Document QgoK894Mypb0pZd8NjQkZLJo4

DownloadSearchable PDFRandom document
FILE NAME: Warning Labels (WL) DATE: 1969 June 20 DOC#: WL019 DOCUMENT DESCRIPTION: Symbols for Packaging and Containers for Hazardous Materials - MIL-STD-1341[SA] H IL-ST J-13 M 1 T n T J l l Q3ciE 5 0 cl S^S MIL-STD-13^l(SA) 20 June 1969 MILITARY STANDARD SYMBOLS FOR PACKAGES AND CONTAINERS FOR HAZARDOUS INDUSTRIAL CHEMICALS AND MATERIALS > THIS DOCUMENT CONTAINSA^PAGES I Provided by IB S I N o reproducbon or networking permitted without license from IH S 1413 ' 7 Sold to P A TT E N , W O R N O M , H A T T E N & DIA M O , 01344492 Not for R esale 011/2/4 14 31 30 G M T HIL-ST]>-13m cW cm i 03^2510 TD7 m i l -s t d -13^i (s a ) 20 June I969 i DEPARTMENT OF DEFENSE NAVAL SUPPLY SYSTEMS COMMAND WASHINGTON, D. C. 20390 Symbols for Packages and Containers for Hazardous Industrial Chemical and Materials MTL-STD-13^1(SA) 1. This standard has been approved by the Naval Supply Systems Conmand. 2. Recommended corrections, additions, or deletions should be addressed to the Naval Supply Systems Coranand (SUP 0kk2), Washington, D. C. 20390. 1414 Provided by IH S N o reproduction or networking permitted without license from IH S ii Sold to P A T T E N . W O R N O M , H A T T E N & D IA M O , 01844492 Not for Resale,2 0 1 1/2/4 14 31 3 0 G M T t flIL-STD-1341 T W I ll 03^2511 =143 FOREWORD MIL-STD-134l(S A ) 20 June 1969 Bie purpose of this standard is to establish a uniform symbol to warn users of the potential dangers involved with the use of the mate rial in containers. The materials to be marked are those having one or more hazardous characteristics defined herein. This standard prescribes marking of unit, intermediate and shipping containers, unit loads and containers that are components of kits or sets. It also provides criteria for application of symbols and for submission of data. Exceptions. The symbols of this standard are not intended to cover or conflict with the following conditions, regulations or categories of material: 1. Chemicals or drugs used or dispensed by medical department phar macies. 2. Chemicals used by clinical or chemical laboratories. (The exempted laboratories will be those designated by the departments, bureaus, offices and the Marine Corps.) 3 . Explosives, fuels and compressed gases adequately covered by statute, regulation or current instructions. 4. Magnetic materials requiring shielding or marking or both for air shipment. 5. Items and containers which require marking to conform to Depart ment of Transportation or Shipping Regulations. 1415 [m a m m m m m Provided by IHS No reproduction or networking permitted without license from 11- iii Sold to P A T T E N , W O R N O M , H A T T E N & OiAM O , 01844402 Not for Resale,2011/2/4 14 31.30 G M T MIL-STD-134] I W l l l 0312512 66T CONTENTS MIL-STD-IS^SA) 20 June 1969 J Paragraph Page I 1. SCOPE...................... ..................... ........... 1 2. r e f e r e n c e d d o c u m e n t s ............................ ........... > 3. DEFINITIONS..................................... ........... 2 b. GENERAL REQUIREMENTS.......................... .. 5. DETAILED REQUIREMENTS........................... 5.1 Size of Symbols................................. 5.2 Color........................................ . 5*3 Marking and Design.............................. 5.b Posters and Signs............................... 5.5 Criteria for Application of Symbols....... . 5*5.1 Application............. ....................... 5.6 Data Submission............... ................. FIGURES Figure 1. Hazard Identification System.................... 2. Color Format............ ....................... 3 Alternate Color Format........................ . b. Dimensions...................................... 5 Snail Size Marking........... .................. 6. Posters............. ........................... 7. Form U3B OOS-4 ......................... I "16 Provided by IK S N o reproduction or networking permitted without license from IM S iv SOW to P A TT E N , W O R N O M , H A T T E N & DIA M O , 01644492 Not for Resale,2011/2/4 14 31 30 G M T I1IL-STD-1341 T W H l 0312513 71b M20ILJ-uSnTeD-11936^9l(SA) > APPENDICES Appendix PaSe A. HAZARDOUS MATERIAL SYMBOL APPLICATION CRITERIA.............. 10 B. INSTRUCTIONS FOR PREPARING DEPARTMENT OF LABOR MATERIAL SAFETY DATA SHEET FORM LSB OOS-A............. ......... . 12 > 1417 [Provided by iHS No reproduction or networkng permitted without Iceuse from iHS v Sold to PATT EN , W O R N O M , H A T T E N & D IA M O , 01644492 Not for Resale,2011/2/4 14 31 3 0 G M T MIL --STD--1 3 m IITmi 1. SCOPE 03^514 b32 2M0ILJu-SnTeD1-916349l(SA) 1.1 Scope. This standard, covers design, colors, sizes and require ments for warning symbols to be affixed to packages and containers con taining hazardous industrial chemicals and materials. 2. REFERENCED DOCUMENTS 2.1 The issues of the following documents in effect on the date of invitations for bids form a part of this standard to the extent specified herein. SPECIFICATIONS Military MIL-M-I959O Marking of Commodities and Containers to indicate Radioactive Material STANDARDS Federal FED-STD-595 > Colors (Requirements for individual color chips) ( 3 X 5 supplements) should be submitted to the Naval Supply Depot, Philadelphia, Citing FED-STD-595 to gether with appropriate chip number as shown therein (Copies of specifications, standards, drawings and publications required by contractors in connection with specific procurement functions should be obtained from the procuring agency or as directed by the contracting officer.) OTHER PUBLICATIONS Recommended System for the Identification of Fire Hazards of Mate rials, NFPA No. 704m : Fire Protection Guide on Hazardous Materials (contains NFPA 325A, 325M, 49, +9IM and 704m ) (Copies may be purchased from the National Fire Protection Association, 60 Battery March Street, Boston, Massachusetts 02110.) 1Al 8 Provided by 1HS N o reproduction or networking permitted Mthout license from IH S Sold to P A T T E N . W O R N O M , H A T T E N DIA M O . 01 644492 Not for R esale 011/ 2 / 4 1 4 31 30 G M T niL-sTD-iBm MIL-STD-134l(SA) 20 June 1969 ct * m ciii 03925:1.5 s'n 3. DEFINITIONS 3.1 Fire Hazard. The definition of Fire Hazard, which includes Flam mability Hazard, Reactivity and Health Hazard, of the National Fire Pro tection Association, NFPA No. 70^M, shall apply. 3.2 Radiation Hazard. Any commodity that must he labeled in accordance1, with requirements and criteria of MIL-M-19590- 3.3 Reactivity. apply. The definition of reactivity of NFPA No. 70^M shall 3-k Health Hazard. The definition of health hazard of NFPA No. 70^14 shall apply. 3.5 Oxidizing Material. A substance such as chlorate, permanganate, peroxide, nitro carbo nitrate, or a nitrate that yields oxygen to stimu late the combustion of organic material. 3.6 Corrosive Material. Acids, alkali or other material that will cause severe damage to living tissue or to other material it contacts. k. GENERAL REQUIREMENTS h .1 Symbols covered by this standard shall be applied to each unit, intermediate, and shipping container, unit loads and individual compo nents within kits and sets. Symbols shall be in accordance with Figures 1 through 5, and may be applied by stencilling, painting, printing, lithographing or labelling with water resistant materials. Marking of commodities containing radioactive material shall be in accordance with MIL-M-19590. 5. DETAILED REQUIREMENTS 5.1 Size of Symbols. Symbols shall be the sizes designated in NFPA No. 70kM summarized in Figures 1 through k of this standard. Smaller size symbols commensurate with surface available may be used on containers having two or more dimensions less than 6 inches, such as small cans, bottles, tubes, or individual components of kits or sets. (See Figure 5.) 1419 Provided by IH S Mo reproduction or networking permitted without ice n se from IH S 2 Sold to PATT EN . W O R N O M , H A T T E N & O IAM O , 01944492 Not for Resale,2011/2/4 14 31.30 G M T MIL-STD-1341 I I W l l Q3=iESlb 42S MIL-STD-^lCSA) 20 June 1969 5-2 Color. The colors indicated for the symbols in Figures 1 through 6 shall acceptably match in shade the applicable color of FED-STD-595, as follows: Color Class Black Red White Yellow Blue I7O 38 IIIO5 17875 13538 I 5IO2 5*3 Marking and D esign. Each symbol shall conform to the applicable markings and design, as indicated in Figures 1 through 5 5-^ Posters and Signs. Posters and signs illustrating the hazard shall be prepared in accordance with Figure 6. Activities requiring posters should state the size required, weight and quality of paper or other material required, and surface finish required. Posters and signs are intended for display in work and storage areas. 5.5 Criteria for Application of Symbols. Symbols shall be applied to containers whenever the contents has hazardous characteristics defined in this standard. Specifically, any material listed as hazardous in National Fire Protection Association publications, or having similar characteris tics shall be so labeled. Application criteria for Federal Supply Groups and Classes are given in Appendix A. 5 .5 .I Application. These requirements shall apply to all material sup plied to the Navy directly or indirectly through the Defense Supply Agency, General Services Administration, jobbers, dealers and contrac tors, sub-contractors and other channels. 5.6 Data Submission. Contractors shall provide data described in the U. S. Department of Labor Material Safety Data Sheet (Form LSB OOS-^) as required in the contract or order. Once data has been submitted for a particular commodity, no change in formulation affecting its hazardous characteristics is permitted without prior approval b y the contracting officer. Instructions are provided in Appendix B. Suppliers are encour aged to submit the same information to the National Fire Protection Asso ciation, 60 Batterymarch Street, Boston, Massachusetts 02.110. 1420 [Provided by IHS No reproduction or networking permitted without license from IHS Preparing Activity Navy - SA Project No. PACK N0l6 3 Sold to PATT EN . W O R N O M , H A T T E N & D IA M O , 01844492 Not for R esale .2011/2/4 14 31 30 G M T riiL -S T D -ia m ' H ' m i l 03R2S17 3bl M20rLJ-uSnTeD-11936tL9(SA} HEALTH HAZARD 4 Deadly 3 Extrem danger 2 - Hozordou* 1 Slightly hazardous Q Normal material FIR E H AZARD Flash Points 4 Below 80F 3 Below 100F 2 - Below 2WTF 1 Above 200F 0 - Will not burn Oxidizer Acid Alholl Corrosive Use NO W ATER R EA C T IV IT Y 4 May detonate 3 Shock and heat may detonate Violent chemical change Unstobfe if heated Stable Symbol arrangement and text shall be as above. Color formats are provided in Figures 2 and 3* Dimensions are shown in Figure L. The following specific hazard symbols shall be used: TERM SYMBOL REFERENCE Oxidizer Acid Alkali Corrosive Fire Fighting Use No Water Hazard OXY ACID ALK COR -W- 3-5 3.6 3.6 3-6 NFPA No. 70+M Combinations of specific hazard symbols shall be as follows: OXY OXY OXY OXY ACID ACID ACID ALK COR -W~ COR -W- ALK ALK COR COR -W~ -W- Figure 1. Hazard Identification System k 1421 Provided by IH 8 N o reproduction or networking permitted without Scnso from IH S So ld to PATT EN , W O R N O M , H A T T E N & D IA M O , 01644492 Not for Resele,2011/2/4 14 31 30 G M T MIL-STD-1341 1 03^2510 2T MIL-STD-134l(SA) 20 June 1969 Numerals shall be white and may have a black border. Letters G L S or combinations thereof may be used in the center circle to snow that the contents are a gas liquid or solid at the proper condition of storage. The letters may be white with black border or all black. The letter W in the "Use No Water" symbol -W-- shall be white with a black border. All otner printing shall be black or. a wnite background (see Figure l). Figure 2. Color Format 1422 Provided by IH S N o reproduction or networking permitted without license from IH S 5 Sold to P A T T E N , W O R N O M , H A T T E N & D IA M O , 01S44492 N o tfb rR esate .2011/2/4 14 31 30 G M T M iL-sT3>-i3m m w m i 134 M20ILJ-uSnTeD-11936^91(SA) Backgrounds shall be white. Borders shall be black. Numerals shall be the color indicated and may have a black border. The letter W in the "Use No Water" symbol -W- shall oe black with a black border. All other printing shall be black on white (see Figure l). Figure 3 . Alternate Color Format 1423 Provided by IH S N o reproduction or networking permitted without license from IH S Sold to P A T T E N W O R N O M H A T T E N & D IA M O , 01844492 Not tor Resale,2 0 1 U 2/4 14 31 3 0 G M T MIL-STD-1341 iT m n OBTSSEG SSb M20ILJ-uSnTeD-19136491(sa) A B cD W T BORDER 4 2-1/2 3,A 3/8 5/8 5/32 All borders 4 2 -1/2 1 1/2 3A 5/32 shall he 1/64" 6 3-3/4 1 -1/2 3 A 1 7/32 8 5 2 1 1 -1/2 5/i 6 Dimensions are in inches. Tolerance 1/32 in unless otherwise note. TYPE SIZE POINTS KIN MAX 7 8 7 8 10 12 14 16 Figure 4. Dimensions 1 A2^ [Provided by IHS No reproduction or networking permitted without licence from IHS 7 Sold to P A T T E N , W O R N O M , H A T T E N & D IA M O , Q144492 Not for Rasate,2011/2/4 14 31 30 G M T MIL-STD-1341 tm cm i G3^2S21 file MIL-STD-^UCs a ) 20 June 1969 This illustration shows acceptable application for containers too small for symbols having dimensions specified in Figure h. Further reduction is permissible,, providing printed information is legible. Figure 5. Small Size Marking 142 5 Provided by IH S No reproduction or networking permitted without license from IH S 8 Sold to PATTEN, WORNOM, HATTEN & DIAMO, 01844482 Not for Resale.2011/2/4 U 3 1 30 GMT niL-STD-1341 3333311 Q332S22 723 HAZARD IDENTIFICATION SYSTEM M20rLJ-uSnTeDI-1936^9l(SA) IdentifCicoaltoiornCoofdeH:eBaLlthUEHazard Type of Possible Injury Signal Msdheoaatrtehtrieaoxlrspomswaujrhoeirchcroeusoilddnuaclvaeuirsnye 41 jmguiverdyenic.aelventrtehaotumgehnt prowmepret Mpteomastuperoreiraalcrsoywuolhdricrhecsaoiudnsuesahlsoienrrtjiuoeurxys etrveeantmtheonutgwheprerogmivpetnm. edical ocMaruacstoeernittaeilnmsupewodhraiecrxhypoionsnucraeipnacteocniutslade 2 tjtiuroernaytmournelnpetosssissipbgrlioevmernpe.stidmueadlicinal a oMwnoaluytledrmiacilnsauowsrehirceihsrrioditnuaateiloxpninojsbuururyet even if no treatment is given. uMonffadetererrnioafilrsheawzchaoirncdhdibtoienoynoesxnpdwootshuualrdet otefrioarld.inary combustible ma IdentifCicoaltoior nCoodf eF:laRmEmDability Susceptibility of Materials to Burning Signal oaMtrmatocesorpimahlpeslreiwctehliycphrvewsaspiluolrrreiazpeiadnlaydt 41 tdnuiosrrpem,erasolerdawminhbiciaheinrtaarnetdemrewpahdeiriclayh will burn readily. g bLameiqbuigiiednnsitteadtnedmunpsdoeelriradtsuarltmehaoctsotncdaalinl tions. & eMreralaatteteilvryieallhyseathhtiegadht moarmuesbxtipebnoestemtdeomtdo peratures before ignition can occur. a hMeaatteerdialsbetfhoraet migunsittiobne pcraen occur Materials that will not burn. (StaIbdielnittyif)icCaotiloonr CofodRee:aYctEivLiLtyOW Susceptibility to Release of Energy Signal 41 Mopfoasdtieteirtoionanlasotirwonrheiacohcrtioaofrneexarpetlaondsoiilvrymeacdlaepctaoebmmle peratures and pressures oMqnuaiartteeiorinaalsosrtwreohxnipcglhosianivrieetiacrteainapcgatbiolsenouobrfcuetdreoetr wemxhepinlcothsbimveefuolysretwbiinethithiewaataitoteendr.ourndwehricchonrfeinaect aMcnhaadtnegrreeiaadlbsiluwythuidcnohdearnrgeoont ovdrimoeltaeolnnltyatcuehn.esmtaAibclslaeol S wtmiaiatlthleyrwieaaxltspelrowoshirvicwehhmimcihxatymuraereysawfcotirtmhviwoplaoetnteetrln.y bMvuaattetwedrhiatieclsmh wpcaehnriacbthuecraeorsme aennoudrnmsptaarleblsylseusarteatsbelloeer, Q wrehleicahsemoafyerneearcgtywibthutwnatoetr vwiiotlhensotlmy.e eaMvneadntewruhianicldshewarrhefiicrnehotea-xrreepaocnstouivrrmee awcloliytnhdswittaiaobtnelesr.,, Copyright 1966 h y the National Fire Protection Association and p u b lished in the "Recommended Hazards of Materials (NFPA N . System for the o 70^m )." Identification of the Fire Reproduced with permission. Posters in color (16 " X 4") may be purchased from the National Fire Pro tection Association, 60 Batterymarch Street, Boston, Massachusetts 02110. Decals in color (6" X k") are also available. Figure 6. Poster for use with Hazardous Material Symbols 1426 I Provided by iH$ I N o reproduction or networking permitted without fcense from IK S 9 Sold to PATT EN , W O R N O M , H A T T E N & D IA M O , 01844482 Not for Resale,2011/2/4 14 31 3 0 G M T M IL-STD-lBM l l l W l l 0312523 bb5 APPENDIX A i 2M0ILJu-SnTeD1-9136^9l( SA) HAZARDOUS MATERIAL SYMBOL APPLICATION CRITERIA The Application Criteria of this Appendix are mandatory for all material supplied to the Navy. 10. HAZARDOUS MATERIAL IDENTIFICATION APPLICATION GUIDE 10,1 Hazardous Identification Symbols shall be applied to containers of material in the following Federal Supply Groups and Classes: FEDERAL SUPPLY GROUP 68 FEDERAL SUPPLY CLASS 31+39 Welding and Brazing Supplies 6810 Chemicals 6820 6830 68I4O 685O Dyes Gases; Compressed and Liquified Pest Control Agents and Disinfec tants Miscellaneous Chemical Specialties 79 7930 Cleaning and Polishing Compounds and Preparations 80 85 87 91 (Packaged Products Only) 99 142 7 8010 Paints, Dopes, Varnishes, and Related Products 8030 Preservative and Sealing Compounds QobO Adhesives 85IO Perfumes, Toilet Preparations, and Powders 8520 Toilet Soap, Shaving Preparations, and Dentifrices 8720 Fertilizers 9110 9130 9135 91I4O 9150 9l60 Fuels, Solid Liquid Propellants and Fuels, Petroleum Base Liquid Propellant Fuels and Oxidi zers, Chemical Base Fuel Oils Oils and Greases: Cutting, Lubri cating, and Hydraulic Miscellaneous Waxes, Oils, and Fats 9920 Smokers' Articles and Matches i Lighter Fuel Only 10 Provided by IH S N o reproduction o r networking permitted without license from IM S Sold O.PATTCN, WORNOM, HATTEN & DIAMO, 01644492 Not for Resale,2011/2/4 14 31 30 GMT HIL-STD-1341 T iT m i 0312524 ST1 M1L-STD-13>1(SA) 20 June 1969 10.2 Symbols shall be required for items that would ordinarily be cata loged under one of the above classes, but are stocked numbered in another class because of their specific use. 10.3 Symbols shall be required for all items listed in National Fire Protection Association NFPA No. 325A, 325M and and for items having similar characteristics. > 1 A 28 Provided by IH S N o reproduction or networking permitted without license from IH S 11 Sold to P A TT E N , W O R N O M , H A T T E N & DIA M O , 01&44492 Not for R esale.2011/2/4 14 31 30 G M T MIL-STD-1341 ' m i n i OB'teSHS 438 AFPEHDIX B DCSTRUCTIGKS TOR PREPARIHG DSPARTKEST OF LABOR MATERIAL S A F E R BAZA SHEET FORM LSB OOS-4 i KCL-8TO"33^l(SA) 20 June 1969 Instructions in this appendix &r mandatory to the extent specified elBevbere in this standard, or as specified in contracts or orders. 20. U8TOUCTIQI8 20.1 Material Safety Data Explanation of Terns and Instructions. For* LSB 003-4-, or one essentially similar, approved V the Bureau of Labor Standards, is required to be filled it only on materials which, when not provided with special attention or controls, will constitute a hazard. If information is inapplicable to the material under consideration, the Initials "n.a." (not applicable) shall be inserted. 20.1.1 Definition of an Essentially Similar Form. An essentially simi lar form is interpreted as being o n a i n vhicii Section II is modified to indicate only the product or group of products which It is Intended to cover. The remaining sections of the fora will H a t the items of infor mation in the sequence shown on Form 008-4, but the space given to those i entire sections which are inapplicable may be reduced to that necessary to enter the Initials "n.a." (not applicable). 20.1.2 Definition of a Hazardous Material. A hazardous material has one or mors of tbs following characteristics: (a) has a flashpoint, or is subject to spontaneous heating; (b) has a threshold limit value below 500 ppm for gases and vapors, and below 25 mppcf for dusts; (c) a single dose oral W cq below 500 *g/kg; (d) is subject to polymerisation with the release of large amounts of energy; (e) is a strong oxidizing or reducing agent; (f) causes first degree burns to skin in short time exposure, or is eystmically toxic by skin contact; or (g) in the course of normal operations, may produce dusts, gases, fumes, vapors, mists, or smokes which have one or more of the above characteristics. 20.2 Instructions for Section I. 1429 Provided by IH S N o reproduction o r networking permitted without license from IH 8 12 Sold to P A T T E N . W O R N O M , H A T T E N & DIA M O , 01844492 Not for R esale ,2011/2/4 14 31 30 G M T i W L-SEK13la(8A ) 2D June 1969 H IL-STi-3,341 11111],]. 0312321= 374 I 20.2.1 Manufacturer'a Rame and Address. Mailing address, including ZIP code, the Federal Supply C o d e f o r Manufacturers (FSGM), end naan of certi fying company official. 20.2.2 Baergency Telephone Humber. Show area code, telephone number(a) and extension's), end hours of operation at which further lnfoiaation any he obtained in the event of an emergency involving the material. 20.2.3 Chanlcal Name and Synonyas. Applies only to products consisting of a single element or compound, such as oxygen, or ethyl-ethyl Ketone. 20.2.b Trade Hame and Synonyms. Include foraula number or other defi nite designation of ihe product7 20.2.5 Chemical Family, state generic name of single elements and canpounds, such as acid orketone. 20.2.6 Formula. Refers only to the chanlcal formula for single ele ments or conpounds, not to the formulation of a mixture. Example: O2 and C2H5 COCH3 . 20.3 Instructions for Section II-Hazardous Ingredients. 2O.3 .I Ingredients. A hazardous ingredient is a hazardous material in m a Mixture in sufficient concentration to prodnee enough flamaabla vapor W or gas to ignite, or to produce acute or chronic adverse effects in doses which could result from n o x m l use or predictable misuse of the mixture containing it. Ingredients of a hazardous nature shall be noted b y chemi cal name in one of the three divisions of Section II, viz., Paints, Pre servatives, and Solvents; Alloys and Metallic Coatings; and Hazardous Mix tures of other liquids, solids, or gases. Ihe listing of ingredients in the first division is self-explanatory. Metallic coatings listed in the second division refer to coatings such as plating, cladding, and metal lizing; and filler metal is any metal added in making a brazed, soldered, or welded Joint. Filler metals shall be considered with the ingredients of rod coatings and core fluxes as single mixtures. The third division refers to other hazardous mixtures, such as abrasive blasting materials. 20*3.2 Composition. She approximate percentage of each hazardous In gredient by weight or volume shall be shown to the nearest 5 percent. She percentages of any substance constituting less than 5 percent may be indicated as such. For mixtures, such as filler metals and their coat ings and core fluxes, in which the hazardous ingredients constitute very mall proportions of the mixture, the hazardous ingredients shall be stated to the nearest 0*5 percent, and ingradients constituting less than 0.5 percent may be indicated as such. 13 143C Provided b y lH S N o reproduction or networking permitted without license from IH S SoW to P A T T E N . W O R N O M . H A T T E N & D IA M O . 01844492 Not tor Resale 2011/2/4 14 31 3 0 G M T MIL-STD-1341 `i ' i ' i ' m i 03TES27 200 20.3.3 Threshold Limit Valve. The threshold limit value (tUf) tar aaok haz ardous ingredient in a mixture will be entered in the column provided, in accordance with instructions given in Section V. 20.3.4 Additional Information. If more space is needed in the first or second division, use the lines provided in the third division. Normally this space will be used for mixtures not falling in the other two divi sions. In addition, addenda sheets may be added to the form. 20.4 Instructions for Section Ill-Physical Data. 20.4.1 Boiling Point. State the temperature at which the liquid bolls, in degrees F., at a pressure of 760 mm Hg. For mixtures, a boiling range is acceptable. 20.4.2 Vapor Pressure. State the pressure of saturated vapor above the liquid in mm of Hg, at 20C. 20.4.3 Vapor Density. State the relative density or weight of a vapor or gas (with no air present) compared with an equal volume of air. Val ues should be given in the ambient temperature range of 60 - 90F. to facilitate field usage. 20.4.4 Solubility in Water. Use the following terns to describe the solubility of the product by weight in distilled water at 50F: Negligible. Slight.... Moderate... Appreciable Complete... less than 0 .1 percent ,0 .1 - 1 percent 1 - 1 0 percent more than 10 percent 1in all proportions 20.4.5 Specific Gravity. State the ratio of the weight of a volume of material to the weight of an equal volume of water at 39.2F. This deter mines whether the material floats or sinks in water. 20.4.6 Percentage Volatile by Volume. State the percentage of the liquid or solid by volume that evaporates at the ambient temperature of 70F. Q^iis applies to solids such as Napthalene. 20.4.7 Evaporation Bate. State the ratio of the evaporation rate to that of either Butyl Acetate or Diethyl Ether. Insert the name of which ever is used. 20.4.8 Appearance and Odor. Give a brief description, e.g., viscous, colorless liquid with aromatic odor. Provided by IK S N o reproduction o r networking permitted without license from IH S ( Sold to PATT EN . W O R N O M H A T T E N & D IA M O 01544492 Not for R esale 0 1 1/2/4 14 3 1 3 0 G M T MTL-STO-13l4.1(SA) 20 June 1969 MIL-STD-1341 'i'm'Ul 03H2S2 147 20.5 Instructions for Section IV-Fire and Explosion Hazard Data 20.5.1 Flash P oint. State the temperature in degrees F., at w h ich a liquid will give off enough flammable vapor to ignite when tested by the open cup method. When multi-component paint systems are used and mixed in the field, the flash point of the individual components shall be noted. 20.5.2 Flammable or Explosive Limits. State the range of gas or vapor concentrations (percent by volume in"air) which will b u m or explode if an ignition source is present. T.KT, means the lower explosive limit, and UEL means the upper explosive limit. Knowledge of the LEL will aid in determining the volume of ventilation needed for an enclosed space to prevent fires and explosions. 20 . 5.3 Extinguishing M e d i a . List the firefighting media suitable for use on the burning material. For certain specific chemicals, special formulations, in addition to the standard agents, are available for extin guishing fires. These should be indicated b y generic name. The standard firefighting agents are water fog, foam, alcohol foam, CO2, and dry chemi cal. 20.5.U Special Firefighting Procedures. specify the firefighting media to be used. sonal protective equipment. If water is unsuitable, Also list any necessary per- B 20*5*5 Unusual Fire and Explosion Hazards. Specify such hazards and/or any special conditions that govern them. 206 Instructions for Section V-Health Hazard Data. 20.6.1 Threshold Limit Value. Threshold limit value (TLV) refers to current figures of the American Conference of Governmental Industrial Hygienists. The TLV for single elements and compounds shall be entered here. For mixtures, the threshold limit value for each significant ingre dient shall be noted in the column provided in Section II of the form. (See Section II above for explanation.) Express these value in millions of particles per cubic foot of air (mppcf), or in milligrams of particu late per cubic meter of air (Mg/M^) for dustJ and in milligrams of p a r ticulate per cubic meter of air (Mg/M^), or in parts per million parts of air by volume (ppm) for gases, vapors, mists, fumes, and all other con taminants except dusts. State the units in which the TLV is expressed. 20.6.2 Effects of Overexposure. Describe most common sensations that exposed person will feel, and his appearance. 1432 Provided by IH S No reproduction or networking permitted without license from IH S 15 Sold to P A TT E N . W O R N O M , H A T T E N & DIA M O , 0 1 M 4 4 9 2 Not for Resale 2 0 1t/2/4 14 3 1 3 0 G M T MiL-sTD-iam OBIPSE6) DfiB MIL-STO-13J4-1(8A) 20 June 1969 20.6.3 Baergency and First-Aid Procedures. State emergency procedures to be usedi Only inhalation and. skin or eye contact should be considered in recommending first-air measures. 71 victim should be examined by a doctor as soon as possible after exposure. 20.7 Instructions for Section YI-Reactivity Data. 20.7*1 Stability. Indicate, by cross or check, whether stable or u n stable under reasonably foreseeable conditions of storage, use, or misuse. If unstable, list those conditions which may cause a dangerous reaction. Examples: Shock from dropping; temperature above 150F. 20.7*2 Incompatabllity. Provide information on such common materials and eoHtJwinftnta vitb whioh the product may reasonably come into contact, producing a reaction vhich would release large amounts of energy. If none, so state. State whether oxidizing material, acid, caustic alkali or corrosive. 20.7*3 Hazardous Decosmosition Products. List hazardous materials pro duced in dangerous amounts by burning, oxidation, or by heating in weld ing or burning. Thermal decomposition products, such as CO, CO2, and hydrochloric acid from vinyl chloride plastics are examples. 20.7.4 Hazardous Polymerization. Hazardous polymerization is that which takes place at a rate which releases large amounts of energy. Indi cate by check or crosB whether or not hazardous polymerization can occur. If so, list those reasonably foreseeable storage conditions which would start polymerization. Include the expected time period in which the inhibitors may be used up. 20.8 Instructions for Section Vll-Spill or leak Procedures. Indicate any applicable precautions as: avoiding breathing gases and vapors; con tact with liquids and solids; removing sources of ignition; cuiy special equipment used for cleaning up, such as glass or plastic scoops; and dis posal of spilled solids or liquids, such as flushing with water, returning material to container, burning, etc. 20.9 Instructions for Section VIII-Special Protection Information. Indicate the type of personal protective equipment, ventilation, and such precautions to be taken when using the product for its Intended purpose, as elimination of ignition sources. 20.10 Instructions for Section IX-Special Precautions. Indicate any special precautions to be taken', such as in handling or storing, to avoid reaction hazards. When applicable, indicate safe storage life of product in relation to reactivity. Also indicate any other general precautions to be taken. 16 1433 t Provided by IH S N o reproduction or networking permitted without license from IH S Sold to P A T T E N , W O R N O M , H A T T E N & D IA M O . 01&44492 Not for Rwale.2011/2/4 14 31 30 G M T M20ILJ-uSnTeD-1193649l(SA) MIL-STD-1341 W T O 1 QB'JESaO STS 20.11 Federal Stock Number, and Package Dimensions and Weight. Indicate the Federal Stock Number (FSN) at the bottom of page 1. Also indicate the outside dimensions of the unit package in inches and tenths thereof. Example: For a container 4|" in diameter and 6-3/8" high, enter: Package Dimensions A.5 X A . 5 X 6.A. The gross weight of the unit package shall be indicated in pounds and tenths. Example: For a container weighing 44 pounds 12 ounces, enter: 44.8 lbs. gross. 20.12 Submission of Data. Mail completed form as directed in the con tract or order. In the absence of specific mailing instructions, mark the contract or order number under the FSN and mail to the Commanding Officer, Navy Fleet Material Support Office, Mechanicsburg, Pennsylvania 17055. > > 1434 Provided by IB S N o reproduction or networking permitted without license from IH S 17 Sold to PATTEN, W 0RN 0M . HATTEN & DIAMO, 01544492 Not for Resale,2011/2/4 14 31 30 GMT niL-STD-iam `hrrrii 03^2531 731 Form A pproved Budget Bureau No. 44*R1387 Approvai Empires A p rii 30. J97i U.S. DEPARTMENT OF LABOR W AGE AND LABOR STANDARDS ADMINISTRATION Bureau of Labor Standards MATERIAL SAFETY DATA SHEET Form N o. LS8*O O S-4 7 M A N U FA C T U R E R 'S NAM E ADDRESS (Number, Street, City, Slate, and ZIP Code) CH EM ICAL NAME AN D SYNONYMS C H E M IC A L FAMILY SECTION I EMERGENCY TELEPHONE NO. TRADE NAME AND SYNONYMS PAINTS, P R ESER V A TIV ES, & SO LVEN TS (UTnLiVti} METALLIC C O ATIN G S FILLER M ETA L PLUS CO ATIN G OR CORE FLUX H A ZA RD O U S M IX T U R E S OF O T H ER LIQ UIDS, SOLIDS, OR G ASES tlv (Unit) > '*r**r B O IL IN G P O IN T <"F.) V A P O R P RE SSU RE (mm Hg.) VAPO R DENSITY IA IR = 1 ) SO LU BILITY IN WATER APPEARANCE a n d o d o r SPEC IFIC G RAVITY (H20 = 1 ) PERCENT VOLATILE BY V O LU M E (%) EVAPO RATIO N RATE f =1) B 1435 Provided by IH S N o reproduction or networtang permitted without license from IH S Sold to P A T T E N . W O R N O M . H A T T E N & D IA M O 014442 Not for R esale 2011/2/4 14 31 M G M T fUL-STD-1341 1111111 0312532 b?fl KrL-3TD-13^1(aA) SO June 2969 THRESH O LD LIMIT V ALU E EFFECTS OF OVEREXPOSURE EMERGENCY A N D FIRST A ID PROCEDURES UNSTABLE I STABLE INCOMPAT ABILITY (Materials to ovoid) H AZARDOUS DECOM POSITION PRODUCTS Ha z a r d o u s P O L Y M E R IZ A T IO N MAY OCCUR W ILL NOT O CCU R CO N D ITIO N S TO AV O ID CO N DITIO N S TO AVO IO STEPS TO BE T A K E N IN C A S E M A T E R IA L IS R E L E A S E D OR S P IL L E D WASTE D ISP O SA L METHOD RESPIRATORY PROTECTION (Specify type) V E N T IL A T IO N LOCAL EXHAUST M ECH AN IC AL (Cenerai) PROTECTIVE G LO VES OTHER PROTECTIVE EQUIPM ENT EYE PROTECTION S P E C IA L OTHER P R E C A U T IO N S TO BE T A K E N IN H A N D L IN G A N D ST O R IN G OTHER PR EC A U T IO N S 1 Figure 7 (Coatlimed) 1436 Provided by IK S N o reproduction or networking permitted without license horn IH S 19 US GOVERNMENT PRINTING OFFICE- 1969-3M-M7/837 Sold to P A T T E N , W O R N O M . H A T T E N & D IA M O , 0 1 4 0 4 9 2 Not for R esale ,2011/2/4 14 31 30 G M T