN-F01-3MDF02-O-050812 CGMN-F01-3MDF02-0-050812 50 NR NR 50 NR NR 50 NR NR 500 NR NR 50 NR NR 50 NR NR 50 NR NR 500 NR NR 50 NR NR 50 NR NR 50 NR NR 500 NR NR C0096781 ^ ce C0096781 Rep^ meme C0096781 Spk K^ Comal C0096781 Spk L^ comers C0096782^ oss C0096T82 ReD^ Cotes C0096782 Spk C* Comins C0096782 Spk D~ son C00967B3^ CG MN-F01-3MDF03-O-050812 Comeorem CG MN-F01-3MDF03-0-050812 Coun ose CGMN-F01-3MDF03-0-050812 Comeswore som: CGMN-F01-3MDF03-0-050812 couneorumorooses CGMN-F0 I-3LMF01-0-050812 Cline orcs CGMN-F01-3LMF01-0-050812 Coumroraro osm CGMN-F01-3LMF01-0-050812 Commrorsroisom CGMN-F01-3LMF01-0-050812 cameos CGMN-F01-3LMF02-0-050812 50 NR NR a " 50 NR NR 5 = = 50 NR NR " = 500 NR NR = w= 50 NR NR = = 50 NR NR 2 - " 50 NR NR = = 500 NR NR z = = 50 NR NR SEmnE C0095T83 Rap~ C0096783 Spk E^ C0096783 Spk F^ SNRSISII CGMN-F01-3LMF02-0-050812 CGMN-F01-3LMF02-0-050812 CGMkI-F01-3LMF02-0-050812 a " = 50 NR NR 50 NR NR 500 NR MR C0096784^ carina Comes: prosoasoes 5 " Ww C0096784 Rep^ Comme Corremororooums : " G0O~i'l)4 ~pK O^ Smmin Coronmororooumn = " = C009678,4 Spk H^ CGMN-F01-SMDF01 -.0-050812 CGMN..F01 -SMDF01-0-050812 COMN"I=Ol-OMOF01-0-O,5OI~12 CGMN-F01-5MDF01-0,-050812 50 NR NR 50 NR NR 50 NR NR 500 NR NR C0096785" chine C0096785 Reap Comma C0096785 Spk I^ Commins C0096785 Spk J^ comers: C009~786^ chine C0096786 Rep^ Gres C0096786 Spk C^ Comin C0096786 Spk D~ CGMN-F01-SMDF02-0-050812 comer worsen: CGMN-F01-SMDF02-0-050812 Comte morose: CGMN-F01 -SMDF02-~050812 Como morose CGMN-F01 -SMDF02-0-050812 comrnaoresoason: CG MN-F01-SMDF03-{~)50812 comes oroisosm: CGMN-F01-SMDF03..0-050812 comoreeossm: CGMN-F01-SMDF03-0-050812 comersrem: CGMN-F01-5MDF03-0-050812 50 NR NR 5 " " 50 NR NR " " 50 NR NR - =" = 500 NR NR - - 50 NR NR 2 = = 50 NR NR = = 50 NR NR = - " 500 NR NR ^ 1,0 g of sample u.~ed for extraction instead orS.0 g. grat tn cy re hes. So TVSrp Spec Smr CON NR = Not reported due to qustity cont~'ol result falha'es. See Table VII 'Sun'ogate Spike Recover/Summ~ of 13C-~:OA In ComIx~=Ite Fish Samples' for reanaiyzed results. Sm wee os rte romaine Note: =lnce tills summary tabl~ Shows rounaod results, r~oY~ry values may vary =lightly Worn the values In the raw data. EExxyyggeenn RReesseeaarcchh PPaaggee 74701of113300 22009955..00449911 33MMAA0011555522226688 tIneterriim RReeppoorrtt ##66 -- AAnnaallyyssiiss oofCfoCtotttaaggee GGrroovveeFFiisshhSSaammplpeless EExnyyggecnnSSttuuddyyNNoo..: PPO0O0D011440000 TTaabbllee IIVV.. SSuurrrrooggaattee SSppiikkee RReeccoovveerryy ooff ]'3CC PPFFOOAA iinn FFiisshh SSaammpplleess CCoonnttiinnuueedd empn--------sm--o ------"E Soehrsoe n me oans nRes con Exygen -- oweges opp ww 00 IO come coumnsorsusoiozstz - ww C0096787^ coer Comer seo oases = I C00~6T87 Rep" Som so Eotmerorsae oases a W Nt C0096787 Spk E~ SmBE Camsoraueorcous a " = C0096787 Spk F* corn comersurooz we " C0096788^ cores Comirdrsoso H = i C0096788 Rep^ ComeTasG: Cone emoomen o = = C0096788 Spk G^ Cems Comroiswiroomn = = = C0096788 SI:~ H~ Sample Description CGMN-F01-5LMF01-0-050812 GGMN-F01-OLMF01-O-050812 CGMN-F01-SLMF01-O-050812 CGMN-F01*SLMF01-0-050812 CGMN-F01-5LMF02~-050812 CGMN-FO1-5LMF02~-050812 CGMN-F01-5LMF02~-050812 CGMN-FO1-5LMF02-0-050812 ~:C-PFOA Amount Spiked (ng/ll) 50 50 50 500 50 50 50 500 Aatount Rocovsred (ng/g) NR NR NR NR NR NR NR NR Recovery (%) NR NR NR NR NR NR NR NR p13 Average: 93 wave 1 Standard D~vlatlo~: 19 104 largemd rc td 1506. ^ t.0 g of sample used for extradlon instead of 5.0 g. A er yh rs.Sa a SgnSSrF y4 TOA, NR "~ Not revorted due to luall~y control result failures. See Table VII ~Jr~O~st~ Sptk~ R~o~/Surr~m~ of I:=C-PFOA In CorvovmrnSr yies Composite Fish Samples' for reanalyzed results. Me:So i mr hoe ro, Yolo Yr he Note: Since this summary tal~ shows rounded results, recover/Yalues may very slightly ~ the values In the raw data. EExxyyggeenn RReesseeaarrcchh 22009955..00449922 PaPaggee44880o7f113300 33MMAA0011555522226699 InterimReport 6. AnalysisofCotageGrow Fish Surples ~~ ExygeNno:SPrO00d14y00 Exygen Study No.: PO001400 Interim Report #6 - Analysis of Comge Grove Fish Samples TTaabbllee VV.. SSuummmmaarryy ooff PPFFBBSS aanndd PPFFOOAA iinn CCoommpopsoisittee FFiisshh SSaammpplleess CCamE asaSmSo | Client ~mp~l IO CGMN-F01-3LMW01-0.050812 C GMN-F01-3LMW01-O-050812~ CGMN-F01-3LMW02-O-050812 SORES CGMN-F01-3LMW02-0-050812 CGMN-F01-3LMW03-0-050812 ERNIE CGM N~F01-3LMW03-0.OS0812 fibre) CGMN-F01-SLMW01-0-050812 CGMN-F01 -SLMW02-0,.050812 [= ocoSm = (cre = |e = Pty Weitere aes F EE EE E 127 ~ 116 ~ wm173 8~ = wm o8| zz = 140 6O 170 60 Ee JE CGMN-F01-SLMW03-0-050812 CGMN-F01 .SLMWQ4-.O-050812 CGMN-F0 I-SLMW05-O-050812 CGMN-FOt -1LMFO 1-0-05~812 ERTIES CGMN-F0t -1 LMF02-0-OS081:2 gmsenes CGMN- F01-3MDF01-O-050812 CGMN- FO| -3MD F02~}-050812 Corer worms CGMN-FO1-3MDF03-0-O506f 2 ooTn,, sSeNvAReEn)s| [EE gE ee Cla oo Z| ape 8% rae 0,516 30 0.644 30 CGMN- FO1-3LM F01-0-050812 CGMN-FO1-3LM FO2-0-050812 3.29 30 3.12 30 CONTE|PRR, SCG CGMN-FOt -5MDF01-0-0508'12 CGMN-F01 oSM DFO2-O-05(~ 12 CGMN-F01 -SMDFO,~-0-OSO~ 12 CGMI~I-Fol -SLMF01-0-0.50612 rSeRIw RIER| s ntoSamee:| CGMN-F01-SLMF0~-o-0ro0812 a men Sa 1.00 30 1.06 30 CC| 0% % ND 30 0.~ 30 E`Exxyyggeenn RReesseeaarrcchh 22009955..00449933 PPaaggee 4499ooff 113300 33MMAA0011555522227700 InIntet~r'iimmRRepeoporrtt##66 -- AAnnaallyyssiissooffCCoottttaaggeeGGrroovveeFFiisshhSSaammplpleess. EEx~yyggecnn SSttuuddyyNNoo..:: PPO0000011440000 TTaabbllee VVII.. MMaattrriixx SSppiikkee RReeccoovveerryyooff PPFFBBSS aanndd PPFFOOAA iinn CCoommpopsoisittee FFiisshh `SSaammpplleess . ~;GMN-F01..3LM~N01-Q-050~ 12~ CGMN .F0 I,-3LM~N01-O-05081 ~. Amount 5p~.ed us C4 Sul~ona~ PFB~ Amt Found Amount In Sample Recxwered Recovmy (%) woAmount Spiked C8 ~ PFOA And round Amount in ~ample Recovered 10~ 127 127 140 172 10 45 100 10 173 10~ 173 CGMN.F01-3LMW03..0-050812~ |C088~32 Spk G. lo ng/O Lab 10 140 CGMM-F01 ~LMW0~...O=~0812* 140 177 330 152 183 157 10 100 10 10 CGMN-FOt -1 LMFC-0-050812 CGMN-F01-1 LMFC-0-050812 CGMN-F01-3MDFC-O-050812 GGMN-FO 1-3MDFC-O-050812 CGMN-F01-3LMFC-G.050812 CGMN-I:01-3LMFC.O.050~12 10 100 10 10 IO0 10 100 0.~ 0.8G8 Nn 0.516 3,29 3.29 9.5~ 115 124 106 13.7 120 90 114 124 105 104 117 CGMN-F0 t -5 MDFC-O-050812 Lab Spike CGMN-F01 -SLMFC-0-050812 CG MN-F01 .-SLM F C.O-0,50~ 1 Z 100 10 100 ~.00 ND 10.8 98 130 130 SUTRA rss SmndarU DevlrJon |n~12): 11 `EExxyyggeenn RRecsseeamr'cchh 22009955..00449944 PPaaggee 55000off 113300 33MMAA0011555522227711 -- InIntteerriimmRReeppoorrtt##66 --AAnanlaylyssiiss ooffCCoottagte GraorovvgeeFiFesishh SSaammpplleess Exygen Study No: PO0O1400 Exygen Study No.: P0001400 TTaabbllee VVIILI.. SSuurrrrooggaattee SSppiikkee RRee`ccSooavvmeeprrlyyesooff 1'3CC PPFFOOAA iinn CCoommpopsoisittee FFiisshh Samples Cogn Exygen --_-- coer C0096730" comane C0096730 ReI:P Cmermae: C00~6730 Spk C^ Crsao C0096730 Spk D^ cusere CD093731 ^ C0096731 Rep^ Gmmere C0096731 Spk E^ Doman C0096731 Spk F^ comer C00~6732^ coat C009~732 Rel~ Come C0096732 SI0k G^ Crmmsan C0096732 Spk H^ cow (30141931 cone C0141931 Rel:) Snug C00141931 Spk I Conon) C00141931 Sl:~k J coum C0141932 counzne C0141932 Rep Duma C0141932 Spk K SmI C0141932 Spk L coum CO 141933 corse C0141933 Rep Cuma C0141933 Spk C Dummoas C0141933 Dpk D sap Shes Sample comrwiswumemosona eo10n CGMN-F0t-3LMW01-0-050812 Comeiamoiomn: 0 CGMN-F0I-3LMW01-0-050812 Comeamcom: 10 CGMN-F01-3LMW01-0-050812 comsosaweisews ow CGMN-F01-3~01-O-050812 a CGMN-F01-3LMW02-0.~50812 CGMN-F01-3LMW02-O-050812 Communes CGMN-F01-3LMW02-O-050812 conduc: Ww CGMN-F01-3LMW02-0-050812 a CGMN-F01-3LMW03-O-050812 Commies: 1 CGMN-F01-3LMW03-0-050812 comvaamucew: 10 CGMN-F01-3LMW03-~050812 Commiommosos CGMN-F01-3LMW03-O-050812 comeosumcooser 10 CGMN-F01-5LMWC-0-050812 Smmtincoom: 1 CGMN-F01-SLMWC=0-050812 Commiumcoswn 10 CGMN-F01-SLMWC-0-050812 Commiumcosm: CGMN-F01-5LMWC-0-050812 cour sos: CGMN-F01-1LMFC-0-050812 Camron oom i CGMN-F01-1LMFC-O-050812 ComouuConmi wo CGMN-F01.1LMFC-0-050812 anmmEE 8 CGMN-F01-1LMFC-0-050812 comes soroossan: CGMN-F01-3MDFC-0-050812 Comer orcose: i CGMN-FO1-3MDFC-0-050812 Come wrcommn wo CGMN-F01-3MDFC-0-050812 Commmorcomer Ww CGMN-F01-3MDFC-0-050812 Amount Spiked 10 10 10 100 10 10 10 100 10 10 10 100 10 10 10 100 10 10 10 100 10 10 10 100 "coro 13C-PFOA Amount racosa Racy Recovered e oon w o 6.08 Si & 5.96 in a 6.16 = 108 an 0 8.12 8.16 i= i 8.52 = = 122 a . 8.76 a 5 8.t6 pS - 9.40 " bed 112 os 8.96 on o 8.76 8 a 8,68 Ed I 116 ne ne 11.4 a bi 11.9 ne bi 11.4 W bi 121 ws10.6 we ki 11.0 i on 10A o ji 105 Recovery 61 60 62 108 81 82 85 122 8~ 82 94 112 90 88 87 116 114 119 114 121 106 110 104 105 C014193~ CGM N-FO1-3LM FC-O.~508 | 2 10 9.88 g7 cormiseter Comer mrcocn be C0141934 Rep CGMN-F01-3LMFC-0-0fi0812 10 10.0 100 Duumoar comrowCosont Bo rs ww C0141934 Spk E CGMN-F01-3LMFC-O-050812 10 9,96 100 Diwsar comeiwcouer Ww Er w C0t41934 SI~ F CGMN-F01-3LMFC-0-050812 100 114 114 coms commorcosmn 1 20 " C0141935 CG MN-F01-5MDFC-0-050812 10 9.40 94 counane Sommer mercossars in 2 C0141935 Rep CGMN-F01 -SMDFC-O-050812 10 9.68 97 Queso cowcaprcasmm br C0141935 Spk G CGMN-F01-5MDFC-0-050812 10 9.56 56 Sin Oemacoam: we - C0141935 SI~ H CGMN-F01-5MDFC-O-050812 100 109 109 cours comrosucon wn wo CO1491936 CGM N-F01-5LMFC-0-050812 10 10.6 106 chris Cameosmcoosons i bi br CO141936 Rep CGMN-F0! -5LMFC-O-050812 t0 11.3 113 forte Cameo secon br i C0141936 Spk I CGMN-F01-5LMFC-O-050812 10 11.1 111 Smee) Commiswcooms wo = = C0141936 Spk J CGMN-F01-5LMFC-O-050812 100 129 129 servo 9 Standand Deylatlon: 17 J ---- ^Sample was re-e~racted only. There w~ no compos~ made for this ~mple. Ro So etyor i e YAR 5 , hn 30 Note: SinCe tM= =umm~ry table =~ow= rouncleO results, recovery val~ may vary =llglff~y from ~e values In the raw Exygen Research Exygen Research PaPgagee S511 ooff113300 22009955.,00449955 I3MMAA0011555522227722 Iter Interim RReeppoorrtt ##66 -- AAnnaallyyssiissooff CCoottttaaggee GGr-roovvee FFiisshh SSaammpplleess ExygenStudyNo. Exygen Study No.: PPO00O011440000 FIGURES EExxyyggeenn RReesseeaarrcchh 22009955..00449966 PPaaggee S5220off 113300 33MMAA0011555522227733 IInntteerriimm RReepporot #466-- AAnnaallyyssiissooffCCoottitaaggee GGrroovvee FFiisshh SSearmpplleess ~~ EExxyyggeenn Say Study NNoo:.: PPO0O0D0I1440000 FFiigguurree 11.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFOOAA iinn MMeetthhaannooll i~ . fa Exygen Research Exygen Research 22009955..00449977 Page 5307130 Page 53 of 130 33MMAA0011555522227744 Ir Report 6. AnalyofCong Grove Fi Samples Interim Report #6 - Analysis ofCottage Grove Fish Samples ExygnStyNos Exygen Study No.: PP0O000L1440000 FFiigguurree 22.. NNoonn--eexxttrraacctteedd SSttaannddaarrddss ooff PPFFOOAA iinn M Meetthhaannooll,, 00..55 nngg//mmLL aanndd 11..00 nngg//mmLL,, RReessppeeccttiivveellyy WTRBm en 10.07 os "alle ua t4.88 0.0 Er Time. mlh seu] T jo i 0.~3 3.0? ExypenRecah Exygen R~search 22009955..00449988 age Shot 130 Page 54 of 130 33MMAA0011555522227755 r-------------------------------- nr Repor #6 Anyi Catage Grove Fish Samples Bygen SidyNo: FOO1400 Interim Report #6 - Analysis ofCottage Grove Fish Samples Exygen Study No.: P0001400 FFiigguurree33.. PPSpFFkOOAAA, iiannnCCdoon1nt0trrnoogll/gFFiiFssohhrtBBillfaainnekdk,,C22o..n55trnnoggl//ggFFFiosorhrttiSiffpiiekeddBC,CoRonentstrproeolcltFFiiivssehhly Spk A, and I0 ng/g Fortified Control Fish Spk B, Respectively 1 SE atome esr in rhe am snse enn -- ~) 7120 t4 0 2 2.70 5,_ 3.31 1 .,3.80 ~ 5 ~0 .01~ e,71~ '~ 7 ~,~ ..... en i= 2 8 io) T fw Nm ee ~t7.34 i one " Ses Exygen Research 22009955..00449999 ge 5501130 Page 55 of 130 33MMAA0011555522227766 ---- ee ---------- Interim Interim Report Report #46 #6 - - AAnnaallyyssiiss oofCf Coortataggee GGrroovvee FFiisshh SSaammpplleess Exygen Study No: POOOL400 Exygen Study No.: P0001400 FFiigguurree44.. CChhrroommaattooggrraamm RReepprreesseennttiinngg aa FFiisshh SSaammppllee AAnnaallyyzzeedd ffoorr PPFFOOAA ((EExxyyggeenn IIDD:: CC00009966771100,, DDaatta SSeett:: 102605AA)) WT Be ee et EExxyyggeenn RReesseeaarrcchh 22009955..00550000 PPaaggee 5$660of113300 33MMAA0011555522227777 IInntteerriimm RReeppoorrtt##6-6 --AAnnaalylyssiiss oofCfoCtoittaaggee GGrroovvee FFiisshhSSaammpplleess EExxyyggeennSSttuuddyyNNoo:.: PPI0O0O0L144D000 FFiigguurree 55.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr 13CC PPFFOOAA iinn MMeetthhaannooll wo ' 72 .| EExxyypgeenn RReesseeaarrcchh 2095.0501 PPaaggee 55770o1f113300 I3MMAA0011555522227788 _-- Ii Rep6.oAnarlystis of Cotag Grove Fh Samples Int~'im Report #6 - Analysis ofCottage Grove Fish Samples Exygen Sy No FOOL400 Exygen Study No.: P0001400 FFiigguurree 66.. NNoonn--EExxttrraacctteedd SSttaannddaarrddssooff ]3CC PPFFOOAA iinn M Meetthhaannooll,, 00..55 nngg//mmLL aanndd 11..00 nngg//mmLL,, RReessppeeccttiivveellyy LL Lo Bo Wren ie 10.70 Mh i Bogen Resch Exygen Research 22009955..00550022 Page Sor130 Page 5g of 130 33MmaAo011555522227799 InterimReport#6 -AnalysisofCortag GroveFishSamples Exygen StudyNo:POOOI400 Interim Report #-6 - Analysis of Cottage Grove Fish Samples Exygen Study No.: P0001400 FFiigguurree 77.. F~iCCshPPSFFpOOkAAA,iinnaCCnodonnt1tr0roonllg/FFgiissFhhorBBtlliaafnnikke,d, 22C..o55ntnnrggo//glg FFFoiorsrthtiifSfiipeedkd CCB,oonnttrrooll RRFeiessshppeeSccpttikivvAeell,yyand 10 ng/g Fortified Control Fish Spk B, WT TT mie mnt 5 wl I Fool esmomen sew sm moe an LIN P=cian const EET eee ~0.75 | SRST 10.72 i wa | oe ExygenResearch Exygen Research 22009955..00550033 Page 5907130 Page 59 of 130 I3MMAA0011555522228800 eee eet. IInntteerriimm RReeppoorrtt ##66 -- AAnnalyasilsooyffCCsootittaagsgee GGrroovvee FFiisshh SSaammpplleess EExxyyggecnn SSttuuddyy NNoo..: PPO0O0O0I14A0000 FFiigguurree88,. CPChFhrrOooAmma(atEtooxggyrgraeamnm IRRDe:epprCre0es0se9enn6t7tii1nn0gg,aaDFFaitissahhSSSeaat:mmp1pl0lee26AA0nn5aa4ll)yyzzeedd ffoorr 1*3CC PFOA (Exygen ID: C0096710, Data Set: 102605A) WT TY A ea ne oem enn : BEoxyggecnn RReesseeaarrcchh 22009955..00550044 PPaaggee 66000o7f113300 33MMAA0011555522228811 IInntteerriimm RReeppoorrtt ##66-- AAnnaallyyssiissooffCCaottgagee GGrroovveeFFiisshh SSaammpplleess EExxyyigeenn SSttuuddyy NNoos.: PPO0O0O01L440000 FFiigguurree 99.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFBBSS iinn MMeetthhaannooll = : ame Exygen Resarch Exygen Research 22009955..00550055 Page 61130 Page 61 of 130 33MMAA0011555522228822 Inc Repo rls of CoteGrove Fh Sages Interim Report #6 - Analysis of Cottage Grove Fish Samples Ey Sty No: POLO) Exygen Study No.: P0001400 FFiigguurree 1100.. NNoonn--EExxttrraacctteedd SSttaannddaarrddss ooff PPFFBBSS iinn MMeetthhaannooll,, 00..55 nngg//mmLL aanndd 11..00 nngg//mmLL,, RReessppeeccttiivveellyy NSE me -- O53 i. i . Ben 3mz]l }% Poe Eom Recah Exygen Research 22009955..00550066 Page 6200130 Page 62 of 130 33MMAA0011555522228833 -------------------------------- It Re6pAnty Interim Report #6 - Analysis ofCtaGrogve Feis ofCottage Grove Fish Srl Samples Eye Sy No POI Exyg~n Study No.: P0001400 FFiigguurree 1111.. PPFFBBSS iinn CCoonnttrrooll FFiisshh BBllaannkk,, 22..55 nngg//gg FFoorrttiiffiieedd CCoonnttrrooll FFiisshh SSppkk AA,, aanndd 1100 nngg//gg FFoorrttiiffiieedd CCoonnttrrooll FFiisshh SSppkkBB,, RReessppeeccttiivveellyy i -------- IY Rares NS i i of RRS Pg ]2.41 3 ool I 2 3 4 8 Time, rain 18 t7 Bryn Resch Exygen Research 22009955..00550077 Pear130 Page 63 of 130 33MMAA0011555522228844 Interim Repor 6. AnalysisofCotaGrove Fish Samples Interim Report #6 - Analysis of Cottage Grove Fish Samples Exygen Study No POOOLAOD Exygen Study No.: P0001400 FFiigguurree 1122.. CChhrroommaattooggrraamm RReepprreesseennttiinngg aa FFiisshh SSaammppllee AAnnaallyyzzeedd ffoorr PPFFBBSS ((EExxyyggeenn IIDD:: CC00009966771100,, DDaattaa SSeett:: 110022660055A4)) BC RRR Si he an a | I 2 18 17 Exygen Research Exygen Research 22009955..00550088 PPaaggee66440o1f113300 33MMAA0011555522228855 IInntteerriimm RReeppoorrtt ##66 -- AAnnaallyyssiiss ooffCCoottitaaggeeGGrroovvee FFiisshh SSaammpplleess EExxyyggecnn SSttuuddyy NNoo..: PPO00O0114400D0 FFiigguurree 1133.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFHHSS iinn MMeetthhaannooll gu ~~ Exygen Research Exygen Research 22009955..00550099 PPaaggee 6655 ooff 113300 33MMAA0011555522228866 ee Interim Report #6 - Analysis of Cottage Grove Fish Samples , Exygen Study No.: P0001400 1.0 ng/mL, Respectively FFiigguurree 1144.. NNoonn--EExxttrraacctteedd SSttaannddaarrddss ooff PPFFHHSS iinn M Meetthhaannooll,, 00..55 nngg//mmLL aanndd 1.0 ng/mL, Respectively WES Tr T emen :i 1 NRE 1 NEExygen Research 22009955..00551100 rin Page 66 of 130 3MMAA00115555222287 IInntecrirm RReepporotr#t6 Anis - Analysis ooffCCortataggse GGrroovvee FFiisshh pls Samples yg Exygen SyStudy NNoo:.:PPO00O0L14O0D0 FFiigguurree 11S5.. PPFFHHSS iinn CCoonnttrrooll FFiisshh BBllaannkk,, 22..55 nngg//gg FFoorrttiiffiieedd CCoonnttrrooll FFiisshh SSppkk AA,, aanndd 1100 nngg//gg FFoorrttiiffiieedd CCoonnttrrooll FFiisshh SSppkk BB,, RReessppeeccttiivveellyy BE CTs eet 8 1 ie noe 50 mmm i 3 Tr m= of LE iHE u ; av ~- 4.o,~ 2| `EExxyyggeennRReseseeaarrcchh 22009955..00551111 PPagea6677ogoff1e 13300 33MMAA0011555522228888 nim Repor 76. Ansys of Cong Grove Fish Supls Interim Report #6 - Analysis of Cottage Grove Fish Samples BygenStyNs PHOI100 Exygen Study No.: P0001400 FFiigguurree 1166.. CChhrroommaattooggrraamm RReepprreesseennttiinngg aa FFiisshh SSaammppllee AAnnaallyyzzeedd ffoorr PPFFHHSS ((EExxyygen IIDD:: CC00009966771100,, DDaatta SSeett:: 102605A4)) Wmnn nee se 8.70 :: Hl80- | 1 2 3 4 5 ~ 7 9 EaygenResearch Exygen Research 22009955..00551122 Pagea8or130 Page 68 of 130 33MMAA0011555522228899 -_ iRr AsGrO Fe Sis Interim Report #6 - Analysis of Cottage Grove Fish Samples xn sy o: RROD Exygen Study No.: P0001400 FFiigguurree 1177.. TTyyppiiccaall CCaalliibbrraattiioonn CCuurrvvee ffoorr PPFFOOSS iinn M Meetthhaannooll i pd O~ pts Exygen Research 22009955..00551133 ---- Page 69 of 130 33MMAA0011555522229900 --_-- Inri Re6p.Aonyti ofCoe rove Fish Samples Interim Report #6 - Analysis ofCottage Grove Fish Samples Exygn Sey No: POOIA00 Exygen Study No.: P0001400 FFiigguurree 1188.. N]~oonn--EExxttrraacctteedd SSttaannddaarrddss ooff PPFFOOSS iinn MMeetthhaannooll,, 00..55 nngg//mmLL aanndd 11..00 nngg//mmLL,, RReessppeeccttiivveellyy NETy pe | WIRE 12 43 f3 e o g Time. 1o 11 Ecygen Reseach Exygen Research 22009955..00551144 Page 1006130 Page 70 of 130 33MMAA0011555522229911 Ir Repor6t -Analysisof Cote Gro Fish Sapes ExygenSeyNo:PUDIA00 Interim Report #6 - Analysis of Cottage Grove Fish Samples Exygen Study No.: P0001400 FFiigguurree 1199.. SPPpFFkOOSSA,iiannnCCdoon1nt0trrnoogll/FFgiisFshohrBBtillfaainnekkd,,C22o..n55tnnrggo//lggFFFioosrhrttiiSffpiieekddBCC,ooRnnetstrrpooellctFFiiivssehhly Spk A, and 10 ng/g Fortified Control Fish Spk B, Respectively LE ad . I" f= -A WT ee me LR i " i] ws _so.) Exygen Resch Exygen Research 22009955..00551155 Page 710130 Page 71 of 130 33MMAA0011555522229922 Ir Repr. Anyi ofCage Grove Fish Seples Interim Report #6 - Analysis of Cottage Grove Fish Samples xy Sy Nos: IOO1400 Exygen Study No.: P0001400 FFiigguurree 2200.. CChhrroommaattooggrraamm RReepprreesseennttiinngg aa FFiisshh SSaammppllee AAnnaallyyzzeedd ffoorr PPFFOOSS ((EExxyyggeenn IIDD:: CC00009966771100,, DDaattaa SSeett:: 110022660055A4)) 0 7TTAeweer 2.0e4 - 11.19 we]~.e~ ~ Eo i. 17 Exygen Research Exygen Research 22009955..00551166 Fae 7200130 Page 72 of 130 33MMAA0011555522229933 gTrEr,r OST1 LL sTL Chicago TR 2417 Bond Street - Uren a 0465 University Park, IL 60466 To 7085346209 Fc 0m5245211 Tel: 708 534 5200 Fax= 708 534 5211 _ Joi terki www,stl-inc.cam _ SEVERN TRENT LABORATORIES ANALYTICAL REPORT - 08 NUMBER: 236865 Prepared For: - West1o4n00SWoelsuttioonnsW,ayne. - West ChesBtueirl,dinPgA 15752380-1435 project: confidential Client - Cortage Grove: | - f Attention: Jai Kesar | l bate; 05/13/2005 _ Sigmatufte e yS imgan:atuRei~ ce/.~weJight Name : Ric~C. Nright TTiittllee:: PPrroojjeecctt MMaannaaggeerr BE--MMaaiill:: rruwrriigghhtte@ssttll--iinncc..ccoonm - Bate tlishs Date 2SS4TT1LI7 CChRhioinccaaaggooStreet UU2nn41ii7vveerrBsosniidttyyStPPararrekke,,t IILL 6600446666 PESHAHOxON.NE.::: (((777000888))) 55533344---555222100100 FAX..: (708) 534-5211 . TThhiiss RReeppoorrtt CCoonnttaaiinnss ((3.5~)) Praaggeess Severn Trent Laboratories, Inc, 22009955..00551177 I3MMAA0011555522229944 SSTTLL CChhiiccaaggoo W`Weett CChheemmisisttrryy CCaassee NNaarrrraattiivvee fClrinit Weston Solutions, Ine. Client: Job #: Weston Solutions, Inc. 236865 Fn -- Date Rec'd: 05/23/05 \. Thi araive covers te anys of samples ne shove Job or resctive CN snd 1. This narrative covers the analysis of the samples in the above Job # for reactive CN and Te Te om mt hm tr operons Tot Reo sulfide, flash point, pH, and TOC by the methods cited on the Laboratory Test Results peripages. 22..TThheeanaanlaylyssiiss wwaassddoonneewwitithhiinntthheeEEPPAAhohlodldiinnggttiimmeess.. RRefeeferrttootthheeLLabaobroarattoorryyCChrhoronnicicllee iy Page for dates of sampling, receipt, and analysis. 3 The method banks wees an he reporing iis. 3. The method blanks were less than the reporting limits. + THM ------ 4. The LCS recoveries were within acceptance limits. DE -- 5. See the Quality Control Results page for details of all matrix QC and non-matrix QC. pChei m SectionMFanaege e JO Diane L. Harper Wet Chemistry Section Manager = 305" Date 22009955..00551188 33MMAA0011555522229955 - SSeeMvvEeerTnnATTLrreSenntCLLAaabSbooErraaNttoAorrRiieeRssA-TCCIhhViiocEaaggoo METALS CASE NARRATWE 7 CPCrlloiejeen:ct:t WWIeD:esstCtooonnntSS.oolluuCttoiiolonlnass,geIJnoGc.r. ove - STL Job: Project ID: STL Job#: 22C33o66n88f66.55- Cottage Grove DDaattee RReecetd:: 0055/2233/0055 - 11.. TThhiissnnaarrraattiivveccoovveerrss tthheoMMeeatlalss aannaallyyssiissooffssaammpplleessrreecceeiivveeddiinntthheeaabboovvee SSTTLL fJoobb223366886655.. Method Refs: USEPA, SW-846 Method Refs: USEPA, SW-846 - 22.. AAllll aannaallyysseesswweerreeppeerrffoorrmmeeddwwitithhiinntthheerreeqquuiirreedd hhoollddiinnggttiimmeess.. - 3. 3. AAllll ial Initial aannddCCoonntitinnuuiinngg CCaalliibbrraattiioonnVVereirfifiiccaattiioonn ((ICCVV//CCCCVV''s))wweerreewwitithhiinn ccoonnttrooll ilimisits.. 44.. AAllll Ilnniittiiaall aatnaddCCoonnttiinnuiinnggCCalailbibrarattiioonnBBllaannkkss ((IICCBB//CCCCBB''s)) wweerree wwiitthhiinn ccoonnttrrooll lliimmiittss.. - 55.. AAllll. PPrrepoapraatiorna/MteithoondB/BaMlnaenkktsswhweoerrdeelleesssstthhaanntthheerreepporotinrgtlliiimmniittgss:. - 66.. AAllllIICCPP IInntteerrffeerreenncceeCChheecekkSSaammpplleess ((IICCSSAAaanndd IICCSSAABB))wweerreewwitithhiinnccoonnttoroll llimitits,. 77.. LLaabboorrattoorryy CCoonnttrrooll SSaammppllee ((LLCCSS)) rreeccoovveeriress wweerreewwitithhiinntthhee 8800--112200%9 ccoonnttrrool lliimmiittss.. - 88.. MaMtartriixx QQCCwwaassppeerrffoorrmmeeddoonnaannalatlteerrnnaatteeJJoobb.. - - 105 SGercotmiaonlaManager Seetion Manager - ~[-03 DDaatee 22009955..00551199 33MMAA0011555522229966 GC/MS Case Narrative SSeevveerrnn TTrreenntt LLaabboorraattoorriieess CChhiiccaaggoo GC/MS Case Narrative WCWoenesfstitoodnennStSiooollluutiCilooinnessnt: Cottsgo Grove. JJVCooOobbnANNfDiuduAmembnTbetAiera:r:l: 236865 Client: Cottage 236865 Grove VOA DATA: 1. AAclolllllsescaatmmipoplnl.eesswweerreepprrooppeelrlyypprreesseerrvveeddaannddaannaallyyzzeedd withinthe within the 14-day 14-day hold hold imefrom the dateof time from the date of collection. 2. Allofthe Method Blanks and Extraction Blank target compounds were bethlereoportwing lis. All of the Method Blanks and Extraction Blank target compounds were below the reporting limits. 3. TThhee LLCCSS ((LLaabboorraattoorryy CCoonnttrrooll SSaammppllee)) ssaammpplleess hbaadd aallll ccoonnttrroolllleedd ssppiikkee rreeccoovveerriieess wwiitthhiinn tthhee iinn-- hhoouusseeggeenneerraatteeddQQCClliimmiittssffoorrtthheewwaatteerraannddssooiillssaammpplleess.. 4. MMaattrriixx SSppiikkee//MMaattrriixx SSppiikkee DDuuppliliccaattee aannaallyysseess wweerree mmoott ppeerrffoorrmmeedd oonn tthhiiss ssaammppllee sseett.. 5. AAlllolf the ofthe vvoollaattiillee ssaammpplleess hhaadd ssuurmrooggaattee rreeccoovveerriieess wwiitthhiinn tthhe iinn--hhoouussee ggeenneerraatteedd QQCC lliimmiittss.. 6. TMThehetehTToCCdLL8PP26ssaa0mmBppellneedssww8e0re0re0epBpr.ereppAalarlreecddaluuissbiirnnagtgiMMoneetctrhhiooteddri5Sa00a33r00e..mAAelltll pssaeamrmpmpleleetsshwwoederroeeraaSnnOaallPyyzz(eefddorffmoolilllonowiwmiinnuggmSSRWW8~4466 vlMvaialmeluiuttehess.osfdofTor8hrc2ece6ert0rtaBtraagiiaenntnccdcooom8mpm0opp0uoo0nuuBdnn.sdd)sAs.).lwlTeTchraheeleibqllurooaawwntitoppinotoiaicntnrtetidtueinnsrtiitahhneaegirnietinhtmieitiaeailtlncipcatelaiairllbimbrcaraetalittihoibonornadvtvieoorernir.iSffiOieesPstth(hfeoebrbamassieenriremeppouormrttiiRnngg limits. The target compounds were quantitated using the initial calibration. 77.. AAlllooffttheiinntteermnaall ssttaannddaarrdd aereeass aannddrrteetennttoionnitimmesswwerereewwitithhiinn SSOOPPaacceceeppttaanncceelliimmiittssiassccoommppaarreedd ttoo tthhee ccoorrrreessppoonnddiinngg ccaalliibbrraattiioonn vveerriiffiiccaattiioonn ssttaannddaarrdd.. 88.. TThhee TTCCLLPPssaammpplleesswweerree aannaallyyzzeedd uussiinngg aa 1100..00--mmLL ppuurrggee vvoolluummee wwiitthhaa 11/2200 ddiilluuttiioonn.. JohglaSgDelep. 4-lfes Due 22009955..00552200 33MMAA0011555522229977 SSee`vvGeeCrr/nnTMTrSreBennNttSASeerCrvavisicceeeNssa--rCCrahhtiiiccvaaeggoo GC/MS BNA Case Narrative - J`WWoebessNttouonnmbSSeoolrlu:uttii2oo3nn6ss,8,6II5nncc..C/Conofnifdideenntitiaall CClliieenntt-- CCoottttaaggee GGrroovvee: BJBoNNbAANDuDAmATbTAeAr::: 2TT3CC6LL86PP5 - I1.. AAllll eexxtratctrioansacanntddaiannaoallynyssesess wweerree ppeerrffoorrmmeedd wwiitthhiinn rreeccoommmmeennddeedd hhoolldd--ttiimmeess.. 22.. TThheeMMBB((MMeetthhoodd BBllaannkk))aanndd tthhee EEBB ((TTCCLLPP bbllaannkk)) ssaammpplleess hhaaddaalll aannaallyytteess uunnddeetteecctteedd. . 33.. hTTohhueesLLeCCQSSC((LLlaiabmbiotorsra.attoorryy CCoonnttrrooll SSaammppllee))hhaadd tthhee tthhrreeee ccoonnttrroollssppiikkeerereccoovvereirieess wwiitthhiinn tthhee iinn-- house QC limits. 44.. AAMMSS ((MMaattrriixx SSppiikkee)) wwaass nnoott ppeerrffoorrmmeedd.. - 55.. AAllll ssaammpplleess hhaadd aallll ssuurrrrooggaattee rreeccoovveerriieess wwiitthhiinn tthhee iinn--hhoouussee QQCC lliimmiittss.. 66.. AAlillmllitsssaammapsplcleeosshmhpaaaddreaaldllltiionnttteehrmenaacllorsstrtaeannsddpaaorrndddiaanrrgecaacssalaainnbddrarrteeittoeennnvttieioroninfttiicmeatesisonwwisittthhaininndattrhhdee.SSOOPP aacccceeppttaannccee limits as compared to the corresponding calibration verification standard. _ 77.. AsAlallmlpsslaaemmspapllneesds wwteheerreTeCeexxLttPrraaBccltteaeddnaaknnwddasaanneaxaltlyyrzzaeecddteffdoolllsloiownwiignngg1UUSS0EEPP0AoAfStS-WhWe88mT44C66LL88P2277l00eCCacpphrarototeto.occoTol.hl.eTTMhhBee - alsaiannmmdditpttshhleeewseLLarCCneSSdadtwwhjeeeursrTeeteCeedxxLtftPrroaarBcctttlheeaeddnekuuxsswtiinranagsgse11ixo00tn00r0a0vc-o-mtlmeuLdLmouoefssfid.dneegiioo1nn0ii0zz-eemddLwwaoatetfertr.h.eTTThhCeeLrrPeessuulellattssehaaanntded.rreeTpphooerrttMiinngBg limits were adjusted for the extraction volumes. - (ofp GGGaCarrIyyMRRSyynrSakekacartrion Manager GC/MS Section Manager hls DDaattee 22009955..00552211 I3MMAA0011555522229988 te 1 se rin 5TL Chicago is part of Severn Trent Laboratories, Inc. a : Job Humber.: 236865 . customeP...: geston $okut|ons, Inc. EE Ep Attn ....... : Ja{ Kesari RE ELL Project ~urrbar ......... ; EE customer Project Io .... : Project Description .... : EE 20005459 CONF. - COTTAGE GROVE Confidential Ctient - mre Oottage Grove oo emo 236865-1 wrt [emo so 236865-2 [mi 236865-3 [at 236865-4 vs [momen 236B65-5 rs | om 236865"6 ear [mmr soe 2~6~65-7 an [mmo soe 236865-8 C6HN SBC D201 0 0200 C6MN SBC D104 0 0100 C6HN SBC D104 0 0450 C6MN SBC D103 0 0350 C6MN SBG 0103 0 0500 C6RN D2005 C6~N SBC D501 0 0150 C6HN SBC D801 0 0050 Torn soil || soil on| Soil or| SoiL forms| SoiL worn| So~L | || SoiL 05/17/2005 05118/2005 05118/2005 05/19/2005 05/19/Z005 05/17/2005 05/20/2005 05/20/2005 [ron11;30 [oa| ro 09:45 [ovr | om 11:20 [oven | om 08=35 | | om 09:30 | | on 13:00 |r | | om 10:00 es | | oo 11:05 05/23/2005 05/23/2005 05/23/2005 05/23/2005 05/Z.~/2005 05J2]/2005 05/2~/2005 05/23/2005 10;25 10:25 10:25 10:Z5 10:Z5 10:25 I0:25 10:25 Page I 22009955..00552222 33MMAA0011555522229999 HIE ef 3 -- fH BI i EI 2 CEN - 0 i 4s - Thm fC - HEl o REE :- i i a il | : =fio Hy iisE: - fly ERLElel ok ti[5E . Hila HB NE HH 2[i3 toe [3] Big i A iR HE i Hi l f 22009955..00552233 2 ;i : ii : . 33MMAA0011555522330000 Be 1] i 8 i 2 om oM |zl oy| on 0 zo i rl (8 dg TOR fi - cl 3 i i c- EE| 4=]| Lk fi i heI EgEe Bl SE hs | I :sdll lg bl aaE (ys 22009955..00552244 ; :E : 3MMAA00115555223301 Bb: HIBi Coon -) 15: iE :H 5ma I i _ |i 5 a a |2] - mo CE FI TERE - a. i RH i I: 3 - Hio]ls: h: s - A g; 2 8 - HH1E;RE:|g] E sen E[70588 iEg gHEi ] Hi:l i wn 22009955..00552255 i$5 : <:i 33MMAA0011555522330022 . [Es : gl 5 EE bi = ilHe i:ls Hl 13] . EE Ll]TE zfs dog hi | a Hl fo i i: J #c8y i3 BIE as |g) HPpENfeEnHIREE[lH EE | #1 i B = 22009955..00552266 - - - = i~ Po iEio :co .. 33MMAA0011555522330033 7 I: | g's - EB 5 3 I in - i CogE = 1B] in | Hl : _ i| t 30: lis . - HIRE i 5 #] 85zo fi 2 53 _ Hip |g ig HERR] : 22009955..00552277 :5 i: : . 33MMAA0011555522330044 II |A 13 I adtE of 3 # 3238838% EEE Ci15 5fF8 5 SahonEen saas ETawTe 8 =T.8E88Ee3 am : RE I :2 a i aos, 4 oni 3 J i ole H ago| 2e5 HH S| EbpT : 3 23s :i |w 1fB.ad6g:i.i.ed; oBotsll IEE 5 Lal FREEREITHR TI BHlAy LIT IEE gE en BEL 0 eRS Best | 2 rary 22009955..00552288 3MMAA00115555223305 [E[ssassass sssessssss ~ i 1d SEE888 Ba sossosongy _ i5 | ssans 3EFIRINES : le|tn nnn ~ i 2 on Lg s2esases sngansoREa ; Phz gle ss38833338 - i dE lHijmiiianhsdaailsdeh - LPI1R3R BE Enka HER HER|HR gi pee :sHo lg] a i i 22009955..00552299 i:; i: . 3MMAA00115555223306 TE ; : eos .3 B Ph EF . REE i ; ; Ey i3 H 2 Ei E i 3 is i EEE |g RE i 3 [gl amt [i5 22009955..00553300 |ii$ : i3 . 33MMAA0011555522330077 Er [Ll E3: le _ 7 gs - dh = dL iy - fsDo lwg Bh Eon y = o Co HEills a -) ! i #|| 38z338. | 28Eg2 sk 22009955..00553311 }!x 33MMAA0011555522330088 i ---- . Chicago is part of Severn Trent Laboratories, Inc. nr p-- Job N~'nber; 236855 LABORATORY CHRONICLE Date~ 06/13/2005 nwDeErg eva G ScimcE er on e wwei ee cose m oe eent Lab 10:236865-1 A RE METHOD ERT : EDD [Jp Lloyd Kahn Client ID: CBMH SaC 0201 0 DESCRIPTION Electronic Data Deliverable Total Organic carbon (soils) 0200 hJWELsS Clr 400 sBeR a css Lab ID: 236865-2 HEEEd T Ee METHOD E Lloyd ~ahn Client ID: C~N SBC 0104 0 0100 DESCRIPTION Total Organic carbon (eDits) EHEe SEEp cn co o s BG gl Lab ID: 23~65-3 Ee METHOD HE Lloyd Kahn Client ID: CBMM SBC 0104 0 0450 DESCRIPTION Total Organic Carbon (Soils) hWHEEeE CRyETcmTe oun oBriEiE SsT moIcees Lab ID: 236865-4 METHOD 0 B Lloyd Kahn Client ID: CBNN SBC 0103 0 0350 DESCRIPTION Total Organic Carbon (Soils) T WTEEE Ro ET BYREE Ree y lly Lab ID: 236865-5 METHOD HE Me LLoyd Kahn Client ID: C~HM SBC 0103 0 0500 DESCRIPTION Total Organic Carbon (Soils) oWERE Et E unersnoEm pByIeEe oar Lab ID: 236865-6 H I METHOD a pr 50308 BE EE 5030B ie RE. PEE, EEE 3010A jhiBEo EESEaRrEaceSmn orETeR(BEe) a.., P1 sEeme Etome users Imo 3510C Pm HEERRRG EEEE BEE 3510C ihp GENER OR P[EE GEE 1010 m ENTE [EEEERe,n AohEE E 7470A E OW 50108 EEE og E EE 7.3.3.2/9014 Ee | ER ee HeEE 7.3.4.2/9034 w 7470 [QO 8270C BO EE 1311 Se ideE se | 2 #E Eg 1311 HER e {OBE pon SHEE 82~08 EE wa ~045C Client ID: C~MN D2005 DESCRIPTION 5030CP TCLP/SPLP Prep 5030CP TCLP/SPLP Prep Acid Dis. Leachates (I~P) Extraction for TCLP (SVOC) Extraction for TCLP Ignitability (Pensky-Martena Closed-Cup) Leachable, Mercury (CVAA) Leachable, Metals Analysis (ICAP) React~v|ty, Cyanide Reactivity, ~u(~de SW846 Dig. Leachates (Hg) Bamivo~atile Organics TCLP Extraction TCLP Zero Headspace Extraction Volatile Organics pH (Sott) gEHEEr Rcn mo oySeset Lab ID: 236~65-7 ET HRE TE Re METHOD R RHE Se Lloyd Kahn Client ID: CBNM SBC 0501 0 0150 DESCRIPTION Total Organic Carbon (Soils) EgERee E gdigmE cm mento ouBe REc sets at Lab ID: 236865-6 E IE METEOD TH HE Lloyd Kah~ Client ID: C6MN SBC D801 0 0050 DESCRIPTION Total Organic Carbon (sails) Date Recvd: 05/23/2005 RUM# BATCH# PREP ET 1 1 150758 150758 Sar~ole #IS) Date: 05/17/2005 DATE/TIME ANALYZED 05/27/2005 1150 Date Reevd: 05123/2005 Sample Date: 05/18/2005 RUN# BATCH# PREP 87 #($) 1 150758 150758 DATE/TIHEANALYZED 05/27/2005' 1357 Pate Recvd: 05/23/2005 Sample Date: 05/18/2005 RUH# BATCH# PREP BT #IS) 1 150758 150758 DATE/TIME ANALYZED 05/27/2005 1421 Date Recvd= 05123/2005 Sample Date: 05/19/2005 RUN# BATCH# PREP BT #IS) DATE/TIHE ANALYZED 1 150758 150758 05127/2005 1441 Pate Recvd; 05/2312005 Sample Date: 05/19/2005 RUN# BATCH# PREP BT #IS) I 150758 150758 DATE/TIME ANALYZED 05/27/2005 1502 Date Recvd: 05/23/2005 Sample RUN# BATCH# PREP 8T #IS) 151302 151452 149954 149796 150294 149796 150847 149796 150475 150446 150181 151121 150183 150 75 150444-149796 149954-149796 150073 150183 150444 151188 150847-149796 1497~6 150105 151453 151452-150105 150926 150926 Date: 05/17/2005 DATE/TIME AkU~LYZED 06/0712005 2046 06/09/2005 05125/2005 0750 1820 05/27/2005 1700 06/0312005 0700 0513112005 1244 05/27/2005 1538 05/2612005 1813 05/26/2005 1159 05/27/2005 0929 05/27/2005 1015 0610612005 1824 05/24/2005 1345 0512612005 1400 06/0912005 0750 Date Recvd: 05/?_3/2005 Saw,Die.Date: 05/20/2005 RUN# BATCH# PREP BT #IS) DATE/TIME ANALYZED 1 150758 150758 05/27/2005 1536 Date Recvd: 0512312005 RUN# BATCH# PREP 8T 1 150758 150758 Sample #IS) Date: 05120/2005 bATE/TIME ANALYZED 05/27/2005 1~07 ue DILUTION ur we DILUTIOM su DILUTIOH ou DILUIlON DILUTION ew1.00000 1.0000 cue DILUTION un DILUTION iPage 11 22009955..00553322 33MMAA0011555522330089 ane STL, Chicago is part of Severn Trent Laboratories, Inc. Job Number.: 236865 S U.R R 0 G A T E R T [So ver sation, ine Method ..... ;..: Votatite - I Method Code,,.: 8260B Lab 10 a2LCD LC$ Sr MB DT Sampte ]D Organics. 236855- 6 C6MM D2005 236~58--21 EB1 aoieer: EC0VER ! E S RE cow corms Ge P 0 R T enn Report Date.: 06/13/2005 ATTN: dot Neaart Test Matrix,..: TCLP Leach Batch(s) ...... : 151453 Date 12DCED BRFLBE DBRFLM TOLD8 Br EE g 7% 06109/2005 104 100 95 95 06t08/2005 104 101 95 97 BEE Y OEE O6/OB/2005 114 96 98 94 06/09/2005 106 95 98 94 06/09/2005 108 91 100 96 Prep Batch..: 151452 Test Test Description Limits ~ hm Sibert (en 12DCEB BRFLBE DBRFLM 1,2-DichLoroethane-d4 (surr) 4-Brol~ofLuorobenzene (surf) Dibromofluoromethane (surf) TOLD8 Toluene-d8 (surf) i 62 - 127 67 - 132 77 - 119 81 -126 Page 22009955..00553333 33MMAA0011555522331100 STL Chicas fe pare of Severn Trent kersaris, I. STL Chicago is part of Severn Trent Laboratories, II~c. ie ane. 25085 Job Number.: 236865 Rept aut. 4/12005 SURROGATE RECOVERIES REPORT Report Date.: 06113/2005 wee Ceow oreeee ome a ke otros Smatetteorien Method...... ..: ~emivo|atite Organics tne i} E570 Method Cede...: 8270 ww oss LaD ID DT 5ample ID wEB1 &EB1 iEB2 ieLCS B-ass: con 2003 MB Tent arr TEL eh rep tehToT Test Matrix...: TCLP Leach frre Batch(s) ...... : 151188 Prep Batch..: 150847 re soe rie aren wis pews mon Date 246TBP 2FLUBP ZFLUPH N1TRD5 PHEND5 TERD14 women mm wom 06/06/2005 57 71 56 81 36 78 Wns yw 0B nooB om 0610612005 57 68 53 79 35 80 Gms % & Bo oun 8 06/06/2005 62 67 53 81 36 85 wpizes & wo wow ou 06/0612005 63 82 57 87 38 94 SGmhiEees H ROnR o0&8 &Rn o% w0%m 06/06/2005 59 T5 62 85 40 88 TestTest Wow 246TBP fr 2FLUBP Im 2FLUPH rd NITRD5 TENE PHE~D5 To TERD14 Test serpin Test Description Ze Trbrommneno sur 2,4,6-Tribromophenot (surf) ey Z-F[uoroblphenyl (surf) Eire carry 2-F[uoropheno((surf) Wrenn6 te) Nitrobenzene-d5 (surr) Paid canes Phenot-d5 (surr) Tarp hr Terphenyt-d14 (su~r) units Limits ER) 29 - 126 o34 - 112 Hil 21 - 100 Sil 38 - 113 Bim 18 - 100 ols 10 - 119 Page 13 22009955..00553344 33MMAA0011555522331111 JJoobb MNuummbbeerr.;: 223366384655 CUSTONER: Weston Solutions, Inc. QUALITY ` CONTROL RESULTS | PROECT: Conf, + corTAGe chove. RReeppoorrtt aDtaet.e.: 0066//1133//22000055 ATA: sat Reseed RTeIen nBeette omen Test Method........ : 82TOC M~thod Description. : SemJvolati le Ors~nics Tmaim r con sa Equipment Code .... = GCLIO Batch ............. : 151188 [rr Analyst... TtE ePa,Tresroatr enaeri E SUAnltsT fede GE Rone eTeevaleve Orin. vain 6 aele m+ Limits | -- Pyridine,TEULeach wn 700.900 - = Parameter/Test Description Pyrid{ne, TCLP Leach Jose 1,4-Dichtorobenzene, TCLP Leach Uni ta ug/L ug/L QC Result QC Result 200.000 U 100.000 U ' True Value Orig. Value QC Catc. * Limits Ehime os 1 een WA Te Z-Methytpheno[ (o-cresol), TCLP Leach ug/L 100.000 U oars: Ta Ahh FH Hexachtoroethane, TCLP Leach ug/L - EE ew 4-Methytphenot (m/p-cresot), TCLP Leac ug/L 100.000 U 100.000 U BE Nitrobenzene, TCLP Leach ug/L 100.000 U ECT we 3 SEY Hexachtorobutadiene, TCLP Leach" ug/L 100.000 U Z,4,6-Trichtoropheno~, TCLP Leach ug/L Fst te seu 2,4,5-Trichlorophenot, TCLP Leach ug/L 100.000 U 500.000 U pmamfLe w mes 2,4-Din~troto[uene, TCLP Leach uQ/L 100.000 U t peosilegtta-Sit-(- -H Rexachlorobenzene, TCLP Leach ug/L 100.000 U Pentach(orophenoL, TCLP Leach ug/L 500.000 U Po te Page 14 RE, Rr, dea UA, RBI * ~=~ REC, R=RPD, A=ABS Diff., D=% Diff. 22009955..00553355 33MMAA0011555522331122 Job Number.; 236865 QUALITY CONTROL RESULTS " Report Date.'- 06/13/:)005 I QC Type ~ Description Reag. Code I Lab ID DiLution F~tor Date ' mr Test Method ........ : 8270C Toes conc sa Equipment code .... : gCLIO Tost Anatys~...: dpk Method Description.: Semivo[atile Organic~ Batch ............. : 151188 EE PasSmta/eTeswDwngT_ne fte_ teak fede e Te veon ]Or1la Yon 0Gf ar eLimite 1 Parameter/Test Description Units Ta wr mew Pyridine, TCLP Leach Teioattere 12 Lesh FE 1,4-Pichtorobenzene, TCLP Leach 2-Methytphenot (o-cresot)~ TCLP Leach oahloraTretLnakt, Ug memo HexachLoroethane, TCLP Leach Ree Gu eressty, Ter Lene UA 00.000 4 4-Methytphenot (m/p-creeo!)~ TCLP Leac ese ES Fe oon Nitrobenzene, TCLP Leech Hexachtorobutadiene, TCLP Leach TRTI asTae oxime 4 2,~,6-Trichtorophenot, TCLP Leach Bene, TAP Loh tan 000m u 2,4,5-Trich(orophenoL, TCLP Leach pride At mono 2,4-Dinitroto|uene, TCLP Leach Haakon 10 ey aA my BexachLorobenzene, TCLP Leach Tennent 0 tx dow Pentachtoropheno[0 TCLP Leach ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/~ ug/L ug/L ug/L ug/L QC ResuLt 200.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 u 500.000 U 100.000 U 100.000 U SO0.O00 U ResuLt True VaLue Orig. VaLue gC talc. * L{mits F Pa 1S RR, ED, a DF, DR 11 Page 15 * ~=X REC, R=RPD, A=ABS Diff., D=~ Diff. 22009955..00553366 I3MMAA0011555522331133 doJbob MNuummbbear..:;22336688655 QUALLEr TTHY CO LN aTkReOsL WReEsSuUiLsTsS RReeppoorrttDDaattee..::080/6/1133//22000055 Lewm [| gC Type___J oobin Descr fption JJ tenow| wn Reag. Code ~ID Jowimmme ATTN: " 'iii!!i!ili!ii~!::I' D~tution Factor ow] ~: ~iiiii:.i : : Date " Time - TToesstt MMeethtohd .o..d........: 8e22770cC NetSh esh: Semrstatiteorcs RATT Method Description.: Semivotatite Organics `EEqquuiippmmeenntt CCoodde.e...... : GGCLI'OI.O Batch ............. : 151188 AAnnalaylsyts.t...: dpk - E rme Seri e ie endr tt rme e|T Sonoe eTe+e vwye] Pyridine, TOP Leach Parameter/Test Description Pyr~dine, TCLP Leach Units wi ug/L T 1,4-Dich[orobenzene, TCLP Leach ug/L B feST eSea 2 Ts 2-Nethylpheno[ (o'cresot)a TCLP Leach ug/L st TA oom u Hexachloroethane, TCLP Leach ug/L Si4-Methylphenol (m/p-creeD|), TCLP Leac ug/L Ceste a GIS:e1e toe ar Jick Mitrobenzene, TCLP Leach T EE REE Hexachtorobutadiene, 1CLP Leach u~/L uQ/L fmd et, mn me 2,4,6-Trich[oropheno|# TCLP Leach Ug/L He emm en Gd om me 2,4,5-Trfchtorophenot, TCLP Leach ug/L Co mTSentedne i nway 2,4-Dinitrototuene, TCLP Leach ug/L e 105 sn med Bexachlorobenze~e, TCLP Leach ug/L Wn mY Pentach[oropheno[, TCLP Leach ug/L QC Result 220000.,000000 0U 100.000 u 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 500.000 U 100.000 U 100.000 U 500.000 U QC Result True Value Or~g. Value OC Calc. * Limits F - = pete Page 16 x, ra, as ur, omit. * ~% REC, R=RPD, A=AB$ Oiff., D=% D{ff. 22009955..00553377 33MMAA0011555522331144 ry ---- Job Mumber.: 23~865 CUALTTY cenrRer nEReLTS QUAL ] TY CONTROL RESULTS CUSTOMER: Venton Sotuttans, Tne. LIeTvreee [ n oameon Heihod Description. Test Method........ : Method Description.; Sentvalatite 8270C Semivotat||e oOrrggaanniiccss . PROIECT:GNF. COTTAGEGRRE [toTampeer |erwo Shere + Sites Equipment Code.... : 6CLI0 Batch ............. = 151188 [EEPreaetoroverimptaioni nls estoa meenLo ewerarYom _ Parameter/Teat Description Units w TERE e SSE mE Pyridine, TCLP Leach 1,4-Dichtorobenzene, TCLP Leach o Else e (ocreicl, TEP Leach Sah ws mee 2-Methytphenot (o-cresot), TCLP Leach raters Cpe, 1 pA im wee Hexachtoroethane, TCLP Leach piles 65 LoseSA foes mas 4-Methytphenot (m/p-creso[), TCLP Leac ug/L ug/L ug/L ug/L ug/L EE a an a mh Nitroben=ene~ TCLP Leach re r 3 2a ma Hexachiorobutadiene, TCLP Leach susiidl v aa dems 2,4,6-Trichtoropheno[, TCLP Leach Heseml itdg un Fed mae 2,4,5-Trichtorophano[, TCLP Leach eas a gi mow 2,4-Dinitrototuene, TCLP Leach Tea Ta zi wm ~exachtorobenzene, TCLP Leach ug/L ug/L ug/L ug/L ug/L ug/L r A a5 foc Pentachtorophanol, TCLP Leach 'ug/L' gC Resutt 63,016 78.095 76.857 72.158 74.011 79.886 ~2.966 85.824 82.419 ~5.191 ?5.485 67.542 QC Resutt True Vatue 100.000 100.000 100.000 100.000 100.000 IOOLO00 100.000 100.000 100.000 100.000 I00.000 100.000 [-- | Report Data.: 06/13/2005 me 1 Toterere |ome vim| re Ana|yst...: dpk J I O[ r. tor e ene e. s + tr] ae Orig. Vatue OC Calc. "* Limits F mmVE YEE 20.000 10.000 we ur 3 we 10.000 evn i ie 10.000 wes un 3 EE 10.000 WE in oh 10,000 EELS 14 10.000 om us 3 4 10.000 REBUY Gam 50.000 mem oR Faw 10.000 mew ui 10.000 +A id 50.000 U 63 U 78 U 77 U 72 U 74 U 80 U 63 U 86 U 82 U 85 U 75 U 68 ~ 16-100 % 38=100 % 37-100 ~ 34-100 ~ $1-105 ~ 41-100 ~ 51-101 % 54-I07 % 56-115 % 50-113 % 50-112 ET Page 17 * TR Cp ~=~ REC~ R=RPO, A=ABS Diff., 9=% D~ff. 22009955..00553388 I3MMAA0011555522331155 mT Job NL~ber. : 256865 QUAL I TY CO~T ROL RESULTS TT Report Date,; 06/13/2005 i Test Method ........ : 8270C res EERIE meow Method Descrlption. : Semivolati te Organics Equi~ent Code .... : GCLIO Batch ............. : 151188 /Inatyst... :. dpk |ErET EE iEFne rEee,B8ToTT BE ateaese EST EET+ atwe]1 = Fyridire, TCP Coach wr B00 - = Parameter/Test I)escription Pyridine, TCLP Leach 1,4-Dichtorobenzene, TCLP Leach EEeSeiEii TESI 1 BEL 2-Hethy[pheno[ Co-cresol], TCLP Leach Units ug/L ug/L ug/L QC ResuLt QC Resutt 20.000 U 10.000 U 10.000 U TPue Value Orig. Va[ue QC Catc. * Limits m g Hexschtoroethane, TCLP Leach ug/L ew ERmE ~-Methytpheno[ (m/p-cresot), TCLP Leac ug/L 10.000 U 10.000 U Nitrobenzene, TCLP Leach ug/L 10.000 U EER BERG 25 Trientorohenal, TCLS Leseh wan Hexachtorobutadiene~ TCLP Leach 2,4,6-Trich[orophenot, TCLP Leach . EpLSEEamRRLaEER oI@ g 214pS-Trich[orophenot, TCLP Leach ug/L ug/L ug/L 10.000 U 50.000 10.000 50.000 U U 3 gEE! 2,4-D~nitroto[uene, TCLP Leach ug/L 10.000 U Hexach[orobenzene, TCLP Leach ug/L 10.000 U Pentachlorophenot, TCLP Leach ug/L 50.000 U } ha, om, sot,va, Page 18 * ~=% REC, R=RPD, A=ABS D~ff.~ D=~ Diff. 22009955..00553399 33MMAA0011555522331166 so nk. 215 Job Mumber.: 236865 "anaeR: eaten solo, SUALITY control nesuirs QUALITY CONTROL RESULTS niet or. GOTTA GOR Soar Bu. 413720 Report Date, : 06/13/2005 Re RetBer pis Untaite organic Teat Method........ : 8260B Method Description.; Volatile Organics RE Equ|pm=nt Code .... ; GCL16 Batch ............. : 151453 prs Analyst... : anjdn ErPar[ seeabeR rt Parameter/Test Description [EEEWa Vinyl chloride, TCLP Leach 1,1-DichLoroethene, TCLP Leach Jasiaty iat 2-Butanone (HEK)~ TCLP Leach iret, Ta sn Chloroform, TCLP Leach SEE carbon tctrachloride~ TCLP Leech Seen: 7 Loh Benzene, TCLP Leach Siren, er a 1,Z-Dichtoroethane, TCLP Leach THs Ed he Trich,toroethene, TCLP Leach TnSTan es Tetrach.toroethene, TCLP Leach aren, Tei hah Chtorobenzene, TCLP Leach niTtsETfelt ot hemsTL eTre van Ore is. Value 46 al.e + viia ts 1 Units ug/L Sa ug/L @oRE ug/L @oRE ug/L WA RR ug/L wom ug/L a mw ug[L woe ug/L Bt ie ug[L So Sy ug/L QC Result !00.000 o IO0.O00U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U QC Result True Va{ue Orig. Value IC Catc. * Limits Fonts Page 19 + Ee, ha,An of, Oi * ~=X RED, R=RPD, A=ABS Diff., D=~ D~ff. 22009955.,00554400 33MMAA0011555522331177 eve er Job f~umber.; ;~36865 0Uk L I TY C0N TR0L R E SULT$ Report Date.: 06/13/2005 CI Hoatbomd OeIsaEriptisnT:ws VotsaEt me E Toe wE [T mT n Jomm= ]oe] Test Method........ : 8260B ite crgmics Reh he Hethod Deacription..- Votatite Organics Equipment Oode .... : GCL16 BatcM ............. : 151~53 Anatyst...: jdn S TE [erm inea e[i ge e a ree T Ch eT [ea + ea] Parameter/Test Description R SES Ii Spiraea Vinyt chtoride, TCLP Leach Voce oes nm mn on em orn o}1% 1,1~Dichtoroethene, TCLP Leach 2-Butanone (MEK), TCLP Leach eo Tome wm em meme BE ch{oroform, TCLP Leach Cla em mo WIE Carbon tetrachLorlde, TCLP Leach ~ r------ Wwe em eh in Benzene, TCLP Leach Tce isan ae nn oly Ao 1,2-Dtch(oroethane, TCLP Leach ein an an mee mean 3% Trich[oroethene, TCLP Leach ri ra wm ram mah 3% Tetrachtoroethene, TCLP Leach CETWAT mn pe ChLorobenzene, TCLP Leach Units ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L QC Resutt 440.306 604.904 409.448 510.036 541.028 454.428 533.606 506.326 464,206 455.818 QC Resutt 430.582 $96.438 418.416 502.236 536.628 456.948 530.044 '499.046 477.414 463.848 True Value SO0.O00 500.000 500.000 500.000 500.000 500.000 500.000 500.000 500.000 500.000 Orig. Vatue QC Catc. * Limits F 100.000 100.000 100,000 100.000 100.000 100.000 100.000 100.000 100.000 100.000 U 88 2 U 121 1 U 82 2 U tO2 2 U 108 1 U 91 1 U 107 I U 101 I U 93 3 U 91 ~ 52-134 R 20 % 51-136 R 20 % 29-139 R 20 % T5-122 R 20 % 64-132 R 20 % 75-122 R 20 % 67-t20 R 20 ~ 75-124 R 20 % 70-125 R 20 ~ 76-116 2 R 20 Page 20 * %=~ REC, R=RPD, A=ABS Diff., D=~ Diff. 22009955..00554411 33MMAA0011555522331188 Te sss Job Number.: 236865 QUALITY CONTROL RESULTS . nN Report Date.: 06113/Z005 LA SomTIR T S wm T TomTeE Rs |rwlnTToEwnTe ewe] Teat Method........ : 8260B Method Description.: Va|ati[e Organ{ca Equ|pment Code .... : GCL16 Batch ............. -" 151453 Analyst...: jdn J (Er aman aTore Tameaw) !z!:: :::~!::i::!!::.::i ! ': ]: ::.::~::~,:~ ~,:~::::::::::::::, .':::::-: ......... ~:.::-. ::.: :: ::::: .:::::.:-..: :::! ~,,.., .~,: ...........: :::::::.:: :. ........ : ......: ....... " i] "i' '"IT e rH Sa AY BY) Parameter/Test Desoription VVTin|ylonyrlcchhclholirocririaddseet,,heTnTCeGLLTPPELLLeeaacLchh,os 1,1-Dich&oroethene, TCLP Leach fgraa #I oa% EERE HE] 2-Butanone (MEK), TCLP Leech EErma ll, Eo = EBEE EEOE] chloroform, TCLP Leach f NST @EmooEHe min IR Carbon tetrachloride~ TCLP Leach peamnme SH E HEER mmmmiaE IE Benzene, TCLP Leach a H 1p 1~2-Dichloroethane, TCLP Leach FETE. EEo OEBE BEEE EmmEsb ig: Trichloroethene, TCLP Leech B Ed TeSrachlorosthene, TCLP Leach E BRIS 1 RE Chlorobenzene, TCLP Leach Units wnwugi/L ug/L ug/L ug/L ug/L ug/L ug[L ug/L ug/L ug/L QC Result Seize a430o.5s82 596.438 418.416 502.236 536.628 ~5&.948 550.044 499.046 47~.414 46~.848 QC Result 0000 True Value 550000..006000 SO0.O00 500.000 500.000 500.000 500.000 500.000 ~00.000 500.000 500.000 Orig. Value QC Calc. foo0m ie 110000..000000 UU 686 100.000 U 119 100.000 U 84 100.000 U 100 100.000 U 107 100.000 U 91 100.000 U 106 100.000 U 100 100.000 U 95 100.000 U 95 ~ " ~. * Limits XSi ET ~ 52-134 X 51-136 X 29-139 ~ 75-122 X 64-t32 % 75-122 % 67-120 % 75-124 % 70-125 % 76-116 2Page 21 = tare Sen wich wn * ~=% REC, R=RPD, A=ABS D.iff., D=~ Diff. 22009955..00554422 33MMAA0011555522331199 or Job Number.: 235865 [ona vee solution, ne. SQUUAALLIITTYY CCOONNTTRROOLL RREESSUULLTTSS Prove Br corms ve roe- Report Date.: 06/13/2005 wes QC Type I Description ER - TTeesstt MMeetthhoodd. ..............1: 8226600B E Eh rane RETR Method Description. : Votati te Organics Reag. Code Lab ID ESqquuiipgmmeenntt CCooddee........:: GGCLLl1e6 Batch ............ = 151453 D~lution Factor Date AAnnaallyysstt.....,.:: Jjden Time I - E re ry e oii okt ete TTeom winTnT w E+[east Parameter/Test Description Vinyl chtor|de, TCLP Leach E EarG0n0t sel Ch an 005m oT 1,1-Dichtoroethene, TCLP Leach 2-gutanone (HEK), TCLP Leach SChloroform, TCLP Leach Sm EEErESGLw . BB BE Carbon tetrachtoride, TCLP Leech e 3 ogs Benzene~ TCLP Leach m mmm BE 1,2-Dich[oroethane, TCLP Leach E 3 EE Trfch[oroethene, TCLP Leach sme Z2o ERY Tetrachtoroethane, TCLP Leach EE Chtorobenzene, TCLP Leach Units ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L QC Result QC Result True Value Orig. Value QC Catc. * Limits F 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U heePage 22 ee, tn, as os, * ~=% REC, R=RPD, A=ABS Diff., D=~ Diff. 22009955..00554433 33MMAA0011555522332200 I " " JJoobb N~ulmubmebre.r.::232636884655 QQ Uu AA LL II TTYY cC oO NN TT RROOLL mR EE sS uU LLTT S5 ReportDate.: 06/13/2005 ! Report Date.: 06/13/2005 CHSTONER: Weston Solution, Tre. com | Theww Test Method ........ : 6010B Method Description.: Leachabte, Metat~ AnaLysis POET:. cov. COTTAGE GONE ATTN Onl Kennel [sernr|weJowmmeE]row Equipment Code.... : ICP4 Anatyst...: tds (]CAP) Batch ............. = 150181 w< e]J Parameter/Test Tne AArrsseenniicc,, TTCELLPP LLoeaacchh. " PETE Bar~u~, TCLP Leach Cadmium, TCLP Leach EEnN Chro~iuB, TDLP Leach ET Lead, TCLP Leach ~etenium, TCLP Leach Hn silver, TCLP Leach Description Units nm/g/tL grmg/L oomg/L oomg/L oooomg/L mg/L mg/L QC Resul.t BE 00..0611000000 UU' oEm 0.01000 U fem0.00200 U om 0.01000 U fmm0.00500 U OEE 0.01000 U 0.00500 U QC ResuLt True Vatue Orig. Vatue -- OC CarD. * = Limits F = Page 25 * ~=~ RECw R=RPD, A=AB$ Diff., D=~ Diff. 22009955..00554444 33MMAA0011555522332211 dJoobb WNumubmabre.r..1.- 223366884655 = [costonen: weston sovunion, tne. Q$8U 4A rL iI iTvY cC a0 mN tT aRs0eL aR kE iS vU iL iT s$ PROIEGTS Cone CorTAGE GRE RRepepoorrtt DDataete..: 0046/11133//22000055 ane T ESET Ete sete wai ior SSE oe QC FyPel Oescpiptien Test Nethod ........ : 6010B (Raa.. Code l Lab IO Diiution Facto~ Date Equilxnent Code .... : ]CP4 AnaLyst...; tds I I Method Description.: Leachabte, Heta[s Analysis (ICAP) Batch ............. : 150181 I - [ ae rE ite E fet rTe1e wi ) + ey Parameter/Test Description - Tem Arsenic, TCLP Leach YY T= TT Barium, TCLP Leach Cadmium, TCLP Leach chramiun, TCLP Leach rT = Lead, TCLP Leach = HT fe = Setenium, TLP Leach = SRY S(tver, TCLP Leach Units mg/L mg/L mg/L mg/L mg/L rng/L ~g/L QC Resutt QC Resutt True Vatue Orig. Value QC Catc. * Limits F 0.01000 U 0.01000 U 0,00200 U 0.01000 U 0.00500 U 0.01000 U 0.00500 U J Page 2& * ~ REC, R=RPDr A=AB$ Diff., D=~ Diff. 22009955..00554455 33MMAA0011555522332222 sb water. 2s TACT cenveer weavers por be. 4737205 QUAL.% TY CONTROL RESULTS " I Job t~umber.: 236865 Report Date..' 06/13/2005 isto Weston soy To kerEnecoreone Ar I FE 7 [irhaDesc tion wCe aoen, tats uy tyais ciowy B BehreE ns Ho=lE e m rtw OC TypeI Description J Reag. Code LablD Tes~ Method ........ = 6010B Method Description.: Leachabte, Metats Anetysis (I~AP) Equipment Cede .... ; XCP4 Batch ............. = 150181 Di [u~ion Factor Data Ti~elI AnaLyst...: tds PareenhmGrpeirpaernsee. nit Ate, TE Teach Parameter/Test Arsenic, TCLP Leach Barium~ TCLP Leach nin, Te each Sh cadmium, TCLP Leach Erni, ir ton an Chromium, TCLP Leach DE = Lead, TCLP Leach SHEE Ten ot Selenium, TCLP Leach San ot ~i|ver, TCLP Leach Description =Units mg/L mg/L mg/L nlg/L mg/L mg/L mg/L (DfeLltpcotsri 01013. QC Resu|t 0.10135 1.91758 oid0.05023 any 0.19717 sa 0.10452 i 0.09543 B pee0.04579 B gC Resutt mVaaienR _ 0gCYaiL G6 ale. e+rteineee) Se True Vetue 0.10000 Z.00000 fx WE ow 0.05000 Sie 1 RE 0.20000 Glime A] 0.10000 Sign Pores - 0.10000 Sion LA =] 0.05000 ww wm - Orig. VaLue 0C Catc. 101 Limits F 80-120 80-120 100 80-120 80-120 105 80-120 95 80-120 92 80-120 Page 25 * ~=~ REC, R=RPD, A=ABS Diff., D=~ Diff. 22009955.,00554466 33MMAA0011555522332233 Job Nunf~er.: 236865 QUAL I IY CONTROL RESULI$ Report Date.: 06/13/Z005 - ~ [Emr Em TT py pr Bena eripton'sKsctivte.onda EnviGari o1n1 shed To A WH m mere ENWinnfew waar neve osfWuokr scoie f+ tm----ome Tie QC. Lab 10 - m BEEm S eem ewTrE SCTmE mo ney mx ws BmAGeS m1 RB 150073-004 Reagent Units mg/L QC Result 0,01000 U QC Result True Value Orig. Value QC Catc, F * Limits Date Time 05/26[2005 1156 LCS 150073-005 I05BSTCH2 mg/L 0.09190 0,10000 0,01000 U 92 % 85-115 05/26/2005 1157 -LESEreUoBEbBno few1 EUanl n cSihnegroT to otTtet Lab IO SEE wm mm 150758-003 Reagent Units mg/Kg QC Re~u[t QC Result 29.00 U R fomvie e Orie= v tele e Ele Fn SRUsu ee aeme o,wemaTie True Value Orig, Value QC Catc, F *, Limits Date 1(me 05/21/2005 0821 A nen esetCI e iS t R aScets Samat Lab ID Reagent Units TE ens wa we 150758-004 IOOFSTLK3 mg/Kg QC Result 5441.7~ QC Result r neve a tarieevee Ones + M tma nome vm True Value ams WY Gms 4780,00 Orig. Velue QC Catc. F * Limits Date Time 114 % 53-140 05/Z7/2005 0852 SEP RE meTTEL EyG eSeETT 5 ORT To--_nA -- deT T TThRaaiElBiEnreg T Lab ID ~ WERT WR mR vm owe em 236865-6 Reagent Units pN Unit~ QC Result 7,98000 QC Result True Value Orig, Va[ue 7,~9000 QC Ca[c, F * Limits 0.01000 A 0,20000 Date Time STE e E WethS esre a 0 aRonhLo Tf ia w ~ Lab I0 Reagent L AmEE--ww Imm yw Tew ATER ~ 236865-6 Ri=e f wen - Bn t Tom ra o oaotis AAeoonn ~P 150926-002 I05EPHTB Units p~ Units p~ Units Q~ Result T.98000 7,00000 QC Result True Value 7,00000 Orig, Value 7.990D0 QC CBlc, F 0.01000 " 0,00 * Limits A 0.20000 A 0,20000 gate Time =P 150926-003 I05EPHTB p~ Units 6.9B000 7.00000 0.02000 A 0.20000 - ABSeEEiTrA h aeae eaT a Te A [: re e EREoE ww aha9m8 Lab ID Reagent Units 150183-001 mg/~g 150183-002 I05BSTSFIA mg/Kg QC Result 8.80 U i39.03 B QC Result True'Value wae 185,60 Orig. Value QC talc, F * Limits Date Time sw uns x mewSoams mr 8,80 U 75 05/27/2005 0905 % 25-116 05/27/2005 0907 Faas Page 26 na, hl or, * %=% REC, ~=RPD, A=A~ bi~f., D=~ Diff. 22009955..00554477 33MMAA0011555522332244 oR ey[i ---- a cari mn w esa t Job Number. : 236865 Q UA L I T Y 0 0 ((- I ~ 0 L ~(E $ U L T S Report Date, : 06/13/2005 I Test Metdod........5 TATOA 7 Ee en Toue re, iT e SoTryt r ~C Lab ID Reagent Units EEE wre ~B t50293-007 ug/L Smee3h 13 :CS 150293-008 HO4LSTK010 ug/L FEET Ji, ~B1 150293-009 784 mg/L Hmm a sm the ~B1 150293-024 786 mg/L Summne wi omy 4B 150444-007 ug/L bee an 8 .CS 150444-008 HO4LSTK010 ug/L Gimme J, ZB1 150444-009 776 mg/l ibe ZB1 150444-011 781 nui om cemy ~B2 150444-012 781 n~/L mg/L sama mo am !B3 150444-031 785 mcj/L QC Result 0.20 U 1.95 0.00200 U 0.00200 U 0.20 U 1.87 0.00200 U 0.00200 U 0.00200 U 0.00200 u QC Result Beh SE Analyst... sek Sl her e TT paEnT Lgs True Value wa em um S x we r mn 2.00 te maw x mw gFR Sa aa araanealvt .2.00 Orig, Value QC Catc. F * L~mits Date Time 0.20 U 98 0.20 U 94 05/27/2005 1331 % 80-120 05/27/2005 1333 05127/2005 1335 05/2712005 1415 0512712005 1439 % 80-120 05/2712005 1441 05/27/2005 1443 05/27/2005 1447 05/27/2005 1450 05/27/2005 1540 pr Page 27 + nar, ps oe, ot. * %=~ REC, R=RPD, A=ABS Diff., D=% Diff. 22009955..00554488 33MMAA0011555522332255 - res ve ri 1 ss tt or rt ro SLT. et, ls REPORT CONNENTS A 1) bet Cpreuced arly To fe etiratye ALl pages of this report are integral be reproduced only in its entirety. parts of the analytical data. Therefore, this report should - - -| S| Cl 2) SoiL, sediment and slL~ge sample results are reported on a Udry weightIm basis except when analyzed for 3 EE EA tetsu mrs spots received basis unless noted differently. landfill disposal or incineration parameters. received=' basis unless noted differently. All other solid he ~atrix sa=ples are reported on an 3) Reporting Limits are adjusted for sample size used, dilutiens and moisture content if applicable. Se 4) The test resuttefor the noted analytical method(s) meet the requirements of NELAC, Lab Cert. tO# 100201 5) According to ~OCFR Part 136.3, pR, Chlorine Residual and Dissolved Oxygen analyses are to be performed F{mEdisRtay after aman simple Solisctfon UE hen thts PaR rassters, 1nRot (ohRcoted 31 141d Lo-5. immediately after aqueous sample collection. When these parar~eters are not indicated as field (e.g. pH Field) they Here not analyzed immediately, but as soon as possible on laboratory receipt. ity tr AE 2 strstr Got 4 20 t t Glossary of flags, qualifiers and abbreviations (any number of which may appear in the report) Inorganic Qualifiers (Q-Column) PE a. U Analyte was not detect~l at or above the stated limit. RATES Le me in < Not detected at or above the reporting Limit. |EEETRR EE REeSs J Result is Les~ then the RL, but greater than or equal to the method detection Limit. EERE LU ee ne B Result is tess than the CRDL/RLo but greater than or equal to the IDL/t~Lo S Result NaB determined by the Hethod of standard Additions. F AFCEE= Result is Less than the RL, but greater than or equal to the method detection Xnorganic FLags CF[ag Column) ET cs moe ta wt ao ICV,CCV,ICS,CCB,~SA~SB,CRI,CRA~RRL; Instrument related OC exceed the upper or to~er Ee ot control Limits. limit. * LCS, LCO, MO: Batch QC exceeds the upper or touer control limits. + HSA correlation coefficient is less than 0,995. & ds, WED: The analyte present in the criginal simple i 4 tims greater ~ NS, HSD: The anatyte present in the original sample is 4 times greater TE RA ms LR UY ce, than the matrix spi~e concentration; therefore, control limits are not applicable. IE| E1 EATSERORA oly E gO: ~eria[ dilution exceeds the control limits. SE EE mt H MB, EB1, EB2, EB3: Batch OC is greater than reporting limit or had a negative i~strur~ent reading louer than the absolute value of the reporting limit. 1 EE EE SEN N MS, MSD: Spike recovery exceeds the upper or to~er control Limits. - peorganic Qualifiers (3 - Colum) N AS(GFAA) Post-digestion spike Organic ~ualifiers (g - Column) uas outside 85-115~ control " ~imitso U Anatyte Nas no~ detected at or above the stated Limit. bE Tee oi NO Co~pound not detected. - 1y EEe E gz {dont td campeund (TIC). v J Result is an estimated' value be[o~ the reporting limit or a tentatively identified co~pound (T~C). g Result ~as qualitatively confirmed, but not quantified. I a C Pesticide identification was confirmed by6C/R$. The chr~natographic response resembles a typical fuel pattern. Z The chromatographic response does not resen~ie a typical fuel pattern. fon RET - EFF AARFFeCCsEEuEEl:t:kReeesxsuculeLtetdeifsds an estieated vals calibration range~ an estimated value Below the secondary beLo~ the reporting LISI or dilution required. ~eporting li~it or a 8 tteennttaattiivveellyy Iiddeennttiiffiieedd ccoomppaounndd (TTIICC)) e DyiEn Organic Flags (Flags Column) E Bras ene oe toe cre ti B RB: Batch OC i~ greater than reporting Limit. REESE * LCS, LeD, ELC, ELD, CV, NS, HSD, surrogate: Batc~ QC exceeds the upper or lower control limits. EB1, EB2, EB3, HLE: Batch QC i~ greater than reporting Limit -|W BEEe BERIEATRIRN A Concentration exceeds the instrument calibration range ERE a Concentration is below the method Reporting Limit (RL) B Compound ~as found in the blank and sample. D Surrogate or matrix spike recoveries Nere not - tw tmavi . obtained because the extract ~as diluted For , EERE REET ww analysis; also colr~ounds analyzed at a dilution will be flagged with a D. | RR en ~ ALternate peak selection upon analytical revie~ i EERE wr ve ae on ero ct I Indicates the presence of an interfence~ recovery is not calculated. H HanuatLy integrated co~pound. oe P The toueP of the t~o values is reportedNhen the % difference betueen the results of t~o GC columns is Page 22009955..00554499 33MMAA0011555522332266 we i wr REFERENCES AND NOTES go om greater than 25%. EE MT En, etn, i 13" pent Abbreviations Poet bDiiggeensttiioor~n Ssppiikkee ((6F4AAA SSaamplpeless -- SSeeee Note Note 1 1 below) below) Batch Designation given to identify a specific extraction, digestion, preparation set, or analysie set CAP Capillary Col~ann CCB Continuing Calibration Blank EU GEShuinEiiEnEg ClmtRbraEtion Wrificaion CCV Continuing Calibration Verification E CF Confirmation analysis of original i EEimmmEoZmniiiEheey Cl Confirmation analysis of A1 or d C2 Confirmation analysis of A2 or D2 ERigmint.. C3 Confirmation analysis of A3 or 05 & Ende CRA Low Level Star~dard Check - GFAA; Mercury hmmmisr. CRI LON Level S~a~ard Check - fon FUEREERE CV Cat~tb~at~on Ver~ftcatt~ Standard oe fla Dil Fac ~{Lut{on Facto~ - Secondary dilution i hHEem 01 Dilution 1 Dilution Z D3 oa bLFac E EsEmEe, DSL EEE EEl E# pia . EB2 me EB3 #EERfbs eas ELC ELD ERE. ICAL Di(ution ] DDDeii~ssetecii~(ti~ioeendd LSS~ttmaainntddaarrFddac-t- oHrHi~gghh'lLeevveeLl Oisti(l~ Standard - LoH Level Distilled S~andard - Medi~. Leve~ Extraction B{ank I Extraction B(ank 2 Ol B(ank Method Extracted LCS Method Extracted L~ Initia~ cat~bration Initial Calibration B~ank IOL fBi. EmE BeEErI eREOe fw ale)102 ISA " ITE cs ISB ean Job No. fo Er EERE LCO FEE LCS EEE MB i EEEMLTTT MO BE HEE, MLE i mami RRL HSA BE EERELL MS BBorEBEESE secs mts HaD Initial catibFa~io~ Instr~ent Detection LiBit ~nterference Check Saute A - leAP Interference Check sa~ie B - leAP The first six digits of the saute ID ~ich refers t~ a Lab Ib A~ 8 n~er Unique L~ato~y ~nt~f~cat~on Laboratory con~o[ StandardDupticate Labora~orv Control StandaP~ ~ith reagent grade uater oP Nethod Blank oP [PB) Preparation BLank Heth~ B~ticate Neth~ 9e~ect~ L~m~t Hed~ Level Ex~Fac~ion Blank Neth~ Re~ttng Liait Standard Neth~ of Stan~dAddit~ons Natr{x Spike Nat~x sp~ke D~I{cate PREPF F FoneE r RA Eman AI Not De~ected Prepara~ion factor us~ ~ the Laboratory's Info~a~ion Pos~ D~ges~ion ~pike Re-analysis of original Re-ana~ysi~ of D1 mee ci, mies oe von sp~ific client, projec~ a~ sable g~oup ie on i en a matrix free fr~ ~ha anaLy~e of ~n~erest ess en 0) Nanagement Sys~ {LINS) A2 Re-ana[ys~s of DZ A3 Re-anaLysts of D5 Bo REeerictEion ofEdilution RD Re-extraction of RE Re-extraction o~ original RC ~-~xtraction C~fir~tion EEEREE amin erie came RL Reporting Limit RPD ReLative Percen~ D~ffePenc~ of duplicate ~unrounded) ana[yses FERRE RRF Relative R~ponse Facto~ RT Retention T~ stPage Z9 22009955..00555500 33MMAA0011555522332277 ~| - - RUALITY ASSURANCE WETRGOS REFERENCES AND woTES Pe RI tetention Tins indo Sip 10 09 GTlc nba nice for sch RTW Sai ve Beer er - SCB BE Ll Ehtututed shen ssp concentration enced 30 SD UCB SRheron stand SSV TSEEs SIC G LieatorE y Convo! SBtaRndsA) oot sete PH~ LCDP Rm MDPH Retention Time Window Sample IDA 9 digit number unique for each six digits are referred as the job number Seeded Control Blank Serial Dilution (Calculated when sample concentraLion exceeds 50 Unseeded Control Blank Second Source Verification Standard Solid Laboratory Control Standard(LOS) pH Calibration Check LCSP pH Laboratory control Sample pH Laboratory Control Sample Dup|icate pH Sample Duplicate ale, sample, ththe ffiirrsstt tiretimes hethe 1M0D0L)) 7MDFP LCFP 01 GR ard sae 1 F[ashpoint Sample Duplicate Flashpoint LCS Gelex Check standard Range 0-1 @ ones cok Suomi huge 10 Gelex Check Standard Range 1-10 Sion Sek BI ASS lal G3 Gelex Check Standard Ran9e 10-100 Galo Suk Sanat Ris Toon G4 Getex Check Standard Range 100-1000 Rate 11 he Fos Spike Bealpute en Batch 8 for IAN fe designated uth an + aed 10 he curren Note 1: The Post Spike Designation on Batch QC for GFAA is designated with an ',5" added to the current Briar tied. BX. LES SLES Pst Spike (Guay HES Font Bp GHA) abbreviation used. EX. LCS S=LCS Post Spike (G~AA); Meg=MS Post Spike (GFAA) Rote E Th ices my Bessone hercce Ch sen th. sample ciocentration Lec the 5 cies th Note 2: The MD calculates an abso(ute difference CA) when the sample concentration is less than 5 times the Fong ton Lora a1 Perea he reporting limit. The control limit is represented as +/- the RL. Page 30 22009955..00555511 33MMAA0011555522332288 iM{albeioolHa1|| : i SJ4i3E|dE |a | E |iRT IER m| T ART ANNT RNNEN ESELEPEREN. ah H | ( (P A HT RRH RAT N HH WE ee rl Yj) SEH Wolo LAER >bd H LF ind Sli sna fu THER PHS) Ede]sadeTT) ot| {a \ Hp Njg:E H3EEERE81d REE 479s fy | zEoimielne = B= : {| y5 0Bl8l LAs fiiddd gli g LCL EEE LT tee 3 of g i y 1) N piace ala ul . Io adlss 2095.0552 33MMAA0011555522329 : _ _-- STL Chicago n ELyIE 2417 Bond Street University Park, IL 60466 STL STL Tel: 708 534 5200 Fax: 708 534 5211 www.st/-inc.com - SEVERN TRENT LABORATORIES ANALYTICAL REPORT - Jom NER: 237037 Prepared For: - - WestWeCshteo2sBn5t0ueSsrRo,ilaunttBgoiAonns1sa0s,3y80I-nc1.493 Project icamttesnati.clisne. i: uthage Grove - Aeencion: Jal Kesar Date: 06/13/2008 sSaimgen:a ric. tead, wright -- Niatmiee:s RPirocjhe%c~tr~M.anWargiegrht ETvitaliel:: PrroujreicgthtMeasntalg-eirnc.con E-Mail: rwright@stl-inc.com Lf3hs DsSSatTtuTLecCBnhiieccdaasgooBreet Oniverelty Pash, 2417 Bond Street University Park, 1IL c60o4s6e6 Go PHONE: (708) FAX..: (708) BER 534-5200 534-5211 Thhiiss RReeppoorrtt CCoonnttaaiinnss ((3~0)) Ppaaggeess Severn Trent Laboratories, Inc. 22009955..00555533 33MMAA0011555522333300 SSTTLL CChhiiccaaggoo `WWeett CChheemmisisttrryy CCaassee NNaarrrraattiivvee fGer Wgaiggin Cllcnt: Job #: Weston Solutions, Inc. 237037 Sanne Date Rec'd: 05/27/05 | TChot rne mtbtn i i oes 4 ire 1. This narrative covets the analysis ofthe samples in the abo~ce Job # for CN, r~actiye sulfide, flash point, pH, and TOC by the methods cited on the LaboratoE Test Results pages. 22.. TThheeanaanlaylyssiiss wwaass ddoonneewwitithhiinntthhee EEPPAAhhoollddiinnggttiimmeess..RRefefeerrttoo tthheeLLababoorarattoorryyCChrhoronniiccllee Tt en ie ee Page for dates of sampling, receipt, and analysis. 3 Tents ei 3. The method blanks wer~ less than the r~porting limits. J 4. The LCS reco~ceries were within acceptance limits. + Todaro SiH Snienash 5. The r~activc sulfide MS and MSD recoveries were low. See the Quality Conlrol Results page for ddeettaaiillssooffaallll mmaattrriixx QQCCaannddnnoonn--mmatartriixx QQCC.. E DoaE st epp Diane L. Harper ~/ Wet Chemistry Section Manager wd(pos Date 22009955..00555544 33MMAA0011555522333311 - SeSev`vMeeErnTTTArLreeSnnttCLLAaaSbboEorraaNttoAorrRiieeRssA--TCCIhhViiccEaa.ggoo METALS CASE NARRATIVE CPCrlloiijeeenncttt: WWIDe:esstCtooonnnfiSSdloeslnuittoiioannlss,C,lIoincec.n.t - STL Job Project ID: STL Job#: 237037 Confidential 237037 Client Date Rec: 052705 Date Recd: 05/27/05 - 11.. TThhiissnnaartraitviveeccoovveerrstthheeMMeteatlalss aannaallyyssiissooffssammpnlpleessrreecceeiivveeddiinntthheesabboovveeSSTTLL JJoobb 223377003377,, MMeetthhoodd RReeffss:: UUSSEEPPAA,, SSWW--5g4466 - 22. AAllllaaanlaylysseesswweereeppeerrffoorrmmeeddwwitithhiinntthheerreeqquuiirreedd hhoollddiinnggttiimmeess.. - 33.. AAllll nIniitaiallaannddCCoontnitinnuuiinnggCCalailbibraratitioonn VVeerriiffiiccaattiioonn ((ICVC/CCVV'/s)wweCrereewCwitithYhiinnc'coonnt)trrooll llimisits.. 44.. Alsi All Initial aannddCCoontnitinnuuiinnggCaClailbirbartaitioonn BBllaannkkss (([CCB/CBC/B'sC)wweCerreBewwi'kitih)in ccoonnttrrool lliirmni2ttss.. - 5. 5. All All PPrepraraetionp/MeathordBBlaleannkktsswwroeerenlsesss/tthhaaMnntthhieerreeptpoortrhitinnggloliimdsit.s. - 66.. AAUllIICCPPIInntteerrffeerreenncceeCChheecckkSSaammpplleess ((ICCSSAAaanndd IICCSSAABB))wweerreewwitithhiinnccoonnttrroollllmimsit,s. 7. 7. LaLbaobroarattoorryyCConotnrtroollSSeammppllee((LCCSS))rreeccoovveeriresswweerreewwitithhiinntthhe 8800--112200%%cocontnrtrooll llimitits.. - 88.. MaMtartriixxQQCCwwaassppeerrffoorrmmeeddoonn aanrtaalltteermnaattee JJoobb.. - Section aManager b3-oS DDeatee 22009955..00555555 33MMAA0011556522333322 SSeevveerrnn TTrreenntt LLaabboorraattoorriieess CChhiiccaaggoo Te GC/MS Case Narrative [-- Weston Solutions nia Confidential Client: Cottage Grove oomJob Number: 237037 mee: VOA DATA: 1. Allis ws popper ss A dy i tf 1, All samples were properly preserved and analyzed within the 14-day hold time from the date of ne collection. 2. Aloe tod ks Bsn ket oma ves lo i prog ns, 2. All ofthe Method Blanks and Extraction Blank target compounds were below the reporting limits. a 3. The LCS (Laboratory Control Sample) samples had all controlled spike recoveries within the in- h`hoouussee ggeenneerraatteedd QQCC lliimmiittssffoorrtthhee wwaatteerr aanndd ssooiill ssaammpplleess.. . Af ols els ope ovis ine fe rd QC, 44.. MMaattrriixx SSppiikkee//MMaattrriixx SSppiikkee DDuupplliiccaattee aannaallyysseess wweerree mmoott ppeerrffoorrmmeedd oonn tthhiiss ssaammppllee sseett.. 5. All of the volatile samples had surrogate recoveries within the in-house generated QC limits. 66.. TThhee TTCCLLPP ssaanmapplleess wweerree pprreeppaarreedd uussiinngg MMeetthhoodd 55003300.. AAllll ssaammpplleess wweerree aannaallyyzzeedd ffoolllloowwiinngg SSWW884466 Ty `Mvvaaellutuhecossdffoo8rr2cc6ee0rrBttaaiiannn~cdoo8mm0pp0oo0uuBnnd,dssA))..ll TTcahhleeibllrooawtwioppnooiicnnrttitiiennrittahhaeerieinnimittiieaatll pcceaalrliimbbrreaattthiiooonndvvoeerrriiSffOiieePss tt(hhfoeerbbmaassieenirrmeeppuoomrrttiiRnngg im: limits. The target compounds were quantitated using the initial calibration. AT oat ati Coat ite 07h gmme 7. All ofthe internal standard areas and retention times were within SOP acceptance limits as compared tes es do to the corresponding calibration verification standard. 5. AT A PE satin 8. The TCLP samples were analyzed using a 10.0-mL purge volume with a 1/20 dilution. S= E olr es" Date 22009955..00555566 33MMAA0011555522333333 SSee`vvGeeCrrInnMTTSrreBennNttASSeeCrravvsiicceeeNssa--rCCrhahtiiiccvaaeggoo GC/MS BNA Case Narrative - JW WoibeessNtoounnm bSSeoolrluu:ttii2oo3nn7ss,0, 3nIC7noccn./fCiodnefindtenitaiall Client Client - - Cottage Cottage Grove GTove BNADATA TCLP Job Number: 237037 BNA DATA: TCLP - l1.. AAllll eexxttrraaccttiioonnss aanndd aannaallyysseess wweerree ppeerrffoorrmmeedd wwiitthhiinn rreeccoommmmeennddeedd hhoolldd--ttiimmeess.. _ 2.TheMB (Method Blank)andtheEB (TCLPblak)sample hadalaalytesundetected 2. The MB (Method Blank) and the EB (TCLP blank) samples had all analytes undetected. 5. The LCS(LaboratoryControl Sample) had the treecontrol spikercoveriswithin the fn _ 3. ThohuesLeCQSC(lLiambitosratory Control Sample) had the three control spike recoveries within the in- house QC limits. 4. AMS (Matrix Spike)was rt performed. 4. A MS (Matrix Spike) was not performed. - 55.. AAllll ssaammpplleess hhaadd aallllssuurrrrooggaatteerreeccoovveerriieess wwiitthhiinn tthhee iinn--hhoouussee QQCC lliimmiittss.. _ 6. All samples hd all internal standard rca an retention ies within the SOP acceptance 6. All samples had all internal standard areas and retention times within the SOP acceptance Jimit a5 compared toto comesponding calibration verification siandard. limits as compared to the corresponding calibration verification standard. _ 7. All amplesweroextractaend analyzed following USEPA SW846 5270C protocol. The 7. `AssaalmlmpsplalemesspaalnendsdtwthheeereTTeCCxLLtPrPaBcBltelaadnnakknwwdaasasneaelxxyttzraercdtaefodcululstosiewinngdigng1100U00S--mEmPLLoAoffSttWhhee8TT46CCLL8P2P7ll0eeCaaccphharatoteet.o. cTTohlh.eeTMMhBBe nd the LCS were extracted using 1000-mL ofdeionized water. The results and reporting _ mlainmidtittsshewweLerrCeeSaaddwjjeuusrsetteeeddfxfotrorartctthheeed eeuxxsttirrnaagcctt1iio0onn00vv-oomlluuLmmeoesf.sd.eionized water. The results and reporting ( /7 7 Gens De. - DDaavviidd PP.. Kozubk GC/MS Dept. ould DDaattee. 22009955..00555577 33MMAA0011555522333344 ST Chica part of sem Trem uteri, Ie. STL Chicago is part of Severn Trent Laboratories, inc. overs . TAN1T LBEoateTaeriolanavio TI I Job N~mber.: 237037 Ren a Pre escipren.1 Cnrnia SH - otacrore JJ Customer...: ~eston So[utions, Inc. Attn ....... : Jai Kesari " Project Number ........ ': 20005459 Customer Project ID....: CONFIDENTIAL CLIENT Project Description .... : Conf~dentfa| Client - Cottage Grove m Toormly 1comsec a c= oo CEEe S 237037-I arura | cow scoe oom 2:37037-2 rns | con sc oun oso 237937-3 ame |consec sencomo 237037-4 ars |co ee wn coo 237037-5 amre | conver 237037-6 CGMN SBC FTA02 00150 CGHN SSC 0101 00200 CGMN SBC WPA01 00150 CGMN SBC BKG01 00000 CGMN SBC B1501 00100 CGMN WASTE #2 Soil So~L soil soil wR mse T|aE mtn |a wmaes| aeeos 05/23/2005 saws | wae | oes| as 05/24/2005 saws | wo | wan | wes 05/25/2005 was | oie | wars | cous 05/25/2005 was | ws | wavs| ous 051~5/2005 ras | wn | wavs| ous 05/26/2005 13:~0 13:40 09:40 10:40 12;50 10:30 05/27/2005 05/27/2005 05/27/2005 05/27/2005 05/27/2005 05/2T/2005 08:45 08:45 08:45 08: 45 06:45 06:45 Page 1 22009955..00555588 33MMAA0011555522333355 hn1 B ht i % - i2 _ iE ig ce ---- _ Fl LE - ; | co - ii ul - -F: R1 x ik = dflh a - i ie - ;SIE5 i BHEs fi Hj 35 i ~ iIL lg] an Bo 22009955..00555599 : ii : . 33MMAA0011555522333366 my of 1 = | ye sl] | Eee AE : Ho . | i38 | : 1g Ig 12 HE | .i iiol BEo :EJEey if HHEHeE:a l| h2 i Halil 8 : iE 23 $5 3 iL o 22009955..005560 33MMAA0011555522333377 Ee hn _ ul 3 Wo - ip i _ of 2 | HE . Db Em HR :i:~:~:i~. :~:i~ :! i z Coq } ii g toailys Co HSaunenR, EEEE Hig si i - so lg eiii i : - 5 2095.0561 2095.0561 1 33 i5 r3 ; : 33MMAA0011555522333388 LoIf 3 Woid t I=] wn||, ll E . 14] g o |s5e og ee - ;- 1i} 5 ` 3 yl i i els URE SPE10 s:if : : 2 5 88 4 ii aos l hgaEs | E hag ias 22009955..00556622 ] - - i P3o . :i L} 33MMAA0011555522333399 i 3 %|i Br ~ iHilhEe 8g3)l:g: -- - | HN La f {lsh : :PRBTE eo - .| | 1 ig ~ i Jls 5s . ^2 TSeh l EE ag HH Ls = B O a in 3 AL : 22009955..00556633 : i i ; o 33MMAA0011555522334400 HFSWITTTIRTT Siriaas on Pi1is Hmm En 5 li BE -- PE 5 b|e i Alpplz ETl le i : Bj Pl ils Pid mE HI -5 "on, 1 so.8n88ls3 oT Fa a} so. sums 2 9999 gas of Hale i i i ils fli ii fi lSbahiynt [O I HRaElG ER 8 gg mend d FiLEI 5 3 3 7 ABy f: Ll 2Lf:E 3lH3 ie33 e3: ?1 hafe8Eitndy sieitane ||F elEe EE EE 22009955..00556644 33MMAA0011555522334411  . % IH - | - LE [Elessssany ssssssssss He gEmeEaaEe HER | rrp [Hu wen - - F Eolfie e] :i omen gsgssgaess SEH il Er - ou EheE,T ; Boe ie nla ; - HERERIE P TRREE E e HE e Feed FH Ch Ee il : i alE i: 3 i Ife 1 HL i } 22009955..00556655 33MMAA0011555522334422 Sr chicago fs part of Son Tra Labratares, Ic. gTL Chicago is part of Severn Trent Laboratories, inc. sob aber: 23057 Job Number: 257037 CABORATORT CHRONICLE LABORATORY cHRoNICLE ate 04132005 Date= 06113/2005 QUST: Weston solutions, fre. Lab 10: 2ST Lab ]D: 237037-1 es HETHOD EDO oon Lloyd ahn Lab 0: 2570572 Lab ]D= 237037-2 Clrapidn METHOD ctl 10: cowsc 1002 150 CLient ]D: CGt4N SBC FTAOZ 00150 si DESCRIP1]ON ELectronic Data Deliverable Sotasri room coi Total Organic Carbon (Soils} cen 10:com suc 0101 230 Client IO: CGHN SEC 0101 00290 TsoesrcSarrmpion Carb Gait) DESCRIPTION PROIECT: CONFIDENTIAL CLIENT ATTN: daKart ate cuss spars sate ous GBS Date Recvd: 05/27/2005 hice ar4G ONE ALES RUN# BATCH#, PREP BT 1 Tena ma owas 114k 1 151124 151124 Sample #(B) Date: 05J23/2005 DATE/TIME ANALYZED 06/02/2005 1144 Outs tuts cana swole sat: 3/2 Date Recvd: 05/Z7/2005 5ample Date: 05/24/2005 a pl hrs 120 RUN# BATCH# PREP ST #(S) PATE/TIME ANALYZED Lloyd Kahn Total Organic Carbon (Soils) Lab 1: 2570575 cute 1: com sac on corso Lab IP: 237037-3 Lorrkin Tsota iprainecarbon sot) HETHOO CLient IO: CONN SBC SPA01 00150 DESCRIPT]OR 1 151124 15112~ 06/02/2005 1209 ute ees 5127/25 septaower GB13/103 Date Recvd: 05/27/2005 Sample Date: 05/25/2005 iT"O Thies paaT oy BtrAatTesAED RUN~ BATCH# PREP BT #(B) DATE/TINE ANALYZED lloyd Kahn Total Organic Carbon (Soils) Lab 10 EIA cline to: cam aca0! C000 Lab IP= 237037-4 ri otscrion RETHOO , Lorde Tout gan Garb Cite) LLoyd KahnI CLient ID: CGI~W SBC BKG01 00000 DES~RIPT]OR Total Organic Carbon (Soils) tp ste to camsc i co Lab [P; 237037-5 Riri akon HETHOD Loydtibn Tot Spancarb cant) Lloyd Kahn Ctien~ ID: CGRN SBC 61501 00100 DESCRIPTION Total Organic Carbon (Soils) Lab 1 TST ction:to:com we 2 Lab ID: 237037-6 rion aes HETHOD sam sison Tervsne prep 50308 Soon 3a in eathaes Grow) 3010A lions Grama coteriiae) 9014/9010~ Er mati Tel ney 3510C io Fonrataareisclnomseom 1010 Tim Lota, Herr AA) 7470A Eid Lil: ME aon 60108 Filason petit, wtide 7.3.4.2/9034 i SESH utes 7470 fame Semvetatite Srgnicr 8270C bE Ta Bnet 1311 ji Tas 5 aaapace traction 1311 2) frit 82608 Suse ain 9D~Bc Client [D: CGRN ~ASTE #2 DESCR~P~[O~ 5030CP TCLP/SPLP Prep Acid Dig. Leachates (]CAP) Cyanlde (Colorime~ric) Extraction for TCLP (SVOC) Ignitabitity (Pensky-Martens Cteaed-Cup) Leachable, Hercury (CVAA) Leachable, RetaLs Analysis Reactivity, Sulfide SW8~6 Dig. Leachates (H9) {ICAP) Semivokatile Organics TCLP Extraction TCLP Zero Hea~Lspace Extraction Volat{le Organics pH (soil) 1 151124 1511?4 gest ana se Pate Recvd: 05/27/2005 sample in Sais rar Ss RUN# BATCH# PREP BT #(S) TR 1 151124 15112& one wes ETE tte Date Recvd= 05/27/2005 Sample i hic Th ar Hy RUN# BATCH# PREP iT #(S) a 1 151124 151124 Date teas 5/2720 sale -Date Recvd= 05/27/2005 Sample ok ic Than a RUN# BATCH# PREP BT #(S) si 1 1514~5 ioest wos 1 15065~ 150489 bone on 1 150918 150918 To Bde 1 150847 150489 1 fons ars 1 150769 150769 TE Wwe I 150805 150803-150489 1 Tom bess nee 1 150790 150654-1504~9 oe NE 1 150811 150811 Tones , 1 15080~ Te wewrwas 1 151188 1508~7-150489 1 ue 1 150489 i she 1 150487 1s mse 1 1514~6 151~45-150487 TOR We 1 151137 151137 06/0~/2005 1734 ues Date: 05125/~005 SNOT ALE DATE/T[NE ANALYZED Wes 16 06/OZ/ZOO5 1Z59 tates GS Date= 05/25/2005 SkAdTeO as DATE/T~HE ANALYZED 06/02/2005 132~ dat: C3125. Date: 05/26/2005 SACRE ds DATE/TIRE ANALYZED three a 06/0812005 2008 eee 19 06/01/Z005 1800 a 15 06/03/2005 1339 eee oo 06/03/2005 0700 Grea 11% 06/02/2005 1100 ame tr 06/02/2005 1357 cum lor 06/02/20C5 10~7 Shree tise 06/02/20~5 1~38 fri 06102/2005 1030 sme lar 06/06/2005 Sv on 05/31/2005 16~7 1~00 Sis Yoo 05/31/2005 1400 owovee m8 06/08/2005 2008 as 06/07/2005 1035 onion DILUTION orion DILUTION DiLUTIoN DILUTION oTion D~LUTION o1uTion DILUTION tooo 1.00000 two 1.0000 Page 9 22009955..00556666 33MMAA0011555522334433 ST Chica fe part of Severn Tran abrasion, inc STL Ch(cago is part of Severn Trent Laboratoriee, Inc. a0 an. 57057 Job Number.: 237037 SURROGATE R E COVE R I E S REPORT RRaeppoorrtt oDastet,.: 0067/11537/2200055 Cr PRT ORL So Rdiat eter otros Yoarile omni Method........ : Votatite Organics - tn Gifsn Method Code...= 8260B wow swen Lab ID DT Sampte ID aLCS E)HB Bs..z1 ar 236865--21EB! Bah 236966-:21EBI Brn 237037--21EB1 o EB conse 12 237037- 6 CGMN WASTE #2 test testomarion Test Test Oescript~on Tr measen 12DCED BRFLBE SEED bivemshuaremhans (irr DBRFLM Te Totem oer TOLD8 1,2-O|chLoroethane-cY~ (surr) 4-Bromofluorobenzene (surf) Dibromofluoromethane (surr) Toluene-d8 surf) Test wate TEP teh Test Matrix..,= TCLP Leach pe Batch(s) ...... : 151446 ore vee sme omen Date 12DCED BRFLBE DBRFLM woe wm ww 06/08/2005 103 ms wm mw 06/0812005 108 ms Bw 06/08/2005 107 nes we Bw 06/08/2005 102 mms Ww BB 06/08/2005 107 wees Won 06/08/2005 109 99 9# 95 97 90 97 83 94 89 95 90 100 us Limits ww 62 - 12T 67 - 132 75 77 - 119 aon 81 - 126 Toon TQL08 %96 95 o#93 @90 92 E95 Tro seen 1s Prep Batch..: 151445 roe 10 Page 10 22009955..00556677 33MMAA0011555522334444 5 1 rt se re chicago is part of Severn Trent Laboratories, Inc. oi ron Job Number.: Z37037 SURROGATE RECOVERIES REPORT esReport Date. : 06/13/2005 CUSTONER: 483648 ar] Em Method ........ : Semivotatite Fort Method Code...; 8270 ToLab ID DT Sampte IO u2wEB1 EB1 #2EB2 LCS Bore mums MB Imi. mms 237037- 6 CG~N WASTE #2 Organics 237037- 6 MS CGMN WASTE #2 profi24&TEP i hss ZFLUEP iE emlay 2FLUPH iE E EE r NITRO5 2,4,6-Tribromophenot (surf) Z-Fluorobiphenyl (surf) g-Fluorophenot surf) Nitrobenzene-d5 (surr) PHEND5 ~heno[-d5 (surf) TERO14 Terphenyt-d14 (surf) PROMECT: CONFIDENTIAL CLIENT ATT Ja Kesori TEs rea Test Matrix...: TCLP Leach ER Batch(s) ...... : 151188 Prep Batch..: 150847 | a i i ST Date Z46TBP 2FLUBP 2FLUPff ,NITRO5 PHEN05 TERD14 TmmE ony op17E88855BB 0610612005 57 71 56 81 36 78 mELoiiiid 06/06/2005 57 68 53 79 35 80 immos sfof oiofkfi 06/06/2005 62 67 53 81 36 85 id 0610612005 63 82 57 87 38 94 i= rr fF EE 06/06/2005 59 75 62 85 40 88 = EAE I 06/06/2005 45 72 48 81 31 75 0610612005 59 73 53 82 35 75 TE 29 - 126 ig 34 - 11~ 38 21 - 100 33H3 38 - 113 18 - 100 10 - 119 ontPage 11 22009955..00556688 33MMAA0011555522334455 so water: aren = I [ovme i Te~t Method........ : 82TOC : l Method Descriptio~.; S~iYolat~le Organics er ca ele Equipment Code .... : GCLIO Batch ............. : 151188 - EE amEr Seip r nits fep t fet Paremeter/Test Description Units PPyyrriiddiinnee,, TTCOLPP LLeesacchh ide tar tear A ems 1,4-Dichlorobenzene, TCLP Leach wi "ug/L ug/L hn tach To an GA deme 2-~ethytphenol (o-cresol), TCLP Leach ~g/L ee wo de He~ach{croethane, TCLP Leech ug/L a erat 1s Lac A Home 4-~ethy~phenol (~p-cre~ol), TCLP Leac ug/L - PERE LTE BRL Nitrobenzene, TCLP Leach He~ach(orobutadiene, TCLP Leach ug/L ug/L rime #0 BR 2,4,6-TrfchtorophenoL, TCLP Leach 2,4~5-Trichlorophenol, TCLP Leach ug/L ug/L SBiniurovse, Top teach an T0030 u 2,4-DinJtrototuene, TCLP Leach ug/L SomT mEn SEnaEEwSa aA heme Hexachlorobenzene, TCLP Leach ug/L wm ww Pentachtoropheno{, TCLP Leach ug/L QC Result OC Result 2EO0.0,0O0000 UU 100.000 U 100.000 U I00.000 U 100.000 U 100.000 U 100.000 U 100.000 U 500.000 U 100.000 U 100.000 U 500.000 U Freoneeloe_ True Value [Ep-- RR Analyst...: dpk OrtEunEfc S[ie,ev+ eUniie )t - - Orig. Value QC Catc. * Limits pana Pegs 12 ek, na, as i, 00800 * 7~% REC, R=RPD, A=AB$ Diff., D=% Diff. 22009955..00556699 33MMAA0011555522334466 soJob Nr. Number.: 5781 237057 SoaiTy cerreel arsvirs QUAL I T CO#TROI RESULTS Ror ace. 01372005 Report Date.: 06/13/~005 am: wn sles, re. (Tooomw[ eo eo Test Method ........ ; 6270C SethiSmetoite ramen Method Description.: Se~ivotatite Organics ven cwaTeoscs|caTownwe [Toauwsmnaetr ] oe w7 e Equipment code .... : GCLIO Sp Be 6a~ch .......... ~..: 151188 Analyst...: dpk ERSemre erionT beriptim SUniRte NOC fet teleYITE n oloe riaA l Cac. + Unite 7 Paramete~Test Description Units ioe ter oh hee - - Pyridine, ~CLP Leach 1,4-Dichtorobenzene, TCLP Leach Ehathylpbost Go sresl), TP Leach sal 0038 U 2-Methy(pheno~ (o-cresol)# TCLP Leach S Sop e TrEeLsi,en1 Lenean eovoy Hexachloroethane, TCLP Leach 4-Methylphenol (rn/p-cresol), TCLP Leac Abe en a ey Nitrobenzene~ TCLP Leach [ienedo frei Hexachlorobutadiene# TCLP Leach rT an nu 2,4,6-Trichlorophenol, TCLP Leach 2,&~5-Trich[oropheno[, TCLP Leach Sn Te ta A su 2,4-Dtnftrototuene, TCLP Leach m Toaintm or som nst,TED teach uwnn peis m ~exachlorobenzene, TCLP leach Pentacfllorophenol, TCLP Leach Ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L OC Result QC Result 200.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 500.000 U 100.000 U 100.000 U 500.000 U True Value Orig. Value QC Calc. * Limits banPage 15 TL, to, A Bi, BEE * ~-% RECr R=RPD, A=AB$ Diff., D=~ Diff. 22009955..00557700 I3MMAA0011555522334477 -= wr. rn Job Nt~nber. : 237037 QQUUAALLI] TTYY CCOONNTTRROOLL RREESSUULLTTSS [---- Report Date.: 06/13/2005 ~ [stones verten sotwiones Tne : CE omeIE Euwtoewrpe Test Method........ ." 8270C e[rmGoeea |CT wo JToomensmm]oeI m] rE Equipment Code .... : GCL10 Analyst..,: dpk Method Description.; $~n~v~tatiL~ Organlcs Batch ............. ; 151188 Ee T mae SAE ee e emit Tn vie 1g ln Ge e+ ien)1 Parameter/Test Description Units TER EE St Pyridine, ICLP Leach - EEESee. $B t,4-DichLorobenzene, TCLP Leech 2-MethyLphenoL (e-cresol), TCLP Leach Eunos: 67 eich an fick Hexach[oroethane, TCLP Leach BEER ww dh 0 4-Hethytphenot (~/p-creaol), TCLP Leac - mImA La wt BEY Nitrobenzene, TCLP Leach Hexachtorobutadiene, TCLP Leach frit ete EES 2,4,6-TrichlorophenoL, TCLP Leach Z~4,5-Tr~chLorophenoL, TCLP Leach lpaimnemimais,fToapnsteth aonw im0e0s8 bu 2,4-D|n~trotoLuene, TCLP Leach -ommwmmTED ow Rm Hexach[orobenzene, TCLP Leach ug/L ug/L ug/L ug/L u~/L ug/L ug/L ug/L ug/L ug/L ug/L QC Result QC I~esutt True Value Orig. Value QC Ca|c. * Limits F 200.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 500.000 U !00.000 U 100.000 U Pentachtorophenol, TCLP Leech ug/L 500.000 U nn ka, a, pt i, 1 Page 22009955..00557711 33MMAA0011555522334488 77 or" Job Flur~ber.: 237037 QUAL ] TY CONTROL RESULTS ero ar Report Date. CUSTOMER: Maston Solutiens, Tne. PROJECT CONFIDENTIAL CLien] a: T Com IETS wm JwmTosE|Ewen JomoR]oeem| Test Rethod........ : 8Z70C Hethod Description.= SeBivoLeti[e Organic~ Equipment Code .... = GCLIO Batch ............. : 151185 AnaLyst...= dpk Ea e el es eee ATeR we) Parameter/Test Description Units TIES ote e 5 T EE n EmuE YEm Pyridine, TCLP Leach ug/L TS me, HER EE Emi LER l~4-Dich[orobenzene, TCLP Leach ug/L Z-HethyLphenot (o-cresoL), TCLP Leach u~/L En LE ER gE Bmir las Nexachtoroethane~ TCLP Leach ug/L EERE pa B22 Imi iim Witrobenzena, TCLP Lech wa 4-~ethy[pheno[ (m/p-cresoL), 1CLP Leac ug/L N|troben=ene~ TCLP Leech E hSEmmSenTteh B5 3 EE ERI (iE HexachLorobutadiene, TCLP Leach ug/L ug/L m EH EE Emie rE 2,4,5-TrfchtorophenoL, rCLP Leech ug/L 2,4,5-Tr~chtorophenol, [CLP Leech ug/L desma" SE EEE SL 2,4-Dini~rototuene, TCLP Leach Emme BH ph BE ERI ER ~exachtorobenzene, T~LP Leach Pentach[orophenoL~ TCLP Leach ug/L ug/L ug/L OC ResuLt &3.01& 76.093 76.857 T2.158 7~94..8.80881~16 6~.955 85.824 82.419 85.191 75.485 67.542 gC ResuLt True VaLue 100.000 100.000 100.000 100.000 10I10000.0..900000000 100.000 100.000 100.000 100.000 100.000 100.000 Orig. VaLue gC Ca[c. ZO.O00 10.000 10.000 10o000 111000...000000000 10.000 10.000 50.000 10.000 10.000 50.000 U 63 U 78 U 77 U 72 80 U 7~ U 80 U ~3 U 86 U 82 U 85 U 75 U 68 * Limits F ~ 16-100 ~ 38-100 ~ 37-100 ~ 34-100 ~ % x eee 35-I0~ $1-105 ~ 41-100 % 51-101 % 54~107 ~ 56-11.5 ~ 50-113 ~ 50-11Z ws 'Page 15 Bi i te * Y.=~ REC, R=RPD~ A=ABS Diff., D=~ Oiff. 22009955..00557722 33MMAA0011555522334499 4Jo0b NNuummbbeerr.:: ZZ33T7O05NTT o~ uU r.~ L I T Y . C ON T.R 0 L R ~: S U L T S RReeppoorrtt DDoattee..= 0066//1133//22000055 - Test Method........ : 8270C Method Description.: 5emivolatile Organics Equipment Code .... : GCLIO Batch ............. : 151188 Analyst...: dpk - EEr E r Tee see Parameter/Test Description PPyyrriiddiinnee,, TTCOLPP LLeeaschh 1,~-Dichtorobenzene, TCLP Leach 2-Methy[phenot ~o-creso[), TCLP Leach Hexach(oroethone~ TCLP Leech 4-MethylphenoL (m/p-credit), TCLP leac N~trobenzene, TCLP Leach Hexachlorobutadiene, TCLP Leach 2,6,6-Trfchtorophenot, TCLP Leach 2,4,5-Tr~chLorophenol~ TCLP Leach 2,4-Dinitrototuene, TCLP Leach Hexach[orobenzene, TCLP Leech PentachLorophenol, TCLP Leach Units A ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L gC Result QC Result 020..00000 UU I0.000 U 10.000 U 10.000 U 10.000 U 10.000 U 10.000 U 10.000 U 50.000 U 10.000 U 10.000 U 50.000 U True Value - - Orig. Value QC talc. * Limits F Page 16 * %=% REC, R=RPD, A=ABS Diff., D=% Diff. 22009955..00557733 33MMAA0011555522335500 sb Nbr: 5757 Job Cntee s--ori I~un~bar. : 237037 re WUACITY QUALITY conTeol xesuirs CONTROL RESULTS TT necarvcaorn bert Bue. 613200 Report Date. : 06/13/2005 Th: TER QC Type Descrfpt|on RT eha Seerpe ian Sematatitorsmica Cane con san [mr : 8270C eer Hh Method Description.= Semivotat{~e Organics [ Test Method ........ ReaD. Code Lab ID Equ,~nent Code .... : GCLIO Batch ............. : 151188 Date T~me Analyst...: dpk Cs Paecoteenrteorton TillsE mloemeccntenteTero Veln _ ori von = Ste, +metate Parameter/lest Description Units T AR dT h wh mmr mbm memim Ye Pyridine, TCLP Leach Nite Gosresstr, 7) ism es Rem be 1 kom 1,4-9~ch[orobenzene, TCLP Leach Ta esc Sgt ee i RTA 2] 2-Methytpheno((o-cresol), TCLP Leach Hexachloroethane, 1CLP Leach HeeRsen 160 eachSra a wobee as mE REE Ee 4-Methylphenol (ra/p-cresot), TCLP Leac Boaboreosaatees Ta L Ra BE lowe bp & he Nitrobenzene, TCLP Leach STI TeoTchher an ma mmm RUE Le Hexachtorobutadlene, TCLP Leach SST To BA ten mie dow ba Si 2,4,6-Trichlorophenol, TCLP Leach Esme, Ti tt a aim wen de vn iA 2,4,5-Tr|chtorophenol, TCLP Leach ator 8 sa Fi Iden woke vk % ham 2~4-Dfn|troto[uene, TCLP Leach Fever 160 ton Si ies lowe unm i an Hexachtorobenzene, TCLP Leach am Tew Mowe vm XE Pentach(oropheno!, TCLP leach' ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L QC Result 412.457 694.205 755.849 621.828 735.371 785.401 559.6~4, 812.67~ 831.182 88g.368 709.603 687.933 QC Result True Value 1000.000 1000.000 100~.000 1000.000 1000.000 1000.000 1000.000 1000,000 1000.000 1000.000 1000.000 1000.000 Or|g. Value OC Calc. 200.000 100.000 100.000 100.000 100.000 100.000 100.000 100.000 500.000 100.000 100.000 500.000 U '41 U 69 U 75 U 62 U 74 U 79 U 5~ U 81 U 83 U 89 U 71 U &Q * Limits % 38-100 ~ 37-100 % 34-100 % 35-106 ~ 41-105 % 41-100 % 51-101 % 55-107 % 56-115 ~ 50-113 % 50-112 Pan To ek BC, ot, At Bi, Be 0 Page 17 * ~=~ REC, R=RPD, A=ABS Oiff.~ 0=~ DTf. 22009955..00557744 33MMAA0011555522335511 I Job Number.: 237037 = CUSTOMER: Weston Solutions, Inc. QUAL I T CONTROL RESULTS REJECT: CONFIDENTIAL CLIENT. ---- Report Date.: 06113/~005 AT: - "teTesstt MNeetthhoodd................:: 2608 8260B Method Description.: Volati[e Organics - EE EEqquuiippm aeenntt CCooddee.......: GGECLL1S6 ~atch ............. : 151446 ew eee Parameter/Test DescHpt~on IRB Vinyl chloride, TCLP Leach 1,1-Dichloroethene, TCLP Leach 2buna QE TEL5 Lh wn 00% 2-Butanone (MEK), TCLP Leach Chloroform, TCLP Leach OEraeus toa ant iano Carbon tetrachloride~ ICLP Leach -- Eenene,TCLeven wi 0b Benzene, TCLP Leach 1,2-DichLoroethane, TCLP Leach EAL 3 EE Trichloroethene, TCLP leach TCChehlt[oroarrocobhbeetonnrzzoaeenntseh,,enTTeCEL,LPP TCLLeLePsacchhLeach Units uglL uglL ug/L ug/L ug/L ug/L ug/L ug/L wn ug/L ug/L QC Result 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 111000000...000000000 UUU. ~C Result True Value AAnnaallyysstt......: jjdonn Orig. Value eee) QC talc. * Limits F wrPege 18 es am, mst %=~ REC, R=RPD, A=ABS Oiff., D=% Diff. 22009955..00557755 33MMAA0011555522335522 dJoobb NNumub~eerr.,:: Z233T700S3T7 QUALITY fCoOuNTTLRoOLL R eE sSsUeLrTeS RRepeoprotrtDaDtaete..:: 0086//1133//22000055. (ToCmRIWTooGnSNolEutoRe; Tine. e TokTerw: coomesG|Etow Joosno [Tonee ro] Method Description. : VoLa~l te Organics Parameter/Test Description Vinyl chloride, TCLP Leach mE lwl-D~chtoroethene~ TCLP Leach 2-Butanone CMEK), TCLP Leach Chloroformr TCLP Leach Carbon tetrachloride, TCLP Le~ch Benzene, TCLP Leach iSrc,eroer Lucha lw2-Dich[oroethaner TCLP Leach Units ug/L Ug/L ug/L ug/L ug/L ug/L ug/L Tr|ch[oroethene, TCLP Leach ug/L Tetrachtoroethene, TCLP Leach ug/L Chtorobenzene, TCLP Leach ug/L Bal:ch ............. : EEQC Result I00.000 U |00.000 U OC Result tO0.O00 U |00.000 U ee u 100.000 U 100.000 U " iO0.O00 U 100.000 U 100.000 U 100.000 U True Value Orig. Value QC Catc. * Limits F -- -- Page 19 * [=~ REC, R=RPD, A=ABS D|ff., D=[ Diff. 22009955..00557766 33MMAA0011555522335533 sb an. rr Job Number.: 237057 QUAL I T CONTROL RESU L~ $ aor one cas Report Date.: 06/13/2005 - CUSTONER: Weston Solutions, Inc. LomeTomo Type Description Teves Test Method ........ : 8260B Reno Gesription. Votite ora Method Description.: Votatite Organics PRAECT: CONFIDENTIAL CLIENT ATTN: temce| woJotunmtr owe vie Reag. Code J Lab XD I Oituti~ Factor Date Time Capo con ss Tt . EqU~l~ent Code.... : GCL16 En Batch ............. : 151446 AnaLyst...: jR - (EEPRart eto e Dorion RitR so NndT t G6a ents | Tron van rig. low 5 cale , rvines | Parameter/Test Description TE Tw eR Vinyl chtor~de, TCLP Leach eet tn wt Bea 1,1-DichLoroethene, TCLP Leach HA Rls a mo RE 2-Butanone (MEK), TCLP Leach naroers, 1a ten FAH Chtoroform, ~LP Leach AS ar a SA RRS Carl~on tetrachtori~e, TCLP Leach Benzene, TCLP Leach = rath, 1p teach an Jie 1,2-Dichtoroethane, TCLP Leach Tilman: 65 Lh woo ome Trichtoroethene, TCLP Leach a Sld o te WSA we Re ~etrachtoroethene, TCLP. Leach Unit~ ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L QC Resutt QC Resutt True Vatue Orig. Vatue QC ~alc. * L~mfts F 100.000 U |00.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U 100.000 U Ch[orobenzene, TCLP Leac~ ug/L 100.000 U Pano ak, hr, eatoe, DOI, Page 20 * %=% REC, R=RPD, A=ABS Diff., D=% Diff. 22009955..00557777 33MMAA0011555522335544 Foner Job l~umbe~.'. 237037 GaE: Veston Solstens, Ine. QUALITY CONTROL RESULTS FRsicer: CoRFIOBTIAL GLI [-- Report Date. : 06J13/2005 os Er Test Hethod ........ ; BZ60B Nathosbose iptian: Vtneite organics Apne ill x Method Deecription.: Voletite Organics Equil~nent Code .... : GCL16 Batch ............. : 151446 AnaLyst..,: jdn Esme [wma ww a Re E e] Parameter/Test Oescriptton I Vinyt chtoride, TCLP Leach rRmSmEtwiee 5wmBE mEER mmEmmin TEEEE 1,1-DichLoroethene, TCLP Leach ra # z= BE BRIT iif 2-Butanone (NEK), TCLP Leach pEmEECL., BOER BE mmir IEE Chloroform, TCLP Leach Carbon tetrachtor~de, TCLP Leach SEE # Es ER Emi iif Benzene, TCLP Leach BEte EB AE BE EBIZ 13} 1,Z-Oich|oroethane, TCLP Leach E ETeAeT 3HEHER BB2E5R SBREI:F 1i4i%H Tr{chtoroethene, TCLP Leach PEER. #53 BE EES IE Tetrachtoroethene, TCLP Leach Units ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug/L QC Re~utt 419.75& 568.Z60 450.964 483.812 524.058 446.642 510.630 453,156 456.820 QC Result True Vatue 500,000 500,000 500,000 500.000 500.000 500,000 500.000 500.000 500,000 Orig. Vatue QC Catc. * Limits F I00.000 100.000 100.000 100.000 100.000 100.000 100.000 100.000 100.000 U 84 U 114 U 90 U 97 U 105 U 8~ U 102 U 91 U 91 ~ 52~134 % 51-136 ~ , 29-139 % 75-122 % 64-132 g 75-122 % 67"120 ~ 75-124 % 70-125 chlorobenzene, TCLP Leach ug/L 443.474 500.000 I00.000 U 89 % 76-116 wnPage 21 er -------- * ~=~ REC, R=RPD, A=AB$ Diff., D=~ Diff. 22009955..00557788 33MMAA0011555522335555 en ---- - irr QUALITy CONTROL RESULTS CONTROL RESULTS wren Report Date.: 06/13/2005 = C[oimn[ wet sotution ire o ROMJEET:CoomOEeHTwIw AL|ENTwo oEmi mn me] me a]z = MTeetsthoMdetDheoscdr.i.p.t.i.o.n...:: 82608. Valatile Organics Method Description. :Vo[atile Organfcs E`SqAuiEpn.en.tC.ode. .l.t: GCLl6 151446 Batch ............. : 1514/,6 Analyst...: 'jdn - Ew ee Te] Parameter/Test Description Vinyl chloride, TCLP Leach - BThgmamoevdes wm me ltl-D1chloroether~e, TCLP Leach S[EEmR ZBER: 2-Butanone (MEK), TCLP Leach - t S TL F Bami chloroform, TCLP Leach a Carbon tetrachloride, TCLP Leach E EEE eB2 Em Benzene, TCLP Leach imte ge BE 1,Z-Olchtoroethane, TCLP Leach HEmer 3os BBRL Trichtoroethene, TCLP Leach s Tetrach|oroethene, TCLP Leach # EE! ChLorobenzene, ICLP Leach Units ug/L ug/L ug/L ug/L ug/L ug/L ug/L ug[L ug/L ug/L QC Result QC Result True Va(ue Orig. Value QC talc. * Limits F 100.000 U 100.000 U 100.000 U I00.000 U I00.000 U lO0,O00 U I00.000 U 100.000 U 100.000 U 100.000 U Page 22 * ~=g REC, R=RPD, A=AB$ Diff,, ~=~ Dill, 22009955..0055779 33MMAA00115555223356 Jdoobb uNmumbbeerr.:'. 225377005577 CUSTOMER: Moston Solutions, Inc. QUAL I TY CONTROL RES FUELTTES PROJECT: CONFIDENTIAL ELIENT pReoprott1: oDantet.: ars 05/13/Z005 ATTN dai Kesar LT A.ot: Tes~ He,hod ........ ; 6010B Method bescription.~ Leachab[a, Metats Anatysis ([CAP] Equipment cede .... : lOPS Batch ............. : ISOT?O (Eo Tomer TT E [0e [pa Parameter/Test Descrfp~|on Tm om Arsenic, TCLP Leach Barfum, TCLP Leach CEron,RTeIoh EgA S=oren u cadmiums TCLP Leach Un|ts rng/L ~g/L ~9/L Oc Resutt QC Resu[t 0.01000 U 0.01000 U 0.00200 U True Value rSohtieraFrea, tLooen Chromium, TCLP Leach Lead, TCLP Leach Se[enium, TCLP Leach Sliver, TCLP Leach wswhmg/L ~9/L mg/L ~9/L aSotmosemn 4 0.01000 U 0.00500 U 0.01000 U 0.00500 U Anatyst...: tde ooTae-- Tna] Orig. Vatue" QC Ca[c. * Limits F ogPage 23 ser va 0 * %=~ REC, R=RPD, A=ABS Diff., D=~ Dtff. 22009955..00558800 33MMAA0011555522335577 dJoobb WNuusmbebre.r. :: 225377003377 SQUUAALLi[ sTyY zCeOaNi]R aO ceL ARE ES iUeLvTsS RReeppoortrtDD ataete., ; 0086//1133//22000055 - EEE ETT I : Loom [www [wee |wn Jowmmme] me vm] Test Method........ : 6010B Equipment code .... : ICP5 Analyst...: tds Method Description.: Lemehab(e~ Metmlm Analym~m (ICAP) l~tch ............. ~ 150790 ~ [EETee Parameter/Test Description . EEmEEEEE Arsenic, TCLP Leach ReE BattLe, TCLP leach s Cadmium, TCLP Leach RE Chromium, TCLP Leach Lead, ~CLP Leach gelenium~ TCLP Leach Silver, TCLP Leach TT Units B g F g Eamg/L o E mg/L mg/L E mg/L QC Result QC 0.01000 U 0.01000 U 0.00200 U 0.01000 U mg/L 0.00500 U ~g/L 0.01000 U mg/L 0.00500 U Result ea e ere 07 True Value Orig. VaLue QC care. * Limits F e+ arr. Page 24 22009955..00558811 33MMAA0011555522335588 CoTmmssBaomToa m E omen| wT nTo[wee--ere]--oe rin] Q QUUAALLIIT TY Y control CONTROL REsuLrs RESULTS Report Date.: 06/13/2005 Test Method ........ : 6010B I Method Pescr~ption.: LeachabLeI Hetata AnaLysis {ICAP) Equip~nt Code..,.: ICP5 Batch ............. ; 150790 AnaLyst...: tds E TT w eee ray T[aeter]d Parameter/Test Descriptfon n TPin womSmeySSTemeSwesol Araenfc, TCLP Leach SE BE IE Bariur~, TCLP Leach BR Cadmfu~, TCLP Leach B20 8 o Bo im m Chromium~ TCLP Leach fii ooo Lead, TCLP Leach Ei % om Se|eniu~, TCLP Leach Units mg/L moil ~g/L mg/L mg/L mg/L OC ResuLt OC ResuLt True VaLue Orig, VaLue OC talc. * Limits F 0.01000 U 0.01000 U 0.00200 U 0.01000 U 0.00500 U 0.01000 U St(vet, TCLP Leach mg/L 0.00500 U wR n ee T eee Parameter/Test AArrsseenniicc,, TTCCLUP LLeeaacchh EA #oEE Barium, TCLP Leach Sr TCP Leach Cadmfum, TCLP Leach Chromium, TCLP Leach Lead, TCLP Leach SHeleRaiim, TUF Leach I#0 o my l SeLenium, TCLP Leach Description Units wmagt/L mg/L EA mg/L mg/L mg/L mg/L OC ResuLt 0.00.011000000 UU 0.01000 U SO0a..0Ot1Oe0Ze0On00 yUU 0.00500 U 0.01000 U QC ResuLt True VaLue Orig. VaLue QC Cetc, * Limits F = = S~tvar, TCLP Leach mg/L 0.00500 U rs | > sat eo 1 Page 25 ~ ~=~ REC, R=RPD, A=ABS Diff., D=~ Diff, 22009955..00558822 33MMAA0011555522335599 PA oe QUA L ] TY CONTROL RESULTS Job WLr~ber.: 237037 . Report Pate. : 06/13/2005 ' = CUSTOMER: Weston Solutions, Inc. REJECT: CONFIDENTIAL CLIENT ATI: x - Test Wethed........; 0100 Test Method ........ : 6010B EEqquuiippameenntt CCodoed.e......:. : I1C63P55. AAenalaylysts.t.....:: ttddss Method D~scription.: Leachable, Meta[~ Analysis (ICAP) Batch ............. : 15D790 - Eee ee eee Tame] Parameter/Test Description - TET CT TE mm e1 Ehm Arsenic, TCLP Leach EEE 7m EE Emih ER Barium, TCLP Leach CadmiUm, TCLP Leach Ea oom igs meth ES Chromium, TcLp Leach - ES Boi iE imi IEE SLSeeelaleednn,iiuu~mmC,L,PTTCLCLeLPaLchoLeaacchh Units ~g/L mg/L mg/L mg/L wmmaggnJ/LL QC Result 0.0~857 B 1.99410 0.04931B 0.19911 ol0.10660 0.09794 B QC Result True Value OF~g. Value QC Catc. * Limits F 0.10000 2.00000 0.05000 0.20000 900...111000000000000 0.01000 0.01000 0.00200 0,01000 000...000001050000000 U 99 U 100 U 99 U 100 UUU 9918805 ~ 80-120 ~ 80-I~0 ~ 80-120 ~ 80-1~0 ~ x~ a0 80-120 80-120 SilveF, TCLP Leach m9/L 0.04770 B 0.05000 0.00500 U ~5 ~ 80-120 rnsPage 26 manne * ~=g REC, R=RPD, A=AB$ Diff., 22009955..00558833 33MMAA0011555522336600 Job Number,: 237037 "connvestSatie Te DUAL [ TY CONTROL RESULTS PAE: CATIA ute Report Date.: 06/13/2005 Thr aT Kort 0st Rathod.0.2. STAG Ee 8 dmntte e EEE e Eyere ERee asRE 0 meaen] T5000 wn QC Lab [D Reagent MB 150918-004 Units mg/L EEE oe BSE vo sos wx wom CREE LC$ 150918-005 IOSB$TCN2 mglL Result o0.e00m2m6s0 8 0.08780 QC Result TTT TTT Taam True Va|ue Orig. Value QC Calc. F * L~mits Date Tims 06/03/2005 1331 0.10000 0,00260 B 88 ~ 80-120 06/03/2005 1332 E E Rn Ra Eewe BameT a va ~C Lab ID &~B Bas 151124-003 Reagen~ Units wmagi/Kg QC Result QC Result 229.000 U True Value Orig. Value OC talc. F * Limits Date Time - 060/66/022//2200005500884499 e a me ee T a eee C Lab ]D Reagent Units CS T1S5T1T162-4-0000%4 T[OOOOFFSSTTLLKE5S mmag/s~ag OC Result 55005559..7777 QC Result True VaLue T47o8.0.00 Orig. Value QC Catc. F * Limits Date Time 01066 TX~ S533-1400 00a6r/0o22//9200085 v09i1k4 Tart yah CLLoe T EREI TETCL ; Lab ID Reagent E IEEE ERTEE i 1m ~ !51157-00g [05EPHTB Unite pH Units QC Result 6.97000 ,P 151157-003 105EPHTB pH Units 6.95000 ERs m aeSET etSR CT EeE y he = RSI T areEiEn OC Result True Value 7.00000 Orig. Value g~ Calc. F 0.03000 * Lim|ts A 0.20000 Pate Time 06107/2005 1051 7.00000 0.05000 A 0.20000 06/07/2005 1051 E e EE. Bead n mam Lab 10 Reagent Units "T1e5o0a8n1i1--0o0011 wmogr/tE.g BEEETmEEeERiE oOk W 3w5e mi1g 3oan EEE 150811-002 ]05BSTSF1A mg/Kg . BE HUY3 .pnieeE 237037-6 T05BSTSFI mg/Kg HSER E37037-6 i05BSTSF1A ~g/Kg ~C Result 8B.8800 UU 134.34 B 38.19 B 40.60 B QC Result 38.19 True Va(ue 185.60 185.70 B 180.00 Orig. Ya(ue OC talc. f * oT 8.80 ~ 72 ~ 8.51 U 21 N ~ 8.54 U 23 N ~ Limits 25-116 25-116 25-116 Date 0066//0022//22000055 0&/02/2005 06/02/Z005 06102/2005 Time 1144~255 1429 1442 1446 9 R 50 omitPage 27 nmi * ~=~ REC, R=RPD, A=ABS Diff., D=~ Diff. 22009955..00558844 33MMAA00115555223361 - EeE rror Job Nulnber. : 23T037 QUAL TTT PA ] T Y COI~ T eo L RESULTS .... Report Date, ; D6/13/2005 - C (ERN ee RPweRe ee eerrr Tee QC Lab Ig Reagent Units BETEEEREmmeae n Zl |LLJE0 se emo xem SEER WMDo 1T5500880033--000077 rurg/L , BER LC$ 150803-008 MO4LSTK010 ug/L BEITE On BEE EB3 150803-009 788 mg/L . EEESE BEE bod EB1 150803-013 792 mg/L BEBE EE wan EB2 150803-014 792 mg/L QC Resutt o O.ZO vU 2.12 0.00200 U 0.00200 U 0.00200 U QC Resu|t True VaLue' 2.00 Orig, VaLue QC Calc, F * - 0.20 U 106 % Limits 80-120 Date Time D0e6j/0o2z/z2a0o0nEs 11333311 06/02/2005 1334 06/02/2005 1336 06/0212005 1345 06/02/2005 1351 EBI 150803-025 793 mg/L 0.00200 U 06/02/2005 1410 PePage 28 = mt ram se ~=% RE~, R=RPD, A=ABS g|ff., g=% Diff. 22009955..00558855 33MMAA0011555522336622 TORTI Are AAN cE NETRaRE 7 Aan Lo RETERENEES AWo MoTES JE gt tr worn 2 REPORT 15A page of hi rear a teal srt of he rmyHIH dra. Thretre, hs rp shud 1) All pages of this report are integral parts of the analytical data. Therefore, this report should 22 A So eh ITLb Sr Toate ae eprom ary wate bus ect hn yd or be reproduced only in its entirotyo el mr Sen SES SE IRENE 2) Soil, sediment and sludge sample results are reported on a "dry weight" basis except Linen analyzed for LandfiLl disposal or Incineration parameters, AlL other solid matrix samples are reported on an received== basis unless noted differently. 3B Reporting CI ianrefsdehmS esed forsampleE size used d1lC utions wd poiT sturs content S (4app cable. 3) Reporting limits are adjusted for sample size used, dilutions and moisture content if applicable. 4) The teat results for the noted analytical method(s) meet the requirements of NELAC. Lab Cart, ID# 100201 te sts Sookbcn,. hs Dens Fotos oh oe cae3 Ftd ea 5) A'ccording to &OCFR Part 136.3r pH, Chlorine Residual and Dissolved Oxygen analyses 'are to be performed i~nediately after aqueous sa~pte collection, ghen these parameters are not ir~ica~ed as field Fie oy sr ken nately BR 0s a pra on rb RF pH Field) they ~ere not analyzed immediately, but as soon as pass|hie on laboratory receipt. Closeiy of fase, catia sn sthcvicicn ary bar of Gh ay spn i Ve repr) Ctossary of f~ags, qualifiers and abbreviations (any number of which may appear in the report.) ara Inorganic QuaLifiers (g-Cotum~) U TT RErar SlaamtS a or ae b thasat ni os U AnaLyte ~as not detected at or above the stated= L1~i~. < No~ detected at or above the reporting limit. J ResuLt is less than the RL~ but greater than or equal ~o the method detection RII He BaRR Sa - B Result is tess than the CRDL/RL~ but greater than or equal to the IDL]MPL. A A enEh le MRRMR SaT hlnheor Sn to th mth deen S Result was determined by the Method of Standard Additions. F AFCEE: Result is less than the RL~ k~lt greater than or e~uat to the method detection ore Fags hn coms inorganic Flags (FLag Col~cnn) Th 1,4 rin rls nd hr Ls ICV,CCV,ICB,CCB,ISA,ISB,CRI,CRA,HRL: Instrument related QC exceed the upper or lower control Limits. LET oat a extn cv oper a var contr Ci * LCS, LCD, MD: Batch ~C exceeds the upper or lower controL limits. LER edRgee tm ye + MSA correlation coefficient is loss than 0.995. its. Limit. ~ MS, MSD: The anatyte present in the original sample is ~ times grea~er than the matrix spike concentration; therefor% control Limits are not applicable. bBE uhlTeEanI brATalrir ineor ed_--_-- E SB: Serial dilution exceeds the control limits. Ei tens I EA Cri ii H MB, EBI,EBZ+ EB3: Batch ~C is greater than reporting limit or had o NE Te cir ote. negative instrument reading Lower than the absolute value of the reporting limit. H MS, MSD: Spike recovery exceeds the upper or Lower control Limits. biFd, ee nal 55 nr g A$(GFAA) Post-digestion spike was outside ~5o115~ control Limits. Organic QuaLifiers {~ - Column) Oe Mi 8 tie at or shove he stated Le U Analyte was not detected at or above the stated YT o mlT n eenie:d aun belo the rprtig ait or tnatively ND colr@ound not detected. J ResuLt is an estimated value beLo~ the reporting limit or a tentatively fre identified co~pound PRE ee Q Result was qualitatively confirmed~ but not quantified, 8 Thm e remterutlc apes rare 3 pnicea fot puters. C Pesticide identif|cation was confirmed by GC/MS. The rem Ft STE LIDS Gol pce. The chromatographic response resembles a ~ypical fuel pattern. Em Tn Te rere Z The chromatographic response does not resemble a typical fuel pattern. | VEIT I WT SE TTR eats td ment 16 E ResuLt exceede~ calibration range, secondary ditutiort required. Te! Eich SC rater San report UNM PB --_-- F AFCEE:Resutt is an estimated value below the reporting limit or a tentatively identified compound Organic Flags (Flags Column) B NB: Batch OC is greater than reporting Limit. * LCS, LCD, ELC, ELD+ CV, MS+ MSD, Surrogate; Batch QC exceeds the upper or lower control Limits. (tiC) TER RS RR: i areerte rerting Lime EB1, EB2, EB3, MLE: Batch QC is greater than reporting Limit 4 Ete ited he lat caacs ret A Concentration exceeds the ~nstrument calibration range bn Th i ert ie 603 a Concentration is below th'emethod Reporting Limit (RL) BSi IR aSohee arearsSreeerfut B Co~ourK~ was found in the blank and sample. O Surrogate or matrix spike recoveries were not Td airoaShoe Tmatrateehlaork 1 on sand wih 20. obtained because the extract Has diluted for . analysis; also compounds analyzed at a d~lution will be flagged with a D+ 1ERS AT pB k eL e tmteet Freveese fe ot catcatae H Alter~ate peak selection upon analytical review v re ooee veto tedwhenthe Xdiffe batieen the results oftwo Gc columns is I . Indicates the presence of an interfence~ recovery is not calculated. M ManuaLLy integrated compound. P The Lower of the two values is reported when the ~ difference betwoen the results of two GC columns is [ 22009955..00558866 I3MMAA0011555522336633 - ror win Pe greater than Abbreviations BE i st ee ve Post Digestion spike [GFAA Samples - See Note I below) Ha EE 2 CS MLE Batch Designation given to identify a specific extraction, digestion, be Eninie Eelmeh CAP Capillary Co{umnCCB Continuing Calibration Blank & Slee CCV Continuing Calibration Verification SF Shien CF Confirmation ana[y~i~ of original Sma Cl Confirmation analysis of AI or 91 EIC2 Confirmation analysis of AZor 92 c3 Confirmation analysis of A3 or 03 5 ENEERLISER - GICRA CRi LLLooowww LLLeeevvveeelll SSStttaaannndddaaarrrddd CCChhheeeccckkk --- G1F0AA; Mercury minal, CV Ca|ilbration Verification Standard Sore Sr SIE Dil Fac Dilution Factor - Secondary dilution analysis Dilution I J ETE 92 Dilution 2 8 dis D3 Dilution 3 He EER, 9LFac Detection Limit Factor Distilled Standard - Nigh Level EE ee OgL Distilled Standard - Low Level SB sme DSN Distilled Standard - Medium Level EBI Extraction Blank I EEEEE EB2 Extraction Blank 2 ins, preparation set, or sso analysis set D] Blank ELC ELD 1 CAL @Icv oFIPL 3ISA ISB .,Job No. Sp6LCD LCs g5MB Method Extracted LCS Method Extracted LCD initial calibration HEE. Initial Calibration Blank Initial Calibration Verification plume instrument Detection Limit Eran e interference Check Sample A - ICAP ~nterference Check Sample B - ZCAP EHEELEIREL EE si es sic TLLhaaebb If%DDirAAsntn88sirxnuumdbbieegrritsuunniiodfquueetheL|aasbbaoomrrpaaltteoorryy%D iwdheincthifriecfaetrisonto a Laboratory Control Btandard Duplicate ema te Laboratory Control Standard with resgent grade water or Herod Bank or (58) Preperation sient Method Blank or (PB) Preparation Blank EEEaE. Method Duplicate specific a matrix re, sc te client, project and shampilengrodup tm et free tom the an=lyre of intarest MDL Method Detection Limit MLE NRL BBoEMS - BEER ND [mrI pee PREPF oFF5 EEERmRRmaAeEwl A1 EREES A2 PERS. RD - 1 Emmi RE BC RL. BBy oEEEA ation overt te RPD Medium Level Extraction Blank Method Reporting Limit Standard MethodoSftandard Additions Method of Standard Additions Matrix Spike mais Se outeace Matrix Spike Duplicate Not Detected Preparat|on factor used by the Laborat0ry~s Informatt0n Management Post Oigestion Spike Re-analysis of original Re-analysis of 91 Re-analysis of 02 Re-analysis of 93 Re-extraction of dilution Re-extraction of original Re-extraction Confi rmation Reporting L~mit Relative Percent Difference of duplicate (unfounded) analyses System (LIMS) BRF Relative ~esponse Factor Retention Time on 22009955..00558877 33MMAA0011555522336644 . 2; 5 REFERErNCEoS ANaDrWmOTES 5 in nt 1.L4 AN pcnr frle, 0 Retention Time Window Sample [O A 9 digit nL~ber unique for each sample, the first six digits are referred as the job number geeded Control Blank 5fo E Serial DEittonR(Calculated whe sample conentraion exces 30 tims the 1) ~D Serial Dilution (Calculated ~ihen sample concentration exceeds 50 times the HDL) BE UCB Unseeded Control BLank EERE, SSV Second Source Verification Standard BEERmSme me SLC~ $o[~d Laboratory Control Standard(LCS) PHC pH Calibration Check LCSP pH Laboratory Control Sample Bie LCDP pH Laboratory Control Ss~ote Duplicate |. pH Sample PupLicate oOEERE RDFP F[ashpoint Sable Duplicate LCFP Ftashpoin~ LCS Eine, GeLex Check Standard Range 0-1 iamimmmma GoLex Ch~ek Standard Ra~e %10 8 Eminimmimie, 6eLex check Standard Range 10-!00 Fe i ctty ct ot 0 re G4 Ge~ex Check Sta~ard Range 100-1000 Ee SRE wl nw Note 1= The Post Spike Designation on Batch QC for 6FAA is designated with an "s" added to the current EE meRI et os ts 0 abbreviation used. EX. LOS S=LCS Post Spike (GF/L~);.HSS=t4S Post Spike (GF~) EEN A en Note 2: ]he HD calculates an absolute difference (A) ~hen the sample concentration is Less than 5 ti~es the reporting |imit. The control Limit Is represented as /- the RL. 22009955..00558888 33MMAA0011555522336655 m iI16S0 Bei Rea] SE17243 BLm a FE i `Epa - I bie EEE tll [ C T EH H EREth - ian d Ee Cr E ot : ] Se TH R T O En fa (33 _ I 109 EE CHEE | Fafefmleileol TTT ri | i alti he Cnty MN atgie LHe Tah T- oaBlBIE 3 yj as1s5 g BE | NA [shi|t A|T , GE hi GE si ia a i I hitter 2005.0589 2095.0589 3MMAA001"1555522336666 310 gonk S~reet re D~atur, Alabama 35601 sw 256.35329]0 tele geotechnical anaryti(al o materials . egvlronmenta] ceDecatur. StnTodor Flor+nce..~ntgomeryo Tu~otooso 25~.353.3944 fax Se---- TRANSMITTAL -- ee ww~.TlrLItt(. Onl TRANSMITTAL Albany. Valdo~ta At ALABAM~ GEORGIA TTOO:: _ WWesesttoonn.SSooluuttiioonnss,,I.nIncc.. DDAATTEE:: ....... _A__uAugguuetsst 5, 22000055 - --182156P25uTPuomhpvherevyAAvvee__ "TrTrLLUJOOBBNNUUMMBBEERR:: __ 0205004 Aum ALOE? Auburn, AL 36832 ATTN: Tim Erna020504-041 ATTN: . . Mr. Tim Frinak - PPRORJECOT: _J_ ERRefeCeferreeTnnccee: NNoo,, 0022116811--112289--008811--00000011 --D Decatur,e AL quen WWEE AARREE SSEENNDDIINNGG YYOOUU:: -- HEREWITH ........ 00 weemseraareconn UNDER SEPARATE COVER 9 Grain Size Di,,s,tributions and 3 Grain Size DistribuUon with Hydr,,,o,meters for samples listed on - ----e--e--t---------------------- Weston Solutions Chain of Custody / Analysis R~quest Form dated 06/08/05 (copy attached) RREEMMAARRKKSS:: - - --- TIL Inc. 22009955..00559900 I3MMAA0011555522336677 [EE | ole Re] SESE Sis | ] S| 1 | Fes HHH 14LILI] (BS &| [1] |emo] SSH. ES DE | 1 { jl E = Cel ETT BB | || C= i eee i yo i3 shor (06 EgR ed psa Mids PLT 388. ddd i ii 11]! ! RT|i Be[1) || | A yi | 3 3 JER : iil HA Ni- Hi Lp) # [i E1E4R5E3NE9E4L;ED Nf al4a 34 Hy i A 3 A HE ! i |I Eff 14 | I 2095.0591 3MA01552368 E TTT THT iY J | SHEE - EA | Tee Er 2 of I be Ll | - i | igE i I } 5 "4 =m TTT | [== TET EY i TTT [= TT [oe TTT BN i ! BRITT RTT] ede[TITITI AAT) clin self pe ! Be | 3b -3 pi qq q |b i] i {LhJE ii Aig 3 : iJ i IN 42 |! | [FFmm | 2095.0592 3MA01552369 S---- GRAIN SIZE DISTRIBUTION Ee or U.S. irirh SIEVE OPENING IN INCHES Siege azesazane 898 HYDROMETER T T I I E N N E EH 851 - 11 801 . TETIE N rT 751 . ATI CT 70~ - 10 EAR A 1 651 I I e A 1 0 1 T 551' E TTTIIeT TTT 451 . TTI TT TT 401 " ' TTITT 351 ' 1 10 1 1 301 ',. 11 1 1 251 , 11 1 AN 201 A Nr !51 ' ' 1 I RA 101 . 1101 El 51' ATCT ET TT, 01 . 1.00 | miners COBBLES GRAVEL coarse I t~ne II1:1 I GRAIN SIZE IN MILLIMETERS SAND coarseI medium I fine SILT OR CLAY 0,001 Sample ID | IT een[i memew Descdption % Silt - 43.8 % Clay - 10.0 [ seSmamlpeleddtbyy: Jew Client I SrSavmbpileoLooctateionn: [oonwsitee | Date Sampled: S1|~/2005 3 eS for | oCu om{om{oDn30 oDp10 [~sGreavesl amen veilt, Lo, | ~Clay 1 U7 Towfw',ow.~ ] o,.~vJoor.'~ Joo T/ oo |ooo.o [I a"s~~ ] ,~.e ____SSIIEVEEVAENAALNYASILS YRESSIUSLTRSESULTS LT e FA oT on Client: Weston Solutions PPrroojjeecctt:: 33MM --BBoroirninggss. Location: Decatur, AL Project Number: 020504-041 22009955..00559933 33MMAA0011555522337700 SoGRAIN SIZE DISTRIBUTION U,S. SIEVE OPENING IN INCHES U.S. SIEVE NUMBER8 I - TH ESR " fl I HYDROMETER -=.-} foEE e R olAm 1 1 E | aS E oH p TFIE E1 E0 ET H E E 1 ES S 0 9TA C IS 1 E = E11T 1 e T Re1 0T OE 1 e T I TEI NT) A AA T 1 E T iE Amnm 100 10 t 0.1 cotmsersn [GRAVEL ] COBBLES ,, GRAVEL I coarse l fine GRAIN SiZE IN MILLIMETER8 | SSAANNDD coarse j medium : a ---- Sample ID C GMN-~BC-D104-0-0101) 0.01 SILT OR CLAY 0.~1 TL ee Description Tobe Sampled by: Sample Location: Date Sampled: Seco uw POORLY GRADED SAND SSS ES Client onsite ------ [oooToso |ox| [Gravel -- SeSand| wsit_|wcuy| 4 ~.~ SSIIEEVVEE ANNAALLYYSSIIS RESUULLTS |Lr a Client: Weston Solutions Project: 3M - Borings Location: Decatur, AL = P~ojec! = Number: 020504-041 2200955..005594 3MMAA00115555223371 RAN SE DSTRBTON GRAIN SIZE DISTRIBUTION us sercmmonnces woenmes 1 oun or Yalt e.eeaao say 898 HYDROMETER oo ELTTT realHTTHT] wll IT INS E 1 HHH HEHE lL EA olEE 3 1A eo LLErie F000 NO FE 10 0 JL IT TT mh FA 1 1A A eo TA = LEErr AHHHHE IH elEE qe Ee A AHH HEN HE] OE ES DO 1 w= + E31.. LL wi cums wansserers GRAIN SIZE IN MILLIMETERS [Ge RAVEL r TT av sSAa Ne D no r ] i [cCoOBmBLeES FeTamra] coarse I fine coarse[ medium 1 fine swan SILT OR CLAY | GGMN-~BC-D104.,O-~tS0 = ee fan ] Sample ID Description Sampled by: POORLY GRADED SAND [SP) Client Sample Location: on,die d eo e|me Date Sampled: [oosu |oowi[Trims ews on[c=r]| 4 a ,.2~ I SIEVE ANALYS0 IS RESULTS a Si 7 Client: Weston Solutions Fron umber 620504041 Project: 3M - Borings Location: Decatur, AL Project Number:. 020504-041 22009955..00559955 33MMAA0011555522337722 EEeTToN GRAIN SIZE DISTRIBUTION - ages| eens U,S. ~,IEVE NUMBFR8 884 EE SRT I iT] - AHHH THE iE wo ESN HHH HHH _ SHAH HHH (TTT lL HHH EI - |FHof i | eo LLL TE ITE JET HH - o AHHHH 1] FH HHT - : olHHH HH FI 10 AE - E 0 1OE Do OE - Dt 0 1 Art HEH _ ---- - ETE IT - SLL JIE JETT RIT ITT JT) 100 10 GRAIN 81ZE IN MtLUMETERS d [coCOmBBeLEsS FMT STOR SILT OR CCLLAAYY 4 pn| CT CGMN-SBC-D103-0-0350 Sample ID To se eee a Description Sampled by: POORLY GRADED SAND (SP) Client Sew 4| ] Sample Location: TTaBDate 3| Sampled: TTL on$1t~ 5J1.912o06 er8|0 500 oo | 5% Tm eodlai[555 || ~"~ I ~s I 0.6 I o.~ I *'t Iz'~ I, aS'l'l 7.~1 SIEVE ANALYSIS RESULTS Client: Weston Solutions [Sime Project: 3M - Borings Location: Decatur, AL an Proje,ct Number: 020504-041 20955..005596 3MMAA00115555223373 ? SE GRAIN SIZE DISTRIBUTION US. SIEVE OPENING IN INCHES U,8. Slk-'V~ NUMBERS I - en?298... 27083988 B3%8 HYDROMETER el EST TT TT TT] HHH EE 1 0 FN HHH ey AIH Em me | A AHHH QT J 1 A 1111 FI 1 OE 5. HH HE mn i 1 4 AA [HT FE 10 Lr of HHIE rr of HHH o HHH HEH oHEI 0 0A HEE ES EH UTE AT ETT "too 10 1 0.1 cE GRAIN ~IZE IN MILLIMETERS 0001 I i ---- COBBLES COarseI fine coarse I mecliumI fine Sample ID CGMN-SBC-Dt03.0-O$O0 SILT OR CI._~Y i ven Description se fo Sampled by: a Sample Location: 3 Two ea a|o| Date Sampled: POORLY GRADED SAND ($P) Client 4 TTL lr SSIIEEVVEE AANNAALLYYSSIISS RESUULLTS Client: Weston Solutions = ee Roan Project: 3M - Borings Location: Decatur, AL Project NumbeF, 020504.041 22009955..00559977 33MMAA0011555522337744 `GRAINGSSIIZZEERDDIISSTTARRIIBBUUMTTIIOONN CHE EE _ Tul U,S. SIEVE OPENING IN INCHES 143 eae SIEVE NUMBERS sekI me HYDROMETER _ 1 NE EE 101. A Hl N H AreHH HE P EE HET H wp T HE H RH EAHA iH E - 4H i I I 2 1 1 HH 1 H - F fH 3 EE 0 T 0 r - F EI H E HH 1 FE [] - e OH 0 1T OO OE _ oH H EHE i Em He - 11 GR~IN SIZE fN MILLIMETERS ] [comesF E o T Ter] e 1 [| s sSwILo ToOnR a CaLAwYr| ] coarse I fine coarseI medium 1 fine Sample ID - I Description Sampled by: le Sample Location: CGMN-SBC-DS01-0~)15{) POORLY GRADED SAND (SP) Client onsite Date Sampled: S/201200S Cu TTL one 3J)6 q SSIIEEVVEE AANNAALLYYSSIISS RREESSUULLTTSS 6.2 Client: Weston Solutions Project: 3M- Borings Location: Decatur, AL Project Number: 020504-041 22009955..005598 33MMAA00115555223375 To-- GRAIN SIZE DISTRIBUTION ny wor U.S, gra388fleyo SIEVE OPENING IN iNCHES corrguvas U.S. SIEVE NUMBERS 828t HYDROMETER feE fEE 1 E T S A T E r L eTrCN H 1 r 1E 1 1 e E 1EHC TT1TT ET TT Te 1 A 1 T TT C e EE E r r T He T0 F TT ETT E T T T T OTO TT E a\ T] I 100 10 ] EE COBBLES GRAVEL coarse l fine 1 0.1 GRAIN SIZE IN MILLIMETERS SAND coarse I rrlecl|umI fine 0.01 SILT OR CLAY 0.001 Sample ID ee CGMN-SBC-DS01-0-0050 Description % Silt- 76.$ %Clay 19,0 ~ rp e eefoe pe eepee Sampled by: --TT Ty Sample Location: = | -- Date Sampled: Client 4 SIESVIEEVE AANNAALLYYSSIISS RREESSUULLTTSS i Lr e e sn Client: Weston Solutions PPrroojjeecctt:: 33MM --BBoorriinnggss Location: Decatur, AL Project Number: 020504-041 22009955..00559999 33MMAA0011555522337766 GRAIN SIZE DISTRIBUTION THim U,S. SIEVt~ BHM OPENING IN IN=CH3ETS3 T 4 Sian i B BIAU,.S. SIEVEmNUMHBEHRS = iI n 1 = HYDROMETER H p'ilh i' ~H i ~'+""'"a E ""M ' "ta iE ll E e _ | p ] hi HST e FH TL IiTh T] _ AE rB e 1 E HES E EE- iH E : : - |SS I H i HH im I = | B :F iHH HH mi eiBer iEH - fe"IHTH [I| H 1Hi Ti] HHineri H i iis s] inn i 1HHR E H i l b i : a i | iHi inEig HHJE HEHHhR H L]Hi . 100 10 1 0.1 0.01 0.001 : = COBBLES coarse I fine GRAIN SIZE IN MILLIMETERS coarseI medium J fine SILT OR CLAY | F | a:Y a ] Sample ID CGMN-SBC-FTAOZ-O-0150 POORLY GRADED SAND ($P) Description a: Sampled by: Saml01e Location: Date Sampled: Client ons|te 51231200S - - i | | = =rEa E ] SISIEEVVEE AANNAALLa YYSSIISS RREESS!UULLTTSS } L |rTT | E Pemurpn er Client: Weston Solutions Project: 3M - Borings Location: Decatur, AL Project Number: 020504-041 x = 2095.0600 3MA0011555522:377 ST GRAIN SIZE DISTRIBUTION rrr FE --, eoat 3gsl ..cvecaga U.S. SIEVE NUMBERS 28 SHEE EE EH] wl HHH ee wel EEE SN Er ee oI1 0 CN ON so EEEEES re 1 YF A AHHH FD 1 10 1EO 2 SHH HEE ERE i CET Ere i el EE EE E EE Dt solEre HHH HAE 10 3NEYO o HAH HENEE wl ET ETTE Sse JIT SE EE rer oTJIT JATETTLJ JA | IEJ E -- wee COBBLES , GRAVEL coarse I fine GRAIN SIZE tN MILLIMETERS SAND coarseI meal,urn I fine I SILT OR CLAY | meee Sample tD COMN-~BC-DI01-0-0200 Description POORLY GRADED ~AND (SP) Client emo| onslte he a Date Sampled: [0100 5/24/2005 Cu 0100 08D060 |00330. | 010| %Gravel| sara|ws | w%cCilayy|' 010 I%Gravel 1%Sand %Silt I .... a 8 2 a Bt | 4 .~.531 ,=:s I 0.9 I 0.4 I ... O~t I 7.= ..'!.' 8S~0 I 7.6 SIEVE ANALYSIS RESULTS SIEVE ANALYSIS RESULTS ro ore re Client: Weston Solutions ] ne on Project: 3M - Borings Location: Decatur, AL Project Number: 020504-041 22009955..00660011 33MMAA0011555522337788 Seams - - |pwooErEsted od Sal gec2za3Is)naze"s~12T2]8]1 A1t 11 1 i ', ' II1~1 I I~ II I SN 1 10 1FA I 1 1 1 1 A I~ ~" ?1/1 JS IS 1i lI1 E lI'~i 1ttI~I , 1 I I1t!C 11t1T~il,!['TJ1T'~1 TT JI1!! 1Tt tlI ]II = ffoefn I I I fo i i I III~L 1 = llll I ' 1111~ t. 1 I1t I EE Ae) SN T 1 1O N ER -oIF H1J T II E 1~iltIlI t~~ i1E ~T ~! T I1I11~1~1 N N~IRIE m~,T ~. IIIIIII II CIT J I I }t1 I ~11 " '1 f Ce !II 1 . I 1 ~ III I " I I I ~ I, I TI EIt t1~111 III TT II TT ~ee I - m SII EtfEtI1;~11 111. t .1:III11t 5 IIIII I A 1 11 11t I~ i ~I I .. ~! 1 ~ I1~1 c.r...amII e~I r ~ I1 I~ | Sample ID CGMH~BC-WPA0t~IS0 Co meme Description Silt -20,6 % Clay - 14.0 de fCe lient wey | = I omen[eww Sample Location: onsite | OwDaeteSSeamppelesd: [~ mmm ~| Jeon TPTPTce[ov[00[060 T0%[D0[oral] ound |west|%Cy| - [TT 1 wc(/~)' LL ' PL I Temlwal PI I Cc 143.41,, , es~).5 Tes0,3 To0 |o | oe [wa] ~5.4 "ws 34.6 1} 4 ___SIEVEANALYSISRESULTS| SIEVE ANALYSIS RESULTS Lr = f= n" Client: Weston Solutions Project: 3M - Borings Location: Decatur, AL Project Number: 020504-041 22009955..00660022 33MMAA0011555522337799 AHHH "GRANSZEDISTRIBUTION GRAIN SIZE DISTRIBUTION usseme anes orgaog S8le.o useenacns ozeraess | B98 oscueren e SRETTAT TTm \ EES IH JT TE ET I11 el L TNTE err eHHHH HEHE FE 1 1 : {Nr 2 Er : o HEHHH J 1 11 olEr EE EErr rr 00 EO EN 0 00 1 ALEe Ss 8 11. 1 fm | [F ome ir cunsze was wereRs| COBBLES t GRA, VELfine GRAIN 81ZE IN MILLIMETERS SAND IC'O~arrs~e I medium I fine wean] SILT OR CLAY J Sample IB [ J ee see areJr[e oyr mlnmmemees Description CGMN-,5~C-BKGO 14-0000 POORLY GRADED SAND Client ons[te s/2s/2006 reco wro[rer[]ce|GToto[080 [0%[ 01 [Grav] Sand| I TTT Towle w[or[oa [os | wa [sa | ws 3.47 I "19 I ~.? I' 0,4 ! 0.2 "] .... 6.6 I "88.6 I 4 SIEVE ANALYSIS RESULTS om| ly 4.8 - Client: Weston Solutions Projet 3 Borg Project: 3M - Borings 3 evsennen smian-auesiis visnncans | LLooccaattiioonn:: DDeeccaatutru, ArAL,L 7 Prec Number: 020504081 Project Number: 020504-041 oo 22009955..00660033 I3MMAA0011555522338800 - A `GRAINSIZEDISTRIBUTION -- = =| T E 11 T 1AE e 1 A i" PEPIPEIS ELIPPERL } LEE] oo _ | | E A E m1 N S AR LEI T S r TE e T A - E 1 FPN E 00 1T I1 - | AF ECEE e Eee BERN S A00 1 E P1T TTA FS EeA mT 1 1IC 1 A - em cosaLes a TO J e en [e oe e I~escription a ' ' Samp~ed',by: ~oseSenpes [ewes Sample Location: Date Sampled: onsite | 4 [oe [am| 0[os|oa |oo|aa[ww[ai] TTL SIEVE ANALYSIS RESULTS =e Client: Westo~ oe rama Project: 3M- Borings a Location: D~atur, AL Proje~ Number: 020504-~1 22009955..00660044 33MMAA0011555522338811