Document O1GYk9mke6E6mxwBR63ndv66e

otf 99 Se colufa83EETEhEBTenr Rsoi(s5o1ne3g)ri3sA5,t7o.Bn5L8c5oOmT TAFT, PRR2G - |b 50639 STETTINIUS & HOLLISTER LLP R-- ,-006a CINCI4N25NAWTAI,LNOUHTIOST45R2E0E2T-3957 . Faxs:1sa1-33-03.021903280s cond nyRwEanEkSenSnee un March 6, 2001 CCSeeRsPsR Eioen I, CREERTTUIRFNIERDECMEAIIPLTNROE:Q7U00E0S0T60E0D002406963517 AChdrmiisntiisnteraT.toWrhitman UniAtgedenSctaytes Environmental Protection 4W0a1shMi.ngSttornee,t,DSC.W2.0460 TFhEoDmEaRsALVoElXtPagRgEiSoS UAcntiitnegd SRteagtieosnaElnvAidrmoinnmiesnttraaltoPrrotection Agency Region II 1650 Arch Street Philadelphia, PA 19103-2029 DFrE.DCEhRaArlLesEXMP.RAEuSeSr UMnairtyedDoStmaitneisaEknvironmental Protection OffiAcgeenOcFyPollution, Prevention and Toxics Chemical Control Division 4W0a1shMingSttorne,etD,CN.2W.0,4R6o0om 403 FThEeDEHRonAoLraEbXlPeREJoShSn D. Ashcroft SAt1t1o1rnMeayiGneSnterreaeltoBfutihlediUnngited States. W1a0tshhiSntgreteotn,anDdCCon2s0t5i3tu0tion Avenue, N.W. JFoEhDnECR.ACLrEuXdePnRESS `UAnsistiestdanSttaAttesioDmeepyarGtemneenrtaolf Justice Environment and Natural Resources 950 Pennsylvania Avenue, N.W. Division a3 g Washington, DC 20530-0001 og a 25 SFaErDaEhRCAaLspEaXrPRESS ~ x 9z5= UniAtegdenSctaytes Environmental Protection ~~ & R8e4g1iCohnes[1t1nut Building Philadelphia, PA 19107 > = Ni 2 -- CONTAIN NO CRI a= EE = 000.7% USEPA 6461 March 6, 2001 Page 2 RCEERTTUIRFNIERDECMEAILPLTNROE:Q7U00E0S0T60E0D002406963524 Michael O. Callahan DiWreescttVoirrginia Divisionof Environmental Protection 10 McJunkin Road Nitro, WV 25143 FEDERAL EXPRESS William Wentworth Project Manager United States Environmental Protection Agency Region IIT 1630 Arch Street Philadelphia, PA 19103-2029 FEDERAL EXPRESS `West Virginia Health & Human Resources Department State Capital Complex. Building 3, Room 206 Charleston, WV 25305 AFlElDyEnRTAuLmeErXPRESS Mike Zeto WatEenrviRreosnomuerncteasl/WEansftoercMeamneangtement West Virginia Division of Environmental Protection 1356 Hansford Street Charleston, WV 25301-1401 FEDERAL EXPRESS Darrell V. McGraw, Esq. West Virginia Attomey General's Office State Capital Building Room 26E 1900 Kanawha Blvd., East Charleston, WV 25305 Re: Request For Immediate Governmental Action/Regulation Relating To DuPont's C-8 Releases In Wood County, West Virginia And Notice Of Intent To Sue Under The Federal Clean Water Act, Toxic Substances Control Act, And Resource Conservation And Recovery Act - NOTE: For Inclusion In USEPA Docket No. OPPTS-S0639A Ladies and Gentlemen: Our law firm represents Wilbur Earl Tennant and Sandra K. Tennant (Route 3, Box 17, Washington, WV 26181, (304) 863-8787), James David Tennant and Della Maric Tennant (Route 3, Box 372, Parkersburg, WV 26101, (304) 863-5428), and Erwin Jackson Tennant (Route 3, Box 17A, Washington, WV 26181, (304) 863-6977) (collectively, the "Tennants") in connection with a lawsuit that is currently pending against E.I. duPontde Nemours & Co., Inc. ("DuPont") in Federal Court in Parkersburg, West Virginia, styled Tennant v. E.L duPont de Nemours & Co., Inc., Civil Action No. 6:99.0488 (S.D. W.Va). The Tennants have sued DuPont in connection with the releaseofvarious pollutants and contaminants from DuPont's Dry Run Landfill in Wood County, West Virginia. (See Exhibit 133.) The Tennants believe that 00027 March 6, 2001 Page 3 such releases have resulted in and continue to result in personal injury and property damage to the Tennants, including the deathofseveral hundred headofthe Tenants' cattle and serious health problems for the Tennants During the courseofthe ligation, we have confirmed that the chemicals and pollutants released into the environment by DuPont at its Dry Run Landfill and other nearby DuPont-owned facilities may pose an imminent and substantial threat to healthorthe environment. More specifically, information currently available to the Tennants confirms that DuPont has been releasing and continues to release into the air, land, and water, including human drinking water supplies, an essentially unregulated, confirmed animal carcinogen known as ammonium perfluorooctanoate (a/k/a C-8/FC-143/APFO/PFOA) (CAS No. 3825-26-1) (hereinafter "C-8")." Hundreds of headof cattle, along with numerous deer, fish, frogs, and other animals, have died in the area affected by the C-8 releases, and area residents exposed to the C-8 releases have been suffering ill health effects that are believed to be associated with C-8 exposure. For example, oneof our clients, Wilbur Earl Tennant, has been in and out of the hospital repeatedly over the last few years suffering from respiratory problems, chemical burns, and other health problems after exposure to materials from the Dry Run Landfill. For the reasons discussed in more detail below, the Tennants hereby request that each of `your agencies intervene in the Tenants' pending lawsuit and order the immediate investigation, `assessment, containment, removal, and remediation of DuPont's C- releases into the environment from the Dry Run Landfill, includingan order that DuPont immediately cease and desist all C-8 releases and that appropriate medicalcare testingevaluation be provided to the Tennants. The Tennants also request that DuPont's permit to operate the Dry Run Landfill be immediately revoked and that all operations at that landSill be suspended until adequate scientific demonstrations are made to prove that the C-8 releases have been abated and will not recur. In addition, the Tennants specifically request that USEPA exercise its authority under TSCA to order DuPont to immediately cease all manufacturing activities involving C-8 until DuPont can prove through appropriate scientific testing and research that its usage of C- does not pose an unreasonable riskofinjury to health or the environment. In the meantime, the Tennants request that your agencies take those steps necessary to begin regulating C-8 releases into the environment. In that regard, the Tennants request that, at a minimum, USEPA include C8 among the chemicals that it proposed in October of 2000 to regulate under TSCA on the `grounds that the chemicals "may be hazardous to human health and the environment." (See Exhibit 123.) The Tennants believe that the information recently obtained from DuPont regarding C-' potential threat to human health,(sce&.g., Exhibits 71, 125, and 126), warrants regulation of C-8 atleastas aggressively as the related perflourinated chemicals manufactured by 3M. ' Curcently available information also indicates unusual levelsof iodide/iodine, along with Triton in Dry Run Creek. (See Exhibit 91.) 000007 March 6, 2001 Page 4 This letter also constitutes notice on behalf of the Tennants and a class of other individuals similarly situatedoftheir intent to bring citizen suit claims against DuPont in connection with DuPont's C-8 releases into air, land, and water from DuPont's Washington Works facility in Wood County, West Virginia under the Federal Clean Water Act ("CWA"), Toxic Substances Control Act ("TSCA"), and Resource Conservation and Recovery Act ("RCRA") The factual and legal basis of such citizen suit claims is explained in detail below. Additional documentation in supportofthe basic facts summarized below is available at our offices in Cincinnati, including a chronologically-organized databaseofthe over 110,000 pages of documents producedto date by DuPont on this topic. L DuPont Has Used C-8 Primarily At Its Washington Works Plant In Wood County, West Virginia. C-81is a perfluorinated detergenvsurfactant manufactured in the United States by 3M. Company that DuPont uses in connection with its manufactureofTeflon-related products. (See Exhibits 1 and 118.) DuPont has used C-8 as a reaction aid in its production of polytetrafluoroethylene (PTFE) and tetrafluoroethylene (TFE) co-polymers at its Washington Works facility outside Parkersburg, West Virginia since the early 1950s. (See Exhibit 118.) `Wastes from the Washington Works' C-8 processes are either vented to the air following incineration, dumped into the Ohio River, sent to DuPont's Chambers Works facility in Deepwater, New Jersey for treatment and discharge, or disposedofat landfills. (See id) The polymer product manufacturedatthe Washington Works is either sold directly to DuPont's customers (in the United States and abroad) or transferred to DuPont's Spruance Plant in Richmond, Virginia for use in the production of Teflon and PTFE~coated fibers or transferred to DuPont's Parlin Plant in Parlin, New Jersey for use in the productionof Teflon finishes, some of which is then used in consumer cookware. (See id.) C-8 may remain in someofthe products sold from DuPont's Washington Works, Spruance Plant, and Parlin Plant.(Seeid) Some of DuPont's Teflon materials have been used in medical implants that are inserted directly into the human body. (See Exhibit 132.) Please note that, although the Tennants already have filed claims against DuPont under the CWA and RCRA, these pending claims relate only to releases from DuPont's Dry Run Landfill. This letter provides noticeofthe Teanants' intention to also bring separate claims against DuPont under the CWA, TSCA, and RCRA with respect to releases from DuPont's nearby Washington Works plant in Wood County, West Virginia, onbehalfof themselves and a classofothers similarly situated. > DuPont's registered trademark. 06042% March 6, 2001 Page 5 I. DuPont Has Known That Excessive Exposure To C- Causes Adverse Effects. DuPont has worked closely with 3M since at least the 1970s to investigate the toxic and carcinogenic effects of C-8 on animal and human health. (See id. and Exhibits 2, 24, and 49.) Through such company-sponsored studies, DuPont acquired knowledge by at least the early 1980s that C-8 was toxic and carcinogenic to animals, whether through inhalation, direct skin contact, or ingestion. (See Exhibits 12,49, and 71.) Around the same time, DuPont also became aware that C-8 is biopersistentbioaccumulative in animals and humans. (See Exhibits 30, 49 and 71)" In response to the mounting toxicity data on C-8, and because C-8 was essentially an unregulated chemical that, according to USEPA, had simply "sail[ed] under the agency regulatory radar screen" for decades, (see Exhibit 114), DuPont established in the 1980s its own einxtpeorsnualresttaonCd-ar8dvsifaoraiwr heamtisisticoonnss/iidnhearleadttioonberoauctcees,ptDaubPleonCt-8deetxepromsiunreedltehvaetlsanfo"rahcucempatnasb.le For eexxppoossuurree lgiumiidte"li(nAeE"L()CEfoGr)hfuomraanisrbisom0e.0e1mmisgs/imo'ns(osfkin0).,0w0i0t3hmagn/ma'c.cept(aSbeleeE"xchiobmimtusn2i-t4,y and 9.) For human exposure to C-8 through contaminated water, DuPont established a CEG of | ppb. (See id.) DuPont also employes, including began routine monitoring employees at Washington ofthe levelsof Works, as early C-8 as in the blood of its 1981, (see Exhibit own 118), and btoexgiacnallotoekmaitnigvfeortoalCt-e8r,na(tsieveesExthoiCb-i8t.42B),ybu19t9d3e,cDiduePdontotkbeeelpieuvseidngit may have founda C-8 anyway. viable, less Later in 1993, a study conducted by the University of Minnesota linked C-8 exposure with also increased prostate had been informed cancer among that new tests human males. (See were linking C-8 to Exhibits 47 and 51.) DNA damage. (See By 1996, DuPont Exhibit 60.) In rCe-s8poonnseh,uDmuaPnosntt,hr3oMug,hatnedstostohnermsocnokemymsi.ssi(oSneeedExshtiudbiietsst7o7,fu8r4t,he9r3,asasnedss1t0h5e.)potBeyntNioalveefmfbecetrs ooff 1998, DuPont knew that oneofthe monkeys Suffering severe health effects. (See Exhibit in 90.) the study receiving a 30 By February of 1999, mg/kg dose of C- DuPont knew that was one of the monkeys involved in the C-8 testing receiving the lowest doseofC-8 (3 mg/kg) had suffered ksuncehwstehvaetrae sheeaclotnhdemffoenctksetyhaitnitthheasdtutodybehasdacarilfsiocesdu.f(feSreedesEuxchhibsietve9r4e.)heBalythMeafyfeoctfs1t9h9a9t,itDhuaPdontto balesosaccroinffiicerdm.ed(aSdeveeErxsheibliivtesr 1e0f3fe,ct1s05a,m1o0n7g, a1l0l8ofatnhde1m25o.n)keTyhse ipnretlhiemsitnuadryy,mroegnakredlyessstuodfy results exposure levels. (See id. and Exhibits 125 and 126.) Thus, because even exposure to the lowest iDtusPWoansthianlsgotobnecWaomreksaweamrpeloofyeeveisdwenhcoewaosrekaerdlywaisth19C8-18 twhhaitlaetlperaesgtnatnwtoacphpieladrreend btoorhnavtoe been born with birth defects similar o those observed among rats exposed to high levels of C-8. (See Exhibit 13.) 0060.25 March 6, 2001 Page 6 doseof C-8 during the studies (3 mg/kg) produced adverse observable effects, a "no observable effects level" (NOEL) could not be found for C- in primates. (See Exhibits 105, 126.) 3M eventually notified USEPA of the preliminary results of the monkey study ina filing under TSCA, Section 8(e) during November of 1999. (See Exhibit 111.) Within only a few months, USEPA notified 3M that it intended to pursue more rigorous regulationofthe perfluorinated chemicals manufactured by 3M. (See Exhibits 113 and 120.) Soon thereafter, 3M publicly announced that it would "voluntarily" withdraw from the market allofits perfluorinated chemical products, including the C-8 that i sells to DuPont for use in DuPont's Teflon products, and the chemicals 3M uses to make its Scotchguard products. (See Exhibits 113 and 114) TSCA DAifvtiesrilonearneiqnugesttheadt iDnuAPpornitl owfas20o0n0eotfhatthDeupProinnctipsaulppulsyerisnofforMma'tsioCn-r8egparroddiuncgt,DuUPSoEnPtA''ss Cu-s8agreeasenadrcrheldeaatsae toofUC-S8EwPiAthoinn tMhaeyUn2i5t,e2d0S0t0a,te(s.see(ESxeheiEbxihtib11i5t),11f2o.l)loDwuePdobnytpprreoldiumcienadrsyoumseage alentdterretloeaUsSeEiPnfAo,rmDautPioonntincaonlfetitremreddattehdatJiutnheas23u,s2e0d0C0-.8(pSreiemaErxihliybiatt i1t1s8W.a)shIninitgstCo-n8Wdoirscklsossuitree and that it had released C-8 into the air, water, and land at the Washington Works, into water at iitnstoPasroliilnaPnldanwta,tSeprrautatnhcee"PLloacnatl,,a"nLdetCahrta,mabnedrsDrWyorRkusn, LianntdofsiolillssaotwtnheedCahnadmbopeerrsatWeodrbkys,DaunPdont onfetahrethreesWualtssohifntghteonC-W8ormkosnkineyWesstutdiVeisr.gin(iSae.e i(dS.)eeOind)OcDtuoPboenrt1d8i,d20no0t0,,hUoSweEvPeAr,prreofpeorseendcetaony bcehgeimnicraelgsul"amtainygbmeoshatzoafrd3oMu'sstpoehrfulmuaorninhaetaeldthchaenmdicthaelsenuvnidreornmTeSntC.A" o(nSeteheEgxhriobuintds12t3ha(t6t5heFed. Rreegv.ie6wo2f3t19h-e33in(fOocrt.mat1i8,on20b0e0i)n)g.)obUtaSiEnePdAfdreofmer3reMd,anhodwDeuvPeorn,tr.egAufltaetriornecoefiCv-i8n,g paednrdaiftnogfftuhritsher letter in Novemberof a letter dated January 2000, DuPont sent revised C-8 usage and release 25, 2001. (See Exhibit 136) Asoftoday's date, information to USEPA however, the Tennants in are not aware of the results of the C-8 monkey studies having been "finalized" or published. IL DuPontPromisedNot ToDisposeOf ToxinsLikeC-8In Its DryRunLandfill. of the TeInnntahnetsea"rlpyro1p9e8r0tsy,fDoruPtohentpuarppporsoeascofhecdontshterTuecntnianngtas seeking to buy several hundred acres landfill near the base of Dry Run CthreeeTkeninnaWntosotdo Ctoheunitdye,aoWfesesltlViinrggianniay.po(rSteieonExohfitbhietir1l4a.)ndIfnorreasplaonndsfiellt,o DinuiPtioalntrepsriostmainsceedftrhoem TeAnfnearntrsectehiavtinngo DhuaPzoarndto'ussvmeartbearliaalnsdwworiutltdenevaesrsubreandciesspotsheatd noof ihnartmhfeullancdfhielmli.ca(lSseewoExuhlidbietve1r4.) be disposed of in the proposed landfill andthatthe Tennants would be permitted to graze their 5 3M's registered trademark. 0090.07 March 6, 2001 Page 7 cattle along the adjacent Dry Run Creek," the Tennants eventually agreed to sell a portionoftheir property to DuPont for constructionofthe "non-hazardous" landfill. DuPont received a permit to operate the Dry Run Landfill as an unlined, non-hazardous, solid waste landfill in 1982, and began actual landfilling operations at the Landfill in 1984. (See Exhibit 5.) IV. DuPont Has Dumped Thousands Of Tons Of C-8 Wastes Into The Dry Run Landfill Soon after DuPont began operating the Dry Run Landfill in 1984, DuPont received the results of intemal sampling confirming that C- was leaching into groundwater beneath three old, unlined anaerobic digestion ponds at the Washington Works that DuPont previously had used for the disposal of thousandsof tons of C-8-soaked sludges. (See Exhibits 9, 17, 20, and 31.) DuPont's internal sampling indicated that, not only was C-8 getting into the groundwater that DuPont used for the Washington Works" drinking water, but C-8 also was migrating through the `groundwater under the Washington Works and into the Lubeck Public Service District's ("Lubeck PSD's") immediately-adjacent public drinking water wells. (See Exhibits 17, 18, 20, and 31.) Internal DuPont sampling confirmed C-8 in the Lubeck PSD community drinking water supply as high as 1.5 ppb in 1984, (see Exhibits 17, 18, and 20), increasing to as high as 1.9 ppb in 1987, (see Exhibits 19and 20), and further increasing to as high as 2.2 ppb in 1988 (see Exhibits 27 and 28. Seealso Exhibit 33.) Allofthese levels exceedDuPont's own | ppb CEG for community drinking water. (See Exhibits 2-4, and 9.) Upon receipt of those results, DuPont decided to try to remove the sourceofthe C-8 in the public and company drinking water supplies by digging up and removing the sludges from `Washington Works' three anaerobic digestion ponds and dumping the tons of C-8-contaminated sludge' into the Dry Run Landfill. (See Exhibits 20, 21, 22,23, and 26) After DuPont submitted data to the West Virginia Division for Environmental Protection ("WVDEP") asserting that the sludges were "non-hazardous" under RCRA, WVDEP granted DuPont permission to dispose of approximately 7,100 tonsofthe sludge in the unlined Dry Run Landfill. (See Exhibits 21,23, and 25.) DuPont completed the sludge disposal in 1988. (See Exhibit 6.) Rather than abate the presence of DuPont's C-8 in the public drinking water supply, DuPont simply purchased the Lubeck PSD well property and the wells were moved approximately two miles further down-gradient from the Washington Works. (See Exhibits 9, 30,31, and 97.) DuPont then notified its employees to immediately cease all samplingof the DuPont even agreed to lease back totheTennants for cattle pasture significant portions of the landfill property along the Dry Run Creek. Those leases remained in effect until the Tennants began complaining about the Dry Run Landfill to USEPA. (See Exhibit 5.) 7 DuPont confirmed C-8 levels as high as 610 ppminthe sludge taken from the three ponds. (See Exhibit 9.) 009. March 6, 2001 - Page 8 former Lubeck PSD wells and to destroy all previously-drawn, unanalyzed Lubeck PSD well samples. (See Exhibit 29.) Also in 1989, WVDEP informed DuPont that new landfill regulations had gone into effect in the State of West Virginia requiring existing, unlined landfills to be upgraded with more: rigorous waste containment mechanisms, including liners and more extensive groundwater monitoring well systems. (Ses Exhibit 32.) In response, DuPont installed a seriesof new groundwater monitoring wells at its Dry Run Landfill and at its nearby, unlined Letart Landfill in Mason County, West Virginia where DuPont had been disposing of mostofits Teflon and other C-8 wastes from the Washington Works as non-hazardous solid waste since the 1960s. (See Exhibit 121.) After DuPont's initial groundwater sampling at the Letart Landfill confirmed the presence of C-8 at 0.7 ppm, (see Exhibit 9), DuPont began investigating whether any C-8 also was leaching outofthe waste at the Dry Run Landfill. (See Exhibit 6) By April of 1990, DuPont had confirmed that C-8 was, in fact, leaching from the Dry Run Landfill and discharging directly into the Dry Run Creek at levasehligsh as 1.6ppm ~more than100times DuPont's `own intemal standard for drinking water of 1 ppb. (See Exhibits 9, 35, 37, 41, and 136.) Soon thereafter, DuPont abandoned its effortto seek anew permit for the Letart Landfill, and notified WVDEP that it had decided, instead, to simply close that landfill "for economic reasons." (Sec Exhibits 74 and 121.)" DuPont proceeded, however, with its efforts to geta revised permit for the Dry Run Landfill that would allow DuPont to continue to operate the landfill without having to installa liner. (See Exhibit 50.) `After confirming elevated C- levels in the water at Dry Run, DuPont began investigating how to get rid ofthe approximately 7,100 tonsof C-8~contaminated sludge that it dumped into the landsill in 1988, which DuPont assumedwas a source of the C-8 being detected in Dry Run Creek. (See Exhibits 7, 8 and 38) Although DuPont initially notified WVDEP that it would remove the C-8-contaminated sludges from the Dry Run Landfill and disposeofthe material at its Letart Landfill, (see Exhibits 36 and 39), DuPont simply moved the sludges to another location within the Dry Run Landfill in 1991. (See Exhibits 5 and 6.) By the summer of 1993, WVDEP inspectors noticed increasingly excessive amounts of Sediment and discoloration building up in the leachate collection ponds at the Dry Run Landfill. (See Exhibit 44.) In response, DuPont, despite knowledge that the leachate contained high levels of C-8 and despite knowledge thatthe Tennants' cattle were drinking the water in Dry Run Creek, ordered the drains on its leachate collection ponds opened for more than two weeks (after `monthly sampling had been completed (see Exhibit 45)), 50 that the leachate could flow out of AbfetgearnDpuaPyoinntg tfoindailslypossheutofdoitws nC-i8t-scuonnlitnaemdi,na"tneodn-whaasztaersdoatusa"RLCetRaArthaLaznadrSdilolusinw1a9s9t6e, it facility in Alabama. (See Exhibit 121.) 065.7 PMaagrech9 6, 2001 gteuhdteuoepfsottnhededsstaehnaddtimdDeiurnPetcoatntlityosninuptboomnitdthse,aDc(urstyeeeRtEuoxxnhiicCbirtieytes4k4a.)m,p(lSienegErxehsiublittssf4o6r tahnedl8e6a)c' hAlbtehionuggdhisWcVhaDrEgePd TmSoh3rmetpaallcieutstye,unettoivlxeincfioatumyrormenosgnultnthsesotnhaaafttrDutPhonotridgiindalevleenatcuhaalDtlueyPhsoaundbtmdsirutacicn6eesdWsfiyunlDtlEytRahecvaornseefsi.rtma(ekSdienaeg 1Eax5nhy%ibsiutch48.) TTenenanntns anodiztehneisrofftamhielyTaennndtaefnsrtiese'xnpdaosstweeedrtewoeertxhepeodwsyaeitdnegroafloCou.nr,gmtohnetDhrsylaRteurn. C(rSoecekidb)adIantnhtehe ({SaeneeEsxhiBinybtoittthhe1e3f0Da)rlyoTfRhuu1sn9,9L4i,annDfduusPritolhnetirnahnaacndetoiafcdtiophapittsieodcnoaorfpcotorhraeptoeuraptceopmlianngtcolsotsaurrteroofutpieneLly eduLmapnidnfgilCl-. aa"nPtapleeyossveasil,ntotofhetnhbeyiDokcriaynkdeRucfornnotLmaaiWnndVefdDilEPth,atDFualPlo.nt(SbeeegEaxnhidbuimtpsipSnlaagnn,idsb8uC6t.-)w8-iAcctocnostradaimnnaygnactuoytbhDiouorPicozaankttie'osn oowr n aoLlafnod1nf9gi9lt5lh.esdeidsicmoleonrteadt,iofnouplosnmdeslliintn9og3D0wrapytpeRbrouwfnasCC-ro3e.beske,(rSvweeiedthEbxaehliimnbegistdtsiks6,nceh5ea8-r,hg8ie5gd.hoausntutdosf1t5a,hne)d BDfryoyatRheusnpring 56,88 andD9r1.y) RuAnt Cthreeeskambeedt,iwmeh,icehveDnumPoornet oafsstuhemeTdencaonnttasi'neadttCe5.s(sSdeyeiEnxgh.ibits 5, m53p,r5e4s,ent tihoeaidrdcraetstilnsertweheserpboelnadsrceikn0okdironegrpoeauanstdewddaytpilenerga,asnWfdrVofDmoaEtmhPebTneoietnnigafidneitdsscDhtuahParotgneWtdVinDtoEtPhefoDrrcye DRuuPnoCnrteetoktwahkeeraection i(SnSerseesEptxoohniasbdeidtrtseosSWsaVtnDsdEi5Pm7p'.r)sopArfeetrqeduriesistctbhsae,rcgtaehmseeienvoidDernyt Rthuant lCirteleekpraongdrtehtsaotsuiwpesgsroabndeteintngheemeDdardtyeo RsbtuyanrDtuLtPaakoninndtgi RCcehospeioeeuksrcboeefds.vciod(eSoeteaEpxehsisbhitow6i1.n)gtAhreodiusncdolthoeTreesndanmfaeonattmsiimnneo,gtitwfhaietedeWreUsaSntEdVPidAregoaidfntiahaneiDpepaprtaosrbatllmeoemnngtaontfdheNpaDrtoruvyridReudn rea Ofthe disclose to DthrenytTaRecutnenndaCDnruteePtkoh.natt(CSi-neereEwsxaphsoinbisinettt5ho9e.rD)ercyDeenRstpurinetpeCorrsetusecokh,fcnnoomurpmlearionutss,dDeue.Pocnotpe1sgorndotyhiinnggiatnolthe rI1en0gstutheleaadtT,oerDnyunaaPgnoetnnstctihkeaestpttthhesaiitlraelncltaototfnletthshehepoCru-lo8d insostuebeanddritnokoikngthtehepowsaitteirondiniwdtihtDehuCsrpeaopcukbslu(igScgeeaesntEdxihntihaebniyt 7w4a.y) blems with the creek were simply the reasofsome high --_-- * S<DPoupnPasorennetntstalonsfototihocereds{ee0rdoeirdmeptnehtreamtliaisnosdnfiioplnolndfdrraocimonuWolpVdeDfnEleodwidnir1e9c8tl9yainndtoaDgariynRiun n19C9r5eesko,twhiatthtohuetany P. (See Exhibits 34 and 55.) * D1i9s9c5o,lo1r9e9d6,, f1o9a97m,in1g99w8a,tearndcoinnttionu1e9d99i.n) D(rSyeeRuExnhiCbrietcsk6t2h,r6o3u.gh8o9,utanthde9r5em)ainder of 000.57 March 6, 2001 Page 10 iron sulfide and 78)" levels that had been fully addressed and completely resolved. (See Exhibits 5,74, obfedienaitdiaictnaintOglcetaonabniednrsdpoeefcctt1i9ion9n6t,hofUtaShrEeeaPDoArfyctRohnuetnDacrLtyaendRdfuDinullPCorinenetrk.easnpd(oSniesneefoE(r0xmhtiehbdeittrhseecconomrpeaponrytsthoafthiutnwdorueldds {SAoVyDDpEotPeE'ntsiaWwlaeatnefttoharDticveDimusePinootnn)atcftIoieroawnmaberyddeoUdfStUEoSPDEAuPPAo'nst paednrdaitngcoimnpslpeacitniton1, Ealiid5.MD6c4u,Cbouyyy(1v6di8it)fhfuOsnintghe SLaaitncdhfaitnlhg.eeSt(faoStreeeDauEnPxdohniebtni'ttsesreSdaandco6n5s.e)ntWdietchrieneatomrabetlataretirfonugrftwthoeerethkgeosvd,eisDrcnuhmPaeornngttealpcroeomnbpflloeermtcseedmate1ntntheeggoDptriysatRiuonns wSoouolndtahsesriesatRDeurPMorn.tMicnCcpooamyypmlleeynfittnWtgoVwWDitVEhDPtEhaePncdoonbfseaegn$at2n0dw0eo,crr0ke0ei0n-pgfePnoaolttthye.est&s(aSaemAeetsEDxohcuiibaoiitesss 5c.on6s7u,ltaanndt6t9h.a)t 7) (See Exhibit eimdpilteemdeAnustnipdnaegrrtuotphfgetrhSatedaetDsee'tcsoeltmahnbedefDirlrly1r9Reg9uunlsaeLttaitnoldneismleslni,tncsweuict1hh98aW8s,ViDansnEtdPacl,oatnDisuotPnruoocnfttitohfneintaylpye oafgrmeeedrtsoboesgoirns Egifouslplboeincoetcinaockneesdwyaistststeeemcs.oal(toSgteihceeaElDxrrhyiisbkRituassns6Le6asnsadmnfeidnllt6.9.)(SDeeuPiodn)tTahlusso,fibnyaltlhyeatgirmeeedUStoEoPcfeAaa.salecetfuaeacldlhiysposal of L{DiauenPndsofpinoltrltaalnldegheaddlyalhlaedgesdtloyppbeedgudniscpoolsliencgtoifngaciCts-i8vCi--tc8ioe-nsctoianntmtihanemaitDneradtyelRdeuabcnihoaLctaaenkdfeirisolllmuadtrgheeea1aaitnhm1e9y9D7fr,oyrRun (See Exhibtiottsh5e,W7a0s,hainndgt7o2.n)Works for treatment and discharge directly nto the Ohio Riven aRdevpeorrstefBioymrpttahhceetsDernwyderoRefunc1l9eL9aa7rn,ldyfUielSvlEi.dPe(AnStereaelmEexoahnsiegbdinttuo7mD5eu)roPuUosSnEaatPniAdmr'aaslfst,orefpotrst EicnodilcoagtiecdalthRatia,slktAhsosuegshsment csrheeecamoiomcfmatelhneadsDetrdhyefuRcrlutenhaerrCcraaesuesskee,sosUfmStehnEetPoAbsheardvneodtpbreoeblneambsl.e t(oSeiedeindt.ifaytpa5lan2n)ytsUp,aSraEtniPdcAuol.tathrheekrrnesofwoinr,ee,regulcahteed ithmatbemiugnhdtsb"etchoantthriabdutbienegntdoettheectperadonbidnleivdmaesrn.itoifu(isSceaeetniivoidnr)oonfImnneurnmetseaplroonmusesedi"otaentitnhattsihveuegalgryeesdatoeifnoDtnirfaiytcfdRuun Creek -- f"eoovlelrabmoernattiavle"inevfefsorttigtaotifounr,thDeurPionnvetstiimgmaetdeicaotnedliytiroenqsueisnttehdeaanrdeaUoSfEDPryARagereGerdetcohd(isScueses 5 "DuPy9o1vn8ietFt.'ySsuopfppirt.asc1pt5ir2co4edsu(cwMti.stDhw.areGssapa.edcd1tr9e9tso5s)mea(dckoiinunrdgtetipamuiblploiisnc[etdnhroeevceEor.m$p1da0un0Py'osntkdneowNleemdogueorsft&heCo, against DuPont). million in sanesiors 000 :5 March 6, 2001 Page 11 d0EiiscblitohtseesDm7ro9yr.aeRnufdnul83lL.)yantdhPeialprlrteotcfhiatstheaDitudPecnootlnilttaibehsoaorfdaetniaovtce heofffotrtheinvcalruidoeuds DtuyPpoensto'fscahgermeiecmaelnstitthhaatd itduwomupledd cP5e3o.tn)sfeiAnrtlmitenhdotCuh-eg8hDirDnyutPRhoeunnwtaLthaeanrd cbaecehntmiomnei,tDoruiPnogntC-ep8vreelnvetivueoalulsslliyyniiDddreenynttiRiffuiieneddCCfoo5nrc(hcsSfpboreeiy.negaro(snSlaeyned"Ephxohasidsbiibtly almost 83)" a year after the dfill USEPA ina had lcisotmopfldeotzeednisosfdrcahfetmRiicsaklAsstshcastoimt esnenytRepoUrtS.EP(ASeien late " 1998 Exhibit KfiulnldinagnhiiuenncvdearsuetsdiegsoaotffioUhnSeiaEndPtoAof'tthsheepheeTraselitnshtonefanttnhcteocnaTcteetnrlnneasn(ttshcse:t Esxohmiebtihti7n8g).i the Dry ypu Run also Creek agreed was to jointly TiSmepreai,mnghowoawfsev1ce9or9m,9prtlieosscserdteohatfaent.are"fCeeawttdloezTeenaomft"hteo T"einnndaenptesn'dcecanattttltllyee"wiSenpvreecesitfeiivcgaaanltlesysi,ulDcushPliossnsutes`a.TghreBeyeCadttthianltethe eaExnmhipimlbaoilysefeorwhmoanhyadyebaerse,n sienevoElxvvheetidebriinitnD2au4r)Pi,aonnastns'deslteihcnrtteeeerdnvaebltyeirDniuvnPeasortniiatgn.astisinoecnllsousdmtiyongegbpGyirUeegSffESePyckAtesos,faC-D8uPoonnt T32enDnuaPnottsn9t5.cb)oywDtsehsewpeirrteceeeDndtruiPCno-kn8itn'mgsoonkukntoeofwyDlsretdyugdeyRutrhenastuClCrt-es(e8ske,we, aea.tgo,sxEixchiabniitmsa87caarucsin1o6g6e)n),(ta.hsart(etSeheneeforced m2T3ee.nm)nbaCenortnsssoedfqouteehsnetnloCyta,titnldeiTcaetaemthdautrainnygotnhee fcrouormsDeoufPotnhte eCtavhteetrljedoifTsoecrlamomast'eisdonim,nuvcceuhsrtrfieagncatttsliyo1n0a.vtah(ielSaeobtelheEexrthoibtihet iDmupPaocnttowfeCll-8beofnortehetthTheeernfeninaiansltnsCo'atecvlaitetdlTeene,cadeemstpRhiettpetohtrehteCwaratestllereaesTleoeeafastmehdeeivnCeDn-ceomnocsnikodeeyrssttuhdeyproetseunlttisalto CUEaxSthEtiPlbAei-tTae1p0ap9mo.)i"niAtngedadeipnCe,antdDtelunePtTolyne"taimknevmpeetsmtcibogemaprtlesettwheoeluhylesdailltehnotfotnhethTeeCn-n8anises:uecaattnleu, seovbrean1c9tk9h9ao.nudg(hlSeettheethe cs. never have any reason oese 0 think to look at tchoellTaebnonrOaavntetirsveht"haevefelfaosbrtetsetenoveiarndadalrnyedesaosruest,onvfwihtriholenemheDonustpPaioltnaptlrswouabfslfeewrmoisnrgikninthgewairtehsOUfSDErPyARounntChreerek, several of _-- from respiratory problems, chemical * DpArotynadrRoduurnnaidCnrtoehpeeeksnaewdmh,eer5te0imttehh,eatDftuePhwornfetomu,ala-igsnamiiennlg,lihonergdaedcroendtetnhtesDcroyulRdudnisLcahnadrfgielldisreedcitmlyenitnattoitohne in the stream just beyond the fence." (See Exhiobfitthse$1Teannnda8n2t,s "(ej weeswallowing "AtlCheraeaveeskc.tom(tpSwleoeaioEntxehhdeirbtihltaostca5tlh4eriaersnicddaet1nt1tl7se.,a)ipnpcelaurditonghaatveeabsetenonheacrumrerdenbtyDsuoPmoentthienmgplionyDere,y aRlusno 009: 5% March 6, Page 12 2001 ldbeiuasmccshh,aatreagnecdoflorlteohcmetriDouhnePasolyntstht'pesrmDotrbhlyateRmwusansafLtearnhdaiv,ingMobreeeonveexrp,odseesdpittoefiungsittailvleataiiornesmeivsesriaolnyscaanrd liquid SSfuriomnmmgegertintotifong1t9hi9en9tDo,rtyheRDurnyCRrueenkCwrietehk,srueDpsuupPlotossnetads'tshoicpgarhceyavsemnotn7ictPoopnrbtianimgnintrhaeenpotcrstsfrcoomnftihremDtrhyatRCun8s [iaagsonsodfia CcloiompeessDuePoonfnitt'ms tChaEat,nGddfeaossrpihCti-eg8hiinansstwa2al7tle.art6.iopnp(obSfeadeurpEixunhrgipbotirhytee1Fda3l4l)ofTh2u0s0,0D~urPeoraendeitkn,'gasoswmrnoercmeeonnttilhytyotarwsietnnhgety Crenetki.nuing, ongoing discharge ofhigh levels of (of fonleeachD.rycoRlluenctLiaonndfsiylslteimn,tothDerrye is a Run v. unt KaenThatsC8WassHaeLeach nt Driking wat, eCfaftetcltes TuIepnoaanmddwmietiimlobndetrloosifDtutfhPheeoefnutCl'-l s8exifttaeihnlatusroebfteoiatnsdiksncolwosleedtogethreegTaerndnianngtsthoerntahteurUeS,EePxtAe-natp, paouiglnitkeedly kfCunrloelewykld,eidstghceleooisfneftdohtreomafUtuSliloEnePxActu,ernrWenVtDlyEaPv,ailJaobglae] tSoroe(vlneeeamsTmieenngnntaaannldtscenoitnnitdtiiicneasu,teesiststtonheartieglDheuabPsoerosni,nttoalDsroyhaRsunyot tofthe impact of 1s C5. wastes on local drinking watoer,the publi its vTaorsttehemWaAanssahpgaiernmtgeotnfotintusWnoietfrsfk,osri,tnscDtluouPdcoionnmgtpltwehaetsethrirteseqeuRiCreRdAgo.FiacnivleisttyigIantveewsthiegtahteironaRneypoofrtis("fRoFrImeRrepsoolritdy iatXrsePROcFSoIInntergfifaborunttysi,pnegDrutsoPoonansntytorteoulonekraesaesoofnawbalsetehseaolnttho.reninsekie.grhgb(ioSreeiedniEggxpehrsiotbpiieotrnstpi9eo8snadansnddth9wa9ht.e)wtehIrener calnoysewdasitnes19a8r3e, fp{ohrraatintisgteoudswefsorfotrhedrsianmkpilnignwgaotfergmraotorutenhsdeawPmalptalee.rsou(fnSdetechetEhxgherionbueinitdgshwb1a0ot,reir1n1u,n7d6e,ratnhde 9W9a.s)hiDnugPtcooonnntnWeacoltsriokosn swiitteh nWeaisghhibnogrtinnognpGlWaoEnrtkPdslra"isndikrciisnngdkriwinangtkewirna.gt(weSaotaeserhExishguihpbpailsts3.130 os PPL 11) and SamgplGiEngPlcaosntficisrmPeladnCt-t8haitn as higahs 0.71 ppb in the GE the uses _-- y. (Sen Exhibits 10, 11, 43, 76, 96, 99, 102, 104, "ti+WssassulhtnisonttgeotdUotnShaEWto,PraAklstihn(oiwutesglhRlFsDIu3P3R1oe,nt33h2a,dabnede3n36s)a,mphleinsg othrceaemderitnikmiengtowaactteuralwleyllrsepaotrtthe ccooponlevsern,wieenlnoltrltdyhiaddtidhandotpreevveinoussalmyppyloieretlt,dheeDduweCpl-olnstrtehwsaatuslttrcaldaoiftsi)otnhaalsylay|mhppapdlbey(iowenellldly 3t3h6e),drainndkingthe h9e9)s.ultYoeft, w1.h9 pepnb,DeuvDPeuonPnotthnetrewfpeaolbrlrtiwtcihatethseedthaheingeCh.wer3r.ree0saudpliptnstgsintfraodiptiFonRalelpyorbt.elo(wSeed1eptEhpxebhhiyibigiehtlesdre7dC6,.3g96, ohawvninpglatnotrderfienrkeinncgewaantyerd.ri(nSkeiengExwhaitbeirtr9e9s)u.lts excee"dsicnrgeeDnuiPngonlte'vesl"owfonr C1 -p8pbtoCaEvoGidin its Gain March 6, 2001 Page 13 106, 110 and 129.) DuPont even found C-8 as high as 0.8 ppb in the new Lubeck PSD drinking water wells, which are now located approximately two miles farther away from the Washington Works site. (See Exhibits 10-11, 40, and 41.)" Recent sampling of the private drinking water wells on the Tennants' property down-gradient from the Dry Run Landfill also has now cwohnaftiCr-m8edleCv-e8lsimnitghhotsebderiprneksienngtwaattvearrwieolulss.cit(iSeseealEoxnhgibtihte 1O3h1i.)o RiDvuePro,nbtasheads uevpeonn iDnuvPeosntitg'asteodngoing releasesofC-8 into the River from the Washington Works facility. (See Exhibits 40, 100, and 118.) Approximately 24,000 pounds ofC-8 also is discharged directly into the air every year from the Washington Works Site, although it is not clear that C-8 is actually permitted for Such air discharge by DuPont. (See Exhibits 101 and 118) Thus, it is evident that the residents living ina least the area near DuPont's Washington Works facility, Letart Landfill, and Dry Run Landfill (the "DuPont Sites") may have been and may continue to be exposed to DuPont's C-8 through DuPont's on-going and continuous releases of C8 into the air, land, and water at and/or around those Sites, (se Exhibit 80), including direct ingestion of C-8 in the C-8-contaminated drinking water extracted from wells at the Washington Works Plant, the neighboring GE Plastics Plant, the Lubeck PSD well fields, and private residential and agricultural properties near DuPont's Sites." Local wildlife and the environment may be similarly exposed. Despite DuPont's knowledge for years of the nature, extent, and effectofthese C-8 releases on human health and the environment, including the Sampling results from 1991 confirmed C-8 at2.4ppb in the new Lubeck wells with C-8 levels ashighas 3.9ppb in the tap water of several local, Lubeck-area homes. (See Exhibit 128.) Sampling in Augustof 2000 confirmed C-8 still present in the new Lubeck PSD wells at levels as high as 0.59 ppb. (See Exhibit 119.) "DuPont has been evaluating the levels of C-8 in the Ohio River, which is a source of drinking water for numerous communities, since at least 1982.(See Exhibit 15.) "In August of 2000, after the Tenants had made it known to DuPont that they had become awareofthe C-8 in the Lubeck PSD wells, DuPont drafted a letter for the Lubeck PSD to send to its water customers to "disclose" the existenceofthe C-8. (See Exhibit 124) In that letter, however, DuPont was very careful to refer only to thecurrent C-8 levels in the `current Lubeck PSD wells, and avoided any mention whatsoever ofthe earlier C- readings that were substantially above DuPont's 1 ppb CEG.(Seeid.) DuPont again was careful to avoid any public disclosure of its knowledge of earlier C-8 drinking water results that were well-above DuPont's | ppb CEG in recent statements provided to local Parkersburg newspapers, even though DuPont had received in November adraft of this letter referencing the higher C-8 levels. (See Exhibit 135) 060017 March 6, 2001 Page 14 bioaccumulative/biopersistent nature of the material," it appears that DuPont has allowed and continues to allow these releases to occur unabated for fear of not being able to continue to make its Teflon products,ifit cannot use C-8. This situation is particularly disturbing, given that DuPont apparently has knownofways to remediate C-8-laden soils since the early 1990s but because of the expense, chose to do nothing "pending further actions that may be dictated by the EPA for remediation of the Washington Works site." (See Exhibit 122.) Even more disturbing is the fact that DuPont has known for years that C-8 levels in the Washington Works and old Lubeck PSD drinking water wells far exceeded its own | ppb CEG but has done absolutely nothing in response. DuPont has chosen, instead, to focus either on current, somewhat lower C- levels, or to simply fabricate a totally new drinking water "screening level" of3 ppb for the Washington Works Plant when faced with havingto disclose to USEPA in its RFI report for the Washington Works the existenceof C-8 in the Plant's drinking water at levels well above 1 ppb. (See Exhibits 99 and 124.) VL DuPont Should Be Ordered To Remediate Its C-8 Releases And To Immediately Shut Down Its Manufacturing Processes Involving C-8 Until Adequate Demonstrations Are Made That There Is No Unreasonable Risk To Health Or The Envienmeet, Over the years, DuPont has successfully avoided fully disclosing thenatureand extent of the C-8 problem at its Dry Run Landfill by characterizing C-8 as an unregulated "non-hazardous" waste and/or substance under applicable law. Consequently, when the Federal and State agencies have asked questions about the nature and quantityoftoxic wastes handled by DuPont at the Dry Run Landfill, DuPonthas omitted any comprehensive discussionof C-8 on the grounds that itis nota "hazardous waste," "hazardous substance," or otherwise listed or regulated waste under current laws. DuPont shrewdly avoided any permit limits on its C-8 emissions and/or dumping atits Washington Works facility and Dry Run Landfill through similar corporate strategies. "Thus, although DuPont has known for years that C-8isan animal carcinogen and bioaccumulative/biopersistent substance, it has continued to knowingly dump thousandsoftons ofthe waste into the environmenat unlined, uncontrolled landfills and has allowed the waste to be disposed directly into the air, Ohio River, and local drinking water supplies, arguing that there has not been any improper disposal and/or release ofany regulated material. In addition, DuPont has been careful to refer to the chemical in conflicting, inconsistent ways in its filings with regulatory agencies - sometimes calling it "C-8," sometimes calling it "FC-143," sometimes calling it "PFOA," sometimes calling it "APFO," and sometimes calling it by its full chemical name- "ammonium perfluorooctanoate" - thereby making it difficult for the agencies to understand how all the information interrelates. As confirmed by USEPA's recent "DuPont's own employees even raised concerns about Teflon customer exposure to C-8 as early as 1983. (See Exhibits 16 and 52.) 06a 4 March 6, 2001 Page IS proposal to begin regulating 3M's previously-unregulated perfluorinated chemicals, DuPont's past corporate strategy for diverting regulatory attention away from C-8 should stop now. Based upon the foregoing facts, the Tennants hereby respectfully request that your agencies intervene in the Tenants' pending Federal Court litigation and order the immediate investigation, assessment, containment, removal, and remediationof DuPont's on-going C-8 releases into the environment by virtue of the authority granted to your agencies under at least the following laws and their implementing regulations: + The Toxic Substances Control Act, as amended, 15 U.S.C. 2601-2692; + The Federal Clean Water Act, as amended, 33 U.S.C. 1251-1387; + The Safe Drinking Water Act, as amended, 42 U.S.C. 300-300}-26; + The Federal Clean Air Act, as amended, 42 U.S.C. 7401-7671; + The Resource Conservation and Recovery Act, as amended, 42 U.S.C. 6901-6992k; + The Comprehensive Environmental Response, Compensation and Liability Act, as amended, 42 U.S.C. 9601-9675; + The West Virginia Air Pollution Control Act, W.Va. Code 22-5-1 through 25-18; + The West Virginia Water Pollution Control Act, W.Va. Code 22-11-1 through 22-11-28; The West Virginia Groundwater Protection Act, W.Va. Code 22-12-1through 22-12-14; The West Virginia Natural Streams Preservation Act, W.Va. Code 22-13-1 through 22-13-15; + The West Virginia Solid Waste Management Act, W.Va. Code 22-15-1 through 22-15-21; + The West Virginia Hazardous Waste Management Act, W.Va. Code 22-18-1 through 22-18-25; and 00035 March 6, 2001 Page 16 + The West Virginia Hazardous Waste Emergency Response Fund Laws, W.Va. Code 2219-1 through 22-19-6. `The Tennants also request that your agencies exercise their respective authority under the referenced laws to order DuPont to immediately cease and desist its C-8 releases into the environment, as addressed in this letter and to provide for immediate, appropriate medical careftesting/evaluation ofthe Tenants. The Tennants further request that DuPont's permit to operate the Dry Run Landfill be immediately revoked until adequate scientific demonstrations are made to prove that the C-8 releases have been abated, will not recur, and pose no unreasonable risk to human or animal healthorthe environment. `With respect to minimizing harm to the public health and the environment from future C8 releases, the Tennants hereby specifically request that USEPA exercise its authority under the Toxic Substances Control Act to order DuPont to immediately cease all manufacturing activities using C-8, including DuPont's Teflon manufacturing operations, until DuPont either confirms that it has stopped its usageof C-8 entirely or has made adequate scientific demonstrations to prove that ts continued usage of C-8 (whether from 3M or any other source) does not pose an unreasonable risk of injury to heaolrtthhe environment. In the meantime, the Tennants request that your agencies take these steps necessary to regulate C-8 emissions/releases to the environment. As mentioned above, the Tennants believe that such steps should include, at a minimum, including C-8 among the list ofperfluorinated chemicals that USEPA proposed in Octoberofthis year to begin regulating under TSCA on the basis that the chemicals "may be hazardous to humanhealthand the environment." (See Exhibit 123.) VIL The Tennants Intend To Bring Citizen Suit Claims Against DuPont Under The CWA, TSCA, And RCRAIf Appropriate Action Is Not Taken Immediately To Abate AndRemediateDuPont'sC-8ReleasesFromItsWashingtonWorksFacility. As explained above, DuPonthas beenandcontinues to discharge C-8 from its `Washington Works Facility in Wood County, West Virginia into the air, groundwater, and Ohio River. Moreover, the C-8 discharged by DuPont has been contaminating and continues to contaminate the land, air,and human and animal drinking water supplies. A. DV uPointo ls latTihen CWg A. Section 505(a)(1)ofthe Clean Water Act ("CWA") permits citizens to commence a civil action against "any person ... who is alleged to be in violationof (A)aneffluent standard or limitation under this chapter." 33 U.S.C. 1365(a)(1). "Effluent standard or limitation" is defined under the CWA to include, among other things, "a permit or conditionthereof issued under Section 1342 of this tile," such as state-issued but federally-enforceable NPDES discharge permits. 1d. at 1365(F). Based upon information currently-available to the Tennant, DuPont's NPDES permit for its Washington Works facility specifies that DuPont shall not discharge any 006uis March 6, 2001 Page 17 effluent in violationof applicable Water Quality Standards. (See, e.., WV/NPDES Permit No. SWtVa0n0da0r1d2s7p9r,ohCiobintdiDtuiPoonsntA.f1ro-mA.d1i0s,chCa.r1g2i,nganindtoH.s2)u.rfaTcheeorWgersotunVdirwgaitneirasWaantyer"mQautaelriitayls in concentrations which are harmful, hazardous, or toxic to man, animal, or aquatic life." W. Va. Code St. R. tt. 46, 46-1-3.2 (2000). Based upon currently-available information, as described above, DuPont has been discharging and continues to discharge C-8 into surface and groundwater in concentrations exceeding DuPont's own CEG for human drinking water and at concentrations that are otherwise harmful, hazardous, or toxic to man, animal, or aquatic life, constitutinag continuing violationofthe West Virginia Water Quality Standards, and thereby constituting a continuing violationof DuPont's NPDES permit terms and the CWA. See, e.2., 33 USS.C. 1311(a), 1342. Notice is, therefore, hereby provided that the Tenants, onbehalfof themselves and a class of others similarly situated, intend to file suit against DuPont, pursuant to Section 505(a)(1) of the CWA, within sixty (60) days of this notice to obtain appropriate relief for the violationsofthe CWA referenced herein. B. DuPontlsViolatingTSCA. Section 20(a)(1)ofthe Toxic Substances Control Act ("TSCA") permits citizens to commence a civil action against "any person. . who is alleged to be in violation of [TSCA] or any rule promulgated under Sections 2603, 2604,or 2605 of [TSCA], or Subchapters Il or IV of [TSCA]" 15 US.C. 2619(2)(1). TSCA requires any "person who manufactures, processes, or distributes in commerce a chemical substance or mixture and who obtains information which reasonably supports the conclusion that such substance or mixture presents a substantial risk of injury to health or the environment" to "immediately" inform USEPA of "such information, unless such person has actual knowledge that" USEPA has been adequately informed of such information. Id, at 2607(e). TSCA also requires each person who manufactures or processes a chemical substance to comply with the regulations adopted by USEPA under TSCA governing the reporting to USEPAofcertain research and adverse health effects information relating to such chemical substances. See id. at 2607(a), (c), (4; 40 CF R. Parts 716 and 717. Failure to comply with such TSCA requirements constitutes a violation of TSCA. See 15 U.S.C. 2614. As indicated above, the information currently available to the Tennants indicates that DuPont has not reported to USEPA all information within DuPont's possession regarding C-8 that is required to be reported to USEPA under Section 8(a), (), (), and (e) of TSCA, 15 US.C. 2607 (a), ), (4), and (e), such as the resultsofthe C-8 monkey studies andtheTennants' allegations of adverse health effects among themselves, their cattle, and area wildlife arising from exposure to DuPont's C-8. Notice is, therefore, hereby provided that the Tenants, on beohfthaemslelvfes and a classofothers similarly situated, intend to file suit against DuPont, pursuant to Section 20(a)(1)of TSCA, within sixty (60) days of this notice to obtain appropriate relief for the violationsof TSCA referenced herein. 000417 March 6, 2001 Page 13 UIDnumdPmoeinrnteR'nsCtRCAA-n.8dRSeulbesatsaenstFiarloEmnIdtas nWgaesrhmienngttoTnoWHoerakltshFOacrilTirtyeEMnavyirPornesmeennttAn permits Section citizens 7t0o0c2(oam)m(e1)n(cBe)ofactihviel RaecstioounrcageaCinosnts:ervation and Recovery Act ("RCRA") pr[reaealstneymneptnettr,rsaosnntsoproar. ,gteeir,n,colorurddpiiasnspgtoasonarlyppfraaecssitleinottry,opwrwenhseoernhtoargseocnpoeenrrtaarttoiorbr,utopafastor tirsacnosnptorritbauttioinn,g oor dtihseppoassaltoofrapnreysesnotlihdanodrlhinagz,arsdtooruasgew,asttreeeadwthomirecnhwt,,ho moratyhepreensveinrtonamnenitm,minent and substantial endangerment to healt sa4on2idl,UaSwi.raCtae.tra,nad6nl9do7ra2i(aar)of(ur1no)dm(BtD)h.uePWoAanssthd'iissnWcguatssoshneidnWagobtrookvnse,WFoaDcruikPlsoitnyFta'csipiaysthaansdroenn-ugaoding dCi-s8poisnalsooilf,Cw-a8teirn,to SThenindcnahan.ngtebsra,mseoendntub(p0ohneeatlhohtefhctouahrrermteslhaeetllevfyne-vsaivraolnambelnet.infNoortmiacteioins,, tmhiaenryeapfmrooerues,netnhset,raeenbyv.iemplur,poaviiondegenedsactonhndactsetunhbtesrtaatntiioanls naogtaiicnesttoDuoPbtoanitn,appuprrsouparnitatteoreSleiceftifoonra7nt0h0dae2(icaml)am(si1sno)e(fnBo)ttoharenrdRsCssuRibAmsit,laanwrtilitayhlsiientnundaitanenedgt,eyir(nm9te0en)ntddatyosfiolfe stuhiits herein. referenced rreegdaureds,t pPflloeeraayssoeeulcreotinunfsviorklmnvaoesmwiesfnotyonoinuastwhpiioslsismiinpbtolerertvhaenontwepiyunobultihrcerTheeesapnlentcahtnitavsnedageennvciireosnpmleannttsopasddsr:ess Ionurthat ' Federal Capps proceedings or if 0060618 March 6, 2001 Page 19 yCionuciwnonualtdi olfifkiecetso. reWveiewwoaunlydofbtehheapapddyittioomnaeletbawciktuhpydooucautmyeonutratoifofnicmesaitnotdaiisnceudsshetrheisatmaotutrer in more detail. Thank you. Onbehalfof the Tennants, 4 A. Bilott RAB/mdm Enclosures ce: Larry A. Winter, Esq. (West Virginia Counsel for the Tennants) (w/o encls.) Paula Durst Gills, Esq. (Counsel for DuPont) (w/ encls.) (by CREERGTIISFTIEERDEMDAMIALINLON:O:700R0401600000090229490,69R6E3T53U1R,NRERTECUERINPRTERCEEQIUPETSRTEEQD)UESTED & Reg(isCtTerCeodrpAogreanttiofnorSEy.sL.tedmu,P7o0n7t dVierNgienmioauSrtsree&t,CEoas,t,InCch.a(rlwe/sotoennc,lsW.)V 25301 by CERTIFIED MAIL NO: 70000600002406963500) HATENNANTReqs wd 069013 1 00629 w" -- oss73515 Material Dsuapfoentty.Data Sheet TTTo Revised soiar-1999 Page 1 -- Pristed 6-MAT-1999 CHEMICAL PRCOonpD ANYTU omRICITIE GATI) ON TTT Tradeames aad Syacarms TT 200 Ammonium Perflucrooctancate Solution Company Idestification KANUPACTURER DIS`TDRuIpoBnUtTOR W1i0l0a7inMgatrokne,t OSFtre1e3t898 PHTPONrrEaondsuwpcuotMrBtEIRnESfmoerrmgaetnicoyn :i C1H-E8M0T0R-E4C41-17-581050-424-9300 Medicil Pmergeacy |: 1-800-441-3637 CoFOSTTION)INFORKATION ONINGREDIENTS Components TTT WRaEteSrHR pereivorosctancate S3hii-mieers 830 EAZARDSIDENTIFICATION oT Potential Health Effects asSamksoihun.ntcsoEnCtvaaicpdtaebsclmeea'yosficsagpuesrseoedsusckihinnagcLtehsreeiitneatfpifoaencttewsaittoihfonsdyisSsticeaommifscoercturorin toxicity. SEyheaecionngtacStr mBaylEctanugsteoreye iiroritation with discomfort, PIanshsaalgaetsi;onWimatyh Ccoauugsehinigrraintdatdiiosncoomftotrhse. uTpTp"er resplrato:Sl aaIbbnnngooerrsmmtaaillonbllsioavoyedrcaffuousrnemcitgniagosncsryaossltndetemetseftcuitnnecadellbotyhrwalacibttohraLtaeonrreiyatlaat:itoenssts; or ctTchohoinemstp,aobcloufotdn.o"dmpohAuasnsntidrmaeaailmsloafannbgosdlholhraoblwiefimd-nalgbifyeexInptgehierensitebtinohocden,eyblaiionnnoddhdia,mclaaatytaeinbodtnehmodeartyetestbckhetiiesnd in i) 00902 g EID087263 W?o essasis Material sDaufpeotnytData Sheet Re 2 (HAZARDS IDENTIFICATION = Continued) detected years after exposure. meIaxnccdzeiosvwsiidmvueaaylsexhpwaoivsteuhriepnsrc.ereexaissetdinsgusdciespetaisbeislitoyf ftohethLeivetro,xiocritbyonofe carcaogenicity Information . NSPoqenuaeaiol'fnotoohfedGceornmaptoenrenttshapnreOs-e1n%tarien tlhiisstemdatbeyriIaAlRC,atNTcPo,ncOeSnHtAratoiFonAsCGIH FIRST AID WEASURES TT rice Ad INHALATION C1aacleliL?oiahaclipehadyl,sirceriseapmnio:cvaetitoon.fresIhf barlre.athiInfgnoits AbLrEefaitchuilntg,, ggiivveeoxygen. SKIN coNTACT sIhn0o:ecsaa.tse 1oC0faalsltcona1t5apchmtyi,sniuctLiemasend.wihaitlWeealsyhLecmfoolnvutisahnmgisnckaiotnnetudaimccihnlaopttlehadinnccgylbooecffhoiurnegsearrenudse. Eve contact Ifnorcaatseloefastcon1t5acmti,nuttemse.disCtaallly'sfplhuysshiceiyaens.wich plenty of water GESTION CIvatolmilst'uissnlgPl.ohvyesdiN,ceivaeLnrm.egdilvaetealnyytghiivneg 2byglmaosustehstoofawnatuenrconasncdioiunsducpeerson. FIREFIGHTINGKEASURES CT Flammable Properties Non-tlamable. HmZoaonzroamxceidddoeud,surdhiyendcgroomcgpoemobnnuiscfttliouononr,ipdreo,dTuhcettsossxicpLrnogcdalusucedtsisnogrmcaapyzarbctoainucsledeisosxeiavadeyer',ebeceyaez,bon nose, and thioat irritation of toxic effects: 8 00c5n02n5 EID087264 8 :.ossrasis Dupont. Material safety Data Sheet Page 3 (FIRE PIcHTING MEASURES - Continued) 9 Extiaguisnisg Kedia Water Spray, Foss, bry Cheatcal, coz. Fire Pightisg Instructions eHqeuairpmseenltf.-contained breathing apparatus (SCEA) and full protective ACCIDENTAL RELEASE MEASURES CTT Safeguards (Personnel) NPsOEeTRcESt:OiNoAnRLsevsPiRetOwoTrEFeCIpTRIErVoEFcIeGEnQHdUTiIIPnNMGgEVNKITEAhdSuURCrEilSnegaannculdpg:iHnA-NuUDpsLeeINaGpp(rPoEpRrSiOaNtNEeL) TT bErveaactuhaitnegpearpspoanrnaatlu,s. thoroughly ventilate ases, use self-contained Initial containment Dike spill. pull clean up Soak up with sawdust, sand, ofl dry of other abeorbent material. EANDLINGAND STORAGE CT CT Eandiiag (Perscanel) vcWMaeoisnkrhteci,ultnahfstootirhaoaonlnucagsthailnedytnh,aTateftspepArirvrooadhltuadoncrdecloinrantregaes.cptuisreawWdbia.lesenh apcylaeorstt,hiicnlsgeksinaufscolerecscssloetsehaiintgva.boiisd Eandling (Physical Aspects) Keep container tightly closed. storage Store in a well ventilated place. 99 g 0090335 EID087265 2 : oss73s15 Material DsuafpeocnytData Sheet rage 4 ZXPOSURS CONTROLS/PERSONALPROTECTION| Eagineeriag Controls TT Svgparrneeayonhleeyqdueiewpdimcehenxttardaa uefdqeuraltoOsescvC"e3hnhatvnielra6t0Sioopnat.i,caunad.tdeexhwaourskt'areGsuc.a ts, Ddd orinopt Epalnse, 2ofnaootvheerrspdreasyi]gn features to minimize worker exposire th Personal Protective Equipment EYE/FACE PROTECTION Wear safety glasses or coverall cheaical splash goggles. RESPIRATORS Wear NIOSH approved respiratory protection, as appropriate. PROTECTIVE CLOTHING Wa3h"eraepprtohperrieatLes poLtmepnetriviaolusfgolrovseksi,n capornotna,ctpahnatvse, avanadilajbaclkeeta.nd wear Exposure Guidelines ARppalniocnaibulne FEexfpfoisuuorreooLcitmaintcsate ATESVLL + (((aDocusspuiol)n)t) +i+ 00N17on00e11 amEggs//taaa33b,,li8s8hfHerrd.. TTHHAA,, SSkkiinn, A3 zi2 neApEoLsiendiesofcfDecucuPtpo,antt:issouncahAlcSclpeipmotiatnbszlesehaElxTlpToaisttuasrkeewphLirimecichte.daecnecWehL.eorveergochvaenrntmheentRaElLY PEYSICAL ANDCEEWICAL PROPERTIES Physical Data FFBororelmeliznigngPPooiinntt irPoLiicqeuimd.onun CT g g EID07266 009034 SL osssis Material DsuafreotaytData Sheet N SIE REIS Page 5 fae mmspees chitin ioe tise Ghaxical seability EE Stable at normal temperatures and storage conditions. Incompatibility with Other Materials None reasonably foreseeable. Decomposition Hazardous decomposition products including carbon dioxide, carbon fnoosrem,edandduritnhgioactombiursrtiitoant.ionThoefsstoppircoduecftfsecmtasy cause Severs sya, Polymerization Polymerization will not occur. ToTicorooToAL TWPORGAEION Animal Daca - Ansontun Pesfluorooctanoate: iImnahlale3at5io%mn 4 ehoursLCSO: 9g80earamhg/mml inanernaattes , Nok AIisomnoUannttiaautsintoanPderefxflpoureoprtaoinoiecaTtanlacnlosiaedtneesiatirisezaatainsodknin.nasaEafnlfdeceLtyeser oiafrsrtiaotnasn,itn,glbeut dfceoarnsmspailar"nadtsoupbPeeruirteaclupelrneso,du`cdeldanandroinhlsaispv;eecrlieeftnihcaragfyf,ecitansbtorsXsidchsbirn1e2glawetehiigshgt aR1neodspse;accyda'ndgousesixstp:reonAciensstineapgsarlt]oeduiLcnregideisttalitioivenorn,exanpKdiodsneuenryle,arrfgeaesndscirtLaeisdvseri,nanudeight tdieensnctoiendsaetnrccaheatneogfeusbm;eonriaigngneamnitiaecstainacdcutlicayvrai,ntoyspiabsna.csreeTdaetsoitncs,anIannimdnaclr1eeivaersraetds SS5ooitxmlocBnlesieyh. epesrc"Tfseo.scram"Iendi.nani'TszhnailslasncisdoemgpfooonrusnEsdiospcrdoeosdsutcontoitdveevperlosdotupfcmeeectnstgaelhnaevteic Ganairmaaglee.in Bacterial cell culbures but has nat been Cested ln 3g 0090i5.5 EID087267 4 osstsis Material sDaufpeotnytData Sheet Sin eee rage 6 enna Ecotoxlcological Taformation on Az18mohnoiuura P0e5r0f,luofraotohcetaadnciantnao:va: 1,500 og/L. . DISPOSALCONSIDERATIONS Waste Disposal CT TCareceqcauotirmadetanintoc,nes.wsittohragdep,p1itcraanbsipsorFteadteiroanl,, aSntdatdei/s?poovsianlcimauls,t baandiLnocal REGULATORY INPORKAZION Cm 015. Federal Regulations TSCA Inventory status : Listed. TITLE IIT RAZARD CLASSIFICATIONS SECTIONS 311, 312 AFCcihuriteoenic i|i nYYoeosn PReraecstsiuvriet|y i: NNoo . OTHER INPORKATION Cr NFPA, NPCA-ENIS ~ HFNePlaCalAtm-haHbNtIiSteRyating i:3o Reactivity to cPoenrdsiotniaolnsP.rotection rating to be supplied by user depending on use Tshpeecdiaftiac miantetrhiiaslNadteesriiganlateSdafehteyreiDnataandShedeotesrenloatterselaotnelytotoutsheein COmbination with any other material of in any process. Responsibility Address for MSDS + CDJ.hiaraoSb.retcCao'SaptWeeocsrikaslty Chemicals Telephone 809-546-3281 g9S g 0650625 EID087268 : - osanas 15 Material DsaufpeotnytData Sheet (Cont tnued) 2nd of KsDS rageve 7 39 g EID087269 = e066 t 2 prrAcH MENT Z js TSCA cB pen 30! ooooold No san Fired Versiom was provided. CoGL2% 3 66023 ) 0A8n/t0h4o7n2y00J0 P0l:a0yt4isAM Toi H David Ramsey/AEDuPoni@OuPort Subject: C-8 Exposure Linits : FE . Hethreinefor'matsion on C-8,aka ammonium perfuorooctancats. Du Pont Acceptable Exposure Limit (AEL) 0.01 mg/m3,8-hrTWA (skin); "oNrotdeevlelyoptmoebnetaalhtuoxmian"n carcinogen Du Pont Community Exposure Guidelines (CEG) > ADrbinokmineg Water 01.u0g0i0L3 mgim3 ACGIH Threshold Limit Value (TLV) 0.01 mgim3 TWA (skin, A3); The A3 notation means the folowing: `~aCnoinmfalismeatdaAnrielmaatlivCelayrhciignhodgoesnew,itbhy rUonukten(osw)nofRealdmoivnairsctreattiooHn,umatansiste:(Ts)h,oefahgiestnotloigscicatrycpiens)o.geornibcyn `mceocnfhiarnmiasnm(isn)crtehaatsemdaryisnkootfbceanrceelrevianntextpoowsoerdkehruemxapnoss.ureAv.aiAlvaabilleabelveideepnicdeemdiooleosgincotsstuudgigeessdtothnaottthe e`xapgoesnutrse.li"kely to cause cancer in humans except under uncommon of unlikely routes or evels of OSHA Pemnissible Exposure Limit (PEL) None established. 06505 EIDo0g9s13 4 000031 se 0 O => '. zz: 2% Q 31% = , , 3@< a Q gE =X 3 e> m SoHrEe mss 8 8630S32 @2@ 2Se,m3=03 @= 5 TRESS sS S86 - w LoIx) z- a F o 17] - = m Q & 0056:3% g EID078904 zs b5E: eT Smso Ii| 73 ot | SRIFRIFEZES|, O0EZN0S 928% m0 S oO3L B 8E0M8SgE 5oZ 250R55X8 EI32TO 3 i 5223350 gd55 | S3a 5 e<g gS o5y oz5 || 1 -- A 2TBFoldP= 2= 49g3 | Sax eS =O I a g2sul ma aa3 n=Qo l i 25288 A8csTET cmBd mRseO2 9 oO 3=w 0aZ5 T= s0a8 aS ad tQ wco g8= 5 Su <s E22 32355 = 230 R5e30g9=a3d33258%@%ol I | S ce a3E XEsE 3538a Ngn S l | g RSooer lg RBa B5caa3dgaE3 s | EEgafsgesszg | aEBERT oD Lao a ES 52 ,A 0 = | cso s= 8I=cFF= =2 Q | g a =--= 2o8n9o 0 5T= | | 2c= x2FT3 a3o @ I z 0051" EID078905 z : Ei; 43m oO S 5 -. . - vv rr 9 = o= a zo 2 [2 = Ss 33 <2. oO 2 s2m0 8 . = @i Tr 3a 9 x w=m 3SE 2& 33 =< @a 3=5 =3 53= m m2) oT 35 3 2 = zeS 2a > a = S ' z EIDOT8906 g 009634 = -- * * ' S> z -- g 8 c c Ss ao S 2 Sm 3 oO -on TxS a3 5m 1 @ = 8 3 5 @ Oo ow =o (@) = s F g 8 o3 < 9 =5J `0 m = 3 > 32 3 =3 3 < g 7 g |m <Q @ @ ] &oO a 2 & 3 @ 9 5 Ss = 1 z2 I= 5 4 > 22 = | z " EID078907 g 009635 v > o : 2 .| ZEos Q 2 T 52 5I e- -a 2 I= g ZZ g8 33 S = =z ST 5gs |& 5m 2a oO > - o- &2 oO a& > Sg Oo 5n X8x oO =8 rr i. 0 [3 oS w H oNo 9 < Ss g 8 8&8 =< 25&4 < e3 3 3 8 x 3 = m $g 82 35 =m 33 22 5 - EID078908 5 00625 g 3 = Q 8 3 d & a= @= S05 z2 =z 29 4m o 8o2 09= @-~ 2 gE [0 - . D ma Som | ~ -f 2 Oo 2 x son Jo 88 8 ww w BE Z=F Po 3Lo @= Rg o o Ysg z= 3= =< 3 m& ES 3 5 S3 2 32 << m 8 Q ~~ 3 0 m 7 @22 < =m = = 5 08543" EID078909 g S g B | ems] iD + m [T a= o\ 8 o - x 2 Eg geo =rr 8 ~Q~ +m83 <8 8 Zz --o- sd 8 0 = a5 mm 5 8 @ 35mW o8 2 < 8a = 3=x o a2 < co 2 m gs I @ hy EID078910 g 0050s = 5 S -- 4 o I] [4 528 |S t 3 x 5 oO a3 3 orrO 3= Oo os +tww&oO |2 52 8 3 Q 32 = oll ao 3 m 93 = & x gEoz 89 52 --=_-- 25 "x = 37 =m 2dg & = 009029" EID078911 2 o= zg8s 53.39 52 3 H LSFo3 c HEN 2 = 5 : 18 : = g g& g Jo 5o:e X=SX `3 wW gS o z o S2zg up::, QSo oS5s 3g82s3 m33 3mi E = 323 28 m= So on } B 009610" EID078912 : REASONING BENIND AEL INHALATION NDAEL 1 Mo/M3 EFFECTS AT 8 MG/M3 MILD, REVERSIBLE LOW LEVEL (?) ACTIVITY IN [ESTES (TUMORS) 30 PPM IN DIET = 1.5 MG/KG/DAY . 100% 10.5 warm ABSORPTION OF JNHALED DOSE, 70 KG WORKER = THIS IS 1) EFFECT LEVEL 2) HUMAN CLEARANCE FROM BODY SLOW SAFETY (UNCERTAINTY) FACTOR SHOULD BE LARGE (1000) RECOMMEND 0.01 MG/M> (10.5 + 1000) 000625. + g= EIDO7es913 33 REASONING BEHIND CEG (COMMUNITY EXPOSURE GUIDELINE) AS FOR THE AEL (0.01 MG/M3, ADDITIONAL FACTORS 1) 24 HR EXPOSURE IN COMMUNITY VS 8 HR AT WORK 2) DIVERSE POPULATION IN COMMUNITY 3) BIO-PERSISTENCE IN MAN RECOMMEND 0.0003 MG/u> (33 FOLD REDUCTION) 6057 Zz g EID078914 S HUMAN EXPOSURE Source Air Skin Adsorption Ingestion PreventativeMethod * Reduce Air Levels * Breathing Protection * C-8 in Solution * Chemical Gloves * TYVEK Clothing * Reduce Concentration in Drinking Water z EIDO78915 2 . 089015 amas 8 5 \ 000C24 DRY RUN LANDFILL CHRONOLOGY -- 1995-1398 August 1994 January 1995 MFaerbcrhuar1y9/95early M1a9r95ch/April March 23, 1995 May 1995 May 3 June 1995 October 1995 November 1995 February 1996 October 15, 1996 November 1996 December 31, 1996 Filter cake begins to be landfilled at Dry Run TSiSrstexnceoetdiecneceo;f s*tbalratckofwahtiegrh BOD/COD results; Pond Improvement Team organized Addition of antifoam Wdiattcehresdraainndagferenicmhprdorveamiennstsi:nstdailvleerdsion bCaehngetuminiocaa(mls)ultfrecaotnmternotl,ofhyfdilrlogearneap,eropxoindde,, outfall Cindy Musser inspection and recommendations Bcoelgliencntiinognofonewneheaknlceydbmaosinsitoring and data Second sedimentation pond installed Cindy Musser inspection: progress noted tLoabhitgehstTiOnCg pcroonbfliermmsed filter cake contribution 24-hour aeration begun in lower pond Algae control: copper sulfate treatment Lower pond visually improved WIAP-TV news story Mfuasvsoerra/bBlyritivmepcresisnesdpewcittihonpr(oagtreosusr invitation): aZentdo,HilHlillo,f MLuasndsfeirllinosppeercattiioonnto acquaint Zeto maDecEetPtioinnseswudueed80ltlioedtWtavesarhsitoenfgtmioannntaegWnoetrmketsno't fsfitlaaeinlducarirevdislto Pinal filtercake disposal at Landfill DtEoPseitstslueemdenOtrdeofr aalnld Wiasssuheisn,gtoinncWlourdkisngapgaryemeednt of $250,000 c EID089743 & 009025 -2- cDeocnetmibneured31, 1996, February 1997 March 1397 June 1997 July 1997 December 1997 EDnuvPiornotnmaenndtatlhePWreosttecVtiirognin(iWaVDEDPi)viseinotneroefd a ospeetrtalteimoenntaangdrmeeamiennttenapnecretaiofnintghe tDorytheRun aLgarnedefmielnlt., DAsuPpoanrttaogfreethde toseptetrlfeomernmtadditional mdiaticnhteesn,ancteranosnpoerxtistlianngdfiwlalterledaicvhaetresioton Washington Works for improvements planned tforreattmheentlanudnftiillldeasreign cfoimlptleertceadk,e ainnd thsetopladnidsfiplolsaluntoifl pdlaenstign ciommpprloevteemde.nts planned for the landfill are Acaultfo)psyredfeornse itno B*eelmparcei,atiOoHn,(6p-omoorntnhu-torlidtibounlall state; intestinal parasites. Autopsies (2 older cows) done for EPA: i1.n t"Thheeseontlwoy asniigmnailfsicwaanst tloowxiccoolpopgeirc finding dcoinecteanrtyraptrioobnl.em, Sainnacleystihsisofmayfeeidndiiscate a r2.eco"mNmoensdiegdn.ificant pathologic findings." i3.n t"hNeo tliovxeirc, ckoimdpnoeuyn,ds uwreirnee doretefcatt.e"d by GC/MS* EPA ecosystem study vPeutbelircinaherairainngi;nteirnpcrleutdiendg taeusttoipmsonyydaoftaloacnadl acnoinmcallusd,ingbasnoedLaonndfiinlflo ienffetchte oanutotphesyaurteopporstised Draft report of EPA ecosystem study Doc 60531 9 2 EID089744 g= 3 000046 DRY RON LANDPILL EVENTS TIMELINE ++ NAUMECROUQSLDERUAYSREIUS.NR.P.R.OErPvEvR+DT<Y......0.0.0.i.i.u.i.u.s.e.s.s.i.i.ieioeosooeioeeesoseenenninoiL..Ll.. 1982-1983 1983-1986 TcEoNwANsT + BEGAKNAULFAMNADNFILL OPERATION............eeveesessnnnnnnnneaeeen. 1984 DISPOAL RELOCATIOONFOFTFETFPEOPNODNSDEMDAITMEERNTI.A.L..(.S.U.P.E.RN.A.T.E.)..T.O..L.I.N.E.Dc.CoEeLcLc.c.c.c... 11908/925/91 ++ DSITSAPTEOSAINLSPOEFCFTLIUODNG.E..OF.D.RY.RvUsNeSTsAeRTsEDi.u..v.e..s..e.e..ii.i.i.ii..i.ii(oSriUeMieMeiEnRsn)s 9035/O1R69/944 ++ BEFIGLATNEDRIPSRPEOSSSALINOSFTAFLILLETDEARTCAWKAESTEINDWARTYERRUTNR.E.R.T.M.E.N.T..P.L.A.N.T.................. 0098//9944 + BLACKWATERAPPEARED...............ccovsreeesnnsssssnaaannns ++ TEINNANNTMSADBEPYSSTTE RAETAEC MDVEIT PDTEEOINSV.O ...N .....PR.OT.N...........................c....i...i..i........... ++ RIONSUPTEICNTEIOINNSPBYECSTTIAOTNE.O.F.D.O.W.N.S.T.R..E.A.M.B.E.G.A.N..............o.c.c.c.o.i.e.i.i.i.i.i.i.i.i.l... ++ BILNASCPKEWCTAITOENRPBYROSBTLAETME SEONLVFEDO..R..C.E.&.M.P.EE.R.NM.I.TT...W.R.I.T.E.R.............................. + TENPNOAINSTONCIONNGTDAECTEERD"D&NWR V(EDLEKPITNSOFOFAFGI.C.E.).rAeBeOsUoTsr"vSeTeReEsAMsssnunnnnns + TENANT BEGAN TALKING IN COMMUNITY ABOUT CATTLE LOSSES........ 01/95 A0P3-/M2Y39/S95 0055//9053/95 1005//9955 192S/P9M5-96AM + DISCUSSION WITHWV DEPT OF AG VET, WV EXT SERV AGENT, & ++ EWPAASHISNOGITLON&WWAOTREKRS CSAOMMPMLUINNIGT.Y..R.E.S.P.O.N.S.I.B.L.EerCsAsR0EeeTeEeAeMenSnTnAnRnTnEeDs.s.s.s.s.s.. 0101//9262/96 ++ FDRREASFDTOMCOMOPFLAIINNFTOFRMRAOTMIOWNVADCETP.R.E.Q.U.E.S.T..B.Y..D ....U ...7.0P .E.P.A.O ........N ........T ...... 1101//9066/36 ++ TBEERGRAANDODNI/SPPOOTSEASLTAO.F..F.I.LT.E.R.oCrAeKeEenAsTssNcOeRTsHeWeEuSsTsnLsAaNeDeFnILnLn.n.s.n.n.s.s.s.s.s.s. 11/96 12/96 + ADMVIINOLSAETTITOLNE.NENeTe ReEnAsCsHvEsDssWeIsTnHnsWnVssDnEnPnsCnOsNnCsEnRsNeInNaGnnAsLssLnEnGnEnDseeenns 12/96 +* DIBESGSAENCTTRIUOCNKOIFNCGLAETATCLHEAVTIEDBEOA.C.K..T.O.P:L:A.N.Tsi.c.i.i.i.i.i.i.e.eoessssvsvevisseirieensesnnns +* NROETSIPFOINCSAETTIOONBPBAY..EP.A..O.F.C.OrNsCoEeReNsSiQaUaEnSsTsIaOeNn..i.i.i.e.i.i.e.e.i.i..e.s.e.i.o.s.e.s.,. * MESWIT T(HLCEIOGMISMNLUANTIGOTRYS L-EACDOMEMRUSN.I.T.Y..A.W.A.R.E.?...-.E.C.C.)............... ++ ETPOAPEENHVIORUOSNEM"EFNOTRALCORMIMSUKNAISTSYESASTMDERNYTSRAUMNP.L.I.N.G........................................ + LFLEUTOTREIRDTEOSSAIMTPELEESMPTLAOKYEENESBYBDYuPPOLNATN.T.M.A.N.A.G.E.M.E.N.T..................................... * PERMITAPPLICATION PUBLICHEARING............................. 0021//9977 02/97 0053//3270/37 0066//9977 0076//2273//9977 07/97 +* CSEPAESLETDERDIBSEPCOASMAELOISFSAUBS.B.E.S.T.O.S..A.T..D.R.Y..R.U.N....................c.o.o.i.i.i.s.o.e.n.s.s.s.s.s 0031//9081/58 ++ BIENGSPAENCSTEICOUNRBIYTYSTPAATTBR.O.L.S..O.N.W.E.E.K.E.N.DcS..c(cCeOeNiTReAeCuTreAeGaEsNeCsYa)e.i.i.i.i.i.o.n.n.s. 0067//9087/98 .Z * MEETTHIENMG WIINTEHBWAVACDTEIPVIOTFYF.I.C.E vOvFtvWvAeTeEaRnQ nssUssAsnTLnOsnIEnNnT GnAsGYsEessneeens 07/98 S EID089745 O5LLY 6 009015 DL DRRYRRA UUNN LN ANDFD ILL:F CC--8I HHIISSL TORYL SSUue: umRyY SUPERMATE POND SOIL DISPOSAL: ~O7F1N0E0ATRONTSHEOBFOSTOTIOLMCOOFNTTAHIENLINAGND~FI8L5LPP1M1/8C8-.8 DISPOSED ~TAHNIDS BSUORIILEDWAISN MAOVCELDAYT-OLITNHEEDTSOEPPAORFATTEHECELLALND1F0I/L91L. O C-8 GROUMDNATER AND SURFACE VATER MONITORING: ~ BEGAN MONITORING ANNUALLY FOR C-8 IN 1991. ~ GROUWDUATER CONCENTRATIONS RANGE <1 - 15 PPB. ~ LEACHATE CONC. AT O.F. 001 RANGES 30 - 200 PP. PRARNOGPEESRT2Y -BO2U5NDAPRPBY.STREAM CONCENTRATION ~ D1A9T91A RAENPMOURATLEDREAPNORNTU.ALLY TO WVDEP BEGINNING WITH * 1998 RESULTS: OLUETALGEUTTE001 == 1567 PPPrBB SSTTRREEAAMM ##12 == 41.6 ePPBB PROP. BID. = 0.88 PPB 77 POUND/YR C-8 DISPOSED OF WITH BIOCAKE (930 pes). O 610/9M6;PODUONEDSS/MYORTOCFONFTALIN UC-8G. ROWAPSTEODILSPOYSAML REEGRAN 006G19 EEZy EIDO78867 2 | C-8HISTORICALPROSPECTIVE + Known Contaminant Sources - Supernate Ponds (Closed 1988) (Excavated Soll removed to Dry Run Landfill) Excavated Soil Levels - 234 ppm Max Residual Level in Remaining Riverbank Soil-173 ppm Max - Lubeck Public Service Division Test Well 27 - 1-2 ppb Employee Water Taps - 1-2 ppb = Letart Landfill Landfill Leachate - 3 ppm Groundwater Wells - 1.6 ppm (Poss. Construction Cont.) - Dry Run Landfill Landfill Leachate - 0.7 ppm Leachate Stream at Property Line = 0.1 ppm + Regulatory Knowledge - EPA SWMU Survey - 6/5/85 C-8 in trace levels in Supernate waste C-8 found in ppb levels in aquifer - NPDES Permit Application - 9/2/86 Surfactants In 002/005 Discharge (Not specific mention) - Supernate Sludge Disposal Request - 7/30/87, 8/23/90 Supernate Sludge contained 85 ppm C-8 = Lubeck Public Service Division - 6/13/89 C-8 has been found In aquifer in ppb levels Stated no health hazard - Letart Landfill Permit Application - 9/21/89 C-8 in stream and wells reported in required analysis [EERE EID080125 ] Am TahneacacienptoafbltehislemveeletionfgC-i8s tion bdiostchusssurwfhaacte wsahtoeurldabned cgornosuindderweadter 2cnodnttaomindaetvieolnopatathpelanDtrysRturnatelgayndffiolrl.dealing with the C-8 Review: Discuss: AGENDA . Cc--88 -- wOhvaetrviieswito?f limits and guides SSouuprecrenatoef pC-o8ndcosnltudagmeina-ti1o4n,00at0,0D0r0y Rpuonund-s = cL-o8cactioonncenatndrataimoounnt- 2o7f5cpuprmrent known contamination wWahtaetr?is an acceptable level of C-8 in surface Wwhaatter?is an acceptable level of C-8 in ground Baacsteidonontothbeesetakleevnelast, DwrhyatRunisatthethiaspptroipmreiate Some optiNoonsA:ction, monitor for further cCaopntmaamtienraitailonin place, monitor for MfouvrethmeartecroinatlamtionatLieotnart landfill NIenwcinteercahtneology cRaOlcining Ton Exchange 000633 EID0S0103 ATTACH MENT 9 is TS cA eB IL: 074 G30!ti020e040version ben No sani was PT vided. 009654 | PFOA Concentrations Washington Works drinking water 1999 02-05 ppb (building samples) 1899 0.082 ppb (drinking water wells) 1998 w1e.l9,ls1).0, and 0.4 ppb (drinking water Outall 005 1890's 5060 pp GE Plastics drinking water 1999 0.5 ppb (drinkingwaterwell) Lubeck Public Service District OI LPSD we+lWWlwesll 27 2000 1992 198488 2144QQ:: 00381,50,440.,51a6n,da0n.d3103.2p1pbp.pb 02,0.4,a0d0.09 ppb 9samples ranging from 1.02.2 ppb Ory Run Landfil 1089 Leachate 34pp0 Outet 001 66 ppb Stream Sampling Staton No. 1 054 ppb Stream Sampling Station No.2 87ppb Property Line 3990 Letart Lanett 2000 MonitZoorniengAwells are identifiedby Zones, with A ne.arestthe surface and Fthdeepest. MwWt 17.400 ppd 219 ppd Zone OEM3 2100 ppb Zone FMw 172 ppb MMW.254B 1045330p0p8d MWS 34pm Blood Monitoring Data 1995 None higher than ppm. Previously, levels had been detected up to 33 ppm. EID089310 005036 oO PFOA Concentrations Washington Works drinking water 19w9o9 1998 Outta 001 Gopte | , 1999 a dig GE Plastics inking water 1999 Lubeck Public Service Distict 1230200 1982 Ory Run Landfil 1959 Leachate Outeton Stream Sampling Station No. 1 StreamSampling StationNo.2 Property Line 02-05 ppb (building samples) : ooszess (nngvarve 1% 19 ppb arinang water wet) pTPb. vet Git wr 66pm wr 0.5 ppb (drinking water wel) rE 3 & 08,044, and0313pe 02.04,009 ppb #2Ww 34ppb spp 0.54 ppb 87 ppb 9pp0 = alr Lethe ee OT en Tp Letart Landfit 2000 MoniZtoorniengAwells are identified by Zones, with A nearest the surface andF the deepest. wWeTt 17,241080 ppppbb Zone DIEws 2,100 ppb ZoneFMw 172 poo MMWWAB 1,405330 ppppbb MWS 34 ppb Blood Monitoring Data 1905 Nonehigherthan pp. Previously,levelshad been detected upt33 ppm. 0090 :5 EIDO8SS16 | 000:9 | = : - cc: CRl. JR.. CBaumrpgebrell J3.. RL.. GBrraonaqduwiasyt R2.I JT.hisztilpefetlon GC.. AH.. RSotboiltnzson 3K. FGl. RDrooungbhetryg C-8 COMMUNICATIONS MEETING OUTLINE, TALK & CHARTS ii C7./31E./80STEINER : ! PERSONAL & CONFIDENTIAL 3 i . EID079399 t 0g : TTT c. E. steiner . INTRODUCTION SCh-o8r'ts dC-e8sirhaibslteoryproicnesTsFEqu&alFiEtPieMsanufacture TOXICITY oral toxicity - slightly toxic e Compare to other compounds skin contact - slightly to moderately toxic Inhalation toxicity - highly toxic ee CCoonmcpeanrterattoioontsherfocuonmdpoiunndasrea are lower : INITIAL BLOOD TESTS OuMrDaRteasults RECOGNIZING EXPECTED OPERATOR QUESTIONS - A transition ssohmoertdihsibsetloiryeveofbcahseemdicoanlspasitn eixnpdeursiterynceshowing why we are careful MEDICAL RECORD STUDIES Nsotudeiveisdentcheoroofughhealth problem PROVISIONAL AEL NAoEtL cyoemtmiftitremeAEhaLs set provisional AEL of 0.55 mpb This vdearyy low number is to protect people who work with C-8 ever The lorweapsroonviwseioanraelmAaEkLingandchagnogaelstoinreeqduuciepmebnltoodandflpuroorciendeuriess.the EQUIPMENT TMPROVEMENTS GIonaglredtoienrtesducaeddietxipoonsurheoodtoansdolisdtaCc-k8, airborn C-8 and C-8 solutic RElaiimsiinnagteDryWeerigAhiinrgsCuiptprliycIAncliedtsin C-8 hood SAdedailtDiornyaelr DLeraykesr Windo; ws RIenmcorevaisneg VC-e8ntfirloamtiDornyeDrurEixnhgausOtustages . 006.5 EID079400 : . 2 : PROTECTIVE EQUIPMENT Clothing and Gloves Needs to be disposable to prevent secondary contamination. An EOD is being prepared to evaluate clothing. Different protection levels for 3 exposure classes Breathing cEqounicpemnetnrtatiiomnpsrowvielmlentsstiwllillremraeidnuceinaisrobmoernaereaCs-.8 but high C-8 @ Breathing air will be installed - ultimate: solution. Comfo II air respirator with GMAH cartridge acceptable. TESTING Personal Air Samples Will Resample. Blood Samples FBrleoqoudenstamspalmipnlgiwnigllisbenotrenseumceeds.sary. Area Air Samples OWfitllenceoxncteineudeprtoovidseifoinnaelpArEogLrebsesf.ore improvements. SUMMARY C-8 is People wtoorxikcinbgutwitchanC:b8e ghaenndelreadllysaafeclcyu.mulate organic fluorine in ptohteenbtliooadl,. and levels generally correlate with job exposure Although not this has caused tolerable. no health effects continued exposure is our basic AEL, agnodalsto arreedutcoe roerdguacneicexpfolsuuorreisne tolebveellsowinthbelopordoviosfional This weixlplosreedquwiorrekeresquiapndmenprtecvheanntgeasccutmhautlaatrieonbeiinnngedwomweo.rkers. It will of barlesoathrienqguiarieruosre orfesdpiirsaptoosrasblefoprrocteercttaiivne jcoblso.thing and us One otchoenrtroilnlgirnegditehnitsiehnatzairsd.needed- -- your cooperation in ~ 06503 &/570 EID079401 ' =8 COMMUNICATIONMEETING The purpose of this meeting is to bring everyone up to date on our findings regarding C-8, our immediate program , and our long term plans. Most of you know that C-8 is a fluorochemical surfactant that is used for producing fine powder, dispersion, granular and FEP. It has unique properties that allow it to wet Teflon's surface, shorten reaction cycle time, stabilize dispersions and provide sites for reactions. It has been used for Teflon manufactu: for over 25 years. Other chemicals have been tested but none match C-8's properties. Four years ago it was introduced in | FEP manufacture where it was a manufacturing improvement. Let's look over the highlights of the Technical history of C-8. In 1965 tests showed that C-8 was slightly toxic when swallowed. This was not surprising. There is a dose level where almost every chemical becomes poisonous, even water. (Chart 1). This chart shows the oral toxicity of C-8 relative to some common chemicals. These tests were done on animals, and represent what dose would kill 50% of the animals tested. I've scaled up the dose from test data to animal weights comparable to an operator's weight. You can see that C-8 is not as toxic as acetone. It has a lower toxicity like table salt. C-8, like table salt, can also be absorbed through the skin where it is about as toxic as it is orally. But, based on this low toxicity, no change in our safety program was necessary. . 009083 EID079402 Sa. In 1969 it was found that C-8 was more toxic by inhalation, Chart 2. This second chart shows the approximate concentration that will kill test animals in a 4 hour period. This approximate lethal concentration for rats exceeds anything we have measured in the plant. plant is about 1/4 of at the feed end of No. The highest level ever measured in the that level -- and that a 1.lmpm leak 3 dryer which has been repaired. The other C-8 concentrations are generally about 1,000 to 10,000 times lower than this so people working in the area see no immediate effect. (.004- mm However, since 3M informed us in 1978 of organic fluorine being detected in the blood of their employees who worked with C-8, we have been reviewing and expanding our C-8 program. We have concluded that personnel routinely exposed to C-8 will absorb it in their body. Tests at Washington Works show that blood fluorine levels which indicate C-8 levels generally correlate with potential job exposure. result in accumulation of C-8 that we are studying with the is eliminated from the body. Repeated exposures can in the blood. One of the things blood samples is the rate that C-8 Some of theoldtimers remember when C-8 was treated with less respect and they wonder "Why is it suddenly harmful now?" 0050as EID079403 . a. Throughout the chemical industries over the last S50 years this story has been repeated with the same disbelief but often with more drastic consequences. For example, carbon tetrachloride was used to clean auto parts and as a fire extinguisher for years, and now it is known to cause damage in some people and is used with care. The same story has been repeated several times for things like . chloroform (which was used in cough suryp), methyl alcohol and other chemicals. | The difference between the ending of the C-8 story and the others is that Du Pont is reacting while C-8 levels in the blood are low and before any damage is done in the body. The `medical data show that no one has been injured by C-8 (Chart 4). The Medical Division after a thorough study has concluded that ". . .there is no conclusive evidence of an occupationally related health problem among workers exposed to C-8." All that was noted was a small increase in two liver enzyme levels. After 25 years of handling C-8 we see no damage among the workers. However, the potential is there -- C-8 has accumulated in the blood. Because of this accumulation we have decided to undertake programs to minimize accumulation of C-8 in the blood of new workers. + 086025 EID079404 a- The AEL Committee of Haskell Laboratories has set a provisional Allowable Exposure Limit or "AEL" at 0.55 mpb of C-8 in air. This very low proposal is based on a safety factor of 800 below the level where reversible liver effects were observed. An AEL is the same thing as a TLV or EGL -- it is a safe concentration in the air of a working environment. In order to meet the expected low AEL, equipment changes are necessary to protect from solid, liquid and airbora C-8. The next transparencies show the changes that have been made recently to protect against C-8 exposure. To date we have: . Modified the Fine Powder/Dispersion ingredients addition hood to reduce C-8 emissions and bring the mixing operations into the hood. C-8 tools will also be stored in the hood where possible. . Improved the C-8 addition hood exhaust stack. `The hood exhaust stackwas close to an H & V inlet on the roof. . Removed operations that don't have to be done in the C-8 hood -- like citric acid weighing. This has reduced exposure of concentration to the operators The dryers have been improved also: Air supply inlets have been raised to remove C-8 rich air from the ceiling. 000033" EID079405 e Seals of No. 3 dryer doors and seams have been improved. Inspection windows have been added to reduce need to open dryer doors. We have also put guards inside the dryer that will permit using the exhaust fans to remove C-8 when dryers are being cleaned. This has reduced some C-8 concentrations, but more work is to be done; for example, we plan to cover injection pump tanks, seal openings in floor and vent oscillating feeder compartments, sealing . No. 3 dryer fans. The next chart shows the three different protection levels required for three exposure classes: Low dry exposure, high dry exposure and wet exposure. A disposable garpentsof the appropriate design, gloves and air protection are recommended for each of these exposure classes. Sample gaments have been selected and an EOD will be run to evaluate this clothing. Tyveke was selected over cloth or paper gaments because it is light fairly resistant to tearing, a good filter and disposable. Disposability is required to prevent secondary contamination when laundering. During this EOD, sample gaments will be tried and evaluated by operators and mechanics. C-8 will permeate all glove materials over a period of time. New flock lined latex gloves will be used in jobs where C-8 exposure is likely. Even these gloves will be permeated by C-8 over a period of time, so these gloves will be disposed of after each shift. 0055 EID079406 - -6- Breathing protection is very important to reducing c-g exposures. Equipment improvements will reduce airborn C-8 in most areas but there will still be areas where exposure is possible. A COMFO II air respirator with a special GMAH cartridge is required as a minimum. Breathing air is better and will be available soon. The yellow 3M masks are not acceptable. I've had some questions on future C-8 air samples and blood samples. We now have our baseline data and have mapped out the problem areas. The procedures are modified and equipment improved so C-8 exposures will be reduced. . Blood sampling will probably be done on an annual basis in the future to define the real improvements in C-8 control. Let me summarize the items covered: . C-8 is toxic, but it can be used and controlled below the proposed toxic limit. In the past, people working with C-8 have accumulated organic fluorine in the blood and levels generally correlate with job exposure potential. . Although this has caused no health effects, continued exposure should be minimized .with controls. . Our objective is to reduce exposures to below the provisional AEL, and to reduce organic fluorine levels in blood of exposed workers and to limit accumulation in new workers. . 06s EIDO79407 -7- This will require equipment changes that are partially comp It will also require use of disposable protective clothing and use of breathing air or respirators for certain jobs. One other ingredient is needed -- Total Division cooperation in controlling this material. 065035 2 EIDO79408 13 069579 t Lo |i ~ ( M4 a we AwE t oa r 8 BLOOD S: NG RES! Births and Cnt) PPM C-8 a one 0.45 Pregnancies . wo, Status TNorramnaslfercrheilddou- tboorfn FJluunoer1oc9a8r0b.ons 4/79. 0.28 0.078 1.5 0.013 2.5% Normal child - born April 1981.. Normal child Umbilical cord born Apr 1981. blood .055 ppm. Fimvoencha--pregnant. On PUfHAr%Lupe Sis gonchnprsgans. Tm child 2h I CUhniclodnfi- rm2epdluesyeyeaanrds.tear duct defect. 0.048 20007 BChEilIdSos- cFr&iJhleanntdBieo,egyeoarf defect. pa il =Arhm wh 19 #C`buerfroernetpbrleogondanclye.vel - in fluorocarbons area only one month Berd ON EE 009.71 E1D07e: 7 yO \ ie, 1. e = - a a1 i i cc: JW..TF: AF..AgTBeeohwoemra~s sils" 37.00.00 September 21, 1981 1 TO: J. J. DI NICOLA crow: D. u. snvoerCif I ' msaicron oaks LANDFILL FACT SHEET 1 Ref: ((21)) JLL.eettttL.eerr,StD.oC.weHl.Wl.,SCnry9/od1we1er/8tt1oo, CE.. WR.. same KCirmomweel,9/A1./81L,. title. Sskaimnenetritlaen.d | reviewed Attached by phone is on a copy of 9/16/81. the Landfill Fact Sheet which we It will be used by J. R. Draper of | octwhonenetraRsce.tasl wEistthatelanDdiovwinseirosn. ofItGeniesrailn Sreersvpiocnesse tDoeparreqtumeesntts inbyhissome | this with C.botW.h CLreogwael oafnd thPeubDleicparAtfmfeanirtsa.l ETnhgeiynehearsveOfafpipcreoverdeviietweedase. ); /3as(1669) Attachment | I i EXHIBIT 0656s g EID022224 LANDFILL INFORMATION The landfill will contain nonhazardous wastes only, including ash from plant boilers, waste plastics, glass, scrap metal, paper, and trash, all transported by covered truck or closed containers. It will be designed and operated with full consideration for neighbors. The ash will be wetted, and the road will be paved to control dust and mud. The fill will be covered with dirt at the end of each day. | Daytime only operation is planned. The site could receive ' 10 to 14 truckloads per day. The probable start-up date is late 1983. CIE EID02225 15 000675 The miracles of science' Study Title MODELING RELEASES OF AMMONIUM PERFLUOROOCTANOATE INTO THE OHIO RIVER Author William R. Berti Draft Report Completed on May 22, 2000 Performing Laboratory E. I. du Pont de Nemours and Company Environmental and Microbiological Sciences & Engineering Corporate Center for Engineering Research Central Research & Development Glasgow, Building 300, P.O. Box 6101 Newark, DE 19714-6101 Report No. EMSE-054-00 4 CCR 4 CORPORATE CENTER FOR ENGINEERING RESEARCH , Page10f8 EID108608, `CONTAINS CONFIDENTIAL BUSINESS INFORMATION 009673 DuPont EMSE Report No. 054-00 GENERAL INFORMATION ChemicalStudied: Ammonium perfluorooctanoate Synonyms/Codes: C-8, FC-143 DuPont Notebook No.: Not Applicable Sponsor; ER.ob1.erdtuPPionncthdote Nemours and Company BARLML CRP-711/2210-B Study Initiated/Completed: September 1999 to May 2000 Z g Page 20f EID108609 CONTAINS CONFIDENTIAL BUSINESS INFORMATION 00077 DuPont EMSE Report No. 054-00 AMMONIUM PERFMLOUDOERLOIONCGTARNELOEAATSEEISNOTFO THE OHIO RIVER SUMMARY the timePdDurMinigndtihceatyeeadr.thCat-8C-c8onccoenncternattriaotnisoonfsionft1h.e0 rgivCe-r8w/oLulwdouelxdcebeede0x.1c"eegdeC-d8a/Lb.ou9t05%o0%ftohfe time during the year and 10g C-8/L about 2.2%ofthe time during the year. Excel spArveeardasgheeeatnwnauasl0C.-4823cogncCe-n8t/rLa.tiMoonsdeilnetdheCO-hicoonRcievnetrractailocnuslaitnedthbeyriuvseirngraangMeidcrforsoomfta hliogwhoafn0d.1l9o9w rgivCe-r8f/lLowisn,Mraerspcehcttiovealhy.igAhvoerfag0e.9O65higoCR-i8veLrifnlSoewpstaenmdbevro,lwuhmiecdhatcaorcraelcsuploantdedto `fPmlraoondtme.lt,TheThihUseSrBiGevleelorelvfoilgloilwceadDlaatSamurisivstehoyenwctalhosesecOsohtlilleooccRtaeitdvieoartn dt1h3oewmBnieslltelrsevediaolmlwenfDsrtoarmmetahamenodfpltuahsnetedwWihanesrthheienthsgiptsroetnaydpWseoheorefkts information is available. StRuedpyorCtonPrdeupacrteedd nbdy: eport Prep WSeinliloiramReRs. eaBrecrht Biologist -- @ae) z g Page3of8 EID108610 CONTAINS CONFIDENTIAL BUSINESS INFORMATION 009078 DuPont EMSE Report No. 054-00 INTRODUCTION/PURPOSE manufacCt-u8ri(nagomfmoTneifulmonperaftlWuaosrohoicnagttaononaWteo)rkiss.a AflupoorritniaotnedthseurCf-a8ct(a1nt8,u4s1e6dkign itnhe1996) was Trehleeamsoeldetcoultahre wOehiigohRtiovferC-a8s pisar4to31f.a0n98NgP/mDoEleS. pOetrhmeirttperdopreerlteiaesse offorCt-h8eafraecilliistiyed(WbVe0lo0w0.1279). HMeaadltehbryat3inMg Coof2mpany Exposure limits 0.01 mg/m' skin 8 hr LBDO,Dac=unteiloral rat = 680 mgrkg +BiBodCeFgr=a1dation = nil MpolHec~u5la(0r.f5o%ramquuleaoCuFs),(CF,,COONH," + pMeKlat=i2ng38po(i-ntCO=O5H6)-58C (-COOH) COD =700 mgke + WaKtoecr=2s5olubility > 1000 mg C-81L Vapor pressure (at 220) = 7.1 * 10% mm Hg. expecteOdutro oobcjceucrtiivnethweasOhtioocaRlicvuelratdeotwhnesctornecaemntorfattihoenNsoPfDCE-S8 ptehartmictotuelddoruetafaslolnaatbltyhebeDuPont Washington Works. MATERIALS/METHOD WashingRteolenaWseosrokfsaPmlmaontriwieruemmpoedrfellueodrouoscitnagnotahteeP(roCb-a8b)iltiostthiec ODihliuotiRoinveMrodferlom(tPheDMDuBPeotnat cVoenrsstirounct4e.d0 MBiectraoJsuonfet11E,x1c9e9l9s,pUreSadEsPheAetOfmfoidceel.ofCP-o8llruetlieoansePdraetvaefnotiron19a9n6dwTeorxeicuss)edanidn aboth modeling exercises. numberoPfD0M50i3np0u2t0s2i0n3c9l,udaemdetahenNsPtrDeEamSflnouwmobfe4r.7of5EW+V00040m1i2l7li9o.n lTihtiersscpoerrrdeasypo(nMdLsDt)o,a arelaocwh Srtelreeaasmefdl3o3w5ofda9y9s8/0y.ea4r7,MthLeDloaanddinagnweafsfl5ue5n.t13f8lokwgo/fda2y1,6a.n7d5 tMhLeDw.astWeewaatsersutmreedattmheanttCe-f8fiwciaesncy 1w0a5s00%g. CW-8e/LthteondveatreiremditnheetCh-e8CcOonCcepnetrrcaetnitonofaysetahreeCxocneceednetnrcaet.ion of Concern (COC) from 0.1 (USGS:M<ichrpowsaofttedEaxtcealusspgrseagdsohveiemtvuissewd/WrivVerdfaltoawcdoamtpaofnreonmt thie sUScgGseoaltooguimca=l03S1u5rv9e5y30-), T1h0i/s1/i1s9t7h4e 1m0e9a/n30d/a1i9l8y5r.ivTehre BfleolwleivniclulbeiDcafmeeisseocnmtehaesOuhrieodRaitvtehre 1B3elmlievlielsledoDwanmstfrreoammofthe zg wWhaesrheintghtisontyWpeorokfsinPflaonrtm.atTihoinsirsiavvearifllabolwe.daTthaisisrtihveerclfolsoewstdalotcaactoiomnpadroewsnswterlleawmitfhrOomhitoheRpilvaenrt 23 m`AomnntyhCloyrapvseroafgEengfilnoewesrast (Pfiittpsib/u/rwgwhw,.PrAd,-wHeu.nutsiancgetaornm,y.WVmi,l/aMnodntChilncyi_nhniamt/i),.OTHhefraovemrtahgeeUdSaily 2 trihveenrcfolnovwerftoredthteo mthoentavhewraagsecmalecausluarteedd ffrloomw pavearimloanblteh.daWtaebaestsweuemnedthtohseeCt-w8owdaatsesd.isTchhiasrgweadsto the river at a constant rate except for the monthofOctober when production at Washington Page 40f8 CONTAINS CONFIDENTIAL BUSINESS INFORMATION 0967Y EID1086 1 DuPont EMSE Report No. 054-00 W18o,r4k1s6 iksgusCu-a8ll(y40s,u6s0p0enIbdsedC-f8o)r adninvuiadledmbayin1t1enmaonncteh.s.WeTaablsesusmheodwtshatthtehreestuolttaslodfitshcihsargeofwas spreadsheet model RESULTS/DISCUSSION the timePdDurMinigndtihceatyeeadrt.hCat-8C-c8onccoenncternattriaotnisonosfoinft1h.e0 rgivCe-r8w/oLulwdouelxdcebeede0x.c1eegdCed-8a/bLou9t05%0o%fotfhe stihmoewsdumroidngelthienypeuta/rouatnpdut.10. C-81 about 22% ofthe time dring the yar (Table 1) Figure | using aAMviecrraogseofatnnuEaxlceCl-8spcroenacdesnhtereattimoondseilnwtahesO0h.i4o23RigveCr-8c/alLcu(lTaatbeldeb2y).cMoonsdterluectdiCng-8and concentrations intheriverranged from a lowof0.199 g C-8/L in March to a high of 0.965 g C- SRIiLveirnfSleopwtsemabnedrv,owlhuimcehdcaotrarceaslpcounldatteodhfirgohmatnhdelUoSw Grievoelrogfliocwasl,Sruerspveecytiwvealsy.coAlvleecrtaegdeatOhthieo BmeillleesvidlolwenDsatrmeaamnodfustehde WinasthheinsgptreoandsWhoeretksmoPdlealn.t.TThheisBreilvleervifllloewDdaamtaoins tthheecOlhoiseostRilvoecarti1o3n downstream from the plant where this type of information is available = Page Sof 8 EID108612 (CONTAINS CONFIDENTIAL BUSINESS INFORMATION 00963G TABLE 1: DuPont EMSE Report No. 054-00 Pyreoabrabtihlatistthiec cDoinlcuetniiornatMioodneolf(CP-D8Mw)illrebsueltesxocfeeCd-e8d cionntcheentOrhaitoioRnisvaern.d percent of `SonfceCn8ation|| Pceorncceennttrofatyieoanr exceeded ----1 1 Css] TT rr Te] eT el 1] C TS or 07 50 70 Z 3 Page6 of 8 EID108613 CONTAINS CONFIDENTIAL BUSINESS INFORMATION 000CEL Table 2. 2 DuPont EMSE Report No. 054-00 OMihciroosRoifvterExcel spreadsheet calculationsof modeled C-8 concentrations in the STE Tow| Measured Tow|CH serge Oo| ESmated C3 River in 1996 River concentration in Ohio rrrr LeE y 5 oes weer[LeSOm 2 0 B-- [Oewber|Ssow-- |[ vZS|UoE ooR r II .r .%2. 50 1 vas = Page7 of 8 EID108614 CONTAINS CONFIDENTIAL BUSINESS INFORMATION 06nuEs 3 a Biases YY of lL HE 3 3 32 3 | Eo JIE| g#Z2 58 ::|| |3 :REiEsE | E H amE 3; ] 2FI g zg8 a8 |I glHyH 3 I: F2|15:] BS i zy a ARCE rm = z g | Els Frew) REAR 5s 2Z EEl E L BI%|:a Ic| l REIL Eel l : z i 2 2 Horii FE dddaa 22 2S 32 RE3 nSallasase omo ni doa2 C?EE gzE z$ 2& f | laZl| |[eleEg[cl|eEmm@ealmzlel oF = z @2E2gZ LES2s ~SIRE LE Jei}iznase 844 8 @ 2Z gz> E33 [T RsSl.fl:4fsEla e d |2 aSEIS oRrr etpre rimenre eraw C5 LSETA b g & S2E:E: HF|EEEREREREa E CARE ERfRik iE gesS: :E. R i.i.n 3 " : HM i Ey 4 2 z S : H0 ESEEEReReTtn e I i BH :| rE 23 EwO | 2 - ===ES s EID108615 005a5 . PERANSDCOONFNIDEANTILAL TRP..NAT,.hisFTotaslyteletorro'n October 13, 1982 To: Re 0. 2IPFEL Frou: 0. G. LoscHIAv) QH.oX. ESTIMATE OF HUMAN C-8 EXPOSURE RESULTING FROM DRINKING OHIO RIVER WATER drinkingAs Oyhofuo rReiqvueerstweadt,er.T esAtsimaateredsuhlutm,anI'evxeposfouurned thoumCa-n8 eaxspoasurreesutlot Co-f8 tFoinebePvoedreyr lDorwy.er Uesxihnagus1t9)8,2 pmearnsuofnasctwuoruilndg bceonedxiptoisoends t(oanad Cn-o'B sdcorsuebbrionugghloyf Jeeqcutievdalemnatnuftoact0u.r0i8n%g ocfontdhietioancscepftoarble198e7xpos(wuirteh lsicmriutbbi(nAgEL)o.f FiUnsiengPowpdreortDorye0r.3e8x%haoufstt)h,e pAeErLs.ons Itwouslhdoulbde aelxspoosebde tmenatoionCe-8d dtohsaet rCo.u8ghlisy meoqrueivatloexnitc vWioauldtheTnianchtaulaaltiitoyn breouteeventhalnovterh,e oral route. Therefore, these percentages of condiHtuinoanns:C-8 exposure calculations were made using three separate sets o oCfasethe1 -FineRefPolwedcetrs D1r9y8e2r meaxnhuafuasctt.uring conditions with no scrubbing o tChaeseFi2ne- PoRwedfelrecDtrsye1r96e2xhmaaunsut.facturing conditions with scrubbing of oCsacsreubb3ing- ofRetfhleecFtisne pProowjdeecrteDdrye1r987exhmaaunsutf.acturing con.ditions with Table. TMhye craelscuulltastioonfs amrye aclaslocualtattaicohnesd. are contained in the attached J167L9:9s-d1e 0068: EIDO79287 TABLE 1. Estimated Ohio River C-8 Concentrations and Human C-8 Exposure Reflecting 1982 and 1987 Manufacturing Conditions Case Mo. 1 2 3 R-i8verConWcateenrtra(tpioomn byinwt.) 0.8 x 10-4 L1x 10-4 3.5 x 10-4 AovferCa-g8e IDnagielsytedAmo(usngt) A%cLofDoEsqeuivalent 0.08 0.08 0.11 0.11 0.35 0.35 179%8-2 s 00Gean" 3 EID079288 CALCULATIONS General Assumptions: o An average person drinks 1 liter of water per day. o fn average person inhales 1013 of air over an 8-hour shift. Average Ohio River flow rate is 13,880,000,000 1b. water per hour. The scrubber on the Fine Powder Oryer stacks would be 90% efficient. When the Fine Powder Dryer exhaust is not scrubbed, 3% of the total C-8 added to Fine Powder/Dispersion goes to the River. When the Fine Powder Dryer exhaust is scrubbed, 31% of the total C-8 added to Fine Powder/Dispersion goes to the River. Approximately 81% of the total C-8 added to FEP goes to the River. Specific Case Assumptions: cas1e Fine Powder/Dispersion will manufacture 6.9 MMAP during 1982. An average of 0.0022 1b. of C-8 is added to make each pound of Fine Powder/Dispersion (35% solids). FEP will manufacture 6.7 MMAP during 1982 A(nTowavCe-r8agreec0i.p0e0)1.6 1b. of C-8 is added to make each pound of FEP Case? o Same as above except the Fine Powder Dryer exhaust fis scrubbed throughout 1982. cas3e Fine Powder/Dispersion will manufacture 16 MMAP during 1987. Jo average 0.0053 lo. of wilbe added to make each pound of FEP will manufacture 11 MMAP during 1987. * AFnEP a(vheirgahgeC-08.0r0e3c0ip1eb).. of C-8 will be added to make each pound of 17938-3 R 0096E% EIDO75289 : Case 1 Calculations Fine Powder/Dispersion: Ce x 106 1b. Irae) (B-0022 1b. C-8 = (9) re Tb. TEFLO! 365 days x 26 hr. yee day = 0.051b.C-8 nr. goes to River FEP: er x 106 1b. Erion) (o-0me 1b. C8 ) (2) re Tb. TEFLON, 365 dyarys x 24 Ghry. = 1.001b.C8 goes to[ARiver Total C-8 going to the River per hour = 1.00 + 0.05 = 1.05 "1b.hCe-8 C-8RivCeornce(nwttr.a/twito.n) in 613,880,10.0050,01b0.0 C1-b.8/hwra.ter/hr I 106 = 8 x 10-5 ppm AnDoruinntkionfgC-W8ateIrngeEsacthed Dwayith = Titer of ater) (love gn ater) 6 x10-5)(109) Titer water, = 8x 10-8 gn. or 0.0u8g of C-8 Amount of C-8 Inhaled at the , A8-EhLr.ConScheinfttration over an = (10 srg aofrCc-8)a)) (1003 of aif)) = 100 ~4g of C-8 Ingesting 0.08 4g of C-8 is equivalent to: 0.08 ,g of C-8 x 100 = 0.08% of the AEL y 1004g of C-8 17998-4 . 00008 EID079290 Case 2 Calculations Fine Powder/Dispersion: e x 106 1b. TEFLow) (o.02 1b. C-8 = (3) yr Tb. TEFLO 365 days x 24 hr. re day = 0.54 1b. C8 hr. going to River FEP: same as shown in Case 1. Total C-8 going to the River per hour = 1.00 + 0.54 = 1.54 "1b.hCr-8 C-8 Concentration in = 1.54 1b. C-8/hr. x 106 = 1 x 10-4 ppm River (wt./wt.) 3,880,000,000 1b. water/hr. AnoDurnitnkoifngC-M8ateIrngEeascthedDawyith = ( Titer of ater) G3Teermn aatteerr)(1.1 x 10-4 om) Gs = 11x 10-7 gn. or 0.11 xg of C-8 Anoouvnetr. aonf 8C--h8ouIrnhSahliefdtat the AEL Concentration = 100 ug of C-8 Ingesting 0.11pg of C-8 is equivalent to: 0.1149 of C-8 x 100 = 0.11% of the AEL 100sg of C-8 17998-5 00508% ; EIDO79291 :3 } CCasael3culations Fine Powder/Dispersion: ( x 106 1b. Jr) (0-00 ye. 1b. C-8 ) (o-) Tb. TEFLONS: 1.851b.C8 365 days x 24 hr. hr. yr dy going to River FEP: TM x 106 1b. TEFL) {pom 1b. C-8 ) (2) yr. 1b. TEFLON, 365 days re x 26 fr2. = 3.061b.C-8 golag htro.River Total C-8 going to the River per hour = 1.85 + 3.06 = 4.91 h 1b. eC-8 -8 Concentration in G 4.91 1b. C-8/hr. x 106 = 3.5 x 10-4 ppm River (wt./wt.) 3,880,000,000 1b. water/hr AmoDurnitn.kionfgC-W8ateIrngEeascthedDwaiyth = Titer of ater)(10T0i0taenr wwatder)) = 3.5 x 10-7 gn. or0.35 ug of C-8 x 10-4 on) (ro Amoouvnetr oanf CB--h8ouIrnhaSlheidftat the AEL Concentration = 100 4g of C-8 Ingesting 0.11 4g of C-8 fs equivalent to: 0.35 4g of C-8 x 100 = 0.35% of the AEL : 100 4g of C-8 17998-6 006088 EID079292 18 000420 | - TT WA bea i #T. Hope Gl Tm Kemp Dapm! TF Dpuglly Wppanlen 93,1733 LGr C niREn Wim tome, 0 Lito F710, Rose os F.C, Bagprtic L Lorie vein) vicarBse above Luin ton woncirnid Hof He Lofrimitin peril) of Hh med Lots rt adlogriatl phdHo valallosls:, QO esifpimibooin Ho ford Pipe gy A oth Lt firm. Doe Bocdlidsitpr grin Tfin by phone join TPR mete Badd open Hho Ink) Be onl|poe auld I Hee Conch Hot 4 soridl srvomd of 9 sn fro wn He 440d of Zoerf tveniin an 202 AT tins Fo tome Sb Apion in ose Ho pins Te pl Bit Peer Horie Ll ge th tmgpensin RT CFLptiin FoAuth He Longo pigplsspond gr tl plo CF ai lod) Sa Se Fine oil fern Dit Bot 2uplygeta of 2B Bpziance pont verde Se asin HHiy void ore Lode gimilin Ho Aus of ie dspeion cots The antoge tonceiFald fou 27 pagal woe 0.02 5, prope tomo foo ron Ulonnnpleg ANpslo Biba ose 0.226pom, EIS nla Dfwre ont Lgmeome list sprouse =plorte Siete an goolipi posi Fe grins Avitrone | HB mad hi Print fd 17 005023 PERSONAL % CONFIDENTIAL 6/13/88 70: HM. V. BRADLEY DT.. GM.o WKIEKMAP T. Li SCHRENK FROM: J. A. SCHMID r-8aIrN WeATrER . BELOW IS A COMPARISON BETWEEN THE 3/15/84 SAMPLES, AND THOSE TAKEN ON 6/4/84. LaOxCaArTaIrOeNx LLIUTBTELCEK WHAOTCEKRING * POWELLS STORE 3/15/84 c-8 IN PPB 6/4/84 rx0s.x8aasx NrOaTarDaEiTeECTED 1.2 1.0 * LUBECK HILL NOT SAMPLED 1.5 HOCKING, THI EWOCU-L8DDHRAOVPEPEDTOBECLOONWCLUTDHEE DTHEATTECTIINONTHELICMAISTEOFOF0L.I6TTPLPEE. ATLESSOT,'SRSEECNOSGINTIIZVIINTGY,THATTHEWEBESATREWEOPECRAANTISNAGY AATBOUTTHETHEEXTRLEUMBEECKOFWATHTEER IS THAT IT IS PRESENT IN THE 1.0 PPB RANGE. REV.6/14/84 - 6/13/84 DATA WAS REPORTED AS FLUORINE NOT C-8. 0EeLE. L \ p07"73 o -- PERSONAL AND CONFIDENTIAL TO: J. A. Schmid FROM: J.Fe Toh CC: T. A. Foster June 14,198 UPDATE on C-8 IN WATER SAMPLES The attached recent data. table shows I conclude the the C-8 new diantwaatceornfdiartmatihenclourdiignignalthdeatmao,st a1.ndThtehe DusamPpolntingdatsaystsehmowsdoetshatnotthecontetsatmidnoaetse not the sseaemplCe-.8 up river , c2.onTtheent saescontdheWafisrhsitn.gton sample had essentially the same C-8 3. The new Lubeck sample shows essentially the same concentration 2s the Lubeck Washington sample. Thus the Water System as I suspect or Washington sample is at least the Lubeck from the the same concentration. system has bd4.eetlTeohcwetitohoneridgleiitnmeailcttLifioortntllteihmeiHtot.ceskti.ng Tshaempcleoncwaesntrvaetriyonclonsoew atpopetahres to be I do not plan to do additional airseneneodtedc.auseTheforconcocnecnetrrna.tions sampling are very unless further information low and in my judgement 000035 1007927! Y LOCATION DISTANCE (MILES) SIDE ppb C-BhAk PARKERSBURG 7.5 up stream 1 ND DU PON(T3/15/84) 0.5 up stream w ND (6/4/84) ND DISTRIBUTION 0.25 down streank WV ND CENTER OF : "PARKERSBURG VASHINGTON 0.25 down stream WV | (3/15/84) 1.2 (6/4/84) : 1.0 LUBECK 0.25 down stream WV (6/4/88) 1.5 LITTLE HOCKING 3 down stream OHIO (3/15/84) 0.8 (6/4/84) ND BELLEVILLE 12 down stream WW ND * REEDSVILLE 14 down stream OHIO ND 'RAVENSWOOD 29 down stream Ww ND RACINE 50 down stream OHIO ND POINT PLEASANT 74 down stream Ww uD 4% GALLIPOLIS 79 down stream OHIO HD #well is back from the river AAELirst community to take water directly from the river #xivalues obtained from Experimental Station multiplied by 1.5 to i convert to C-8 vs F content originally reported i ND = below the detection limit of 0.6 as C-8 (0.4 as F) 0006370 EID079272 19 000085 | DuPont INTEROFFICE MEMORANDUM DFartoems: TDeelptsNo: T1o2n-yMayP-L1AY9T8I7S03:06pm EST TPELFATYETCIHS 2775 TO: ROGER ZIPFEL ZIPFEL > cCi JOHN CRUM CRU > Subject: C8 In Water whichAtatraechieddent1i3fiaedcopays fofolltohwes.smalytical report for our five water samples, #1 - Washington Works drinking fountain, 83. #2 - Pouell's General Store, Washington WJ 7 - Lubeck Pennzoil, Lubeck WV #4 - Masons Village Market, Little Hocking OW #5 - 812 20th Street, Vienna WV Ca.plLa.stHiicllbootbttlaeinefdillseadmpwlietsh1-d4rinbykindgriwvaitnegr.to Seaamcphlelo5cawtaison taaknedn absykiDn.g Kt.o have Moore at his home. ALL samples were taken on 3/13/87. the rNeostuelt tohfat 1.t3hepprbesubletcsomeasre1e.x9prpepsb.sedTahsispprbesFu.lt Wihsenhigchoenrverttheadn ttohospepb fCr8o,m 1d9i8f4f,erbeuntcecoinssipdreorbianbglyhonwotclsoisgeniwfeicaanrte. to the detection limit of the test, the Z g 035: EIDO79091 PRoelsyemaerrchPr&odDuecvteslopDmeepnatrtmDeinvtision Experinental Station ce: MSs.. AR.. KLaaiasser -Z 225566 MB..SL.ombsahrespkaird ._- 236293 GR.ALJ. FiSlleoan S- 2a56 Ic. Sa ANALYTICAL REPORT ray 7, 1987 To: A. J. Playtis - PPD, Washington Works From: M. J. Vilone and R. N, Vasta - PED, ESL 269 mgt ow (36h No. 870-441;PEPRRFALLUCNRoOsO.CT8A7N-O2A9T3E3(-C8)293I7N, WANoTtEeRbook No. E4875) by electroFnivceapstaumrpelesgasofcwhartoemratohgarvaephbye.en aMneatlhyozdedES-f5o6r7pwearsfluuosreodocwtiatnhoatthee (C8) hfooulrlso;wincgonmcoednitfriactaitoinonosf:pesrafmlpuloerosdiezceanwcaaste10ingt;ernlaylophsitlainzdaartdiownevsasdec-r1e8a-s2e0d 10 wfoelrde.'exaSmpiinkeedd. stAandraerpdrsoduactibcloencdeenttercattaibolnes opfeak0.4w,as0.o5b,se0r.v8e,d 1f.o0r a0n.4d 1p.p9b papnbd we hsatvaenduascdesd t<h.i4sppabs.ourFodrettehectiqounantliimtiatt.ionNoveC8hapdealkinveaasr dceatleicbtreadtioinn ctuhrevesspikoevder atnhaelyrzaengdeionfdu0.p4lictaote1,.9 pTphbe. reTshueltssaamrpelesexwperreessefrdeeazseppdrbiefdl,uodreirdievivthiezceed, and 6b F = 0.688 x ppb perfluocooctancate. questions,Thedonr'etsulhtessiatcaetegitvoencaliln. the attached table. If you have any Roemtachnent. Keyowords: wPaetcetrluocooctancate 0095.56 EIDO79092 RAL a7-2033 87-2934 a7-203 87-2936 a1-20m7 Pecfluorooctancate in Water Designation n ngF/g. B,0 (ppb) * . n.d. 2 1a 9 et << La 9 es # n.d. is nd. * n.d. = none detected; detection limit = 0.4 ppb FYse =F 000504 BiDossass LuFont TO: ROGER ZIFFEL INTEROFFICE MEMORANDUM FDartoem:: DTeeplt:No: 4TO=NaYy=F1L9A9Y7TIS02:0%m 37 ETLEAFYTTEICSH 2775 CzieFEL Subject: C3 in Watar by theTheendfoloflowtihnegwereeks.ultsThehadveetebceteinonrecleiimvietdofbythpehontee:st iasl0a.t4terppbw.ill sacele seb_CB duraisnhiiinnggtonfouWnotrakisn, ES 0.4 Ftioawsehliln'gstonGenWeYral Stere, 13 Lubeck Fennzeil, Lubeck wv 3 LMiatstolne'sHVociklilnaggeOHMarket, 0.4 312 20th Strest, Vienna WY 0.4 fallen Zz 00912. \ EID079094 20 0001.03 | C-8 REDUCTION & CONTROL PROGRAMS STATUS R. J. ZIPFEL 6-11-87 003546-19 - 06/09/87 - RJZ:kat ~ 009: EIDO79685 : WASHINGTON WORKS OFF PLANT EMISSIONS WATER POUNDS C-8 1983 1986 - + 21,700 19,100 AIR 12,700 16,200 PRODUCT 8,000 8,300 OFF-PLANT DISPOSAL 7,700 8,300 50,100 51,900 003546-10611 ~ 06/03/87 - RiZskst 000125 EIDO79694 C-8 LEVELS IN DRINKING WATER PARKERSBURG WASH. WORKS LUBECK WATER DISTRICT LITTLE HOCKING RAVENSWOOD DISTANCE FROM NO. 5 OUTFALL (miles) C-8 LEVEL - PPB 1984 1987 7.50 UPSTREAM ND ND 0.50 UPSTREAM NR ND 0.25 DOWNSTREAM 1.1 1.9 0.25 DOWNSTREAM 1.5 1.9 3.00 DOWNSTREAM 0.6 ND 29.0 DOWNSTREAM ND - ND = NOT DETECTABLE 003546-7 - 06/10/87 - RJZikst . 003185 EID079695 SUPERNATE POND ELIMINATION BENEFIT ~ ELIMINATE C-8 CONTAMINATION OF LUBECK WATER SYSTEM AQUIFER FROM THESE PONDS STATUS ~ PROJECT APPROVED (320M) 11/86 ~ PERMIT APPROVAL 3Q87 ~ START-UP 11/87 003546-33 - 06/10/87 - RJZ:kst Q00i5 Emorsron 21 000108 ----- -- Sro-- y bm 17 E. |. ou Pont og Nemours & Company rouvmEn sours SErARTIENE Tres r on rage us CC: R. V. Mihaflovich, U8P.a1Si.lcahEdePeAsitsnnRuitse,BsiPdAts.a19r10t7 Biv of tater Resources Greg Menger, Acting Supvr. 6321 Emerson Avenue Parkersburg, WY 26101 CERTIFIED MAIL RETURN RECEIPT REQUESTED June 15, 1987 Mr. David W. Robinson, Chief WY Division of Water Resources 1201 Greenbrier Street Charleston, West Virginia 25311 Attention: Industrial Waste Section Dear Mr. Robinson: De Bor and 008. The changes planned vere reviewed in a telephone This letter is to comply with WY0001279, and Section D.1, Page 17 of Section D.1. hud of NPDES Permit WV Permit 1W-6238-82, informing you of planned physical changes at our Plant and a minor change in discharge from Coaversation with Kr, Randy Sovic of your staff and are as follows: 1) Relocate the Ko. 006 outlet sample location, 2) Add Calgon H-9006 microbiocide to our Process Water wells on Slennerhassett Island to control fron bacteria, and 3) Close three The details of anaerodic digestionponds. the planned changes are shown fn Attachments 1, 24 3. Please call ma on 863-4271 11 you have any questions. - Very truly yours, Ai Envirormenta Control Consultant Washington Works AACtHt:ahcehwments 187 . . acrren rumen son serves vine 000509 EID076048 : Appendix F - page es : ATTACHMENT 3 Page 1of 3 CLOSE ANAEROBIC DIGESTION PONDS Sackground ousuerd fflourorcTohoprnoetleayimnaemnreaenprtroobdaiunccdtidtoirngeeastftmaieconintlitopifoensds.somelTohnceoantw-eadhsatzoaenrdtiohnuecsluOdhaeiqsoueowRuaistveerrw,asbtaiennkesrftroarme Sauntspeerncdbeidcal$loy11dsigaensdt tahneond-eftoenrfgcentd.etergent, and is held in the ponds to Povaenrtflloowc.aTthieoTnhitshfroerreeqfupuiorrntedhssershahtvirepeaetenmnoetnotuotflaendtdigeuansldtteiadmrawetaesotpdeeisrpaootfsefad-ls.istoetShtioenyceandtoohtehnoetrcosDtu of mdaitseprosiaall waste to osfhitphpeedwa{s3terasitnrwaetaemr,hasa bsetaonragienctraenaksinigs significantly reduce the volume, It is braepiindglycoannsdtruabcotuetd f5o0r3 otfhethe anticipated that two ponds wih1e1n tbaenkclocsoendstriumcmteidoiante{l3y,cowmiptlhetet.he third being closed by the end of the year Description 1) 2) 3) wTihteh posnldospedareearotfheenartbhaennkscoanbsotutruc2t2iofne,etawpipdreoxiamtattehley basef.eet Adlleep BBdieeknnettoownnaiilttleeswwawasesreaaflxsreoedcuosinnesdtwritutcohtestdeahlefnclle1aa9yk7s5beoifrnort1eh5e76rbewopitltathcoimnrgoefdthctelhaeyw.alls. upriver pond.e, aPnadgeel3evoaftitohnisofattthaechmtehnrtee(iWmSpKo-u1n3d6m7e5n)t usnhiotwss.the location, size The cmbined volume of the ponds 1s estimated to be about 3 sillfon gallons. Closure Pas~ 11) aTnhde scohnitpepnetdsofoff-stihteedifgoerstdiiosnpospaoln.ds will be pusped into rail cars 2) hVainsdiblsehovTeulmesd oifntpoolSyS-tgeatlrlaofniuostreoeelthdyrluemnse a(nidnerltansdofliildlse)d aarteLteotarbte. 3) The and bdiostctoolmoroefdth5e011p,ontdos awild]eptthhenofbe3 troemo4vefde,etiDnecllouwdintgheslduodtgteon of the ponds. 1573H-6 0095.56 EID076049 apenas age 3 Ancwent 3 Page 2 of 3 CLOSE ANAEROBIC DIGESTION PONDS (Cont'd.) 4) The sludge and earth removed from the ponds will be disposed of 1n our Ory Run landfill (Permit IWL-6282-82). 5) It is then planned to push the earthen walls fmward, 111 with clean soil, level, and plant grass on the leveled ares. Sludge Test Results Analysis of a composite sample obtained from twelve locations within the eastern most (up river) pond showed the following results: COMPOSITE SAMPLE COMPOSITION (ORY WEIGHT BASIS Fluoropolymers Triton Ammonium perfluorooctancate ner Inorganic fluoride Chloride (FC-143) 13,61 9.7% 85 ppm 47 ppm 26 ppm 20 ppm *fnsoluble, at about background level The sludge tested non-hazardous dy the RCRA EP toxicity test as shown below: 0router est mw Concentration (ppm) 26M Limits Go ren Arsenic Sari Cadeium Chromium Lead Selenium Silver Go0.006 <4 0.1 <0.8 0.8 0.1 5.0 100.0 1.0 5.0 i:85.0 of 5.0 157347 : [LITRES EID076050 J. r eee nn1 p_: Ih iii A3 Bi Hk | i3 ; 3 LJ 4 age :ill Ii i | C oe ) ili W1h7a8 + I I= i 2-- ii 4 3-- i += 1 i S-- S-- ees meee rm 3023 CDOMENT 3 wppgoeitioey__of -- SE -- i 33 VU ferurresid dhe psrT et TYPICAL PROFILE fr orl HOfwRIV NORMAL POOL ELEV. 582.2 ees IE I: pmsi- srise o hit 3 2 45 e3e 1- Frgom]. Ys6 LONGITUOE LATITUDE 20. A LB 814019.3 BI4s8.c 8/40/7.6% B8140/5.8% 8/40/5.7% 3/40/3.3% 3316 18.4% 391613.5 391618.3% 3316 18.77 35/618.7 391618.8% 7-- 6c.9l 8-- 623.25 9-- I5i.4% Elev. Res 535.07 af rap oF sCresn Wak WW= 45252. ADINKAEEREZLEEIVCATDIIOGNESST&ICOONORPDOINNDASTES "a ra =#09 gagitz EoeOsI 006115 | .: ce: T3G... GMR... LKAleommsspc/hSi.avoV. -GaDn1g2a0l22-3 3D.. kEjl CFrluemnsborg 5R.DL.AlLiannyeon J. ALLL optoest 0l.H4.. SStcehvnaerieder July 7, 1987 TO: CJ.. AA.. SDYCKHEMSID FROM: R. J. ZIPFEL C-8 cowTRoL PROGRAM vKeerrythvevlalsMywmoistrthevilieinwtttelorenestctehhdiasngieinssrtueheqeuvipirrteedhsenDtrco.eouoBrfrucCpe-r8eKsaeornuctthsicodonentrJtouhlneepprl1o1a,gnrta1m9b.8o7u,ndDrva.erinets. Hfteoesushetasav.teedC-Dr8t.haitKnacvteehhenieaeldsbolofooadc.pclepatcMeeyd tchhtehaerhtsipgohsaeinstdtiotnphreitoshraptietcyoiufriocnemctpohlmeomseyeenetessnvivmriaoldnlemecdnoutnratilinngue the reviev are attached. C-8 controTlheplfaonllvoivtihngthise anecreessstaacteymeancttioofn sttheepsspeicnidfiiccatepdr:ograa tems in our I. ADHINISTRATIVE CONTROLS A. EQUIPHENT DESIGN 1. IMPLEMENT AN IMPROVED FINE POVDER DRYER GASKET DESIGN (RESP -KLINE) 5. PROTECTIVE BQUIPHENT 1. ATFUDICTURVRAESNHTINPGRTOOTNECTVIOVREKSECQ-U8IPKIENNTBLO(OADNDANODPECR-A8TINIGN APIRROCEDDAUTRAEST)O ADREETETRHMEINE OPTIMUM AVAILABLE (RESP - LOSCHIAVO) 003855-1 - Rzzkst EID091375 =S 8g 0005.45 = .' CFC.ga'cAe.CO2DNYTRREOSL /PRJO.GRAA.K SCHMID Sr 7, 1987 C. C-8 HONITORING 1. REDUCE EMPLOYEE BLOOD TESTING TO ONLY THE FOLLOVING JOBS: RAV DISPERSION AUTOCLAVE OPERATOR DISPERSION OPERATOR FINE POWDER DRYER OPERATOR ENVIRONHENTAL OPERATOR (SUKE) DISPERSION PACKOUT OPERATOR GRANULAR POLYKETTLE OPERATOR FINE OVDER PACKOUT OPERATOR FEP POLTKETTLE OPERATOR FEP VET FINISHING OPERATOR FEP DISPERSION OPERATOR FIRST LINE SUPERVISION OF ABOVE PERSONNEL (RESP - LANYON) NOTE: BHEAFVOEREANVEINTCEHRANNAGLE OBUTRO BCLOOMOMDUNISCAAMTPILOINNG(PRREOSGPRA-M,ZIVPFEELV)ILL VANT TO 2. TPHEERSOFNOALLLOVC-I8NGINJOBASI:R SAMPLING - HONTHLY SAMPLES SHOULD BE REQUIRED OF RAV DISPERSION AUTOCLAVE OPERATOR GRANULAR POLIKETTLE OPERATOR o FINE POVDER DRYER OPERATOR DISPERSION OPERATOR o FEP POLIKETTLE OPERATOR FEP VET FINISHING OPERATOR FE? DISPERSION OPERATOR (RESP - CPOOLPYOMLEYRHSER-S O-TT20ST) zS 003855-2 - RJZ:kst EID091376 0695.15 . C. A. DIKES C8 CONTROL P/ RJO.GRAA.M SCEID AJUGLEY 37, 1987 3. AERQEUAIPMC-E8NTTN(eA.gI.R, MOFNINIETORPIONVGDER- ADSRYENRESE)DEADNDBYTOARERAESAPRONODUNDTOCRHIITGIHCALLEVELS NOTED VITH PERSONAL SAMPLES (RESP - CPOOLPYOMLEHRESRS- O-TTPOST) NOTE: EINNOUGEGNHERPAELR,SONVAELARSEAMTPALKEISNG FAR TOO MANY AREA SAMPLES AND NOT 4. DLEOVCEULNSENT(APTEIROSNONA-LEXSPAMLPALNEASTIOONNLSY)OFABROEVASEONSSOXANODF ATHCETIOANELRE(S0P.O56NSEHZBF)OR AIR REQUIRE (RES - TPHOPLRYOMVEERHSEN-TOTITN THE DIVISION'S ENVIRONMENTAL SAMPLING BOOKS COPOLYHERS - POST) D. C-8 CONTROL LEVELS 1. ELESVTEALBSLISH(RMEASXPIM-UMG. SAL.FEKEC-N8NEDIYN B-LOHOADSKEALNLD)C-8 IN DRINKING VATER NOTE: OONFCETAIASSLAEFEVELLEVVIELLLISBEESRTEAQBULIIRSEEDEDT,O TBHEOSREEMOPVEERDSOFNRNOEML TEHXECEEEXDIPNOGSUSROEX AREA II. PROCESS CHANGES A. CIHMAPMLBEEMRESNTWOURSEKSOF(PRUESRPCHA-SEPDOLLYIMQEURSID-C-C8RUMAS IS BEING DONE AT DORDRECHT AND COPOLYMERS - HERRIDGE) B. NEV SURFACTANTS 1. BTUBSSIANEISNSFNEEPED-SREJDUUSCTEIFYPRIFOURRITTHYERONUSTEHI(SQUPARLOIGTRYAMANTDOCOTSHTE)POI(NRTESV?HE-RE HERRIDGE) 2. CN-E9W, SCUR-F1A0C,TACN-T1S2. - No ENVIRONMENTAL LINITS ARE PLACED ON THE USE OF . C-8 RECOVERY 1. FPIRNOECESPSOVDBEYR4D0R87YER(VREENSTP -- SDCEHVNEELIODPERB)ASIC DATA TO IDENTIFY RECOVERY 2. FEP AQUEOUS STREAMS - APPLY ABOVE TECHNOLOGY IF ECONOMICAL (RESP - SCHNEIDER) D. LUBECK VATER DISTRICT CONTAMINATION z 1. ELIMINATE SUPERNATE PONDS - GOAL IS NOVEMBER 1987 (RESP - FLENSBORG) 2. DETERMINE MODE OF CONTAMINATION (RESP - STEVART) g At0t0a38c5h5m-e3nt-s RZikst 006.15 EID091377 23 000.17 (  a E. 1. ou PONT of NEMours & Company ae sr souruen rosuETs aEmaRTIENT CC: UR.S.V."EMAenRaetglioovnicThi,tJMS3 aPdhiilcahdeelpshita,sPdA"g, 19107 W6GY3r2e1gDIYEH.ennegorefsro,lnatASveuerpneuRreev.siosuorrces Parkersburg, WV 26101 RETURNCERRTEICFEIIEPDT MRAEIQLUES=TED duly 30, 1987 WHeY. DiDvaivsiidonW. ofRoWbiantseorn,ResCohuirecfes C1h20a1rleGsrteoenn,briNeesrtSVtirregeitnia 25311 Attention: Industrial Waste Section : Dear Hr. Robinson: Ref: CPoenrsaoiltidKao.teWdV0P0e0r1mi2t79WV/NPOES dPaetreadit7K/o7d/i8f7ication No. 5, ModificatiTohnisanldetSteerctifsontoD.1comopflyWVwPietrhmiIttemNo,3 o[fWLt-h6e282r-e8f2e,renicneforPmeirnmgityou of a ptlhaennweadstephmysaitcearlialchadnigseposaetdouorf PflnanOtrywhRiucnhLwainldlfilrle.sult in'a minor change in non-hazardTohuesmastleurdfgaelatnod bdeirtdisfproosmedcloofsiwnigllthbreeeapapnraoexrionbaitceldyige7s1t0i0ontonpsondosf. Tshleudgseludagned dtierstt wrielslultbse abryersohaadwnin(0opTeanv-lteop1tartatialcehresd.. Transportation of the Please call ma on 863-4271 1f you have any questions. Wz Very truly yours, - A. c. ston Environaental Control Consultant Washington Works Ahtotnachaent - 16604-1 : | g acres rinas ron serves uving EIDO007534 L689 ! ~ BLE 1 SLUDGE TEST RESULTS the easterAnnaloysstfs(oupf arivceorm)pospiotned ssahmopwleed otbhteaifnoeldlowfirnogm trweeslulvtes:locations within , COMPOSITE SAMPLE COMPOSITION (ORY WEIGHT BASIS) TrFliutoornogolymers ZAimnaensiun perfluarooctanaate (FC-143) ChIlnoorrgiadneic fluoride 153..76%% 8475ppomm 2260 ppppmm ~ *fnsoludle, at about background level : . shown below: The sludge tested non-hazardous by the RCRA EP toxicity test as P TOXICITY TEST Hetal Concentration (ppm) RCRA Liatts (pon ABarrsieunmic Cadaium 0a.006 <0.1 1005..00 10 CLheraodatum <00..55 Nercury <0.008 55.00 0:2 SSetlievneirum <01.08 51.00 1604-3 : 0oniig 3: EIDO007535 000529 z ( sme wa weno sma owHineoeauysrniharigane aBesarmania sBwaoabmiimseson sa Fax (612)733-1773 "es or -- am FACSINILE TRANSHISSION INPORMATION suET sace_Noy 20,197 web4er avcancton_Binsy Kirradiopn RW. Rickarel Ph.D. tocatton_Hasell LAR ~~ _ Pax wo. 302-366-5207 Special Instructions or Information: ORIGINATOR'S NAME Cpls foe Telephone nusber to verify complete transaission, of to relate problens: GIJ 733-3LTT . Qoaiis ID071428 - SHEEaRsR,E . 3M Megical Department Tosicowgy ---- i R ener R 6 GastB ,eseo Np 1tP 1.s8 Tfin Atoway 3I T9 uhr E sPeeIn eItepLm onEe TconuRraLsnioinT,rEegust6ing th ERR RG HEI DTfL PnheiEEeeTtnrcAElyoRsedSemaatetrsitalt S os ainikcelsudeS lDdr.oR SpykheTseL'L gyBOcatRoatbeS erCh2p9,N1M5h87eitme,mogh aE pErobpeiTr SaebrTaaiL kientioTieseonmuREelrsun eaistTaeSefLr rinnse e1sshae StTA tatUaInIniyt, sI Rntoeunr RtErnAnrhTReaFAiTrseSi31AatghS eAaoTrf e eshnri, erpr7ss TEhesmmRtr Sn LHAn IITLR ET SLTLnE BmATUT Tsar mh "final youdraf t searebing rm TELL report," mailed too uyFoouoivraitnah,nta tSMaacyt1ae2d, u19lg8e6s, cofoRvehRre enclosure includes pages 15, 16, 22 ane 23. Ve discussed the statistical analysis of the incidence of lerdis a T TFOrmTEeShtSaTeAdRRW TeAR aLII dS ST h ehnT ]see at Faskell, 880 control rats in Charles River CD Mat, 24 mont: ID071429 PRaogbeert2 G. Get, DLV.M. November 30, 1587 uLnguese4e8lvtaos tfihned cnaoneLeiyndihgeceFlCl-16a3densotmuadsy. inThSealeMasrkaetsllofdat2ka mionnths Rsi$v5earcherdepoforrt ysoiunrceiynooursbsrtoiuognh.t iI tboelioeuvreatytoeunthiaovne.the Charles EEnlcrlodo,nedPha.lDe,o 3a RanikeerxtrLaacbtoraftroormieas.tripherepionrftorapsrteipoanredprbeysen8.tedV. S0oiltheScmeenectminengnointedCeritnaitnhleyToCf-1Li3ntehriegshsdaorsereagntirmdasls.the Leyeis AFsevielwucuosfsesdlidvietsh ryooau btyhistelsetpubdoynea,ndveanyfaeAlddtihtaitonaalnysefcutritohneirng of SCalaufaaetsancsehouilndthbiesdomnaetteurn.der your guidance. Ve thank you for cVeontnreucsttioynouvitvhillthissubaaidtdiytoiuornslstactoenmseunlttatfoiron feiens thfeor tsaesrevimcaensnerin hetore. DIrn. suSmymkeesr.y, pIlfeaysoeu nfeosadl farneye ftuortdhiesrcudsoscutmheinstsrefproormtovuirthfiles, Plesse 16% me knov. Thank you again for your assistance. Sincerely, oSelniyor Togxiicoorlio aSpieecialist Digleasce of the American Board of Toxicology nop:n (18105 2.8) Melosures: 1) MOecmtoobGerreg29,Syk1e5s8,1 D.V.M. to Charles Reinhardt, M.D. 2) 31)) TE3wr1otrpaaYcgeteaserdOorpfealVseosl(uDaifeerto)m1 Letter Gerry Kennedy oMTaofyxic1i2,ty/1C9a86rcidnroagftenicity to Roger Perxine October ... 16, First 3967 5) 1E5x8t7ract of Memo 8. V. Kired to E. H. Erickson November 17, dei 6H.asLkoelKleLnaebtoyr,atoJrr.y RNeiwtaornk,RoDaEd,129.702.4 Sox 50 X.enoD.s King, DVN, Ph.D. ; Po. Box 5008 North Branch, RI 08876 EIDO71430 : QELS 000371 25 AR) rn--ae-- DEPARr TIsENT e oOi rFwNeAaTaTrEURiAAns eLoemRsEaSOURCES Cont ee a1 no[ unnroLrEsoTa Noun parsons December 17, 1987 Suiey Sater: MEr1. 2TAc.odruCp.oProHanuttsetddoen Nemours & Com.pany PBLLAANNTT FFIiLeEcory 007 srunvg PP.a0r.kerBsobxur1g2,17WW 26102 = ~3 RE: VDartyeNorR.unPoTlLWlaLua-td6i2o48n131-8C2o(nHtorodolCoP.e)rm#itY Hottfication Ror | Deas tr. Huston: This serves as Modification No. 1 for che above referenced facility. This mSCtoohednrpseitefeiomfcb(ae3)tnrioona1n-n3h,aaeizrs1ao9rb5gdi7rocaunTsdteieqgduseeTspsuuttlriigsoeaunga4nppntdeornmdStiisorsesya,ioounWrthheilcceoHthatdVseiIrhssLipLonvogeferoesnoJufuWllotyarpkp3rsr0e,oaxfia1ac9tat8hti7efeelacyynl.dos7u,r1e00of Should you have any questions regarding the above information, please do mot hesitate to contact John Britvec, Geologist at (304) 366-5880. Very truly yours, QD. W.uRobinrdoln,iCchieefnm DWR/ib/me ces GCriengdyHNeansgeeer,r, SuTpavs.s. 0003.55 8 EIDOS1114 26 0605.25 : . nar mv am QP aa E. I. ou PonT DE NEMOURS & CoMPANY WILMINGTON, DELAWARE 19898 RCW. HICHAUD, FBR CC: D. G. WIKA, PPD W. H. MARTIN, FIBR K. D. DASTUR, C&P R. Z. FORTNEY, INTL D. P. GLESSON, PPD April 27, 1988 0: 05.. HL.AYADSAHRIB,Y, "SDHUIMPIOZNUTWOTROKKSY,O JAPAN GRRC.C 0JL... KLZIAEPNNFYNEOELND,,Y,`WWAHASASHSHKIIENNLGGLTTOONNLAWWBOORRKKSS A. E. MORRIS, CHAMBERS WORKS 20k 7. WOLCOTT, FAYETTEVILLE K. J. HUISMAN, DORDRECHT J. P. BOLLMEIER, EXPERIMENTAL STA. FROM: H. A. SHITH Aldi AMPMOENIURM FLUOROO(CC-8T)FOALLNOW-OUPAMETETIENG Ref: H. A. Smith to R. D. Lanyon, et al, 2/29/88 A meeting to review our progress and path forward will be held: Date: Wednesday, June 29, 1988 Time: 8:00 a.m. - 4:30 p.m. Lunch will be provided Place: Kent Room Hotel du Pont. We will be discussing: o Strategy for managing C-8 in the workplace. o Strategy for managing C-8 fn the community. Future program regarding C-8 fn blood - monitoring and goals. Please cone prepared to discuss and share fnfornation on the following: 3 1. Your personnel air monitoring results grouped by jobs. ~ : 2. Practices implemented to minimize skin contact. 0004.77 serren reinas rom serEn Living EID079641 . 0. L. DARBY, ET AL -2- pri 27, 1088 3. Aassufmolmlaorwys:of your C-8 fn blood data If you have any. Summarize ob % Number of employees at a level of 0.5 ppm or less. ed % Number of employees ata Tevel of 1 ppm or Tess. % Number of employees at a evel of ppm or Tess. % Nunber of employees at a level of 10 ppm or Tess. % Number of employees at a level of above 10 ppm. Door ntooot sopvaerrcweortkoyboeurofblroeoadldavtaal.ue, need to over focus on this subject Idfofntotfhsinogf wqiutehstiiot.nabWlee at this tine. dvoaluneot 4. DTohees CyEoGur(CsoimtmeunmieteytEtxhpiossugrueidGueildienlei?ne) for C-8 fs 0.3 ug/m3. 5. Aetney. information available on C-8 in groundwater, public waters, 1988 reAfleccotpiyngofth3e'sreslualttesstoMfSDtSheiarndlToonxg-itceirtmy attached. S(utmwmo-ayreyarS)heertatdafteeeddinFgebrsutaurdyy is AtHtAaS/c1hsaent A, trit ah 2 2 PY EID079642 27 000429 . INTEROFFICE MEMORANDUH FDraotme:: a2PL9NA-TYAHTuOIsWS-19J.88(0T3o:ur4)3mFLAYTIS oeTeplesNo: 3PP0O4--33F6D3-2775 TO: Roger J. Zipfel Czere > CcCc: SJAoLmTEELR.caSuTEMART ScTrEuAeA)RT Subject: Test Results - C8 In Groundwater bLSeeafvmoeprllesMeaswrsyreweientJiaSnniugaebmUttiihhtleeeodnLuesautiaanalrttHarEySesLpaemarpst:leeplsabe.reptchaounosfeed oustrhheemweraensstuolsrtuisrnpgrliisssetrdeadgmrybaenliohwe sbhfeoerreattbheiinwialter Sample Description s82i12zeDr,ink"1i4n5g00 Fountain Ls/u1b2e/c8ks,Wat1e7r:00- Playtis Home L8evel none detected 2.2 ppb RLiittetnloeurHoHcokmien,g 5Ha/t1e2r/88= T5e/s1t1/2W8e,is 1#312070 $Le1t0a8rs8,Uppieirr00Pong L5/o1t0a/r8t9,Low1e1r100Pong none detected 1.5 poo 1.6 oom 2.2 gon 0081.50 + 2 3: EIDO790%0 | INTEROFFICE MEMORANDUM FDraotme:: TDeelpt:No: To: Roger J. Zipfel CCCC:: WJAOLHTNERE.M.CRSUMTEWART Subject: Test Results = C8 In Water A3N0T-HJOaNnY-19J.89 [0TO1N:Y1]8pmPLAYTIS PPPLDA-YSTPIDS 304-363-2775 ZIPFEL ) SCTREWWMAR)T ) samplTehsefofrolmloowniintgorirnegsulCt8s ihnavleocableenwatreerceisvoeudrcefsr.om TEhSeLyfohradthae tNeorvreimbbleer time 3greetticnognfitdheenitr atnhaatlystihseytonogwivkenowthwehantececsasuasreyd ltehveeilr dofifsfeincsuilttiiveist.y, but they Sample Description 200CO 1812/122/8D8r,in1k5i:n4g5Fountain none detected T1e1s/t4/8W8e,ll 08#:2370 1.3 1L1u/b2e/c8k8,Wat1e7r:00- Playtis Home 1.4 RLiittetnloeurHoHcokmien,g 1W1a/t7e/r88-, 06:00 ncootntpaomsisniabtleed sample, analysis . 0esiin EID079089 | INTEROFFICE MEMORANDUM TO: ANTHONY J. [TONY] PLAYTIS DFartoems: DTeepltsNot W3I1L-LMIaAyM-19E89CRA1W0L:E5Y4am P3CP0RO4A=-N"8LT6EE3NF-EL2O7N4*2TECH PLAYTIS ) Subject: C-8 Sampling . S2uapmgprlniantgeHetPhoehnadLvuebceldcoekscuirdseey.dstetmEhaftffoercittiCv-ie8s 13arake ony more sampling fr ntioomtmesdeneieacteteshlseya,riymupeatcotwicloolfntnisonmtueeneed stoampsalvees tthheatsaamrpelibnegingcoshte.ld ofmorthaenaLluybseicsk sshyosutledm.be AanisycaLueesck cJlyoa?sruDcrueepr.olnyWte,HbeadLsoeistswhaaornutttoldLmtaoaonnldiscftooionrtcionntutheienuiteompastcoatmptolafkeeHtwahateteerSruWpeeslralnmaptlNeoe.sPo2asr7douonnda ll on a monthly basis, Please call me if you have any questions. Thanks, Bill. 060535 ~ =5 EIDO79087 30 0001.25 HE.onkIs. BDAURRPGOENRT DE NEMOURS & CO., INC. LASH0.INGBTOOXN1W2O1R7KS PLANT PARKERSBURG, WJ 26102 STANDBY PRESS RELEASE June 12, 1989 Du Pont's purchase of the Lubeck Public Service District (LPSD) facility on Rector Lane is progressing satisfactorily. The LPSD initiated the transaction in late 1986, offering sale to Du Pont to facilitate relocation of the LPSD's well field to a larger location to meet their forecast increased demands. After careful study, Du Pont agreed to purchase the wells to obtain additional process water and real estate to facilitate current and future Plant operations. The Plant has provided the LPSO with information to include in its response to a request from the West Virginia Public Service Commission for groundwater analytical data. Information has been provided from testing that has taken place in compliance with requirements of the permitting process of the Resource Conservation and Recovery Act (RCRA). This includes a test well that is the Plant's well closest to the LPSD wells. Additionally, since the mid-19703, samples have been taken to ensure that Plant operations are hot adversely affecting water quality. We believe that the data indicate that the water is safe and reliable. . --more- 000535. ~ EIDO79154 ou PONT 6/6/89 STANDBY GE 2 Both the LPSD and Washington Works agree that Du Pont's purchase of the LPSD wells will benefit both LPSD customers and Du Pont. The sale of the property will enable the LPSD to make a transition to its new facility more quickly and to reduce the cost increase to its customers. Benefits to the Plant include additional real estate adjoining the warehouse where products are stored, improving traffic flow and alleviating congestion around the warehouse. The water wells located on the property will also help fill the Plant's increasing needs for process water. Additionally, the purchase will allow the Plant to delay expansion of its well system on Blennerhassett Island. EDITORIAL CONTACT: HP.LAN0.T RSAUMPSEERYINTENDENT W3A0S4H-I8N6G3T-O2N739WORKS PLANT eos | EIDOT91SS (Background InQfuoersmtaitioonns afonrd APnlsanwtersMedia Contacts) surfAac:tanItt-'--saadnetaemrmgoeninutm-liskaeltmaotferaiafllsuorinated carboxylic acid. It is a 2.0: Hhat does Washinaton Works use FC-143 for? inclAud:e aItppliiscautseidonsin inthethmeanfuifealcdtsuroef mofediTceifnleo,nk.spacEen,d utsheessoefmiTceonfdluocntkor industry, and non-stick cookware. 3. 0: Is FC-143 harmrul? ratsAihaveThedemiosnssuteraitsedconthcaetntirtatiison-sl-ihgohwtlmyuchto amnoddwehreant.elyAntiomxaicl. stuIndietshesweith aSnaifmeatly DsattuadieSsh,eetth(eMrSeDSw)asnoantesinhduimcaantiosnkinof irlirvietratitoonxsi,cittye.arinTgh,e Maantderial ardevseprisreatoerfyfecdtisocnomefmorptloyweiethhoevaelrt-hexapsossoucrieast.ed wHiowtehveFrC,-14t3heerxepohsausreb.een no 4. 0: Hou lona has Washinton Works been using FC-1432 AL Since August of 1951, nearly 38 years. S. Qi Where does FC-143 come from? DataA:SheWete p(uMrScDSh)aseaviatilfarbolme 3tMo Cyoorupotrhaattiogni,vesanda gtohoedresuismmaarMyatoefriiatls Safety properties. 6. 0: uhy were vou sampling for FC-1432 by 3AMithHate bietgahnadtbeesetningfoeunmdplotyoeeasccufomrulaFtCe-14i3n hinuma1n979blwohode.n weHewearleso informed uisneidt.iated a program in 1983 to track FC-143 outside the areas where it was d7r.in0k: ieAt the 1-2 pob level, wil it sccumulate in the blood of those who techAni:calHeJudodgmneontt hatvhaet thite wionuflodrmanottionacctuomucloantfeirmat itt,hesbeutloiwt liesveolusr. 0095.PA3R.8. N EID079156 8. 0: why does it accumulate in the blood of humans? res A:not Wereaddoinl'yt processes of the hpduremecaconimspoebsloedyy,.knroeawItctt,ihse ormeexcpbheralenalikesdmd.ofwrnomWeintdhoeihekmondobswiolstoihgoaiwticpai:lt 2.0: Uhat is the allowable safe Limit in drinking water> TS(hXaiPcsOcASeUwipTatEsabDlWuceearlPecoenuxtlptaoosthueaordscecucbryLailmvcciiuotaln)avteterfhdeotrindagoruisrnatkfheipenlagdlneatvoiefllwyo2rdokfLoeisrteSse,rpbspasbteodfoarnonedqrbuuiinvkBeiornnegensswatAdeeorrs.e if APPropriate reductions were then incorporated as safeotfywaftaecrtorpse.r dey 1t0h.e0se: uhoTo aurheatexpleovseeld htoas Tt itacbeesnhemePaisaunrrsed to accumulate- in the blood of t3thes5eApiloemvHeeolrsh.laovweerd.eteTchteerde lheavselsbeeunp ntoo a3d3vepprms,e wefiftehcta osnigenimfpilcoapnets pheermcsenntaogfe 11.0: How often is the blood of emplovees monitored for Fe-1432 LFcCIa-n1ct4tAi3iLn.cueesEvC0eoarnnmydsoinspoitrttehoonecrtreduwytrioeeatsrha.fffoiuorrrm WoactschheuipnaagtdtieooqnnuaalcWyorhkoefsaltoeuhmrplsopcaeynredseaosrndewelh,o pwmroeortkescltewisiotnh 12.0: How did FC-143 get into the LPSD water system? TTahhoerseesw8ua:lspttoeWnodefsibsDweuelsrinePeiovpnepctel'doisstetCdocooruaiplnnodort1ah9hte8aer8veEDaunncvdoiPmroreonentpfmlreasoncimtetadetlhwfrPioerotelhidocminyes-,tpsaoilstaelc,ocroilenlceiscsitoinocnhetaposnonenedssw.as 12. 0: What are you doing to reduce FC-143 emissions from vour plant> but AtLo dpluarnisn.g cWHoeem'phlayarveewictauhrprreConotgrlrpyaomraitnteo croeemndpvulicireaonnmcaieerntwaieltmhisdsiailrloencstrieoggnouislnagwt.eoriynntaerveeqoupseidrrdaeitmrieionontssa,l the last quarter of 1989 (at a cost of $3,800,000), and we are also studying means to remove FC-143 from waseeuarer. . zgg 000325 \ EIDO79157 1T8e.d7i0ce: tLhfe tahiresatnudffusitsernoetnhTsasrimafnusls,whyarevouspendinganymoney to eefmfiescAstiiso,nsltitbycoirnsetdoiuunrcuteisionntteonotfbewtaoDsytmeiP.noinmti'Ezsveenpoelxtiphcooysuugrhteo thmheiincmihamtiezcreoiuala:dquhceaaosuusseneaCnokdnncoaweinrrn (11 associated with accumulation in the blood. D1u3.0P:ont'sIsputrhcehapsreeseofnceLPoSfD FwCe-l1l4s3anidn ptrhoevercLPySD wsadtiesrcenstysttoem thteheFiroesarsosn for PUrseeseAon:ft.tWheelweaodundleidetdiohnaaanvleamdradedialteioetnshatelatpewu.erlclhAawdsadetietwrihoentsahuieplrpyl,yo,r tanhneodtpwuterhcewhiaFlsCle-1m4aa3lklewoawssgooude to delay the expansion of our well system on Blennerhassect Island. 16. Q: What was detected in the water system? cthhainoAr2:i4d0eAsc--ofumuaplosluncsdocsna,dluecutsoeifdn.gnoUrA.mSda.dlitwEiaPotAnearmlolntyie,tsotrstih-ne-gswuacrtheeqruasiwraefsmoernatnhsaalrydfoznreesdsgrfooarunndmdousrteer Foafrsoma17 rtmehaeftemreoernriceael,sthwaunenrdee2r40detmthaeectteReredis.aolusrcTehtehasCteonwsreeerrsevualttaisnoanldyozaenndod,t RoerncelopyvreerstyernatAccetaqcu(oaRnnOcRteAir}tn.i.es `e2s.t0e:n? Hou long have vou known FC-143 was present in the Lubeck Water A Since 1983. 18. 0: bhy have you not made this information public knowledae until now? founAd: wasAt 30thaltow-t-icmel,oswee twoertehenodtetseucrteionof litmhiet.findHiengdsi,d level to be a health problem. nsoitnceregtaherdletvheel 19.0: Isn't this a female reproductive concern? bFuCt-14Am3:o,reNboue.txtweinItsnhiivtietahleteostrteiisgntigsnabdlyemo3tMnesswttiirtnahgtedprraottcsheadtiunrdtehi.ecatperdoblaemcawuasse nfootr wciotnchern, 20. Q: What is Ou Pont paving for the wells? Ar $1.8 million. . z g 006515. EID079158 LOCATION OF DU PONT WELL 27 ATTACHMENT 1 LUBECK PUBLIC SERVICE DISTRICT WELL FIELD | |A -- . QQ ~ S - 9S>--__ S E5N / . TN / LL 3 ' : . ; i QU // ~ "oe, ss JI 1 * oS; x 0, <2 98 3 a/ 8 a ! 3 2i . / 5 ~.TTR bog . ax Sy 2 $3 alg = 8 83 Sn aS&N x3 3 In 3 |[= TR . & "8 sa) EE Sa ch oiyD $30 | 40) H-- |L-- . TY --- TT AFmRT Ct mo . Yi 183 ~ smi ete EERE ti} | 32 | 0003.23 | - ST EEN POR => u oH : DEOPSVraATOOEIFFoRWFNAwSATeTTEsURtIRRvEAMiSLROORGUEERiCASNEOSNU.RCTES Gast`oGonvceamaprenton Cras2a0si7n:GreaasrarvergSaat3531 June 21, 1989 gRANTFiLECOPE, 4. EoWADRiDrecHtAoMrRICK 1 Mr. A. C. Huston goror-t.2 uaowepvuwty.Dcireeoctnaare E..'10.. BDouxPon1t217de Nemours & Co., Inc. Fike 2303 Parkersburg, WV 26102 ' CERTIFIED RETURN RECEIPT REQUESTED Dear Mr. Huston: RE: West Virginia Solid Waste MIPaeWnrLam-gi6t2e8m2eN-un8mt2beRraesng:dula3t49i4ons As you should be aware, the West Virginia Department of Natural Resources (DNR) filed Title 47, Series 38, "Solid Waste Management Regulations", which became effective on November 4, n1o98t8ifi(coantiaonnemtehragtenycoyurbafsaicsi)l.ityTwhiisll lneottwerbewiglolversneerdvebyas these regulations and to inform vou of what you will be required to do to comply with these regulations. The regulations specify that all solid wastedisposal facilities must have a liner under the site and that the liner system must include a subbase, leachate composite liner (compacted clay topped with a detection synthetic zone, liner), and the leachate collection with a protective regulations also acknowledge the fact cover zone. However, that existing landfills may not have the specified liner system in place. To allow paerpmriotvtiesei for the continued operation omnayhaspetbieteinonintchleudeddireicntotrhe of existing toregaulllaotwiounsse facilities, owfhearnebyaltaernate rcseuysrsotrueemrn.ctelsy.Theemplpoeyteidtiosnysmtuesmtwiilnlclupdreoviadedempornosttercattiioonnofthgatroutnhdewater The division wishes to begin reviewing these proposals as psrooopnosaaslsposfsoirblteh.e gWriotuhndwtahtiesr inprmoitnedc,tioynoudeamreonsrterqautiiroends ttoosutbhemit dSDoielvmiiodsnisotWnrasattoefionMWaatnmeaurgsetmRebenestousrRucebegmsuiltatbteyidoJnwusil.tyh 3Ty1,ohuer19r8ae9spuplultsisicantgoifotnyheoufrEormergency permit renewal expires within or Permit Application six (6) months of the Addendum unless your permit date of this letter in which 0081.44 EID007493 . MPEa.geA.TwoC. Huston eixntsetnasnicoenthtoisaalgleonwcya wrielalsoneanbtleertatiinmeaperreiqoudesttofcoormpalepteermitthe anlelcesaslalroywandceemsonsetxrhaatuisotne.d foIrf eyoxutrenspieornmitashapsrovaildreedadybyexsptiartuetde,and Tyhoiusaraegenacdyviwsieldl teoxeecxupteedietnifoourscleymesnutbmditiscyroeutriodnesmonisntrtahteisoens. instances. yThoeu apnudrpotshee odfivissoiloincittihnagt ptrheopodseamlosnstnroawtiiosntowilalssbuereabcoctehptable pcroimoprliatnoceit`sscihneidtuilaetifoonr. comTpheletpiroonposoaflthsehoudledmoncsotnrtaatiinona. cSohnotuladctyMoru. rJeoqhunireG. fBurritthveercionfformatpyi;sotnafforatas(s3i04s)tan3c6e6-5p8l8e0a.se veyq Kruly yours, LEM: bw Laidley/E11ChiMcecfoy, 4, - 009545 EID007494 33 0005.16 INTEROFFICE MEMORANDUM DFartoems: DTeeplt:No: A3N0T-HJOuNnY-19J.89 [T0O3N:Y5]1pmPLAYTIS PLAYTIS P3P0O4~-S8P6D3-2775 TO: WILLIAM E CRAWLEY CRAWLEME ) CCCC:: WJAOLHTNERE.M.CRUSMTEWART CCCC:: BRiolglerTiJ.ceZipfel ( CSRTWEMWART ) TICE ) ZIPFEL ) Subject: C8 In Water Test Results From ESL SAMPLE test well 27, 5/4/89 P12 drinking fountain, 5/6/89 Lubeck Water (Playtis), 5/7/89 5L/i4t/t8le9 Hocking Water (Ritenour) SAMPLE Letart * = ** + *+ + * upper lower upper lower upper lower ulpopweerr lupopweerr upper lower pond, 11/23/88 *, * * , 12/30/88 *, * * , 1/24/89 +, * ** ,,2/20+/89 +* ,, 3/17/89 * , ar25/89 =, * PPB C8 0.44 none detected 0.73 cnootntapmoisnsaitbelde sample, analysis eemMce 4.2 2.3 0.96 1.5 3.2 3.1 11..92 11.a1 0.49 1.5 030i EID079124 34 0004.15 INTEROFFICE MEMORANDUM } FDraotme:: HBaUAaMRuGOAgLR1DKsE,B6U0NG0AR8NEsRt 1! TdeelpteNo: P(o30k4e)r 8d63s-e4rv7i9c6es i: "0: SEE BELOW i Subject: LOWER POND LEAKAGE ORY RUN NTO THEFOBALNLKOWI10N.GLOOUCRATIENSATNRDUCRTEIPOANISR, THBEOSOLEADKR.AINETDHISTHEMETLHOOWDEROFPONRDE,PAITRH.ENUSUIGNG VJEEILNDVTEIONNNTIOTEIA0NDCLTAHHYEE WWWAOASSRKARBOELNCEOM8/MT2E0.'NDDIEGDTHETBYHRPTOAHUTEHGHOW.FITWVAAA.NTDERSOPTIALHCKROCUOTGHNHESERHTVHOEALETIGAORNNODUNSADEDRVJWIAACCSEE.NVTERAYREAS IETPHAIRTEHDE GCULTATPR(OHEOFUWSIELDL RETQoUkIROEF PBEORTMOINTTIITNEG).THEWEPAORNED TCOONFRIEDFEINLTL WiITHLERAAKIN1W5ATER. HTEX WAEMEOKUSNTAGOOF." ALGBAUET WPREES0E0NT,SEEBAALSGEDAEONSOAPBPOESAORAWNICLEL, PUITS AREDSUHCAELDL AOMVOEURNTWHOAFT WTEHEHAD 0OPPIENRCRESAWUSELEFAHTA1EV7ESAVLAOGSLAKUEEMCDEI.D8E050HIENTOTIHNERTEENMPDOOSVNEDTAOTSHEDOISTTEHTFITILSLLESDW.ORSKOLOIDVSERFTRHOEM NTHEEXTUFPEPWERDAPYOSN.D ROM THISYOAPKONDT.ELLSTHEMEATUHGAUTSTHISSAMPSLAEMPLWEILLREPIONRDTICAFTOER JTUHLEYSWUICLCLESSSHOOFW TNOHESFELOW ODIFICATIONS. istribution: 00: RFEJLIXYORDKAVIS, R. 000::: RRiOolGgEeyRkTC0.[.GAGCUaLArRnLeSrEN C: PENNY C MAHONEY C: AWrAtLhTuErR MC.. S[TArEtW]ARTHuston, Jr. YDAOVRIS)E CGGAAARURLLNSREEERRL) ) HAHONERC ) SHUTSETWOANRT) ) Geigy ' EIDO14083 ' 35 0001.50 INTEROFFICE MEMORANDUM FrDaotme:: TDeelptsNot A1N2T-HAOpNrY-19J9.0 T0O2N:Y4]5pmPLAYTIS PPLPAOV-TEIRS 304-863-2228 TTOO:: PCEhaNrNlYesC MT.AHOANltEY TO: WALTER M. STEWART C AMATRO)NEPC ( STaMART Subjects C8 At Ory Run Attached are results for various water samples taken at the Dry Run cLhaoannndcdfe-irdlnrlea.dwnabmToahupet. nCu8mIbelaressakcehdriefnJegirmouYttoaakovfartiotohuetsamkasettertrehiaeamslesastmaapkmlepnilnegsoutlboecocfaatuistoehnesITwneoaftsleodnkon my dSou' pseormneateaddbiatnidonsailtest.estiSnign.ce some of these results are nonzers, we may want t 000.5% EDosors? INTEROFFICE MEMORANDUM dFartoems: TDeelptsNo: 9P2e-tAeprr-01.990Spo0h8n:50am SPPPODH-NSPPDD. 863-4732 TO: ANTHONY J. [TONY] PLAYTIS PLAYTIS ) Subject: Ory Run C8 Analyses Here are the results: SOa.mRp.#l1e DDI.RR..##23 DDILRRI.%#4S c1o.m6C8 00..00 0o.l6a These values were calculated from the area of the peaks. 00953 EID0S0168 : drieCenacnena,treFo haat pos sive) Lnoweer si ec, Cg GATTO ce oRrHED Dam NR | @ seeenca(pao fous) N Niger eo gy, ~ , & sR&d a Toe,=,Te NTs "5,"nc, uy, "iVe es coe Gfiogrs perm rom mires 039125 5 a. NN Uyv O EID08016 | CO TER LE RETIRE a EE EAT ERR SUPERNATE SLUDGE TO LETART LANDFILL ~ * :- . (Latter, stevart to Robertson, August 23, 1990) FouHtaBS:oriRamsXaey Br EE BCC: J. B. Allen, Legal C. F. Muska, Wilmington g `C. C. Chien, Louviers. ".... 13 f . M. S. Eaton C. R. Campbell F. Davis . L. W. Goin L. K. Ireland A. C. Sobrero W. E. Crawley " a - + BN T255E8: GSSiaemmemer : "Routae'to:! --rTTR : dFt .C.m Manoney 20un Rese tag TELE Jets Erhiresd Er oy wn Conid. ae i wa: R To. E - Be EID0S1924 } ER SEER ERR hRs a CEl ERe E E es @UPIRD E. |. ou PONT DE NEMOURS & COMPANY roe eera~S_ EE i oMe iers August 23, 1990 Mr. Max Robertson, Acting Chief Waste Management Section GRT A a: eRoLate C ter, uA ston htoesReoubricnssan, 7/30/47 Latter, Huston to Robinson, 9/15/87 Letter, Robinson to Huston, 12/17/87 Eh i NPDES Permit Application: WV0076066 base He. Robertson: Permit Number: 3495 Tfhliusorolpeotltyemreriscotontaimnifnoartmedyousluodfgeourfroimntoeunrt tDoryrReulnocaltaendfill to the Letart landfill. It is our site policy to segregate fluoropolymer waste from other aplllantofwatshteesflduuoerotpoolfyimreer vpaostteen,tiawle. wiIlnlabneefrfeolrotcattiongconsolidate aiptpsrocxuirmraetnetlylo7c,a0t0i0ontoantsthoef nDorny-hRauznarLdaondufsilslludtogethaendLdeitratrtfrom Landfill in Mason County. This sludge is the only fluoropolymer waste known to have been disposed of in Dry Run. All other fluoropolymer waste has been disposed of in the Latart landfill. The sludge vas generated during the closure of three fluoropolymer anaercbic digestion ponds during 1968. The movement of this soil to the Dry Run landfill vas discussed with and approved by the DNR in the referenced letters (attached). We boeulrieevxiesttihnagt tLhaetavratstLaenmdfaitlelriaplermtiot.be relocated is covered under We plan on beginning this movement early in September, 1990. If you have any questions or comments, please, feel free to contact me on 863-4271. Very truly yours, Ww. Yl FN aE J Environmental Control Consultant 009135 a7| 000457 WIANSTHEIRNOGFTFIOCNEWOMREKMSORANDUM POLYMERS March 27, 1991 To: CC.. RF.. MCuasmkpabell TL.. WL.. GBoyirnd AR.. JJ.. PYolaakt,iss WH.. MDl. RStaemwsaeryt ML.. KG.. MIcrCelluansdky L. Williams From: P. C. Mahoney yh QUARTERLY C-8 RESULTS AT DRY RUN LANDFILL Awfetortuearcthhnoetdquatirastkeearnn, duup1rd9i9a0nt.gedthDfeuiegtuhtrieordsahmqouiwasircntogemrmt,uhnei1c9Ca9-t08.iornSe,asmupslltaesmspifweoesrrethe bfeaeknenredcueriivnegd.the first quarter, 1991 but the results have mot dcTaohtneatilnpeuoviiennlgtss torfietnCd-w.8ouladIppbweeialrlprteoimsabsuteeurdetehcerteoafsaiisrnssgtu,mequbautrthtisewriwtihrlelsjuulbstets ta awso soon as' they are available. 0caiis Zz EIDOSOI 72 2aooga] E<>z "z 5 2w 2Z2 8. &2 35, ooS wS 5 %3 s1 Z e aefXTso23 3 5 3 3 z=x< 3 60 5=. w3 a 8 I Ii Eig Sn Es fee C2 CoFg: CaYs 0601: EIDOS01T3 38 0601.59 st wrs A= AIM TQ C-8 ISSUES AT WASHINGTON WORKS IN A WAY THAT ALL col RNS ARE ADDRESSED SO THAT C-8 CAN BE EFFECTIVELY MANAGED AT THE SITE. AGENDA ITEM INTRODUCTION REVIEW OF AREAS AFFECTED o C-8 BALANCE FOR 1990 AIR DISPERSION MODEL RESULTS CEG STATUS, C-8 IN WATER C-8 TEST STATUS RECOMMENDATIONS FOR DETERMINING SIZE OF PLUME FROM SUPERNATE PONDS PLANS FOR TIEING IN LPSD WATER WELLS TO PLANT PROCESS WATER SYSTEM OTHER ISSUES RELOCATION OF SUPERNATE SLUDGE FROM DRY RUN LETART PERMIT 727 RESPONSIBILITY STEWART MC CLUSKY STEWART MC CLUSKY CHIEN VANDELL IRELAND GARNER MAHONEY STEWART 0035.54 EID080797 : BACKGROUND _c8 WHAT IS C-8? o AMMONIUM FC-143 PERFLUOROOCTANOATE FC-118 (20% SOLUTION) CAS NO. - 3825-26-1 WHAT IS IT USED FOR? DISPERSING AGENT - POLYMERIZATION (USED SINCE LATE 1950's OR EARLY 1960's) WHERE IS IT USED? TEFLON) POLYMERS - ALL POLYMERIZATION BATCHES TEFLON) COPOLYMERS - FEP POLYMERIZATION HOW IS IT RELEASED TO ENVIRONMENT? AIR - FINE POWDER AND FEP DRYERS WATER - DISPERSION & FEP SUPERNATE STREAMS ~ FLOAT TANKS - FEP COAGULATORS ~ POLYMERIZATION UNIT STREAMS LAND - SUPERNATE PONDS (NOW CLOSED) - SOLIDS (SOME WET) SENT TO LANDFILLS HOW TOXIC IS IT? ACUTE - MODERATE CHRONIC - TREATED AS VERY TOXIC BECAUSE C-8 BIO-ACCUMULATES IN BLOOD o AL - 1046/M3 CEG = 0.346/M3 [hew 830 (4/15/91) ' eesti EID080798 WASHINGTON WORKS SITE SUPERNATE POND AREA - CONTAMINATED SOIL - GROUNDWATER (-20 FT) WEST END OF SITE ~- GROUNDWATER (-75 FT) C-8 DETECTED LETART LANDFILL SURFACE WATER ~ LEACHATE POND OVERFLOW GROUNDWATER - OLD WELL SAMPLE ORY RUN LANDFILL . SUPERNATE SLUDGE SURFACE WATER - UPPER POND - SEDIMENTATION BASIN - DISCHARGE STREAM AT PROPERTY LINE GROUNDWATER - MONITOR WELLS PPM 100 100 PPB 2-3 Jiu] 23 2-3 Py 75-100 2-3 2-3 .04-.2 NO ecntis EID080799 Lo C-8 IN DRY RUN MANAGEMENT PLAN PROPOSAL NO. 1 - PROS LEAVE SUPERNATE SLUDGE IN PLACE, STABILIZE THE C-8 T RETARD MIGRATION BY COVERING WITH 2 FT NATIVE CLAY ~- EASY TO DO - LESS EXPENSIVE = NO TRUCKS ON HIGHWAYS = NOT A COMMUNITY ISSUE AT LETART - REDUCES SURFACE WATER CONTAMINATION LEVEL - PERMIT MODIFICATION NOT AN ISSUE CONS = MAY NOT PROTECT GROUNDWATER - SURFACE WATER CONTAMINATION MAY BE ABOVE CEG PROPOSAL NO. 2 PROS REMOVE SUPERNATE SLUDGE FROM DRY RUN AND RELOCATE THE MATERIAL TO LETART - REMOVE SOURCE FROM THE LANDFILL - REDUCES SURFACE WATER CONTAMINATION LEVEL - GROUNDWATER CONTAMINATION POTENTIAL IS REDUCED CONS ~ TRUCKS ON HIGHWAY ~ COMMUNITY ISSUE AT LETART ~ NEED PERMIT FROM WV-ONR ~ SURFACE WATER MAY STILL BE ABOVE CEG ~ GROUNDWATER MAY STILL BE CONTAMINATED = COST EXPECTED TO BE 75-100M - OTHER PERMIT ISSUES AT LETART 0Ganit EID080800 o SLaw I - | Gwaneso ~ o~ oc S a4 3 05 s =oO - =0 az 3zZ =z 3 > 8 oO oc 3 a 3 S$es g8ssc 5cS e| e 2 S| = = , a:z QT=O =&")-8"2E&=8 g.fE 2: i3=- s $c 85 83 22 `om (GPE a Qo = a 0691.25 EID080S0L 39 000155 TEMPORARY OPERATING INSTRUCTIONS 101 No. 91-6 TITLE: Relocation of supernate sludge within Dry Run Landfill AREA: Power and Services Dry Run Landfill Extent of work: 09/23/91 to 10/31/91 Objective: sluTdhgeeobtjheacttiwvaes oofrigtihnisalwloyrklanisdfitlolerdelaotcatDerytRhuensLuapnedrfnialtle tion a1n98o8t.herThelocsaltudigoen wwiiltlhinbethmeoveldandffriolml.itsThicsurrneenwtlloocactaitoinon wsilluldger.eduAclel threeapsootnaebnlteialeffoofrtlseacwihlilngbefrommadethetosucpoemrpnlaetteely remove the sludge from the existing location. SAFETY: Arlelmaisnafeitnyefrfuelcets dnuorwinign eefxfeeccuttioatn otfhetDhriys TR.u0n.IL.andfill will MSDS MSDS for for FC-143 Triton XF-L1U0O0RADis (aCt-8t)achiesd.attached. ((AAttttaacchhmmeenntt AA--12)) PPE requireSdafdeutryingglashsaensdliwintghofsidtehesshiuepledrsnate material: RLounbgberslegelvoveeds shirts Nsoupescmnoaktinegmmataetreiraila.ls will be permitted in the vicinity of the AIvfoiddustbreiasthgienngeradtuesdt dcuornitnagmintahetedexcwiatvhatitohen osrupmeronvaetmeentmatoefritahle. sludge, the sludge should be sprayed with water to reduce the dust problem. CIofortdheinadtuosrtin(gA. prJ.oblPleamytpiesr)siswtisl,l the Site Occupational be consulted. Health 0605.3 . gz EID024306 8 5 D22E3; : =43 I : sgE 8 88 K 8:v18 73 HEE : QYOY 40 C 303A HiE i Ei ' Frond {I . 009125 EID024307 Tas Rng I NG AScshe)A TIEENNNCRANRAE HEN = A STN === =~Nil] a ay=== [Ree Nl] SESSPE SET S N =~Suaae Y s Tan 2 LR) INMNS SNZSA C ZCUE R NR Emad Tf) == Ji RAKwzs2l 166120 ABJAl NULL UO 97 sm 1e (fuoises Aq| xx 8 P3 SN 7) A = EE IE HEE [Ee QE smn Brazil E iZSS &21 El 590 i2sso MAE | Wy #y (HEE wy g i: eg! 2= > |e . 82258 BI 28 z= va r= pA NN a (tasogFl z g = =. i : 40 000172 | PamWeAaSnHsPaIouN.nGG8T.0OxWNYW2O726R0K2S.27 on LB on Jp-- TLOeREe,s gor cer TLLW GEoiicnhstadeor HPlLCH. MMachColnuesyky WHI H0. RStaemwsaeryt, October 3, 1991 CONFIDENTIAL TO: JW.PB.. AANLGLEERNSO-N07-150612026 CTC. RCDC BCAHRIREYN-- N(93g34529-1 . WM..S0.. CD0E8A8K - 001112003106 M3.S.. ELAETTOTNI-NGWi- Wat0 3T00S0T! LVIANNDDEELLLL -_ 0L131a0e5e6s 0. K. VON SCARILTZ - p11030 FROM: R. J. ZIPFEL - why AV OHIO RIVER, SITEC-8TESITN WWEALTLESR, SAANMDPLENEWRESLUULBTESCK WATER SYSTEM pplraenstencseiteoTfhteeCs-t8siwtieenllcSseopntdaenumdcbteetrdh,eann1e9w9e1x.tLeunbseThicikvsePpusrbaolmgiprclaiWmnagtwaepsrrogStroyasmtfeumroftwheetlrhlesanOahflioyorzeRtihvatehre, nQTeuewavleilLfsuybeincakntohPueutbsOlihidiceoaRDtuievrePronStyasndtaneanilnwyettlihicesa,laqutToiafbgeoarrianbteonrfeyuarttfhhoerrtCh-ei8nsfiIotnrem,Vaatiatonendr otno tbheeginC-8to data (CH The results of the sampling program showed the following: 1. Non-detectible levels of C-8 fn the Ohio River upstream of the site. 2. CS-i8teleavnedlsinattheexpdeocuttefdevableuneesathfnthtehesOihtieo(R0i1dverLubdeocwknstVraetaemr oSfysttehmes walls). 3. Sweevlelns s(7h)oweodfneoing-hdtet(e8c)tirbelseultlseveflrsomotfheC-Bn.ew TLhuebeecikgWhatthersaSmpylsetemgsave a C-8 result near the lower analytical detection limit. are attachTedh.e cAonmypleqtueestdiatoanspaocnkatgheeseandrespualthtsfoorrvaortdherfroimtemtshisinsetghmiesnt of work wcroimtuenri.cation package should be directed to Penny Mahoney, Dave Ramsey or the AtRtZa:c5ham1ent . EoTsi10 . 00niz \ PRIVILEGED & CONFIDENTIAL SAMPLING PROGRAM SUMMARY OVERVIEW OF SAMPLING RESULTS SUMMARY PATH FORWARD 950-1 pani EIDO79111 :8 SAMPLING RESULTS wTeelslt W#e3l3l1 #27 Well Mi-4 OGhhiioo RRiivveerr -11 Duplicate OOhhiioo RRiivveerr --22 Duplicate OOhhifoo RRiivveerr --33 D(uNpelaricOauttefall) OOhhtioo RRiivveerr --44 Duplicate OOhhiioo RRiivveerr --55 Duplicate OOhhiioo RRiivveerr --66 Duplicate NHeeww LLuubbeecckk WWeellll --FF up] NNeeww LLuubbeecckk WWeellll --B8 Dupl 0011dd LLuubbeecckk WWeellll --11 bupl 0011dd LLuubbeecckk WWeellll --44 Dupl Tw 3% ExSptearitmieonntal (PPB C-8) <7.11 2.7 <<11 3<.19 1196.:58 53.2 42.82 <2.10 <<11 <<11 8a.18 42..92 CHM Hille (p8 C-8) poten pePslHE 0112 2e.r3e0% 02 fe NNoott DDeetteecctteedd NHoott DDeetteecctteedd 112.000 01.08 111m 00.65 NNoott DDeetteecctteedd Not0.D3etected Dest1r1oyed 01.79 75 46 * ChoowW.TI experienced analytical difficulties. Absolute nusbers may 91501/2/91 . . 009275 EIDO79112 CA ef] ING SE aE is > ETNGE a] NCH ARE LER S= PNERLE LL Hi Eee Din AE Gf) AE = ThN E Egn)EWrI, AR R = EZaS llTe2es = - - -- ; WAL NS Zs f iTVi AEs SHi RSAES E)Ri SESAetIw VNiSdesVitrI lZA pokwiidndJ l Jnl SHEfeTSSwEi STEE R NE Ns Q Ron, Ag om eee TRE ST ATR, oe Re roSggEidNd ||SEElRe E aeE ee T e SepA EE oT, eed [2 SEERA TE Tosa FN As onus oa El ef I bm HES 3) Of SE Paaas pe ATL vel 0) A mma I3pi lomntV RBY Y 77 ee . oss . [C _ Wo, A ~SEED 5 Ads [ Zerr En ! ol Teg He / oloeann I oYs LH U EN ZNNRuE: TORN TER wig[+ IE J \ B. {Le \itn SC Es 2 LET =\ m peacA e SiWh NIT IR 4 Lexmum Tue | =INAEsT BONES TIS =a IT cos resus EL Een, ~ in : oT6091 EIDO79113 --t_ gl) 4 A by, RECN W[i eZg AfrPa ET : hy AS gis TT Wi be (, ga 1 EI ERT he, { Te 7 " # hy J i 8 i a 1 ps = 2 NN _ \, K LY : He TE : 4] 43 3[i iim - SULA i| 3 Se" a wd | fiom =a & Ve UA A Xa SLE Ay ve Wh + Is Is & ne 3 - E0714 ) ) | \ RiNCE { AXE Lh Raa 5 \ 24, \. WMA M025 nl itd jf HB i |3 3 i J CA) FT = i ~i - _-- --_-- Tm . Goo EDUPNS "a C0017 | TOXICOLOGY * LIMITS - Tw - AEL = CE6A = CEGW ug/m3 100 10 0.3 = 0 5.6 0.56 0.0015 1.0 CALCULATED DOSE - REL - CEG 100 ug/day 6 ug/day . EID079258 : 009139 D-E8 TECTED WASHINGTON WORKS SITE o SUPERNATE POND AREA ~ CONTAMINATED SOIL - GROUNDWATER (-20 FT.) WEST END OF SITE - WELLS 27 & 4 - GROUNDWATER (-75 FT.) KO. 5 OUTFALL - DISCHARGE TO OHIO RIVER WASHINGTON WORKS EMPLOYEES e 1991 (VOLUNTARY TESTING) DRINKING WATER (LPSD) o 1984 - 1989 o 1991 LETARTSURLFAANCDEF= ILWLATER - LEACHATE POND OVERFLOW GROUNDWATER - WELL SAMPLES DRY RUN LANDFILL SUPERNATE SLUDGE SURFACE WATER - UPPER POND - SEDIMENTATION BASIN - DISCHARGE STREAM AT PROPERTY LINE GROUNDWATER - MONITOR WELLS *Revised analytical method . 0091.34 oH 100 100 PPB 2-4 40 BPH UP TOS PPB 0.7 -2.2 3.8% = PPM 2-3 0.05 - 0.7 PoM 75-100 2-3 2-3 0.04 - .2 PPB 2-5 EID079259 GROUNDWATER ISSUES - 1) PLANT SITE ROUTINE SAMPLE RESULTS @ VERIFICATION INVESTIGATION 2) LETART LANDFILL eo LINER DEMONSTRATION e SITE OVERVIEW o PROPOSED STRATEGY 3) DRY RUN LANDFILL o DETECTED IN DOWNGRADIENT WELLS 060485." EID079269 42 065233 &7 We N & @ 1 1F-- TBnL m Lpgme oor, 5 ro: sa3vsazion,n (oom sects cro cmmmunee g EID087668 g 009.34 g INTEROFFICE MENORANDUK DFartoem:: TDeelpt:No: J2A2M-EJSan-R19L9A3WSO1N2:23pm LPPADWSONIR 304-863-4618 10: Distribution List Subject: Great News on Surfactant tBorxuciec,itythainsd ibsiotaecrcruifmiuclanteivosn. coTmhbienefdavwoirtahblepriroerporwtosrkonshobwoithngatchuitse shauvrefaactavnitablsehocualnddibdeatseuittoabrleeplfaocreFCE8P mienanmsuchthaotf, "Tfeofrlotnh"e. firEsvetntibmeet,terv,e the candidate position. would be produced internally, improving our overall cost Waeddhiatvieonableenpowlayimteirnigzaotnionthitsesttionxgi.cityI athsisnekssmtehentfboecfusoreofcowmomrekncsihnoguld now stewsitticnhg.to oCuarn oyroguanpirzoavtiidoen.us Ovbivtihoupsoluyn,d wqeuawnitliltiense?ed pure material for Tchoentafcotcalhimpotiontdefvoerloopurouirntepratnhalfoerfvfaorrdt.s should be Roger Zipfel. Please ...3im g EID087669 2 000125 2 INTEROPPICE KEMORANDUN PDraotme:: bB2rA3uK-cEJeRaBnE-r.19A9Tm3aAkLe0r3A:T55JpLmCLOL TDeeplt:No: D54u0p-o3n4t90Chemicais T7O0:: KH.sus-pNeannceHruanPgrowse (( PHroOAWNSGEHKSaTATALALaTATicSrLoCnEO)) ) Scei: TA.imcehsar.les`Lasvoebernero (( LsRoRBSROENRTARC AATT AALL AATT WWEESS |) Subject: Co-Tas: the rest of the story Folks: -- C6-185, aGenrdry hKaevnenedsymehasgoofdinineswhse,d ahinsd bIihcaavcecunsuelmaetisoenentemsatciensg on It you'll recall, the good news (I've attached the ETmBpherieatecstwveteiieotCnnuahgs-a7n382mX3wesmaaowsn,adIs3swH5ah'n3isiodtcthiCatBmhseeaspxnrrp,oelldaaeudtsicihsntlas,ytbiivoetiaalnsciiomsniuoinsnddaeeletiyteaabditNylia)visfefirdowiemaihsnehcottehmhpeipaicattreluiCnirs6vgeo-ei;nrTtBisSiittawsasasaiied iinntothethebloliovdesrt,reabnut(caonudldRenncoet,saeyLilwihetbhieeractcwumaisntSiisnepsiy emcining finished.TheAbedtettearilendevsrepiosrtthaetn tthhee bsvleoroadllwormkceonnretheismice is Gfoerrtthycosmnianrge,d vbuitthImweantotseady!you all to be aware of the information mdEaeyOasl'DsofVsApSriEeksceasodevn"etwCriioyant,lthlryovd,lua*rriwynhiggranotguwphvl)iae:scvheldsaWoevneeowrfeyvraCese7-FdttoaahsveenfeabteneiddooCa38dl"gosriwoehumopupsprterohafiwreamsriece dsteaaeyk,'esnarsaepnsldueltpvspamsveFralsntaolrsyiozneegdo,oidn twotehesahvabellvoueonddnevthcaees,sstdaeetrseytrimanigfnoeardf.eieraknaithayiovutiiaienir.l 7 average oTfhefirveesualntisna(lisn pfporm eFalcuhordianceainpoitnhee) blaoveodssterefaasr,ioutnhse control oDfay`R"ezceorvoe"ry RDealyov7eroyf g EID087670 5 0:. 30 0.-8 0944. 5 8a ce30-TpBpsm diet 3u0rsppcma diet C3o0-018pSpm diet E 300 nppm atet 5.30 0.35 33.23 19.26 8.19 0.45 71.52 22.20 $fdZhooe.suCen8sde,vieainnnreTatatthhkieeentnghbbeellsiootnooedddcssottbmrrybeeianamnamatlieatohpnapm,neiacerCt,s5h~eTstsBoieSx.breteosaFurulnoritutnsnhedesrtamsiyoemrveteesh,natmdtohrewenhvesnhneaLleriqoeuliaiilfiec tfliumoerfirnaemele(vGeelrsry'hhsaidgchoremesmtteurncntoendwcaestnottrhtaahtteiotcn-o1nt/te2rsotlecdobualCdsoeohlraievnseembainuheowdthoast same spnhtoirctipasateodnegrdaeya;teritv'asluteosughandtosoteldlidfnrootm tthaekedaatnay bSeemcearuesse wehad dbbgoeaeetytsusweeeCeCnenh-aTt3da0as,yw.2h0ez4nerSotOheatnidmmaetdsearyimaoSlreevednoo)fe.sthleAenaCdvaefwtiihnneadlslbyl,uopodtshitneretlhaiemv'.erdiseednaoetcaonTeerree yery goon2% (IviPthromGiersreyd'saboavses,ist1a/n1c1e)b,e wanrditwiinlglupRavaecocmopnlieesteorrerpuoirst report sent to each of you when it is finished. Jim/Charlie=- Bruce I've left it to you to forward this note to other ybmoeeutmrtbeeerrnsdt.hoafnyoIuwrhoorsgpaenicziaftiicoanl,lyasis yoiuntkenroeswtmeudchan = EID087671 2 2 60518 = Hsu-an/spencer: 2shnadresinicteSwoimIte'h119y0ob0ued on"uebtvesfoorfjeutshItegionefsfoincethethiCss wheoemkoslog3uethoofmgiZeomy)liaTSS, piLenirvftelhreuowredoilGeogetchr.ttrayn(oKHvisee.cnnteaeccdsoiytndetrdjo(ulZ3s)oMt'nsysalsen"7taC8%Smfj,eu.ntcahtTepihloeCnoterotefoBsfEup.ioptmesarrcsealrnaetsreiennncccoreueorasascgeiannigyn. ivnersliiovnerAlwtoeoiktghhgetoohgdiagihrnee,rlattehinedvevoaftlouteChase. slcoaoSlkpee,cLiikfbeioctathlhliTly8!,S aantd1t00h%e Cs6ocrease cs - 13.1ppm ms 378ppm ce-r8S -- 705ppm shows theTheC6-kTeyBSdattoabearecleaatrl5y0%beitntcerreastehaninthlei.vecrheweeigshitc,: which cs - sam ms ppm ces -- 142ppm between CE8venandatth2e5%C6i-nTc8rSeasies qiunitleiveerncowueriagghti,ng:the comparison cs ~ cam C6135 -- ca 30pm ce-TBS."Gerry's cover note says: "cs = 30-50X more potent than Lluorineinthe bloodstreanwork is stillDeinedane oi bie efficiently. RAR . out to Ihe blood be as good testing should be finished soon; if it turns Sfiirnggeerrysescroassleeds.s biaosrettheinstirveesulftl,lorwoesumrafyacitnanfta.ct hRaeveey tfooounnsd 6094.85 EID087672 g g22 h Bruce 669.5 EID0ST673 g 2 3 a3 000130 C-8 IN WASHINGTON WORKS DRINKING WATER shown C-8Recleenvtelssamofpli0n.1g, of0.5t,he2.f9our& W3.a3shipnagrttsonpWeorrkbsilldiroinn.kinTghesweatvearluweesllsarehave surprisingly high but do not pose a health threat to our employees. corporateThAeELa.llTohwiasbleleveexlposiusre0.0l1evmelg/mo3f oCr-80.f5o6r popubr. eTmhpilsoyeiessanisaisretborbnyeour bceocnatursoel lseuvcehl.a Aconctornotlrollevleelvelwasfonrotemdpeleoymeeed dnerciensksianrgy.water has mot been set level basEixsp.osAutrethteo ACE-8L ains ebemsptloyuenedercsatnoboed sbyafeetxyamienxipnogsedthetoASaL12onhoaurdaidlosyedoofse h0e.10woumgldofonCl-y8.beIfexpanoseemdpltooyeaedwaeirley tdoosedriofnk0w.a00t6ermgw.i,thora C1-/820tlheveolf otfhe3.A3ELppb c(onnostuem:edC)-8. is essentially fully absorbed by the human body if b.reathed or for airboAtrnethCi-s8teixmpeosaulrle.opeThreatisnlgighatreaasddiotniosniatle earxeposiunrecomipmlpioasnecdebytodrtihenkAiSnLg dwoasteerofwiCt-h8C-a8llolweevedlsbyofthe3-A4ELp.pb should not affect our compliance to the daily GuidelineW)e sfohrouCl-d8noitn gweattercoonffus1.e0d bppyb.thTehicsurgruenitdeCElGeve(lCoimsmufnoirtyexEpxopsousruereto the general public and not for the healthy workforce here on site. enviromenHtoawlevegrr,oupthiasndsittheuatC-i8ontesahmoulwdillnotendbeeavtoarkentolifguhltllyy.undTheerstsaitned these recent sample results and provide you with future programs. from HaskAetltla.ched is the technical basis for the allowable dose exposure levels 06535 EID089421 44 0663.22 - GSasteonnCnaega,ron Lig 5 DEPARTDMIEVNITSIGOFNCOOMFMEERNCVE,ILRAOBNOMRE&NETNAVLIRPONRMOETNTEACLTRIEOSNOURCES Cha1r2t0es1ioGnr,oaWnNtr2i6r3S1i1r1ee0t88 July 8, 1993 Oa a can dni SMrr.. WE.nMv.irSotnemewnatratl Control Consultant PE..0I.. BDouxPon1t217de Nemours and Company Parkersburg, WV 26102-1217 \ FeW a pa ) profed XKQD \\} w [i Mr. Stewart: Re: fSooliids Wiaasntcee/pNuPeDeEmSs Wmateerr WV0076244, Dry Run Landfill \ 2| \PB , ISivseaalgeedncnyo'ns-cJoumnpelia28n,ce1w9i93thfcioenldditrieovnisewD.o1f. thaendaGb.o6v.e offactihleity bsaebeiodnvigemenoptpeaertrmiaiottnedapsoinnedx.ccoemspAsllisivoea,ncsetehdweiimteuhnptpeCrhoansdsietdaiicomcneunmtuD.al1ta.itoendduepionntdotheis lnoowter tehxeceslsoivveer psoenddi,meOnuttlaectcumNou.lat0i0o1,n. isFcuratuhseirnmgorae,distcheolodrisacthiaorngeof ftrhoem wreictehiivnitnhgestporneda.m, Tahpepraerfeonrtel,y tdhuee steodiamnenatcactuimounlatpioondnsomfusatlgbaee racselsqeiuasentsetdsinotudtheattaentrdhmietnhieOnugtclaetuthsee00co1faubsaeelgaaolfnaagllrygozaweltdhgfrmoourwsttNhi,tbreitthdeie,sterNamigitenrneacdty.e, To Aumonia Nitrogen, Total Phosphorus, and BOD. I {4 aTgoenfcaycilsiutgagteeststhethactletahneoutuppoefrtsheedilmoewnetratsieodnimpeonntdatbieoncploenadn,edthoiust CFAloawned rsupbosnedq.uently placed into service during the cleanout of the wae? Tbheisanaagleynzceyd aflosroacruetqeuesttosxicthiatty atshededtiesrcmhianregde bfyropmerOcuetnlettageNo. 001 mmionrntoawlsityand(fDoauprhtnyi-ae.ightDihsosuorlvesdcrOexeyngienng bciocnacsesnatyr)atitoonfsahtahleladbe deternined prior to running the bioassay. Wsihatlhlinsutbhmiirtty1)dayascutoef tthoexidcaittey oftatshtiinsg rleetstuelrt,s,yo2)urthceompaabonvye oruetfetrheencuepdpelraboanrdatloorwyeranasleydsiemse,ndation3) poandssc.hedule for cleaning oe pbs" whal ofl - = 069733 EIDO12563 oo MPra.gesttweowart Scohnotualcdtyomue hatave367a-n2y72q0u.estions concerning the above, please sincerely, OFFICE OF WATER RESOURCES Dic Bute JIonhdnustG.riaBlritBvreacn,chGeologist 38/3 ce: SCuipnedryviMsuosrs,er,EnvInisrpo.n,menEtnavlirEonnfmoerncteamlenEtn,forDciesmt.entV,I. Dist. VI. 0001.2 EIDO12564 4s 0001.25 | PROCEDURE FOR CLEANING OUT LOWER SEDIMENT AT DRY RUN LANDFILL b1.etwIeneneartlhey Aluogweurstspeldaicmeentbapilosndofandhaytheatacthteivenarfrilolwesatreapoitontmiofnimtihezehosleldoiwmen going to the pond and out the outfall if it does rain. f2.roAmfttehre tlhoewerAugpuosntd moovnetrhfllyowsalimnpelesandhavderaibneenthetakleonwerrepmoonvde. the drain plug 3. Allow the lower pond to dry out for approximately two weeks. 4L.anRdefimlolvethtehesesdeidmiemnetntinfrotmhethaectilvoewerlapnodnfdillusianrgea.a backhoe and a bulldozer. 5t.heMepaonsdu.re the dimensions of the lower pond and note them on the a sketch of p6.ondRebpalcackeintheserdvriacien. plug in the overflow line to place the lower sediment 0695.37, EID017107 a6 0001.27 | INTEROPPICE MEMORANDUM TO: Thomas B. Valdron FDartoem:: Dept: Tel No: R05I-CAHuAgR-D1A99K3IROSlC:H3NlEpRa, JR KPIORVSECRHR&ASERVICES (304) 863-2992 ( VALDROTR) Subject: Dry Run Pond, Toa, MpIel'leavaissneurdebeoyeossunu''rtevethehsienenknouiVstalvvtih'laslt'adsnodgaoEnidy'nsghamorenmm,oasn.hdavvehWahhtenimtoyooeupxepnteactlthk.e tvoaAllBsvooes,oalilf 1tshe lvoaoyk.ingThbeettfearstearndthbiesttesrtufalfl letahveest,imet.he use one? bIsettheer.eveTnhtautalsliylgtoifnegnceto Thanks, The "worst* golfer around... 0601.25 2 EID017129 i a 0061.85 |- verses| Fi-o ; Mortality Among Employees of a 9 Perfluorooctanoi%c Aci:d Producti: on g Plant s i1 Frank D. Gilliland, MD, PhD Si ammonium peruoroocnote, , Jack S. Mandel, PhD, MPH erfluorooctanoic acid (PFOA) and its are' perfluorinated surfactants. Be. craougseorfstthheeiry nairquewesdurifnce3sce Perfluorooctanoic acid (PFOA) has beenfound at low levels (10 to 100 poacnctuspapteironbaillllyioen)xpionsseedrawoorftkehrse. gAelntehroaulgphopPuFlOatAiohnasanbdeeant rheipgohretredle1v0elbseian Smet of mance mci ats ccioznerssu,mleurbripcraondtus,ctwsetitnicnlgudagienngtsp,laastnid- promoter ofrodent hepatocarcinogenesis and to alter reproductive hormones emulsifiers." Despite their wide- | in humans and rodents, there is litle information on human health effects spread use, little is known about po- | associated with between PFOA PFO and Amoerxtpaolsiutryeu.sTihneg parerseetrnotsspteucdtiyveexcaomhoirntedmtohrtearleiltaytidoensisghni.p tenPtiFalOaAdvienrdsuecehdeamlathrkefefdecbtse.patomeg- i The cohortconsof2i78s8mtaleeandd 749femaleworkers employedbetween aly and peroxisome proliferation in ii `1m9o4rt7alaintdy r1a9t8io3 watasa p.l75an(t9t5h%atcponrfoidduecnecdePiFntOeAr.valT[hCel]a.ll5-6catuos.e9s9s)tfaonrdawrodimzeend ~~ Todent livers. The chemically di- Verse groupofxenobiotics that induce | and .77 (95% CI. .69 to .86) for men. Among men the cardiovascular ~ Peroxisomes is of concern because of | gsatsatnrdoairndteiszteidnamlodritsaelaisteys rwaatse .w5a7s(9658% C(I9,5%.29C(I0, ..995)8. tTohe.r8e0)waasndnotshiegniaflil-. 1PSaaisoscourcciiantoigoennewsiist.h"nonPgFeOnAotdiodrboietc- 1| Socrarwlloymeinnr.creTaaesnedyec5aaru5sso%e-fsCpee1mcipf1li0oc7ysm1te0annt1da0ir6nd)iezxnepdorsmeosdrjaotlbistcywoarsantesioomfcoiaranetieltdhyewrcimotemhn.a (BpogreSlloafEdialenr2 iincnroeamsaeS dsniunmbaeryoSefEahreErpt. i| pcaanrceedrtdoetatohesmopvleoraylmleanntdfinouPrFaOmAopnrgodtuhcetieoxnp.osTehderweorwkeerrse; otnulsy,sihxeprroessilaltse `rican ndpromotion) and wi Po pertio eeior3:0 Pee" PmuFsOtA,bePRiOntMermpraeyteidnccraeuatsieoupsrloys.aItfepcraonscteartme ocarnacerbmortaelriitnygirseprreoldautcetdiv1e0. afesminatosicntashmaveeshownfsiagninfictantly `hormones in male workers. SthueggPeFsOteAd-htraetattheedmraactkesd.rIotdheanstbheepn maatromkeegralfyorpcraordcuicneogdenbiyc PpFoOteAniisela cl`Tlhetoubmseorrvantiaon3s-oyefairnrctreaPsFeOd ALefydoigd. EynPipnegoRtbsiytOpuadolytuAhiaesnc.sdiatteoahtfaasdrriPesFrciguOoopAnotei-ssosdendna0otcfsawietthidhea nor are medised by 3 hormonal |Clme etsehnoSnofoMEnimniamrpeMitieupCioMdetinoStrebraETeoEdTReeSi mpaPdsFsObsArheysdof0ccubpuneioealiybxu :!! MCa`E iAodidmoreeis,sncNoerowrr eyMsepAsoinmcdoeaTnnucr emnoo:rCoFR lraezgk e Dof.sG0iglp0lCaasnimdi,ssMy D1d,edUSn, ilEvoevrdisiNotEny,soAcflNbaueaqwuMeMriqeudei,doNSMch8o7o1l3o1.f LGcHIeooiaocs8re,mPfeaFocmOci.Ausmgisumrlataelhtlais,otntreheqoarfune1Pro.nFf5sOyuheAePagrFmsmOa.oAy 0CO=G EID088658 A, -~ eral populations of industrialized countries'" iz likes 10 he ac result death certificates for coding by the same GOSOIOPS. In the 2F death cer men based on US andMinnesota waite male moraiity ries for three : doPofsFNeaOsonA. sGhcecarutmhueiaptnooenleofsssmeralndPFnOs0A oare nee ocoChsnne a tificates from 1970 10 1989 resubmit ted to the posologist for ICDcoding, SaipwRtOT cl of fmutoneof latencyiatervals(10, 15,and20years) and three categories ofduration of B CPcPrRaooOsnsN-ltcseocate CipohanaaolshPseawtEoucrv OdPikyENeoraOvnsmNaoasnpBgtoo tosiwuocrgkaileoeroensfdoprcooeWaovrderkeTroodsrdse|owlBemoprsoeeedhciatoeogsBomrPoizEraetdOavsa,oexr- opf roegrpeamodrpeievr,d aeaelkbb(lry(CMRn MoBDoo)snpst1o2eorodndns d.9e2x5% a as 0 carole pfwioTttmhoidneGcnyeremeuamsietsdneoforedwenheteStshteoSrstemTroonrealalnyd CompsPOoRn ClSwhooerromtkvieeaecddea]lbepDiemevoiosihCvohne.hUCmwnehieehxpDHeomsoeednnwvorfrp ky Bwearreo tesTtaigmatiEed.s udTts5ihoe3ne8gtdfeptpmrros oodrpoo00rrtciicoDetnnoaetml Cooierisoorhm3oploanreal 5lywrea.s hgneemesBDiwO olnbcRoonfoona m. a oe abd women of ue: ooCfaea oeohpoe1f909,nds eeodhdmaoddesblfsoer fmoem Soa in i calomel Jets orate deus ve Sono So ohcpemorment Laddur The Ipslant coms of sv dike spp a nk iy expected num ofdb eathe sobr tais ned Soi SodTo ates covariates inthe model. Theanalyses sions, with PFOA production re- aSvrecbe1e phreoCcheedmiIshDsiviiv.i.A nSdimasp0estmeaynrhoh number of other specialty chemicals quinquennial age, calendar period, theUnitedStatesand Minnesopotpa- priatenessof theproportionalhazard poeoCnsofhBe poavpoicrailsondybsarodf fied models with graphical analysis of `Thestudy cohortconsiofswtorekedrs whowereempaltto he py lane tfod rat served person-time.' Because less than 1%ofplant emplowyereeneons- time relationships and models that tested the significanceof a product least 6 mouths between Jan 1, 1947, and Dec 31, 1983. Data were ab- white, white male and white female rates were used for comparison. For term between exposure and log follow-up time. Proportional hazard | mmtmnomeme ele AJ soStrraectevdfortomeerplannat epheredsonpneaflomrnecvorohdswe, S wnodmpen,eoe nlay UI nciatevn deSttaatedsrBao etenEsdweerre calculations were conducted using ty |J{H3|] ISTpRSoncooioadnwl aSev1c9i5uD6ar7HietayaloAAsdIl9mni8dwnve1iesesrtefarrmoakreteithoowdenimfvpoierittndhhnee sSaofalreantnenceduy,rdtultrayotiogCn hopf`eermyoplonhyymey,nt, Comoe mom | DBaeA pSto6tpalT2of3395w377erwoawrorkkeersdr1esn1eic9memp4dpl7ol1ryoe0orddmd. Bogner Sx worker who | aaofmces cpm ahh eecompu bes ma Lo empl emploment reer | + or hl ep a directory assistance, Metronet a0d TRW searches, reverse directories, unexposed workers using stratified SMRs. SMRs were calculated for cohort consisted of 2788 (9%) mea and 749(21%)women(Table1). Mea |(3| TaBcatiangoSneeeaighrbporosamaDnnedhanerelsartivpeis,neaaeod -- mCy oofos n ni dMt lEna ee,1s 9n471088 ri } identifiedas,orpresumed10be, de- Division Division HIEs2 Suea dand caruaseioof ntwocodnectetrhnsinwghitchhe Female Male Female Male Female Male i JC ESKacm orlones coyse btceadneussoucdossy; i ai cue ofdoh MmWeereeiewieotey Nmes EmSs 16 Tm OmeBEmRo OmBs 0m3s Pai Coeyoy nm, Th BS WE MW ME oS eng + stom mm of Movwaos ww ges me Menemacuny wr "wd"di gms owes mo "ai "wl "Wl EID088659 GWJ000078 GoDLaL 1 .| ocvbiosdneetrdrvibabtuitoeend,r7w1h,hv1ie1c7hCe.h7weeepremerissoennq-uDyaeloalryisdnoif ~~ CTShhMeeRmiawlcala<scaD.u3is6veis(s9iSe5eM%RwCIo,mfoe.r0n7tthwoeet1m.0o5n)1-. a0 son.Coemicu Urvison. Women (53% Cl 08 10 1.24) 80dthecancer 4.ata5nt9e)cain6ct(ehre4wC%ehreCem1i2c.0a3l7(D19i5v2i%s0iC9oIn,br.o5o5au1yp0 Don-Chrmicl Dwaken coset, 1s the . } ctwoou-utlhiorudisodf w1h9i3c0h9w4erepeinrtshoengoeo,. Ceca Division. (SdMaRa nwoatsh9ow1e)(.95% CI, 4910 1.52) UsingMinnesota rats for compar. 4fChoeommbispcerarovlesdDaitevaiccsdaonn2cger.ocuiTpph,eectrihenrwedawseenprtge oftiheicohsotarttis(Twaabsleo2b).oTheereforwe1re00$%0 fsoornc,arhdeioSvaMsRculfaorrdmiseenasefosr,aanlld orsasl, cgauaseiofadesastocanadcoaneobgey n1esiandy : it tdCbeheaetmhoiscna-alCmhoDeniavgiisctihaoelnwcDooimbvoeirnstoa(nInLdcoi3nb9otrhi)en tgchaaesnttcrloyianlteeussttishnaalned1Sip(sMeToaaRsbeslcsewa4wis)a.slfNaroggineaescioorf SveixMspiRoosnwuracesogboLrotri, 0Ftoo5hre%thCupLerCo,hsp3aetm2ei,4cacal4n7Dc0ei)r | ; d2e0adth3s48idneatthhse aCmhoeomgictahlemeDinvi(s1o4n8 wTahseraensysultgswenreisiiimcffwirahelenntafhtroemye1x.. ignrohupe pear than 15-year Meagy rDiovuipsioanndgr2o0up0).in tDehaethv.on.cCehtefmciaceals bpaosceiddonnuUmbSermsorotfalmiatlyeradteesa.tFhorwetree tioTnaabllbearpdremoedaesl tohrelfloaclapirnopaor.. |i werFeobotainred twfhoer o9S9M.R5m%fooferdaelaatlhasu,.ses tdheraetehslaftrenocmy ailnltecrvaaulsse,sthreanSgMedRsfrfoomr acmanocnerg, athned 2p7ro9s8tamtea-lceanwcoerrkmeorrstaelimty : hI! ofdeath (SMR = .75; 95% CI, 56 to p9e9c)tewda(sTasbiglneif3i)c.anTthleyrleowwears tohoansoe.x 75 to 7].For al cancers,the SMRs rpaonngsegdnifircoamnt1.06 10 1.12 and were ployed for more than 6 months. The emsotinmaltyed froerl3atiyveearrisknfocr eall<cagusee : i oGraloatnenwciytfhordudreaaitohss rofoemmpalllocyumseenst, tioAnmbeotsweemnesa,ntyhecga:usiesof0doeaatshsoacinad: CatI,fs1t07emtpolo0y9m)e.ntYewarsof1.f08i(e5a% cancer, and cardiovascular diseases duration of plant employment. The ploymeat and duration of employ- ioit (ChdhaaeatmaiecxtapoeltcisDeidh.voiwsnIi)no.nChMweoomrimucleainltywDaiasvmiolaneng ag7lr2lo1cu0apusa1e.n0sd1)S6fM9oRr9tsh5e%wCehrCe1e,rn8$c69alt(oD9i75v9%i)siCfoLon,r mdceieatntethdswwefirrteohmnmeagolantctiahvuessleyse.mapsTslohocyieartidsekdinswsitoth-eh : | 5wo%menC,Lth2e3a1l0l-.c8a6us)esaSdMtRewcas e46 (theennotn-sChhoewmni)caTloeDMivisBionsgr.oup sChoemmticgailfnDnivtision was small .and ii oct ity ntmhe odef,oallenpgtohsotfeecmapnlcoeyrment inmare the Chemical Divison was posively ! VialStats4nd Causa ofDeathAscertaioammaontg Fama and Mal tdi wi !|| Enhjeen_1C5h47o-m19c0u9Oiun_ oS, Tene we MreeinnChoamecONFoene__TWoe _ {Clyveroait nwcoee1s30er) iFnoreCwha1e0smiac1a1nl D0ci5m%v :i; SAe Tf2eE4 %9A53 W1R1e91 N%889SH46os x9M16W1E2o00 %8E62fT6o39 %9C33HWuAeSo %gNrEs LpSelo6[ycmmleinavteiin0thneCnhem1i0ai0ln apimvipdoend, | Tou 265 1080 a a sod 100 veh a 4p 100 ai oo wihworkersnever eploinehde _ ployment was posiively asadaied t `withprostatecancer morality. Length Obuseersved(Obs)andExpected (Exp) Deaths, StandardizedMortalityRatios (SMR) oDfivtisiimoen ewmapslnooytedsiginnifitchaentClyhermeilactaeld and 95%ConfidenceIntervals(CI)for 749 FemaleEmployees. t mortality from Jung cancer, gas . --CrHC eecCueeeswu essoe 7w3 c EwBGpnuEiO SooMmmRucGot XmmEawSEnh a ipoa d cann cer, pancreatic cane ; afCroeoin 23imisFm oSonhm ooommweaen Di"sTchu"ssvsaiosnthefistrezospe)cicvoe- ScoxUrroneie W3w3 uu EmR taoSmk ooSsmoeam:m pFHolrotyeemdoirnal8oitrPysFsOh uAdyprooe fduwocriokonena rlspmlaenemt. 1 pr w --_-- DII 3 34 8 2 wn au Jueh Shan ; and womenwassignificantlylessthan ewxoprekcetred.effeBcetc,auinsteernoafl ctohmepahreiaslotnhsy | EIDO8S6E0 009.8% I rrmmo comico 1 sn oe sn be WE RaDTteeaest,hlsAamndcS;ta7n66dairkdLMiioonruaesF,eT u1os (6SME4;Ba4s7eT d1o-9n39r1Mnoens9EovrsT e6WEhmi5pteoyM,euda summed association between PFOA YSiXoPwOSeUdTsEshyipotbi ess p sbae . ntheChemica Ovisn, 1947-1980 Causes AsEmpioyeas YYoan nEmpotrorie eain bsseohcocuiladtcihooantocmebaeydbovieenrro.etoaelrpmrmeatayeydb.ehTathvheee Te of Death Coane e --_-- wer U2 i0n0 oSeme;n v-- eUaoe eW-- 2Ns s1-- 0 oO72rT-- eIrSa hDeaumnsItpoffeaaen nuonareevc,oSgenoizrbetdeaedbnovnierob:ne. OCuPoranewssta Rory 528?4 3567%48 0019048 0u05mi1mB3 3042 102 M148 4{9 Id4oume i1o1am5 o0ossaa1sdrodsrr 12 12 tor Osorss io<loagiPcFaOnAd phurmcandaonbveypaiindiedasdmmaileopltrooodgrse.. daathatshowanasocisdon ens PjTreLoruslantga Urercposs 2318 02m68%0974 m1T00m%0 0e00630a766-i2101d4s54 11141 1oo10e57Rs70 i221.0N3003 00Sb5o31sh-i41ru8%e4s 13 1207 109 057484 5 478 108 0304s TcPhFaeOnAgdeasendwrseprdoduectimve 'ahoirmnone CCodoowsaiar 1T4O5 21182109 00868 00855700880 QS& $77848 00774 0assisigoo Ovoemnencosboar.r TmhoeralleoixwtypSeMcRistataeamrhodeeng = Corwrovascar OfAllgaeesntonrtestral 10 31o2s 078 Gai 2468 080 032-102 N21`I.o1Ex3 O0i5Mm7oO0m29B-a0199 4 18 a 853 047 013-120 L82T7 sin G08N7 0 2Ca064H.2v-3I1.e9N1 Sonsmioudip wit he beidy `mostlikelytobe resultofthehealthy owforkpearcefafepctl. oLartemnecysnarnidsdusraotimon Sicee iu Sm on aiid 0 em 10 was pede 3 c CHD. r ere y es S quis coR nternioonroef methsetocinst. workers are not sricly comparable psiloonyeasadTphoenr-eChweemriecagloDsiviipsiifoinceamn.y gerlenvoante-dChSeMmiRcaiaDiCvhiesimoinceamlpDliovyieseosn. isPpFrOoAblaenmaptriocs.taAtgeec-aadnjcuesrtoecdcuprrroesnaclee c1a9n8c9er(3m4o9ralpeirt.y1a0t0e,s00f0)rom 1983 to weizreed braastedroaatisoes;shopwuesvmebre,rssahned peass duced uasabe ratios. Evpmseey of &| meHnoaswteaivsaeorct,ihaetpCerodshtwaitteeh lcmaDniecvieirsoaficmoeongrmatppallhroliyoty- were only cT2ah5is%ssloafotwphteroirnptcioodbperarocotfuesduiretaateottcehsnasn(ec9ae9m.rod4rn)eg. PFOA. exposure were bes on Jos tih henoCihcemsvainct davecraDo mtiievsgr ionrseioy vzneatrr, iaoenymoppflowotoprdekedenr1ss Z33|| F| ov`fpiosmreotminaponlvadolaysdhmaeaoznsatsriodicdnianataiehldyeosiwCsihc5.teh%mrTiCe2cen2aLlsyLeeDsa0eiirc:2s .spefmerletevaic.tensgdGtcdhaeeauithshiesgsvhfhfeorrrseiotsmmkhanopflirdosesptadatutiehmscofafocbniorcafdceerosl0rmibeny-. stPphFreeO`aAbdeiaoloogxnicgepfefewmcpatolsiovensespdcpossseeunnototlfdryPseFaOedyAe.: exposed 10 PFOA ansthe rms F| `T1heu0seo1fpprro0ossuatt6eecacna0ncceer)rmmooriraalilntiyt.y thie isntcuiddye,nacnedatahdeombosrearlvietdydirfafteer,entchee craste5goruinzeaxtipoonsteadywhmebclhuesyiieymacoxk. T-a_ e Propo.rtionalHezard RegreAssCiaounsMeosdcet!DoofaFractorsPradictngMorCtaanitcyaarmaoantgiAsIMaleEmployeesProcaaCancerSaath. YorweT ollme w Tas n 00m 00r 07 wose T 0meono Gi worss oooowoeoer 0r5 owior 3 OAuFgueyfmmaaaieew7sn Soymen0t1 OU) 0% os om 001 Gow 108 0 O07 ams 00M om 001 Gow 108 om: 0082 aor 0S om 0oe ow 1088 om Ma-araan n ot om 02 1 oom oom 02 tmz oor oms om ton 3 RAoerevveatirksE fursceodivr:tE 2c.waretcE papaarcr:eE SEiG:.wandE a areofT speparserA, oe 2& EID088661 000.405 " HANG & a may 18 Un rs ra * pboeseed.ecSeudchtombiisacsahsseieffilccaitoensiwmoauleds pReouorrolnoficDiodsw.e[r4:5 P[rWoHx 16. USbaerFG,f Soernveise5.rRoccohedD. Heaw.s . ` fiponlcworayeeraddtietsnhtedheeualCtlhheimfriaitcnecasr,leaDMsioevdnitsXihosnPmeamOyo S; Gii cs wUithAaomgLmaoonngii.u,mAnpieImrRalluOoNrIroaSicTcaOnyoAmaStu,ed. |15. GIpnudsypiWg,dsFolsieoriAocopmIproounvAdesso,fiiatn fdoecvsersocreefuleesctcutmhuelabtiiovleogeicxeplfoecirvee. 3,Oof opCAr udenasTodpc eraoa dm, hRoons.boendccWomGanvrtnsy PhSoens fWloecrtksetrhsebwieoraccxcpoutmeu.dlat1it0oomnmaonafysPoFobOueAsr. osnSoicasyRtdienOmsaT e atsaa AardttPhheast rfmlaocc,s 4 Puno T,LoeK.PeriM.Gli P. 16. Gc19u7my.Wp, TavsD,bBmreynW.pOercpBryo.. : LenstodcretTinFoBn. tebheerstpolssa,nbtdasuHrbioeawegenvteshrse,iiroscoeanmtepedlofowbyiemhseenptrmonaa.t oBGifuocadhmemmniocwnaliovm0nedbplmoeyrupmhnorldmocgiapcsalootmeeiiemns: roYodobBroioAchceAemCniSrnymsireCvoabtinvgeceaSrroba oenhuce. re ough he engt IE. SSEisGioon EpaMol Parmt BrATs, 17. GISuytIWoTennasrT pc tL une i DDomainoviysieon 100mean J O 20d non-Chemictl Dievmi0siMio.n CpieSrcslroenseS0rodlftm eoimosniabumBmibeyypmerO,:f T3 197t5, Comidr nag oCOlWid enshPer cobortsofmen and womheenco,m: aaron adds nt Bor, 18. Tors Evid tat hr ar to opanrfisiooounsnndoodffatbghyeedirfatfTekrseTnoahcfeEdiiasnCetarhsOeeTdrairMse.. 6. SmHKeeupaamnteolplloyegyoO.,rRDs1e9or8Ac9m.aa9Ilm:5ow7Lu0i-.5cS81yT.oofcaamamro: 19. af fTooen.aoeIoDf.hAruCaSoom srmIipdu0s e1tiSdanos0nb1u0a-m%fa)o"noserbrcum".sNo difunceteh,rebsuitntoeomtaceollmipmCaisOnmatPeA,TcSoOnDfouBnOdiWT=nSg have diferent disbutions of these 2KMneuinaansnccaoGsitulo. c.FoonBfdomCeholo.mtCoToomtapotr,.. 153636 35-53. 20. 9GDbieeasntF. BPseOsasnReutDosisoe1d obunmsna FAD ts Misses MG Ui i ceiumrmerenfcaoceftoeuri.tBomencsahausiep tGhe ddoiesfeioanseed oheJen. 8. CaLooomow)eau,onnMuomfpmLyedoFeubmeedSe, cHLoormaoMb.y 21. sBS tyoroyf:n iTsoeesnsaeud9oEosmoarryby he : barvueeboefetnecbiaosfedPFtoOwAardexopraovsuarye Omamy 5 R3eCy)O,ErSoUlD,SHEisSeIHTyLpSo. 22 MadamparhoepAsosrismoforasyiv.e Cvomipt i the null by uncontrolled confounding lipidemic hepatic perotisom prokifera- Biomed Res. 1974;7:325-332. : | bwa yaFttiamunedfracocnbtfoirrosm.tse aossodciationeinnebe. 10.StRooroesfasormJpRL&raenaowvmeslsB c N.rClaoO rflatchneslomIpics nacolthca.r- 23. 34. Mi Cioetxtin .ne'nReOg.re|SstiaoEnnd_armdoiazattsionanodf risk te y refssmauadllitlnesdgfuirnommhiocbsfhsaecnauscdreeysoaarrnuednrbceaocsuoelgddnohiaznveaed rCLiro,EnRoCof IToEisIkioUfIpHOSEIpTIIAIlSEaNeEs 25. wS0ASbSa)sJ iA Sir SAS So (8) 1973345 Uses Gide Sis 11 NinR.Ba B,Pret V, ErtoKa. SxGriGamNCSAS it cTdcoeinonfrcos.uendSitinundghiesfsooamfnrdexoopnsoesausrecPaR1nO0cNoethRien.r. RhDoabwlmeomCao-nrtOunCoohpmtcyBmelconfhaapneitonosf1o9hm0es; 16. nK19au%b,bieAh,PlireetTehseNseiwaY.oik " onSeEs 12 A Tool n Poi.Vea m , Non 27. SMoiblaeW.Caa&nSymasu190, evi 1975 gestedincrease inprostatecancer Roo.RnnovbeeorsfmrotiyodMo.rdPoerlnofxeinsmsoombiemprrooolriufinerrcs-. N1e98no9. BuoefthLeasodtash,M4iaroyflHHaanedm.haU.SSDNeopeavontn,- AcoHTknheaniltoswawGlorierakdsigvTmaoserImnOotSoosurOpewHdiDosnp1TuSdn-lbhy1yeN1I,e3M4. 13. aTeCciuda,mr2p,A4,mSe5u-tnKrai,ch1Ulc9aor0doApambLe1n0oIndxTye,meNacltcsiEpcoanahcrsd., 28.`BCC1ao9ns9nc8ear.wInasRyiteutHe,i.NsPTHiiPeub.No,No.Cd9v2l-o2o78ro9d, 3 i Corporation. References R8O r,Kuprot okoawd4caS5Ye4.h1Siah2roarntop-nteemercmr,ecnxpopsdueeortfesat8.o. 29.`lRtUieoonnnbaieloetipJinydAePmmioeoklwrogty0.p.NmreowscYtoworikc:Oaxlfo0rd : 1. Ghursnboeo.mViptoruM.oSulie si1v3e3 bosiCootteyLdtoeIyIiaIalSnos,oDiNAoGeY iTnedrexponMaehMne.n ! : 1 EIDO88662 ] 060504 : Page 1 AH6&40M4 EMaNcVCIorRkOlNeMAEvNenTuAeL,,SIWNC. St. Albans, WV 25177 BIOASSAY REPORT FOR E. I. DUPONT WASHINGTON WORKS P. 0. BOX 1217 PARKERSBURG, WV 26102 AM NO. 93-114 DAPHNIA PULEX } DECEMBER 8 - 10, 1993, 48 HOUR STATIC ACUTE DEFINITIVE AH&M toxicity Environmental, Inc. of a landfill leachate conducted a collected by 48 E. hour static I. DuPont, aWcautsehibnigotasosnayWotrokdse.terAmignreabthseample was collccted on December organism, Daphnia pulez. 7, F. 1993. The . DuPont, sample was Washinglon tested for Works is toxicity located using the freshwater in Parkersburg, West Virginia 26102. The test was conducted on December - 10, 1993. DILUTION WATER Tfrheeshdwialtuetrionthawtatiesrfauvsoerdabtloepteorftohermaqtuhaetidcefoinrigtainviesmtosxiucsietyd tienstthweastesmt.odeTrhaetemloydhearratdeslyyathhaertdic syathetic fresh water is prepared according AcuteTolcityofEffluentandRecelving tWoatEePrAtporForteocsohlw"M atere andtMfaorhriMneeo aOsrugrd ainnigstsmhse, EPA/600/4-90/027." Water quality analysis `The water is is conducted allowed to acrate for on the dilution water 24-48 and if hours prior at any time to use water in a test, quality is not adequate, an additional batch will be prepared or an alternate source wil be chosen. LEACHATESAMPLE: TcohlelesctaemdplbeycDoullPeocntetdWwaasshianggtraobn sWaomrpklse pceorlsleocntneedl,onreDfreicgeermabteedr, 7a,nd19p9i3c.kedT-huep sbaympAlHe EwaMs Environmenul, Inc. on December 8, 1993 at approximately 1100 hours, The effluent was translucent was present a . nd had an oran The receiving ge color. An odor temperature of the was observed anda sample was 12.4C. 4C and were used in the tast prior to the 36 hour holding time. small amount of sedimeat Samples were stored at 00985 WVDEP 02 Page 2 AEPdAefipnriottiovceolto"xiMceitlyhotdesstfwoarsMpeearsfuorrmiendgtfhoreAE.cuI.teDuTPooxnits,itWyaosfhiEnfgutoenntWaonrkdsReaccceoirvdiinngg to Wsaetrieers,sta oconFcreensthrawtaitoenraranndgeMaofri1n0e0%O,rg5a0n.i0s%m,s,25E.P0A%/,60102/.45-%9,0/60.2275".% aUnsdin0g%a(0c.on5trdoill)utwioans used to test the toxicity of the sample. TUhpeontesrtecveeispst,elssawmeprlees3a0remllopglgasetdicind,isapsossiagbnleed test an vessels. AHM test The test number volume was 25 ml. and initial parameters aterset rveecsoserldeids.raTnhdeomtlesyt dciosntcreinbturteadtiaonnsd aartelteahsetn2m0ixoerdgaannidsmdsecoafntegdiv(e0nthsepetceisetsvaersseelesx.posEeadchto each effluent concentration, five (5) per replicate. `DTehaetht/esmtordtaatlaitmyeaissutrheedefifnectthemeteasstsuraerde biniotlhoegiaccaul,tectheesmt.icaMloratnaldipthyysoifctahle data, test chambers are monitored Chemical for and pehayrsliycamlordaaltiaty(ied.u,rpiHng, tchoendfuircsttivfietwy,hoduirsss,olavnedd only every oxygen and 2t4emhpoeurrastutrhee)reaafrteer, mhaeradsnuersesdaarte amemaisnuirmedumininthaelcotensttroclosncaenndtriantitohnesheivgehresyt2c6onhcoeunrtsr.atiToontaalt atlhkealbiengitiynnainndg tooftatlhe test. `The 40% tseasttutreatmipoenr.atuIrfehorwaenvgeeri,s 25+/-1C. the sample Dissolved has a high oxygen oxygen idsenmoatnadllaonwdedthteo exceed test below concentrations chambers will oecxchiubritprdiiosrsotloviendtoroxdyugceinngleovreglasnliessmsstthoanth4e0t%estsacwhraamtbieorns,. acration of all test A`ThHe&teMst Eonrvgiarnoinsmmesntuasle,d Iinnc.theDatepshtnwiearepu1l-e2x4ahduolutrsDwaeprheniisaolpautleedxownhi12c/h07w/e9r3e acnudlturreecdeiavted oofnh1e2a/lt0h8./93.AHT&heM DEanpvhinroinamenncotraalt,esInpc.ropdeurcfeodrmasrerebfeelrieenvceed ttooxbiecadnitsteeassteinfgreaendanmdaiinnttahiensbe2st contol chart for the Daphnia organisms and the techniques neonates cultured in house applied by the techaicians. to assess the health of our cultured RESULTS: T`Whoerkasdvwearssedeefaftehc/tmsormteaalistuyr.edAitn 4t8heh4o8urhsou1r5%defmionrittailvietytesotccfuorrrEe.d I, ia DuPont, Washington the 100%, 5% mortality occurred in (controls). the The 50%, and LCSO for OWa%shmionrtgatlointyWoocrckusrrseadmipnlethwea2s5%>,10102%.5.%,Th6e.2A5c%utaendTo0xi%c Unit Was not measurable. Chemical analysis of See Section efflucat and V,, of the Test dilution water Summary for Daily are in appendix A. Percent A copy Mortality. of the All laboratory bench sheet is in appendix B. 00009a WVDEP 029 Page 3 AH&M ENVIRONMENTAL, INC. 6404 MacCorkle Avenue, SW St. Albans, West Virginia 25177 TEST SUMMARY SHEET FACLITY: WaEsh.inLgtoDnWuorPksont ADDRESS: Parkershurg West Virginia 26102 TELEPHONE NO:8(1064) 3-4633 TEST DATE: _12/08:10/93 CONTACT: Jim Yoak OUTFALLNO: NPDES NO: Wy. SAMPLE ID:LandfilLeachate REPORT DATE: 12/20/93 IL SAMPLE INFORMATION A. Method of Sample Shipment: AEHn &MvironIm nc.e coun riet r al, B. Condition Upon Arrival At Labortory: " 1. Temperawre 124C 2. pH 8S2 tdUni5 ts 3. Chlorine --O_ mgn 54.. CDoOnductivity u _510m00h imogs l 6. sAmppaelalraamnoceunTtroafnsselduicemnetn.toragecolored liquid, odorpresent,anda C. Collection Dates: __12/07/93 D. Collection Location: Prortodischarge O. DILUENTINFORMATION A. Method of Dilueat Shipment: Notapplicablepreparedinhouse B. TPrreoattomcoelnt6o0f0/Di4l-u9e0n/t:02M7oderatelyhardsyntheticfreshwaterprepared toEPA 000505 WVDEP 02 Page o AH&M ENVIRONMENTAL, INC. St6.4A0l4baMnasc,CoWrekslteViArvgeinnuiea, 2S5W177 TEST SUMMARY SHEET C. Conition of dilution water L 2. Temperature 25.4C pH 8.U07 nSudits 43.. CCohnodruicrteivity _3_00_uOmhmogs/l 5. Do Bomgn 6. oApo pearance Translucent,colorlessliquid, with nosediment.and/or D. Collection/Preparation Dates: 12/0193 E. -Co--llection/Preparation Location: AEHn &MvironImnee , ntal lI. TESTSTART A. Test Organism: Daphniapulex B. Age: <2ehrs Isolated 12/07/93 C. Test Vessel Size: _3m0 D. TestVolume: _25m E. No.of Replicat_es4:_ F. No.ofOrganismsper Replicates: 20 G. TestDawcyTimes: BEengdiinnnginDgaDtea:te: 1122//0180//9937TTiimmee:: 11221100 H. 100% Effluent at Hours 1. Chlorine Initial __Omgl Adjusted NAogtpliczhle 23,. pSHIantlalin8 ity Init1 ial _9 _uQniptd os pt AAddjjuusstteedd NNoottAApppplliiccaabbllee 003729 WVDEP 029 Page 5 AH&M ENVIRONMENTAL, INC. 6404 MacCorkle Avenue, SW St. Albaas, West Virginia 25177 TEST SUMMARY SHEET 45.. HAlakdaoliensisty 2_02068mgmlgl 6. Conductivity 600umhos 7. DAeOrIantiitoinalPe_rioBd (iif necmessgary)lNotAApdpjluisctaebdleNotApplicable I DILUENT at 0 Hours 1. pHInitial _8.05stdunits Adjusted NotApplicable 2. Salinity Initial _Qppt Adjusted NotApglicable 3. DAeOramtiitoinalPeri_o8d.0(imfg/nlecessary) NotAApdpjluisctaebdlNeotAppliczhle 4S.. AHlakradlniensitsy __62mgl 9m4g/l < 6. Conductivity 310 ymhos IV. TESTRESULTS A. Test Accepubility 1. 2. Control Survival _100% Average Weight per Control Organism _- B. Satstcal Analysis I. Method of Statistical Analysis_NotApplicable_ 2. 48 Hour LCSO 2>100% 3. 95%Lowerand Upper Confidence Intervals NotApplicable Cc. T1U, TU = 100/LCSO = 100/> 100% = AA (Below detectable) 006445 WVDEP 029 AH&M ENVIRONMENTAL, INC. St.64A0l4baMnasc,CoWrekslteViArvgeinnuiea, SW 28177 TEST SUMMARY SHEET v. TABLE1DAILY PERCENT MORTALITYTESTCONCENTRATION ee -- S-- -- S--_-- VI. COMMENTS 030 AL WVDEP 02 GI212 (. : HASKELL LABORATORY FDORUPOUSENONTLY LInITED DISTRIBUTION nloitterbaeteunrTeeh,viaslbuoratethveidpeuwbfloriresfhslecedicetnsatnidtfhieucnpaumvbealriiiltsa.hbelde.CotnotSxaticuctdiitsyHsaskhealv)e Laboratory if you have questions. Common Name: Ammonium Perfluorooctancate (APFO) Chemical Name: Octanoic acid, pentadecafluoro-, ammonium salt synonyms: Fc-e8-143 CAS Registry No.: 3825-26-1 Chemical structure: CF=CF~yCF,~CFC ,~CF F;~; CF; ~C-0= NE+ . Physical Properties (5): . DKeoslcerciupltaironW:eight: L43i1ght-colored powder, slight odor BMoeilltiinngg PPooiinntt:: s--ublines @ 130C VBauplokr DePnrseistsyu:re: Flash Point/Flammability: 07'.x6-01.0-75 g/amnLBg @ 20C --- ESoxlpulboisliivtey:Limits: S-oluble in water, ethanol and Conversion Factors: a1cmegt/onLe= 57 ppm 1ppm = 17.6 mg/m T2h3 ispagleisterofatutreext saenadrch62 cornetfaeirennsces. Annew %daitna thaeddledeftat matrhgiisn upidnadtiec.ates TRhiicsharsdearC.chGwraahsamp.repaSreeedthbey last g puapgdeationfgthhiisstodroyc.ument for its 3 EID087793 L 009115 . Exposure Standards: DuPont AEL = 0.01 mg/m} (8-hour TWA), skin + DuPont Community Exposure Guideline (air) (CEG,) = 0.3 ug/m + DuPont Community Exposure Guideline (water) (CEG,) = 1 ug/L + ACGIH TLV = 0.1 mg/m, skin . DOT Classification: None EPA RCRA Status: None FDA Status: . None : TSCA Inventory: Yes TOXICITY summary: 470 C-8 has mg/kg. Amnodearqauteeousacuptaesteoraolf Ct-o8xipcirtoyducweidthmialndLDtSoO moidnerraattes of irritation on the skin of were seen at doses as low rabbits. Clinical signs of toxicity as 1500 mg/kg. Instillation of the solid material into opacity, iritis and tchoenjurnacbtbiivtiteiyse. proTdheuceodculmaordereaftfeectcsorngeraaldually eryeecsederde.covePrreodmptmorweashqiunigckloyf. the By eye the reduced acute itnhhealaetfifoenctsrouatned, these C-8 is highly toxic with a four-hour ALC a two-week subacute inhalation study in the rat of 0.8 mg/L. performed at 11 and 83 In mg/m), liver enzymes were doebgseenrevreadtiaotn,botehnlcarognecdentlriavteirosnsa.nd Aincsrcecaosneds stinudyliwvaesr sreuennatin 1,the7.6ratasnd ex83p.o9semdga/tm.1 mgN/om'c.ompoEuxnpdo-sruerlea-treedlateefdfecmtosrtawelriety was seen at macroscopic the and mhiigchroslcevoeplicofliveexrpospuarteh.ologAyddiwtaisonoablsleyr,ved in the aanpipmeaalrsedextpoosbeed raetver7s.i6blaen.d 83S.u9bacmgu/tme}.studTiheesse bylivtehre effects oral and skin absorption the liver. roInutetswoofchraodnmiicnisftereadtiinogn sctuodnifeisrm intheratesf,fecCt-s8 of C-8 on produced an increase and testis. iCn-8thewasinncoitdentceeraotfogetnuimcorsin intestthse liver, pancreas, by inhalation and gavage and was not mutagenic in the Ames test. -2- =Z EID087794 E 009424 A. Acute 1. oral ALD (rat) = 480 mg/kg (3.18). ALD (rat) = 670 mg/kg (3.1,3.5). . LDSO (rats) = 390 mg/kg (11.10). o LDSO (male rats) = 470 mg/kg (3.15). o LDSO (female rats) = 482 mg/kg (3.15). LDSO (rats) = 540 mg/kg (5,12). DSO (mice) = 457 mg/kg (3.16). LDSO (male guinea pigs) = 178 mg/kg (3.14). LDSO (female guinea pigs) = 217 mg/kg (3.14). o oC-r8alwadsosessligtohtltyhe tofxoilclowwhienng agrdomuipnsistoefrerdatsi:n swienagnl--e lfienmgasles(,21LDdSaOys=ol5d8)0:mg/mkagl;es,youLnDgSOa=dul5t73s m(ga/pkpgroxa-nd nigm/aktgelyandeigfhetmalteos,tenLDSwOeek=s 4o5l3d)m:g/kgm;aleosl,derLDSrOats=: 470 mnagl/eksg,; LnDeSwObo=rn33(6< mtgwo/kgdayasndolfde)m:alesm,aleLsD,SOLD=SO343= 243 nrge/gkargdsandtofethmealesse,x oLfDSOthe= 2r5a6tsmgs/hkogw.ed nTooxisicgintiyfiicnant odlidfefrerernactes. hadHowleovweerr, LDnSeOwbvoarlnue(s<twtohadnaywseanolldi)ngsandot young adult rats (3.32). o Cy-o8ungisadmuoldteramtaleelyantdoxifcemwahleenraatdsminthiastt'erweedreournatlrleyatteod oIrts sLuDrSg0iciasllbye-tmwoedeinfie4d00 (aonvdar4e9c1tommgi/zkegd oorf bcoadstyrated). wreaitgihots. werNeo csheaenngeisn finemallieverrawtesigghitventosibnogdlyewediogshets osfingulpetoora2l00domsge/kgof (eoivtahreercto10m0izeodr o2r00nomrgm/aklg).proAduced aCnastirnactrieoansereindulcievdertheweimgahgtnitoufdemaloef trahtes.liver weight hienacvrieearse lbiuvtersrattshancadsitdrattehed acnodntrgoilvse.n 2C00linmigc/aklg had asnidgnspersienenealinarC-e8a atnrdeatsepdorardaitcs wienicglhutdedlossstai(n3e.d21)f.ace EID087795 = -3- g 3 009745 =  ATwPoFOmzileedbweiatghliens 4g8ivehnouras.singPlleasmdaoseenzofyme4s50wemrge/kg mgiavreknedl20y0emlge/vkagtedhad24-e4l8evhaotuerdsGaPfTtearndiGnOgTestiinon2.4 hoDuorgss pwlhaiscmhaneonrzmyamleizeldevealfsterisoniendwieceakt.iveThofisceilnlcurleaarse in damage (3.3). pThreetroeraaltedLDSwOithofphC-e8nobwaasrbidteatlermsiondeidumionr rpatrsoadifen dhyidfrfoecrhelnocreisdei.n thTeherLeDSOwervealuneo osfignC-i8fic(a4n78t mg/kg) sfoodliluomwinogr pprreo-atdriefaetnmehnytdrwoichtlhoreiidteher(3p.1h9e)n.obarbital AsPiFnOglewasdosaedsminriasntgeirnegdfrtoomra1t.s5-b2y250stmogm/akcgh. tuCbleiniincal sairgonusnd ofthetonxoiscei,typewreirneeailnadcitisvciotlyo,rataiorned anddiscwheairgghet leonslsa.rgeAdnilmiavlesrs re(c3e.1i)v.ing doses > 200 mg/kg showed e mRagt/skgrheacdeiveinnlgargiendtralgivaesrtsric(3.d5o)s.es aGsastlroowinatses6t0i-n9a0l i(r3r.i5,t3a.t6i)o.n was also obsecved in rats ingesting APFO ApPrFoOd,ucegdivenno cinlinsiicnagllesi12gnsmgo/fkgtdooxsiecsityto (t3h.2r)e.e rats, eo EPxrceh-adnogseingResorinpaotst-1d00o0sinmgg/wkgithchDaonwgeexsth1e-X2t-oCxlicTon eDofvfeexcst,s oefithCe-r8 bienforraets.or AalflterratCs-8dohsaeddrweidtuhcedthe maolrotneali(t3i.e2s3).compared to the rats dosed with C-8 * Gsrionugplse odfoseyouofngeatdhualntolraatts60w0e0remga/dkaginiorsteare1d5%a asosliuntgiloen dionsetheoifrCd-8rinatkindgosewatleervelfsorof1420d0a,ys48a0n,d/oorr o6f70etmgh/akngo.l foInllothweedra24tshoaudrmsinilsatteerredbyaC-s8i,nglaelldotshee draaytss aafdtmeirnisdtoseirnegd. 670Inmgt/hekgroaftsC-a8dmidnieidstewirtehdinethanol afdormin14istdearyesdbe4f80oreandC-8670dosmign/gk,g aofllC-t8hedireadtswithin 6 dsahyoswedaftaershdaorspinign.creaLsieverinweaillghtt/hbeodryatsweitghhatt ratios rraetcseivtehdat C-r8ecwehievned coonmlpyareedthatnoolc.ontrTohlesre awnedretonothe scoingtnriofliscanatndditfhfeerreantcsesthbaettwreeecneivtehed ounntlryeaettehadnol or bC-e8tweaennd tthhee ertahtasnotlhatprer-etcreievaetdedonrlaytsC-a8dmi(n3i.s34t)e.red = . EID087796 2 3 0695.25 : i tSeoexicRietlyateadndRkeifneerteinccse o13f pfeorrfliunofrooromcattainooniconactihde. 2. skin LDSO (rabbits) = 4278 mg/kg (3.10,6). mRga/bkbgi.ts wSekrien diorsreidtataiton750o0c,cur5r00e0d, at30a00llanldeve1l5s0.0 bclrienaitchailngsiagtnsallinlcelvuedlesd, wweeitgnhetsslosusndearnndealtahbortehed mboodsyt, lecvyealnsosi(s3,.10d)i.acrhea, and lethargy appearing at o LDSO (male rats) = 6959 mg/kg (3.10,6). Mianlietiarlatsweidgohsted loasts.3000R,ats500d0oseadndat75050000mg/okrg 75s0h0owed mmga/jkogritweyrehadlewtehtargaincd/oocn sthteaindeady poferitnreeaaltmeanrteasa.nd the nCgh/ikogmod(a3c.r10y,o6c)r.hea was seen in rats dosed a-t 7500 sFekmianleirrriattsatidoonsedandatin5i00t0ialorwe7i5g0h0tmgl/osksg. shAotwed750m0ild anrge/akgwearestaailnsoednoftaecde a(n3d.12a,6w)e.t and stained perineal . + Aimrmrointiautmionpewrhfelnuoraoppolciteadnoattoethdeidsnkoitn opfrodruacbebits (5). o AtPrFunOk (a50n0d mlga)terwaals aarpepalsiedofassixanmaalqeueoruasbbiptass.te Atfotetrhe m2o4dehroaurtse sskeimni-oicccrliutdateidonc.ontaOcbts,ervAaPtFiOoncaautsed48mihloudrsto indicated slight to moderate irritation (3.9,6). ePvearlmueaatteido.n ofThrfeieveoftyptehse ogflovgelsove(sNeboyprCe-n8e,was mneeaossuyrnatbhleeticbrleaatketxhroaungdhnattiumrealandlatpeexr)meahtaidona rate ca-f8tersoleuitgihtonho(u3r.s22)o.f continuous expos1ure to a 30% See Related Reference 14 for additional information. 3. Eyes AwPiFtOh acaussmeadllgeanreearaloifzesdevemroederoaptaecitcyo,rneianlteorpmaictitteynt m3o8d.3eramtge ofiristoilsid antdestmodmeartaetreialcownajsuncptliavcietdisintwohenthe orciuglhtarceofnfjeucntcstivgarladusaacllyof raecerdaebdb,it'hsoweevyeer., Tthhee small -5- gz EID087797 g 068: vaarsea miofldcwoirtnhealvasocpualcairtiyzapteirosni:stedAnanedye ztGos2e1-d28widtahys RtaohredeeartaoetfsetslmtoiagthestrliiagtlhotmaoncddoencpjarutonemcpttcilovryintweiasalshweiodtphachanidotyaLeanlsdtmailcl wGfioErtfehcimtni.ld14Tchodeanyjsueynec(t3i.w0va)as.lnorremdanlessw,ithwihnichsewvaesn dmoatymssiexcept A2PFOrab(b1i0t0smg()mewaanssmcoordeera=te1l4.y0;irrhiitgahteisntgptoossitbhleeeyes Fs"ecEtofereectesv=ida1e1pn0p.te0a)ri.endunwIwhraeisndihaeeldyeseaynewdse,rceonbwjuatusnhcoetndilvyaalccotneejrfufneccttisval exposure (5). RDaetrsiodexpeoxsheidbitteodAPcFoOrnedaulrinogpacaitfyoura-nhdouwriceirnahtailoantion wdhayisch (w3e.r6e). still microscopically : evident after 42 4. Inhalation - + Four-hour ALC (rats) = 0.8 mg/L (3.6,7). GgCro/onLuc.pesntArotaftiaroantcssonwocfeerneAtPrFaetOxipoornsaendogfinfgo3r.2frfoomumgr/L0.h3oo8urrsmhgi/gtLhoert,o 5a.i7l eeTxnoplsoasrudgareteeadnrtweitturhreinanicnhge48d thoaoumnroasrxmiaamlfutsew:istehevixenpnost4u2ored1.a4ysd.aLyisveAraPfEtOer "ashighly toxic yhen inhaled but no changes in cell morphology were observed (3.6,7). * d-hour LCSO (rats) = 980 mg/m' (11.12). NnSooimgindsneaaltdhusrcionnrgceesnuetlxtrpeaodtsiuocfnerovmoefraeABoFnrOeedh(on1ua8r.s6alemxgpd/oiLss)uc.rhearCtgloeinaical yaYenealdlomlwaactresirtmiaaaitlniionangf.ouofndStihmteihelaacnevoe-ssgi,egnnisetxacalepspsefiuarvr,eeddsrapyloisvtra-atlieosn,, exposure in a ld-day observation period, Bilateral mSoutttolpisniges of(5t)he lungs was observed in eight of ten 5. Intraperitoneal Injection e LDSO (mice) = 192 mg/kg (11.3). . o Stehee RteolxaitceidtyRoefferpeenrcfelsuor15oocatndano1i6cfoarcidi.nformation on e- EIDO8T798 5gg 009525 B. Extended Studies 1. oral - BwiiotchheAmPiFcOa-lindaundcedmorhpehpoaltoogmiecgaallycwhearnegesstaudsiseodciaitnedrats. oGfrouApPsFOofformal1e, 3r,atsorwe7redayasd.miniSsomteererdats50 rmegc/ekigv/edday dCoiste-.labeThleedrsatosdiwuemreacektialtleed34aftheorurstheaftlearsttdheaselasotr 3 hSooudrisumafatceertatteh,e aanddminthiestrlaitvierosn owfererardeimoolvaebdelefdor eixnacmrienaasteidoni.n alLlivAePrFOw-etirghetastedwerreatss.ignTihfeicarnetllaytive amount of DNA/g total amount of ohfepaltiivcerDdNeAcrweaassendo;t hsoiwgenviefri,cantthely aNf-fdeecmteetdh.ylasCeytoacchtriovmietyPw-e4r5e0 asnidgnbifeinczapnhteltyamiinncereased bayndAPcFaOrniatdimninei-sptarlamtiitoony.l-trCaanrsnfietriansee-acaecttyilvtirtainessfewrearsee daelnseothsyilgansiefiacacnttilvyityinwcarseasdeedc.reasEetdhoxayftreersoroumefino-rO- tdhirpeheosdpohsoegsl.ucuGrlountyalt-htiroannes-fSe-rtarseanswfeererasneotand uridine SIingcnoirfpiorcaatnitolny aofffercatdeidolbaybeAlePdFOsaoddmiiunmisatcreattaitoen.into hanedpatsitcerollispidcsonetxacienpitngfo2r7 dciaarcbyolnglaytcoemrsolwsa,s squalene, Psrioglniiffeircaatnitolny oifncrtheeaseedndobpylAaPsFmOicadrmeitniicsulturma,tion. mtirteoactheodndrraitas,, anThdepehreopxaitsoommeegsalwyasinodubcseedrvebdy AiPnFO is dPueeroxtiosohmyeperptrroolpihfyerartaitohnerdotehsannohtypenrepcleasssiaar.ily result iinncrheyapsoelipiindelmiipao,genasesiesvidiennctehde btyreattheedobrsaetsrve(d9). Atdomisniixstrraatstiocnausoefdtemnodesruactceesseinvleargdeomseenstofof6.t7hemgl/ikvger aSnidmulstlaignhetouselnylartgheemreentwasofakisdlniegyhst daendpretsessiteosn. of pSalnicgrhetaltyicenwheanicgehdt panndeumtohenitliusngs(3o.2f).rats showed o dIinspaertswion-gweeakgenfteewdaisngasdtmuidnyi,ste25r%edTeifnlotnhe wdiiteht AofPFOa gtrhoeuptroefatesdixanriatmsa.ls Ahfatderslaighttwloy-weheekavireercovleirvyerspertihoadn the controls or animals receiving Teflon without the APFO (3.2). EID087799 " -1- SE [DEER] 0 Ca-c8encpmraozduciendTaants infecdrez3s00edppimnciofdenCc-2e ofofrLeIydyeizgrsc.ellA hsionrcmeonaCl-8 (wnaosn-ngeegnoattoixviec)inmeschhoactn-itsemrmwsasteesxtasminfeodr genotoxicity. Ggraovuapgse days. oatf daodsuelst mofale1, Also included, ra10t,s w2e5,reoradm50inmigs/tkegr/eddayC-8forby14 in'addition to an ad libitum c5i0nontmbrogod/lykgw/gedriaoguyph,tC-w8aansdgroarueppl.aaitriAv-efeddaocsecc-eodsnestrpooerlnydegsnertxoupdoregctaroneatshee: w(eAiSOg)htsweiofghttsheva5s0 msgee/nk,g/wdiatyhgrtoheupresliagtniivfeicAanStly less etshtarnadtihoolseloefveltshewepraeir-efleedvatceodntrionlst.he S10e,rum25, and 50 mngg//kkag//ddaayy ggrroouupps.wereEst2r.a7d-ifoolldlgerveelasterinthtahne t50hose of etshetrapdaiiorl-feldeveclosntrooclcsu.rredTheatinthcereassaemeindosseerulmevels as tshiegniifniccraenatsedoiwnnwhaerpdatitcrenbdetwai-tohxiddoasteionwasactsieveintyi.n A 2sderulinbitteusmtocsotnetrroonles.leveHloswevwehre,n wchoemnpartehed w5i0thmg/thkeg/day gsirgonuipfiwcaasntcomdpiafrfeedrenwcietsh wtehreeirsepeani.r-feCdhalcloenntgreols, ne eLxopceactiimoenntosf,`a whliecshioncaniniadnenetnifdyocrtihneepraxeisse,nceweraend udnodwenrwtaarkdentretnodcilnarisfeyrumthetessitgonsitfeircoannecefoolflowtihnigs the aofdmirnaitsstrwaastioandmiofniCs-t8e.redIn50 thmigs/kge/xdpearyimoefntC,-8 a fogrrou14p deaiytsh.er Oanehumhaonurcbheofrioorneictergmoinnaadtoitorno,pinrat(shCGr)e,ceived gcohnalaldeontgreo.pin-FroellloewaisnignghhCoGrmcohnaelle(nGgneR,H),seorrumnaloxone stiegsntiofsitcearnotnleyldeevcelrseasiendthbey 5500%mgf/rkogm/dtahyosegrooufptwheere 2Rodtsliibgintiufsiccaonntt,rolwse.re Sseiemnilairn dseecrruemasteess,tosatletrhoonuegh nfgo/lklgo/wdianyg CG-n8REgraonudp.naloxone administration to the 50 TtheessteostsetruodnieesfsoulglgoewsitngtCh-a8t atdhemindiesctreraasteioninwasserduume to Aandlreossitoneneadtiotnhee lleevveellsofinthteheteCs-t8ist.reated rats were dseucgrgeeassteidng60t%hefdreocmretahsoese ininsethreumadte`sltiobsitteurmonceontrols, fthoellocwoinnvgershiCoGn cohfall1e7n-gaelphmaa-yhybderodxuyeprtoogeastdeercorneeaseto in aenldervoastteedneedsitornaed.iolThleeveclosnclinusitohen wCa-8s tthraetatetdhe rats may be responsible for the decreased relative 8 EE EID087800 < 000226 Jaecvceeisssorsyiensexincrtaniasn, weciignhdty aasndwesielrumsstethsetositnecrroenaesed cihnrcoindiecn,ce2o-fyeaLreydfiegedicnegllstauddeynomians roabtsseravdemdiniisnteared c-8 (2). . Amg/gkrgou/pdayofofmalCe-8 raftosr w1a4sdaaydsm.inisItneraeddditbyiongavtaogean25ad o1ibtihteun25comngtr/oklg gCr-o8upg,rouap.secAonddeccroentarsoel iwnasbodpyaira-nfded laicvceersswoeriyghotrsganwasunisteenweiignhttsheaCn-d8angroiunpcrwehaesne in gcroomupparewdas wictohmpatrheedafdo libtihe tpumairc-ofnterdolc.ontWrholen grthoeupC-8 osnelryumthteestloisvetrerowneeighctonwcaesntriantciroenaserde.maiAnletdhouungchhantgheed, htihgehesreruinn tehsetraCd-8iolgrocuopncethnatnratiinonthweaspasiirg-nfiefdicantly control group (1). o Aobnseirnvcerdeasiendmilcieverfedwei30ghtp/pbmodoyf Cw-e8ighitn trhaetiixo wdaiset for o1f ndaoynsa.decWahfelnuorC-o8decwaasnoiccomabciinde,d waitshimialnarequeaflfecatmowuanst produced (3.31). @ G3r0o0uposr 3of000tenppmmicoef wCe-8refofred14a ddaiyest. coAnLtLaintihengmi3c0,e 3f0e0d 3pp0m0.0 ppBmodyofweCi-8ghtdieldo.ss wDaesathisndiaclsaotedoccautrr3e00d aatnd s30h0a0rpppimn.creaLsieverovewreigchotn/trbooldsy wineigthhet mriacteiosfedshotwheed a 30 ppm C-8 diet (3.26,8). G1r00o,ups300o,f 132000m,ice300w0ereorfe1d0,0a00dieptpmcoofntCa-i8ninfgor101,4 30, dpapyms.grouDpesa.thsBoodcycurwreeidghtinlotshse w10a0s0,ind30i0c0ateadndat10,t0he00 benoddyofweiegachht wreaetkiosatsh30o0wedppma asnhdarpmorien.creaLsieveratwe1i0ghptp/m ainndclwuedreed wdeoasken-edsesp,endternetm.ors,Clipniilcoaelrecstiigonns, ofpaltlooxri,city stained perineal area and unkempt appearance (3.17). o Cw-e8ekswastoadrmatisnisatnedremdicethraete thtriemeesdaosweeelkeveflosr, th0.r1e,e o1.c0curorred10imng/tkwgo. feWmeaaleknemsisce fdoolsleodwedatby10demagt/khg. bSoptohradsiecxesweiogfhtmicleo.ss Awassisgeneinficinantthelivfeermawleeigrhatts and aidnmcirneaisseterweads n1otaendd 1i0n bmgo/tkhg.maleSiagnndififceamnaltelymice aindcmrienaissetdereldive1r0 wmegi/gkhgts(3w.e3r3e). also noted in male rats = : EIDoggg, g 009525 t e GG.r0o%u,ps8.o4f, mi$.c3e. we1r.8e, fe2,d a10dioert 30conotpmainoifng80.0f1o,r 20 dsalyisg.htlyLivheerasviewrereatsi3 gpnpimficaandntlayppeheaarveidernoramtal30atppa, g10roupppms. fedNo1chpapnmgeosr ilnesslivoefrC-w8eig(h3t.2w9e.8r)e. seen in the ARtats10w,e0r0e0 afnedd 300-,3000,0000ppmppmallAPFaOnimdaalislydifoerd w2i8thdaiyns.the bfiordsytweweiegkh.t anIdn agneneirnaclr,easaendimallisvershwoewiegdhtdec(raetas>e3d0 pFoeml,atemdalehsistaonpdat>h3o00logpipmc, chfaemnagleess)a.ppeaTrreedatmiennta-ll test dgorsouepds.at >In1a000sipmpimlardietdeswtituhsiinngtmheicefiarlslt atnwoimawleseks. Amtuscduolsaers woefak>ne3s0s00weprpem eavirdoeungth hianirmicceo.at Sanldight aCyvaenroasgies,livdeercrweeaisgehdtbwoedryeweailsgohtnogtaeidn a(n5)d. increased G1r00o,ups300oforten100r0atsppwmeroef Cf-e8d dfioerts90cdoanytsa.iniNnog c10h,ang30e,s cinonsgiedneerreadl btoehabveiodri,recatplpyearraenlcaetedor tosurCv-i8vawle.re Aseen csloingshutmptdeicorneawsaes sineenbodfyorwmeailgeht rgaatsin inandthefoo3d00 and u10r0i0nalpypsmisgrovuaplsu.es Hfeormattohleogfiecm,alebiorcahtesmischaolwedandno vcahlaunegses obctoanisniedderefdor tothebe marleelsatesdhotwoedC-a8.sliAghtfew dleovweiratieornythfrroocmyttehe cocuonntt,rolandvaleuleesvat(ei.de.blosoldiguhrtelay Cniotmrpooguennd-raenldataeldkalgirnoessphoobsspehravtaatsieonsvalsuuecsh).as tehnelarsguermfeancte oafndtvhearyliinvgerdweegrreeesobsoefrvdeidscoalmoorngatimoanleon orbastserviantitohnes10a0m0ongppmfegmraoluep.ratsThefrreomwetrhee n1o000sucphpm gfreoveulps.or sintamtailsetsicoarllyfemsailgensififcraonmtlovwaerriatdiioentsaryin csoemxp-ogurnodup rmeelaantedo,rgaonccuwerirgehdtsi,n wlhiivcehr woefreratcsonsiindetrheed u3n0a0c-coamndpan1i0e00d bpypmagnryoumposr.pholAolglicothaelrtervaatriioantsi.ons were Mciocnrfoisnceodpitcoaltlhye, lcivoemrp.oundT-hreellaetseidonslescioonnssiswteerdeof cfyotcaolplatsomimculteinfloacragle,menvteryofslhiegphattoctyotessliglhotc,ated in cIeonbutlreisl,obualcacro-mmpiadnzioendalin resogmieonsinsoftantchees afbfyecitnecdrealsievedr almiopuonftuscGfin yeinllocwyitsohp-lbarsomwnof phigempeanttoscytreesseamnbdling oicnccaisdienocneallayndinrelsaitniuvseoidsaelverliitnyingofcetlhles.abovTehe lesions -10- EIDOST802 g5 00053% g . wmeernesprteedeomiienanttlohy asevmo.n Tphaelesctnaenrd mcohraengepsroncoeucnocredded niinnatutmhoresatlllyiivneosrctcanuacrnerdsinogtahmedorinsgetaitssheessuecsaonndwterrotelheylanedswieortenesstproefrsaetnst (5,111). . Gorrou1p0s0 opfpmraotfsC-w8ereforfed13diweeetkss.contBaoidnyinwgeig1,ht10a,nd30, Cweurmeulastiigvneifbiocdayntwleyiglhotwergaitnhanforthotshee o1f00thpepmcornattsrol GSriogunpi.ficHaenptaltyicinpcarlemaisteodylinCorAatsoxiaddamsienisatcetrievdity30waasnd 1t0r0anpspimenotfly C-h8i,ghearnd lervaetlss.admiEnnizsymteereldeve1l0 sppafatehrad 8 waedemkisnisoftrarteicoonvewreyrefonloltowisniggnitfheica13ntlwyeekdsiffoferednitetafrryom tihnocsreeasofedthaebsoclountterolasn.d rAedlmaitniivestrlaitvieornweofighCt-s8 canadused haedpmaitnoicsetlelrueldar10,hyp30e,rtroroph1y00 inppmtheofliC-v8ersaftoefr ra4,ts7, ahnedpat13ocewleleukslarofhytpreerattmreonpth.y diThdenoptrogarpepesasriaptoofbe aoonfbfseeicrntvteerddacbeayrlelutlhsaeurggleemsnetgtitahvbeolofiofsmtareaacntdommepmnoatuy.ndb-erTehaelsastcoehcadinagteeefsdfect wTietchovepreyr,oxitshoemsee pchraonlgiefserawteiroen.notAtobstehreveedn,d of icenvdeircsaitbilneg. thaTthertehewaisncnroeasceonsiinstleinvterpawteitgehrtnsfwoarsthe h2o8rmoandemindiestterramtiinoant.ionsNonwehicohf ctoheuldhobremonaettrliebvueltsed to wtehreere saipgpneiafriecdanttloybedifsfomeecenitndifcraotmiocnontofroleslevaalttehdough edestterramdiinoaltifoonr. theThe100NOApEpLm gwarsoup1 aptpmth(e11w.e1e3)k. 5 Gorrou1p0s0 mogf/kfgourofmoCn-8keypservedraey afdormin90istdaeyrse.d 3,The10, 30 mmtoghen/kkegsy/tsduadyyt).reaaAltlteddtwiheietdh3d0utrhmeign/ghkiggw/hedeearkysddootssweoa,geth(rl10eo0vueglh, fitvhereeof malolnkesyhsowdeidedsidgnusrinogf wteoexkiscitsyeveinn tthheroguaghstr1o2.inte'sThteiynal btlraacckt s(taonoolrse)x,ia,paleemesfiasc,e asnodmetgiummse,s bsrwoowlnleninfcaocelora,nd epyreoss,trastliiognh.t toThesevmeornekeydsecrofeastehed a30ctiavndity100and mfgr/okng/tdhaeyfdiorssatgeweelkeveolfsthsehowsetdudyb.odyBewceaiugshet olfosstehse cdcaoornsldayugcetdeeldae.tvehls,Tohfethemtohenckleimynosinckaealyts lthaaetbort3h0aetomrg1y/00kgt/medgsat/sykg/wddeoarseyagenot Tevel showed, in the first month of the study, -11- EID087803 g: 000%55 wBseetlielihitials idrLecncrierczeacareseepd.fnicapilrikonaltihtnrieomembpihtnoRs.PpthimaTe.tTa.sa0endtaacilntuievasci,ttiyvaasitned 2mtohelnokwesyearlufbmruoam(isntthavitsailsudteoi.scaaglelAyt lestvhieeglniefniidncaotnfhti)st.hepersOtinulodydy,osnheotwheed oTnelveyl resmhaowiendingappmaorneknety afnreommiat,helo30w mblgo/okdg/dgaluycodsoes,age Vaallkuaelsi.ne Tphheorsephawtaassem,o mtootratlaliptryoteaitnthaend10albmugm/ikng/day mGdaooysnsakgeeyin lewexveheeilkb.it1e2 dOnaepndalmeoonckcfeaaycseihoanadnadllbylgaucmaksn.orsetoxAoitla tohainnsd sedovnoeesraagle level there was a very slight increase in the ASf.iiPrg.snTti.fTim.coanntvtha)l.uoefs Tthhieneresthteuwedryfeem(annlooet csmhotannakgteeiyssstiicdnaulrtliheyngotthheer indices and no changes in the body weight. In pTseihvnoegsllpseh,atmaotsnhekeeryeisnwetfrhreeomstertrehuenmd.s3 tanoIdvnar1t0dhedmegcc/orknegtra/osdleadyandadolskaatglheiene3 Rtcgoh/xaikncggie/tsdya.yindoStshoaefgtebosdtloyeovlew,leigdthhiteasrrerhaewnaadsonronoesimmgoenrsstiasloifwteyr,e no moebnsteirovneeddocsciagsnsionoaflltyo.xicTihtey mionrttahelit3y0 aanndd t1h0e0 above Tmhge/rkeg/dwaasy in single madoosntakrgeeeynsd laettvoewlatsrhedwet1r0heemgcs/aommkepgo/udsniadgy-nrsdeolsoaaftgeetdo.xliecveilt.y bTSheietgnwse3enomfg/tkhtego/xidacadiymtiynd,oissatgeTerheedrleedveoilssesasneaemnesdvidttoehentbedergefrrleeaeetiooofnfshtihpe wtteoirxseiscuiectsoyn.soitdhNeeorredtgrhoacsnosmptohoreunmdaid-crrreenolasalctsoe,pdicwbeornleeesmisaoernersnowwi,hnicshpleen and lyaph nodes for male and female monkeys at the at3n0hedan1a0dd0re1nm00agl/smkgg//fkdrgao/yndamdaoylseadgoesaandgleevfelelemsvaellehsa.mveonkMceioycmsrpoosauctnopdtihceal3l0y, mCaerlcatoewdfmraormkemdaledifafnudsefemlailpeidmdoenpkelyestioant; thtehe 30bonaend TS10yl0aipghhmtg/nkotgode/sdmaoydferrdoaomtseamgaelheyplaoencvdeellslfuelhmaaardlietcymo;omnpkoteuheynsd-srpaetlleaettnheedan3d0 maondder1a00temagt/rkogp/hdyayofdoslaygmepholiedvelfsollhiacdlecso.mpound related mSetaantiwsetiigchatlslyofsiganiffeiwcaonrtganvsarioactciuornrsed inbetsweexengrotuhpe waCeocrncetormooplfanuiaenndkdnobewxynpemrboiirmopelhnootglaiolcgailcgarlosuipgasnl.itfeircTaahtneicsoeensvaan(rd5i,aw1te1ir.oe2)n.snot ia EIDO87804 gz 005% B dGireotuspscoofnta1i20ninrgalecizaancdr 1210G ofxema3l0e0 LrPaRts Gfwar-e fefdof UP utnotrtewoateydearfse,ed.whilTeheamacjoonrtroiln-lgirfoeupfirnedcienigvsed only daossseo-cdieapteenddewnitthdeC-c8reaasdeminiinstmreaatniobnodycownesiigshtted gaoifn aand maalterse;atamenstl-irghetlatterdeatimnecnrtea-sreelaitnedfooidncrceoansseumpitniotnhe in Tihnecriedenwcaes noof aitnacxrieaasewasinombosretraveldityinobtsheecvfeedmaliens. peoiptuhleartitorne.atment group when compared to the control Cr-a8tsrecloantseidstehdemaotfoldoegcirceascehdangreesd bsleoeond icneltlhecoturnetast,ed thienmeosglotbhirno,ughaonudthetmheatotcwroi-tyeavraluteesstspeeernioadt. vaWchiiolues vtheerydeecarrelayseisn tihneersytutdhyr,ocyttheiscocuonntdsitiwoenrediodbsneortved ptrwoog-ryeesasr sitnutdoy.a generalized anemia by the end of the wHeirsetopfaotuhnodloignictahlelyl,iveCr-.8 aTshseosceiatcehdangteosxicwercehanges sCihzaeraocftertihezedlivbeyr icneclrlesasweidthlivvaercuwoeliagthitosn, ofinctrheeased dceygteopnlearsamt,ionanwditshomeocceavsiidoennacle sofignhsepaoftocneelcrlousliasr. As wcihtahngetshewerreed nblootoedd ecealcllyfiinnditnhges,stutdhyeseandlivsehrowed vreermyainldietrtleofevtihdeentcweo-yoefarprosgturdeys.sion over the Trheelatiinvceildyencleowofandtumtohrestyfpoeusndofinnetohipslassatsudyfouwansd were not different from in geriatric rats. tHheepattuomocrellpurloafriletsumocrosmmwoenrley vfeoruynd hsolwiegvhetrl,y niontcretaosetdhe ienxttehnethitghha-tdowsoeuldmalbee erxatpse;cted hcoenpsaitdoecreilnlgulatrhe smtoirmpuhloaltoigoincaflirsetvidseenecne atof thcehronic one-yeac necropsy (11.11). wAeLrLeofcartcheinolmiavserantdumotrhse ifnocuinddenicnethien atbhoeveconsttruodly, 30 pfpemm,aleasn:d 030/050,ppm0/5g0r,oup1s/50()madleisd: no3t/50a,ppe1a/r50,to5/b5e07dose trheelatleidv.er T(hmealeisn:cid1e/5n0c,e 0of/50n,odu2l/a50r;hyfpeemralpelsa:sia0/5i0n, s0/t5a0t,ist3i/5c0a)llywassiaglnsioficsainitglhytly(3i.3n5c)r.eased, though mot -13- EID087805 zg 2 000525 APLrLacuocfedtheinotthheirs tre1muayrkawbelree stsusmcocrliiintecdidewnicteh values Shdocrine or endocrine-sensitive organs (3.35): T(h2e03)i,nci1d9e/n50ce (o3f8%)m,amm2a1r/y50gl(a4n2d3))fibsruogagdeesntoemdasa (10/50 Hcaosmkpeoluln'ds-cehliasttoerdiceaflfeccto.ntroHloweivnecri,denwcheen focromptahirsed strain of rat (373), there does not appear to be to any compound-celated effect. E Ts(hu0eg/5g0eisntc(ii0vd3e)e,ncoef3/5oa0f cto(e6m%sp)to,iucnud1l/-a5rr0elaL(te1ey4d%d)i)gefwfcaeeclslt.alasdoeWnhoemnas csotmrpaairnedoftoraHtas(k6e.l1%l,`s rcaongnetro1l-12i3n)c,idetnhcee infocridetnhcies in tihnecre3a0s0e.ppm group shows a statistically significant . + ci-n8vevsatsigaitnicnlgudeedxtrianheapamteicc.hantiusmtoircibnidduacstsiaoyn by cInomptohuinsdsstwudhyi,ch30i0ndupcpem poferCo-x8isowmaes pfredolitfoerraattisonf.or t2(w/so8i0nygleiean,rsa.dmulltIiinbpcilrteeu)amsehcdeopnatitrniocclisdeanadcneednsom3ao/sf79c(o1imn0b/i7p6naeidvre--rfseuds c2/o7n8troilns)c,onLtreoyldiggrocueplsl),adaenndomacsomb8i/7n6edveprasnucsrea0t/i79c and accoinntarrol ceglrloupasd)enowmeraes n(o7t/e7d6.verTshuestu0m/o8r0 ainndcid1/e7n9cesin wfaeodrrjeusHtoamusetknsetildlesLtatahbteoirsathtiiocsrstyo,railcsaaonld sicunopnpatodrrdotiletdiiontnhc,eidecangocene-clursainogne tlihvaetr,thepantcurmeoars,inacniddentceesstiswer(e3.e3l6,e1v1a.t1e4d).for the 2. skin o Tfhorreesixgrohuopusrs/odfay1,5 mfailvee draaytss/wweereek efxorpostewod dweeerkmsalltyo 220000mg/mkgg/,kg20r0atsmg/lkogstorwei2g0h0t0 mdugr/iknggAPtFhOe.. ex`pAotsu2r0e0 of pSearliiovdatiaonnd wsahsowendotesdligahtt20r0e0ddmegn/ikngg. ofDtohsee-rsekilna.ted ifunnccrteiaosne.s weLrievernotdeadmagien weanszymfeosundmoniintoarllinggroluipvser wfaoslloawninigncrtheeasetenitnhlidovseer. weiDguhrti.ng tCroeaagtumleanttivethere niencrtowsoisratosf dtohesedepiadter2m0i0s0 amtg/ktgheafdtoesre stietnedawyass.noted Btleonotdh odaryganofofleuxoprosiudree.leveTlhsesewerdeecreelaesveadtedduocningthea 14-42 day recovery period (3.11,6). -14EID087g05 009:36 3. Inhalation Gpraorutpisculcfar ivatmroorssphewreerse Bours a day, five days osfxpo1s1edo,f h83edmgs/omly,offoC-8, six a week for two weeks. The bexopdoysewdeigrhatt.s shLoiwveedr aindjoursye-roreladtyesdfunscutpiporneswsaison of eSnuzgygmeesstedforbyupdostoe-r28eldaatyesd ealfetveratitohneslaosftpleaxspmoasure. Lthieverenddegofenetrhaetieoxnposwuarsedpeetreicotde.d hiTshtesoelogliicvearllyeffatects wfeerceovencoyt. obsEeyreveedxamafitneartio1n4,s 3r2evoerale4d2 dnaoyscoomfpound related effects (3.7). + Gdaryosupsa wofeekratfsorwetrweo ewxeepkossedtosi1x.0,hou7r.6s aorda8y3,.9fmivge/m QoefixSpcochs-a8u.rrgee.osbhsoewHreovdweavtoeinrol,nys safloftiegrhctlitnnhiarcseaaell toasnidgfnosuorcudlduaarryisngon atTneaostttshehartadw8a3ls.o9stsmagac/ccmio}fniscoiendederiranabtleexdtiaremedomuidnsu.trinogfBotewhexipagohfstu.rtehesaBenoddy Gwfeigihhte ocfonttrheols1.0whimlg/em'thegrbouopdsy wweerieghtssimioflartheto7.t6hose gbo/dym wegirgohutp wrearteiossigdneimfoincsatnrtaltyedhigahedro.se-rOerlgaatnedto wsTeiiivggenhrit/fbiocidamynmtewdeiiiangtchretelaysreaafttiieonrs lwueenxgrp,eosuslriievgenreinfdiaencdda.nttlesyTtheehsigher pienritohde. 83.C9linmgi/cma}l glraobuoprattohrryougmheasaur2e8m-ednatysrecovery ephmoosnpshtartaatseedinanalilncerxeapsoesurien gsreoruupmsalakfatleirneten Etxhproosuugrhes1,4 wdhaiycshofperrseicsotveerdy.in Ptahetho83l.o9gicmga/lml group eTevsailounastioinn trheevea7.l6edanhdeav8y3.9livmegr/sm angdroumpisc.roscTohpeisce . Gpceheraminoogndes.strawetBreleododaredvfoelsruseoir-birldeeelatafenodalllyopswriiesnsgencclaeea2ro8lf-ydCa-y8 reincovaelrly gBrloouopdsdeicnrcelausdeidngwittheh ctoinmet,rolbsu.t waTshedeatmeocutnatbloef Ca-f8terin g8r4oudpays(3.r1e3c,o7v)e.ry in both controls and the 83.9 mg/m} . cRheapnegaetsedanedxpoesluerveatoefd orratgsanotofluCo-8ridperodluecveedlsli(v1e1r.12). c. carcinogenic Potential pInrodcuhrcoendica,n 2i-nyceraerasefdeediinncgidesntcuedieosf tiunmorrasts,inC-t8he Liver, pancreas, and testis (3.35,3.36,11.11,11.14). -15- E EIDO87807 z 009.37 . * @ See Falsted Fsfarsnces 17-23 for irfcrrmation on the hepazocazcinogenicity of perfluorocctancic acid. D. Mutagenic Potential o AtPyFpOhiwmausriutmestsetdraiinnsmiTcAro9b8,ialTAas10s0a,ysTAusi1ng5SaT3lAm1o5n5e3l,7la AlL tSEeTAstTsSH0weraendneSgaactcihvaeromWyictehs ancderweivtihsoiuate astcrtaiivnatiboodn. (5,12). . cC-e8llshadanda nloowevoirddeernceofofcyttortaonxsifcoirtmyatiionnCw3aHs107-1/2 observed (11.8). - mSueetagReenlaitceidtyReofferpeenrcfeluo2r4oofcotranionifcoramcaitdi.on on the E. Developmental/Reproductive Toxicity eo The oral administration of APFO at 25, 50, 75, 100 noorrogta1n5r0oegsemunlget/skigis/ndaa(yndyaytsodeasrtiahxtss.tdhurAroiungtghoxit15cheoeffpfeegrceitsotda.otofiforne)dudciedd obfodygeswetiagthitongaiinntoheccu1r50redmgb/ektgw/edeany ddaoysse sgirxoupa.nd nThiene etfwofecntonopnregbnoadnytwe1i50ghtmgo/nkgd/adyaynirnaetsofhadthea msotruedysetvhearne Cthoensipdreerganbalnet ahimgohuntdosoef dwaemisg.htThaenyd lonoestwaas observed to have urinary incontinence on days 11, 12, and 13. `nsTighg/enksgp/rdaeangydnandgtoasiendeadmgsrowueopfisghttdheidat25n,octom50ph,aavrea7b5,laebannoldremvae1ll0s0 cltoinitchael control group. Four fetuses were examined from each soffeorctfioeouyreneddchaamhnsagdeisne.yethAeclhla25ngoefasndthce1o5n0sriemsagtd/aibknlgge/dofafyetodunoesseesorgrmoorueps torfhurnontiuhnegghfootlnhleeo-whliaenlngfs: otro ladtrhigrseeoer-glqeanunsairzteclederfslte,nosfdaftrhikeberwssat.yreakThe Ltehnosseaobbnsoerrmvaelditiiensthoeccutrworedpreivniotuhse staemreatolloocgaytion as asbtnuodiremsaliotniecshemiincatlhliys srteuldaytedappceoamrpoeudndmso.re pThreonounced stthuadnieisn, thteheprteevriaotuosgensitcudieefsf.ectIwnasthea pdreevveilooupsmental eye abnormality which appeared to be an arrest in development of the primary lens fibers forming the aembberryroantailonslenosf tnhueclesuesc,ondfaorlylowleednsbyfibseerconofdartyhe fetal nucleus. The same general morphological changes occurred in this study (11.6). 16- 069225 EID087808  TGShr0ro2eu7eps1ro0a6ftshprianegentahneOtfhiCrgaEhts downoseerceeyGeraodumfp-i1nfGiisetoaef.regderii-0&s.0t5ic,ianus1.e5d, oTroweamebarnyotbooxdiycweeifgfhetcstsinwertehisfogurnodup(.11.7N)o. teratogenic . + JgPaervceauggrneraendtonardnaadtyssduwer6ri-en15gadotmfheingiedssottsaeitrniegodnp.e1r0i0oMdma,tge/rktngha/eldasyduerabvtyihvsing dtahmes cgoanitrnoeld lterations wadaebmroseu.t soounEgxeht-tet,rhniaraldn,d levtsihsesceebryoaedlsy, woefaingdshetvsekretalhlaental TsfheteteursoeenoslsycooffpiinecadacilhnlgylinantodtteerdhistinthaotlbootgchioculagdlroluyppossfsoriwebrlaeylteberexaatmCii-o8nnesd. VcTeeerslsiauftseidcatwthaeisonianncsiidtieensnccreoenasientdhethienfciricsdotenntcrleoulmboafgrrofuevpte.ursteesbTrhaiwesith dTSitif1gfneiprfreiencscaeenntceinownalisyncipidfreonabcnaeabllyywzasead srbetysaptoianssoteincea-tltolayigleenderatlesitz.ed 0oS8tsrtetpshasereoeuvfnofksepvdiraibnbigylitfthryeo,m tgaordxiodcwitthisotnaratalete,dofamasntdhegdiedvavepensl.oCp-m8eTnhwetere xAfodatmmiindnieasmttoienorsentdr.aoftedCtrheitoteprubeipasaodffvoerrdseeexvlteyelronpaamflefnetcatletidenrcalbtuyidoetndhes C-8 and Sphthalmoscopic examination of the eyes (3.25,10). o SGotrfoug5p0esstmagotf/ikogpnr.oefgnaCAnt-t850irnambdgbi/itskstgiwltelhreeeddwaaamdstmeirnliosostnterdmeaodyrse1w.65e-,1i8gh5t wCehraen otbheseruvnetdrea(t1e1d.9)c.ontrols. No teratogenic effects GG2r1aoyunpogsnymdofayosfprCe6-g-61n.5antofMartgaetesrsntaawlterieodneaetxthposos0.eo1dc4c,ufrorr1e.2ds,ixat9h.9otuhteost21a nags/oansg g/m tcghroeonucpse.unrtvrNiavtoiinotgnerdaanatdmosgeonvaiencrdt armetosonpxgoincsitethyoswweaassofobesvteiherdveen9dt.9 waa%staenomybpsoerofravryetdheroeendlxuypcotsiieondnthgiernou2tp1hse.mbgo/dEmymbrwgyeroiofugpeh.ttalofOtthotexhreicipttuhypasn SEeceonm ithneth2e1 mofgf/smprignrogup(,3.m2o4,1a0d)v.erse effects were F. Metabolisa Animal studies dSSeitxsupdoyasniditnisopcneactsio,efsmridacidefi,foelrhaeabnmecsletesedrsiC,-n8athnwedereerxacobrbbeisttesir.ovnedTahniedn a 174 = EIDog7g09 Z easy ftheemalzeimirnaitseacnrdedthedosmealebyha1m2s0tehrouresxcarfetteerd odovseirng9.9% of Ceoxncvreertseedly3,9 ainhde G6a0.%coffa.the27%admihienisfteemreleed tdoesmestebry 120 htohuersC-8posats-droaspiindgl.y anBdothcomspexleestelofy arsabbtihtes feexmcarleeterdat aonndlyma2l1%e ohfamsttheec.admiThneistmearleedanddosefeminale120micheouresxcreted (3.28). . HCa2l8ebayndintfermaavleenoursatsinwjeercetioand.miniFsetmealreesd hraaddioelxacbreelteedd ehosusresntwihaillley t1h0e0%maolfestheexcardemtiendistoenrleyd2d0%oseofwitthhein 24 anodtmidneitsetcetraebdledosaef.terRa17diodaaycstivien tthiessufeemarleessi,duewshilweere atthe36lidveary,s, 1m.a1%le inraptslashmaad, 2.a8n%d olfowetrhebuctarbsotni-ll14 in detectable amounts in other organs (11.5). TfheemalueptarkaetsanfdollcolweianrgancaesoifnglCe-8orfarlomdotshee vbalosodraopfid waintdhwitthhe vpeiarktuarleacthoteadloncel-etawroanhcoeurbsy p24osth-outrrse.atmeAnt dcGohosasineng-ger.sespionTnhsebelosowldaosweCrd-8emcollneesavrtearlnsacteefdolrwlatioetwhinignno mmauallpetpiaprrleaentts orwaals GGeenmeornasltrastteadtemfeonltlsowianpgplya sfionlglloewinogralindhoaslea.tionThe same eexspuolstuered. inApesaiknglbeloosdix-lheovuerlsiwnihatlhaitnioonneexhpouorsuraefter cfersosmattihoenbloofode,xpotshueren,umbteher omfateerxipaolsurreaspiddildy ncolteared acfofmepcotundblomoudchlemvoerles,Sloawnldy.malePrergantsantcleaanrdednont-he pfroelglnoawnitng reaitsthesrhowoerdal siormilianrhaCl-a8tibonlooedxpolseuvreelss. Specific data follows (3.20): Fp ournaclto iaodnmis nofisttt riamteio- n, d femao le rs ats,i C-8nlevg els . as a Ct-h8e dloesveels(25ofmg1/4kgp)p.m weTrheeseseelneve1l5smirnousetestofaolpleoawkingof a26ppprpomxibmyateeliyght30hopuprasatandonetoto0.7twoandhou0r.s0,45drpoppmpeadt t24o and 168 hours, respectively. Ctohneclbuldoeo:d oCf-8femisaleabsroartsbedgiavnend arapsiindgllye cloeraalreddosfer.om -18- EID087810 : 005:30 Emre Cra) adminict-ation, female rats, C-8 levels as a C-8 levels at 1/2 hour following treatment ranged from 3 to 162 ppm, doses administered 2.5 to 150 wmgi/tkhg.blooTdhe vaslaumees dorsaengirnegspofnrsoem w0a.s12 se(e2n.5 atmg/2k4g)houtros 18 (150 mg/kg) ppm. The response was linear. Caomnoculnutdeo:f C-C8-8adinmibnliosotdereids doirralelcyt.ly related to the OraS-lsinaadlmeinoriasltratdoisoen,oF m2a8le Baajnkdg.female oo rats followin Cp-p8m l(eevieglhst hionurfse)m,ale0.7raptspmwe(r2e4 h1o6urpsp)a a(n1d/20.h0o4u5r),ppm26 w(e1r6e8 h23o,urs6)3., 50Theandco2r3repsppao.nding values for male rats Cfooncalugdree:aterC-8extiesntrettahainnedfemianletheratbsloofdololfawimnagle orraalts treatment. Oral adfunctmioninofistnruamtbieorn,of femdoaslees: rats, C-8 levels as a dBolsoeosd lofeveCl-s8 wienrefenmoatlecornatssidegriavbelnyondeiffveerresnuts. 11 oral aCnodnce1n7trpapmt,ionosneatand1/411hoduosress,posrte-stpercetaitvmeelnyt. were 14 Aatt e1i/2ghthouhrourCs-, c26onacnedntr13atippomn;s waetre2416houarnsd, 250.7ppaa;nd a0n.8d p1p1m;dosaensd, atre1s6p8ecthiovuersl,y. 0.045 and 0.10 ppm, one Conclude: C-8 does not appear to accumulate in the bttroleoaoitdnmfeolnfute.nfceemTahlteehe nruCa-tm8sberbflooolofldowtilrneegvaetlmreewnptiestahteddodeossoeranlortemasieneimng constant. p Inhao latfuncits iononof t extpiomr seuree s, x femaple o rats,sCu -8 lr evee ls ar s a aC-8sinlgelveelssixof-ho9u6r ppimnhwaelraetiosneenexp15osumrienutteos 10fomlgl/omw'i.ng This level stayed around 100-110 ppm through one fhouurrt,herfeldlecrtoeasaepdprotoxim52ateplpym 7a0t p24pmhaoturseigahntd dhrouorpsp,ed mptoagt/t0me..r3n9 Tpwhapesm l1sa6eg8en phhoiaunsresratslsaeteenerx.ipnoseTodhrailsto esaxempieotshuegrreense0r.a1ilsornot1 -19- 5 g EID087811 2 000.34 Sseoennalahttieondueexpotsourbeloo(dratshaemrplitnhganfoallsoiwnignlge oaraslix-dhoosuer at's given, finite time). CCiohnnahcCalhluiadoteci:donofeC-x8pfoesmiusarleea.bsroartsbedgivanedn arapsiidnlgyle clseiaxr-ehdourfrom InhalationPaetionf expdsosseurres, female rats, C-8 levelsTais a i-(aB6hoatlleanvteeilosncoeantxcpeon1s/t2urraethiouorrnasngfeoodfllo0fw.r1ionmgto2a t10osina1gg0l/0emip:psai,xT-hheour SS2oi8an%)e1,4f,%eo0ie7g5h6te,shpo"o5u2nrsspepm()v0a.s8-5,cseoen4n,cen7a1ttraptptwmoi)onhsoaunrdcsor24r(3e,shopuo17rn,sdin69g 0341, 1%ana 10 ag/a.7 The response is linear at 1/2 hour (correlation coefficient of 0.999). SCPooonncGlhlutedaeot:fanccCae-8 rianinthealbelidso.odsoAmitsewdhtiahtreecshtlilogywheersrteltahltaevneedlsteoeusnetdha,et h{nethSeevecrlealrevaenlcse. sysTtheias. suggests massive overloads Inhaaloation exposures, maTlatetoanndof TfeUmalBearazts followin c6(3-384 opBlaoe.uvte(slt)sw:o ihnotuhfreesm)ac,loerr71ersatppsopnmdwei(rneegigvh1at09luheopusprmsf)o(,f1/2manadlheou5r2r)a,ptspm wete 137, is7, 162 and 147 ppm. CCoonncelugdree:aterC-8extisantrettahainnedfemianletheratbsloofdollofowimnagle rats inhalation exposure. fa oermaalleardamitnsi,sCtr8atTioenvveettloss FprFoeeliglnToaonwnitinngagnada snstoinnag-llpereeogornnaalnt fCf-oo8slelnolwteiivneaglislya instihenbgoltsehame2p5re16gmnga/ankntgd oanrdalndoons-eprewgerneant rats 10 ppm at 1/2 hour, 33 2Pnoauce3,9 Appomn-patregtnwoanthouarnsd, pr26egnaanndt31ratpsp,m artespeeicgthitvely. fCootnclauldtee:redC-i8n cplreeagrnaannctevsf.ollnoowni-npgregonraalntdorsaitsn.g is 20- EID087812 ; 005.3% InTekvselisstiuzsnosoTeumcctaolohroefatizoeiotte,r.rrssfnomaenst: rats, C-8 Borlootdenldeovseelss oifn pC-r8egnwearnet reastssentgiivaelnlyeitthehersamoene,1/2six a1n7d2 h24ourhoutrhse fleovlelloswiwnegrethe18,las1t2 oarnadl 12trepapmt,menotn.e, Astix atnhde tleenveltsreastemeenntast, twroesapnedctievieglhyt. hoWuhresnfoclolmopwairnignga saerlioewserionfgtoefn Cc-o8nsbelcouotdivecodnocseenst,rattihoenrse aipnpetahres rtaotsbe g11ivecnomptaenreddosteos 31(15atcoemipghatredhoutros)2.5 ppTmhisatmatywo hours, dionsdiincagtebutanwoeunlhdancreedquicrleearcaonncfeirmofatiCo-n8 wpirtiohrmutlotiple atcencepctoannsceecutasivefacsti.x hBoluorosd/dalyeveilnshalfaotliloonwinegxpoosnuereosr were not different. Cbolnocoldudoef: preC-g8nandtoesrantsotfaoplpleoawringtoraecpceuamtueldatoeralinorthe inhalation exposures. - RtoaditohelabfeelteudsesC-8ofwapsregtnraanntsferrartse.d fAromsimnagtleern1a0lmyb/lkogod dMoasteernwaals baldomoidnisatnderepdlacoernatlally olnevdealsy o19f oCf-8geisntcarteiaosne.d bdeetcwreeeansedtwobetawndeenfoufrourhouarnsd aefitgehrt dhoosuirnsgafttheern dosing (3.27). aIbnlea ptorevrieoduuscesttuhdey,acuDtoewexlsethIaoln EexfcfheacntgseofResCi-8n.wasIn thhoiusrs satufdtye,r dcoatssinganwditmhiceC-8w.ereNogivseingnsDowoefxenhraensciend24 eailrimivansatisoenenof(3C.-380).via the feces, urine or exhaled + SmeeetaRbeollaitsemdofRefpeerrefnlcueosroo2c6-t3a9noifcoraciindf.ormAaltsioonseoen the Rfoerlattehed Rdeefteerremnicneastio6n1 oafndC-682 afnord apenrafllyutoircoaolctmaentchiocds acid in biological samples. Human Studies * o Phuemrafnlsu.oroAoctsatnucdiycofaciodcchuapsataionloanlglyhaelxfp-olsiefdewoirnkecs aftluoaripnleantlewvheilcshipnrotdhuecebsloCo-d8 rsahnogwiendg ofrrgoamni1cto 71 pprmo.n tOhnee fwlourokreorchweimtihcala plreovedluctoifon70 aprpeam waansd hriesmoved bmolnotohds.analAyfzteedr f1o8rmoonrtghasn,ichifsluoorrignaenicovefrluosreivneerallevel had decreased only to 39 ppm (45% reduction) (12). -21- 0695.25 EIDog7g13 ; G. Biochemicalstudies . o cInatsexfvoilvloowisntgudi1e4s,dayLseydofigdocseilnlgs. werTehe isolated from hTteaetGssotsohtsaitdemruolsnacetaecdipsrtLoiedcyuadclitgliyonceglrtlehsaatnefrrinomicnotcnhreteraosCle-ss3.-tirneIanted cvToientsthtroaCss-tt8e,ropnrceoudlutacunedrdedata Led5yo00dsieg-uidecepplerlnosddeunctterdeadtaeendcicnincerIeavainsstereo in estradiol (1). . eo pSeeeroxRiesloamteed pRreofleirfeenrcaetsion40-a6n0d ofxoridaitnifvoermation on phosphorylation of perfluorooctanoic acid. 4. Clinical Reports of Hunan Exposure . + "tHeehmaepleltohyfelssucororefoecnhiaenmg3iceapxllasam.nitnatNtiohoanthsepawlrteohrdeucpeordofbfleCe-rm8esdasrtoewleatlthleedas awTmaoosnegxo.pbostsehurorsveeedteoxbaemtfiwlneueeodnr.ocdheAevdmidiaicttaiiloosnnsawleflrryeo,mennnoocorumrnaetlleartbeiedotnwseheinp TfFlraueboqorurieanntetolryy(tetheensctoLuinvrteeersrueledtnszytmeaesntdSGbrGleTosouwdlatsleevxtechleesedmioofnsgtortghaenic ntoora7a.l6 gra/nmge)(12)C.-6 exposure levels ranged from 0.03 . o Apotsetundtyiawlalsy meaxdpeosoefd WtaoshC-i8n.gtonReWsourlktss eofmplbolyoeoeds Coihcnecdmuiicpsaatttreiydonnatolelsytc-iornnegcllau(tsSeiGdOvTe,heeavLDliHtd,henAcpPer,oobflanedmanbaimloinrgubwionr)kers exposed to C-8 (3.38). I. epideniology Acaprleotyreoesspeacttivae3HcohpolratntmwohretraelitC-y8,staudlyongwaswitmhadeothoefr 1$f2lo1ru8orsoeicxmopnmlpooonyutenhedsss,woerriemsormreaenvui(fe3aw6ec8dt8.urweodrO.knelrysR)etchoworesdrese whoionncwlourdkeedd doievnaetrthahsle,lmo1tr7h7etaldniuetmaybtehrfocleolfrotwid-feuiapct.ahstesOwafswetrhseeig1on8bi0tfaiicknanenodtw.lny less than expected. The observed-to-expected ratio for cancer deaths was 1.0 (11.4,12). . pIrneeclafaltuirooerntsorhooicsppteacnbtoeiitvcweeeancciodhmoorr(ttPaFmOlAio)trytaplarinotddyucetsmtipuoldnoyy,mpelnattnhetatwerae favestigated. The cohort consisted of 2788 male and -22- E ElDog7g;4 g 069.34 . 70Th4.e975 afleflmoroalceamuesnweosraknedsrtsa0n.7de7amrpdlfioorzyeeddwombmeeontr.wteaslniAtmyo1n9g4r7amteeann,d(St1R9h)8e3.vas cSfaAirtgdenisiotfivinacasalcnutlldayirseiaSnsMceRrseawsaSesMdR0w.ca6a8susae0n-.5ds7p.etcheifTihacelrle-SgHwaRasstfroorn-o w2"niedtehe0:2..408m3eninionfthtewhoemneoCnhn.e-mCihceTamhleicaSDlMiRvsiDsiifvooirnsipogrnroosugtpraotu(epexpc(oansnoectde)r Xgfrrpooounspepdrthoestrtoeatcehweemrcieacnac4lesro).b.serTvhIeenrdethaenwdasCh2enmoeixcpsaeilcgtneiDdfiivcdiaesnaittohns atishnesoeciSitHhaRetrifoorngropburepot.swteaetnIen antcyhaencceaCruhseemwiacsoafl1d.eD61aitvhiisniaontndhe glragotrueepna,ctyer . tcthhaainnecerp1l5a-vnyeter,asrus6lda6etaeetnxhpcseyctwgeerdro.uep.reFcuorFortrdheedrallfroermseenparroceshmtpalitoseyed at nbeeetdweeden toPFOeAvalaunadteproasntdatceoncfainrcmerthe(4)a.ssociation J. Aquatic/Environmental Studies - B o 96-hour LCSO (bluegill sunfish) = 569 mg/L (11.12). . 96-hour LCSO (bluegill sunfish) = 634 mg/L (3.37). . o 96-hour LCSO (fathead minnows) = 766 mg/L (11.12). 48-hour LCSO (bluegill sunfish) = 1500 mg/L (3.4). 48-hour LCSO (snails) = 820 mg/L (3.4). . 48-hour ECSO (Daphnia magna) = 632 mg/L (11.12). o 5l0e%velgro(wstehvenreddauycst)ion= 7(2d0iatmogm/sL) (=3.42)4.00 mg/L; safe =ld-73daymg/ELCS(11(.g1r2e)e.n alga, Selenastrum capricocnutum) o cop = Nil; 20-day BOD = Nil (11.12). o TihnedicSaotielsAbvseorrypthiiognh mCooebfifliictiyenitn a(Koscajndyis l1o7a;m tshoiisl (11.12). -23009.35 EID08785 REFERENCES 1. B(iAebgsetlr,actL. 15B.63)et (a1l9.5,3)The Toxicologist, 13(1):399 2. C1o1o3k(,3) J3.09C.20e7t a(l19.5,27Toxio col.tApi pl. TPhhaamrmaacceoll.., 3. Dupont Co., Haskell Laboratory Data: 210. MmRR--660044--77,, HHLL--5565--6611 43.0 AMcRa-d.33-N1a,t. HLsc-i1.23-P6h5iladelphia Data (1968) (C-1762) 65.. MMRR--11017908--11,; HHLL--116208--6698 78.. WMRR--23755637--11;, HRLL--623553--7799- 109.. MMRR--33556677--11,, HHLL--665396--7799 : 1121]. MNRR--53354627--11,, BHLL--568892--8800 - 11340. MnRR--53364922--11;, HHLL--229015--8811 1156]. MMRR--55334422--11,, BHLL--239259--8811 1178). MMRR--55431482--11,, AHLL--556650--8811 - 1203. MMRR--54314420--11,, HMRL--4516477--811, and MR-4152-1, HL-593-81 2212.0 MMRR--54314928--11,, HHLL--661020--8811 2234)] MMRR--54314239--11,, HHLL--882881--8811 22560. MMRR--54411380--11,, HHLL--112--8822 2278.. MMRR--44217553--11,, HHLL--6612--8822 239000 NMRR--54431780--11;; HHLL--342035--8822 33120. NMRR--55344534--11;, HHLL--573878--8822 334300 MMRR--55435443--11;, RHLL--17398--8843 35. L(eAtEtLerF,ileG). P. Sykes to C. F. Reinhardt, dated 10-29-87 3367.. MMRR--59638063--11 38. DRievpiosritondatoefdCo1r-p15o-r8a1t,e WM.ediE.calFay(eCr-w4e1a2t4h)er, Epidemiology 4. G3i5l(l3i)l:a9n5d0,%95F4. D(.199a3n)d. J. S. Mandel, J. Occup. Med., -24- 3 EID087816 Z 000:35 REFERENCES (CONT'D) 5. Girciaf)fi:t5h7,6-5F.43 D.(1a3n8d0)J. E. Long, Am. Ind. Hyg. Assoc. J., 6. Kennedy, G. L., Jr., Toxicol. Appl. Pharmacol., 81(2):348-355 (1985). 7. Kennedy, .G. L., Jr. et al., Food Chem. Toxicol., 24(12):1325-1329 (1986). 8. k(e1n9n8e7d)y, G. L., Jr., Toxicol. Lett., 33(2-3):295-300 9. P(a1s5t8o7o)r., T. P. et al., Exp. Mol. Pathol., 47(1):98-109 10. sStaOplIesR, RT.j hEa.eteitalal.,om mFuyndame . Appln . Toxe icol., 11. 3m co. Data. 1. IRDC Report No. 137-089 (1978) (3-3546) 2. IRDC Report No. 137-090 (1978) (J-3545) 3. Personal communication, J. Long to P. J. Gort (1/8/79) 4. AS(sccsh-uo4mc1a2in4a,)tesL. See letter Re.p w. oratnd (J1.980S). H. Pearlion H(atSnoudbeTml.i,tOt'eEBdpriydtaoenm)iEoPlA(oCgo-yn41234-)22-82, S. R{ickietredLaibnorRaetfoerrieensc,e b1r1a.g11)Metabolism Report 1-20 (1980) 6. Report M-601 (1981) 73.. 5. RGEBoenacpvttoihnrr,etorn,mNSoet.noEtn.ae0Gl6.8R1ePTseaRtetOah1rao1cll0.ho,gyL(Ra19iLb8kao1ebr)roartaoL(traJoib-re5oys9r,1a8t()oD1re9p8it1e.)s L(aJb-.412M4e)d. Data (1982) 10. H(acz-l4e12t4o)n Laboratories America, Inc., Report Dated 11. 2R(i-3k6-e-7r8674L)a(bSourbamtiotrtieeds,toIEnPcA.,, TRSeCpAoBr8teCA0P2,81CFRi0c0h1e253(61998847)) 1132]. MH(Sa3Dz-Sl9e87t(8o1)n993W)isc(oCnistiend, inIncD.u,PonRtepoMrStDSHNWoI.-6322596-11720101)(1993) 14. EPA Submission (8e Notification Letter dated 10-11-93 (AEL File) 12. U(b1e5l8,0).F. A. et al., Am. Ind. Hyg. Assoc. J., 41(8):584-589 "aso 000.37 2 g EID087817 RELATED REFERENCES oral 13. Kojo, A. et al., Arch. Toxicol., Suppl. 9:465-468 (1986). w"iTsotxaircitryat.a"nd kinetics of perfluorooctanoic acid in the skin . 14. Dpuront Co., Haskell Laboratory Data, MR-4234-1, HL-736-81. "FC-143 occluded skin test on rabbits." Injection Studies 15. o7l0s(o3)n,136C2.-3T7.2an(d19M8.3).E. Andersen, Toxicol. Appl. Pharmacol., p"eThrefluaocrutoedectaonxoiiccityaciodf ipnermfallueororoactstanaonidceafcfiedctsandaa tissue fatty acids." 16. S(m1i9t6h0,). F. A. et al., Toxicol. Appl. Pharmacol., 2:54-58 t"oSxcirceietnyi.n"g of fluorine-containing compounds for acute Caccinogenic Potential 17. SAEbCdeellTaItif,11A8.50)G. (eBtrosalT.s, TArAchR.TInt. Physiol. Biochim., p"rTohmeotperromootfinrgatacltiivevritycaorfcinpoegrefnleusoirso.o"ctanoic acid. A novel 18. A(b1d9e9l0l).atif, A. G. et al., Carcinogenesis, 11(11):1899-1902 c"aPcecrionxoigseonmeesipsrolbiyfe2r,a4t-idoinchlanodropmhoednuolxaytaicoentiocf arcaitd,liver 2an,d4',5n-atfreniocphilno.rophenoxyacetic acid, perfluorooctanoic acid, 19. A1b1d1e(l3l)a:t5i3f0,53A7. G(.199e1t).al., Toxicol. Appl. Pharmacol., p"eThceflumoordouloacttiaonnoicofacriadt, liaveprerocxairscoimneogepnreosliisferbaytor." -26- EIDOST818 Bg 009435 RELATED REFERENCES (CONT'D) carcinogenic Potential (cont'd) 20. N(i1l9s9s1o)n., R. et al., Chem.-Biol. Interact., 78(2):235-250 p"eOrnoxtihseommeechparnoilsimferoaftotrhse."hepatocarcinogenicity of 21. R(ecvaic1i,0E.6, :U.S1. 6Pat9ent0N3o. 54,n6274,8751 (1986) "Treatment of symptoms of neoplastic diseases." 22. Takagi, A. et al., Cancer Lett., 57(1):55-60 (1991). p"eSrhfolruto-rtoeorcmtaenxopiocsuraecidto antdhe peprefrlouxoirsoodmeecapnrooilcifearcaitd,orsc,auses DSNiAgniofficraantts."increase of 8-hydroxydeoxyguanosine in liver 23. Twaakaygi,esA.ieest asl.,yJ. Environ. Pathol. Toxicol. Oncol., h"eHpeaptaotcoamrecgianloygeinsesainseairnldyucebdiombayrkpeerroxfiosrome proliferators." Hutagenic Potential 24. Kubinski, H. et al., Mutat. Res., 89:95-136 (1981). n"uDtNaAg-ecnesl.l" binding (DCB) assay for suspected carcinogens and Developmental Toxicity 25. G1o0m(b4a)r:,306V.-33K3. e(t19a91l)., (Q1CuAa1nt.7S7tr2uc4t.-9Ac8t.8Re)la.t., "A QSAR model of teratogenesis." Hetabolisa 26. G(o1e9c9k2e),. C. N. et al., Chem. Res. Toxicol., 5(4):512-519 "pAercfolmupoarroactairvbeoxytloixcicoalcoigdiscailn irantvsesbtyigaftliuoonrinoef-19 NMR Spectroscopy. 21 : EIDOS7819 : 0001.09 RELATED REFERENCES (CONT'D) Metabolisa (Cont'd) 27. 1Ha7n1h:i5j0a-z5v5i,(1R9H8. 2)e.t al., Proc. Soc. Exp. Biol. Med., i"nThethesexr-atl.i"nked difference in perfluorooctancate excretion 26. H(a1n38h7i)j.arvi, H. et al., Pharmacol. Toxicol., 61(1):66-68 s"uEblcihmrionnaitcionadmaindnisttorxaitciiotny ionf pteherfWliusotraoroctraanto."ic acid during 29. THahnehiirjaIcmvpil,icaH.tioentsalf.o,r L NewaDevbeloo pAmner inmtsaa lSicnt iBeinoo csecsir eTnhcy ees:shicd SETSyeaagtessiuRnrsofocitahterofnesd,erAantsicoenrdofen,Epuororpe{a0nT-Laib1s3ea(tLoroybb maTant (8105757882393).| p"eArfplruooproosoecdtasnpoeicciesaciddiffienretnhceebeiangltehedorgenaalndexrcatr.e"tion of 30. P(e1r9m92a)d.i, H. et al., Biochem. Pharmacol., 44(6):1183-1191 m"eEtfafbeocltiszionfgpeenrzfylmueosr,o efnaztytmyesaciwdhsichondexteonxoibfiyotriecactive forms of oxygen and 1ipid peroxidation in mouse liver." 31. 4R0o(z3n,er,ParM.t A1.):6a7n5d D(.198R.1).Taves, Fed. Proc., a"cAidm.e"chanism for lipid peroxidation by perfluorooctanoic 32. 1Si8n0g2e)r:,111L.14a0nd (R1.382O)p.haug, Crit. Rev. Clin. Lab. Sci., "Ionic and nonionic fluoride in plasma (or serum)." 33. V(aTnodxeBn18/H8e9u/v3el6,405J2.).P. et al., Lipids, 24(6):526-531 (1989) p"eIcsfolluaotriooonctaanndcipcuraicfiidcsatifornomofratpertfilsusuoerso.d"ecanoic and 34. V6a(2n)d:e8n3-H9e2uve(l1,991J). P(.Toetxsarl.s,/9J2. /B0i4o5ch8e%m8.).Toxicol., p"eTcifslsuueorodoicsttarnibouitcioanc,idmeitnabmoalliesma,ndanfdemaelleimirnaatts.i"on of -28- g EID087820 g g 0095.14 . RELATED REFERENCES (CONT'D) Metabolisa (Cont'd) 35. vanden Heuvel, J. 2. et al., J. Biochem. Toxicol., 7(1):31-36 (1992) (TOXBIB/92/263270) . RInehniablitoerxycreetfifoenctofofpetrefsltuoosrtoeroocntea.n"cic acid in male rats: 36. vTe5n(k4a)t:e6s1w2a2r6l7u7, (P1.992e)t a(l.B, IJ.OASssTocS. /Of9f.3A,na0l.40Che9m.1)Int.., "cboimrpeocutndsdetbeyrmailnuamtiinounm mofonoifnlduiovriidduealmoorlgeacnuilcarflaubosroirnpetion Spectrometry." 37. Ylinen, M. et al., Arch. Environ. Contam. Toxicol., 14(6):713-718 (19857. p"eqruealnutoirtoaotcitvaenagiacs acchirdomaatsogtrhaephbiecnzydleteersmteirnatiinonploafgaa and urine." 38. Y(l1i9n8e9n),. M. et al., Pharmacol. Toxicol., 65(4):274-277 p"eScttiimuuolraotoicotnanbcyicoeastcriaddiionl tohfe tmhaeleurriant.a"ry excretion of 39. Ylinen, M. et al., Bull. Environ. Contam. Toxicol., 44(1):46-53 (1990). "siDnigslpeosiatnidonsubofchproenrifcluoardomoicntiasntoriactiaocni.d in the rat after Biochemical Studies 40. Ellenbogen, E. and P. H. Maurer, Congr. Intern. Biochem. R5TeC0sA:um1e6s 8C3om5mon)s.., 3rd Congr., Brussels, p. 12 ( 7 "Heat denaturation of serum albumin in presence of perfluorooctanoic acid." : 41. Handler, J. A. et al., Toxicol. Lett., 60(1):61-68 (1992). "pPIeenrrdofuxlciutdoieroonopcrtoofadnuccpatetireoonxidsoioenmseismnottbayctintcrlreieavatesrme.e"ntrawtiesthof hydrogen -29069.15 EID087821 . RELATED REFERENCES (CONT'D) Biochemical Studies (Cont'd) 42. H9(aSsuepgpalw.a, 1)R.:50et (a1l9.9,0) F(rBeIe0RSaIdSic/a3l1/Bi0o7l8.2M0e0d.., p"eorxoixdiastoimvee DpNrAolidfameargaetorisn orratfelirvreirc annidtrikliodtnreiyacientdautcee.d"by 43. 5In(t6r)a:sAu1k5s7r1i,(1U9.91)a.nd D. Feller, Fed. Am. Soc. Exp. Biol., p"eCfhlauroarcitneartiesdticosctaonfoipceroaxciisdomien pcruolltiufreedratriaotnhebpyatocytes." 44. Kawashima, Y. et al., Biochem. Pharmacol., 42(10):1921-1926 (1991). 1"-Iancdyulcgtliyocnerboyphpoesrpfhloucohrooloicnteanoaiccyltarcaidnsfoeframsiecroisnomraalt kidney: Sex-related difference." - 45. K(a1w9a9s2h)i.ma, Y. and H. Kozuka, Toxicology, 71(1-2):151-160 p"aCryatmoestoelrictolomnega-scuhraeinhaepcaytli-cCoArehsypdornosleasteo, paerosxuiistoambele proliferators." 46. 1K8e6l3l0e5r7, 3B5.00J3.48et1a9l9.3,) BioRcThOism. ABTio00p3hys. Acta, o"xSiedvaetriavlenopnhgoesnpohtoorxyilcaticoanr.c"inogens uncouple mitochondrial 47. Keller, B. J. et al., Toxicology, 7L(1/2):49-61 (1992). d"eIpnehnidbeinttionheopfatmoittooxcihcointdyribayl sirxespsitrrautcitounralalnyd odxiysgseinm-ilar peroxisomal proliferating agents." 48. K1l8e:v2e7n7s-,288H. (B1.954a)nd (EC.A E4l9l:e1n4b4o3g0ehn),. Discussions Faraday Soc., "aPlrboutmeiinn--pfelrufolruooraocoicdtanionitceraaccitdi.o"n-bovine serum 49. L2e0v(i3t)t:,303D.-31a6nd (A1.987L)i.ss, J. Toxicol. Environ. Health, b"i"Pnedrifnlguotroinpaltaedsmafamtetmybraacniedss."alter merocyanine 540 dye -30EID087822 00415 : RELATED REFERENCES (CONT'D) : Biochemical Studies (Cont'd) S0. Levitt, D. and A. Liss, Toxicol. Appl. Pharmacol., 86(1):1-11 (1986). u"TroixniecitByceolfl pelrifnelsu.o"rinated fatty acids for human and Si. S(oah1l0e8n1i5u/s9,2/3A0.0-8K7.) et al., Biochem. J., 285(3):779-783 (1992) pS"eeTxrheolxeielsfaoftmeeecdtsprdoioflffiefpreeerrnafctleiuoonrionoacnmtdiacnero.ei"lcateadcidpaornamehteeprasticshow no 52. Sohlenius, A.-K. et al., J. Biochem. Toxicol., 7(4):205-212 (1992) (BIOSIS/93/13220). fiver. wperfluorooctancic acid has persistent effects on peroxisome proliferation and related parameters in mouse 53. S(1o9h9l3e)n.ius, A.-K. et al., mee Pharmacol. Toxicol., 72(2):90-93 pB"erproeowrxneilsutooomraobloectafaafntfeteyctseuadclifdobnyibcepteara-ocoixdxisiodimasetiaopnprootlaeinndfteroatihtneodrruscearcitniovfmiotuisees Tiver. Si. T(h1o9t5t0a).ssery, J., Fed. Am. Soc. Exp. Biol., 4(3):ASTL A"Dostuhdoyrmoonnestheplaeyffeactrsoleofinpeprefrlouxoirsooomcatlanoeinczymaecidindiunction adrenalectomized rats." 55. T(hzootxtaatsss9e2r1y3,75J1.1)et al., Hepatology, 15(2):316-322 (1992) e"nRzeygmuelaatcitoinviotfiepserafnlduorhoeopcattaoncoeilclulaacridg-r-oiwntdhucebdy paedrroexniaslomal hormones." 56. Uy-vu, N. et al., J. Pharmacobio.-Dyn., 13(9):581-590 (1990) (BIOSIS/91/03735). "Ettects of chronic administration of perfluorooctanoic aS2cmhioodnsgghoonscthefoaalrtitosyyeloaccaiocdeynlzmtyermtaenasbfoAelridasesmsea,tiunraanrsdaet,acliylvl-earcc:yolmRgpelolysacitetiriooon-nshoifp Ricrosomal phosphatidylcholine. -31- I z EIDO87823 3 000.15 - RELATED REFERENCES (CONT'D) Biochemical Studies (Contd) 57. Ufys-sY0u), NG. aetoasl.,woBioochiemo--. mPhaarimaycols., 39(9):1492-1495 b"icoocmhpeamriactailve restsupdoinessesonofselxiv-elrisnketdo dpiefrffelcueonrcoeoctiannoic acid between rats and mice." S56. v8a2n(d3e)n:31H7e-uv3e2l8, (J1.992P).. et al., Chem. Biol. Interact., i"nCovthaelenptlasbmian,dinlgiveorf, peacnfdlutoersitnesateodf fraatttsy.acids to proteins 59. wTh6i:t9e1h1o-u9s1e5, (M1.967W).. and I. F. Skidmore, Biochem. Pharmacol., c"oumnpcoouunpdlsi,ng"nooftaobxliydapteirvfeluoprhoopsipnhaocroyll.a"tion by some zfluoco- 60. w8W5i3gl)e:r,4562.24W6.3 a(n1d986Y).. B. Shah, Toxicol. Appl. Pharmacol., 2"-paemrifnloupoarroidneecanionictheaciLdS17i8nYactcielvlatmioenmbroafnea acnhdannreelcovfeorry of the channel. Analytical Kethods 61. Belisle, J. W., 3M Co. Data (1978). "analysis of serum for FC-143." 62. B(e1l5i8s0)le,(aJE.Eea/n8d0/0D.862F1.).Hagen, Anal. Biochem., 101(2):369-376 i"nA bmleotohdodanfdorotthheerdbeitoelromgiincaatlionsaomfplepse.r"fluorooctanoic acid Ns.ovwe.mbesrnyd2e4,r 1975 uKpidmabteerdlybAy: Iverson:ad April 18, 1981 JRuilcyhac2d3, C.198G4rah-amI:NmPd1:9.4 Jung 1,71994 - DATA4L.14 R SCCc. orci -32- EIDO8T824 069.14 000715 50 wo -- UPOp N wre SORE v- PARKERSPBOU.RGB,oxWV12276102-1217 J Office of Env. Enforcement D2i3v1.1 OohfioEnvA.venPureotection Parkersburg, wv 25101 JOofhfniceG. ofBriWtavteecr Resources 1I3n0d4ustGroioasle WRausnteRoaSdection Fairmont, WV 26554 July 8, 1994 CERTIFIED MAIL RETURN RECEIPT REQUESTED Mr. Mark A. Scott, Chief OD1fi2fv0ii1cseiGornoefenoWbfartiEeenvrrirRSoetnsrmoeeuenrttcaels Protection Charleston, West Virginia 25311 Attention: Industrial Waste Section REF: WV/NPDES Permit Application WV0076244 Dear Mr. Scott: pSeirbmmiittteadppElnficoclraotsrieeodnnewiasflotrhoetfhoetrhiDegriyrneafRluenraennLcdaenddffoiuplrelr.cmoiptiTehisisssouafedpopulorincWaJVtainoSunoalriyids 1Wb2a,esitn1eg9/9N0.PDES - froa the THihsetoartitcaaclhedPrpeesrearivtataipopnliOcfaftiicoenodfoetshenaWtestinVcliurdgeiniaan Dapipvriosviaoln olfetCtuelrture and History. The results of an archaeological survey of the area were submitted to the Historical Preservation Office on June 10, 1934. The report indicates tThaantdfitlhle.re Waerewinlol arseeansd yoofuathheistaoprpircoavlal silgentitfericafnrcoem itnhethHeistvoirciicnailty Porfesetrhevation Office when it is received. Also, we have been working to obtain the storm event NPDES samples craeqmulicrteidonfoorfthtehepesrammiptlianpgplaitcatthieonl,anbdfuit11w.eathTheer croensduilttsionwisllhavbee fdeolraayredded to you when they are available. signed afAfidcahveictk ffoorr tthhee S$t1a,t0e0m0e.n0t0 rfeonrewBailllainpgplifcoartitohne cfoesetsisoafttpaucbhleids.hinAg legal advertisement is also enclosed. If you have any questions or need additional information, please call me on 863-4271. Very truly yours, . = AItvtlawch(m6e8n58t-s1) WS.t.M.EnSvitreownamretntal Control Consultant Washington Works BETTE 009:.15 _ THINGSFOR SETTERLIVING. Lo EID0S3308 51 00017 INTEROFFICE MEMORANOUN FDraotne:: 1R3I-TSHeEp-A1L994 09:51am EOF Dept: RITCHERLBISCOCYMICOC1I0ML Tol No: To: PLAYTISAA! Subject: Oucataan ViSasil To inforaation: WPS: PLAYTIS TDoa:te:ZIP0F9E/L13/9-4-W09S:30:49 PLATTS es MVIALLHEENRTFRP.-_-uHLScILVoAtX SFruobnj:ectB:obDuRcitacthaesyn, FLPR SHEA, CRP711/130, 999-2870 TAIhfawttaesrscaheuurriNoacudosnfaetfrotreennscdoeerdec4aliclnofnoyfreeasrtseetnridcoaeny,oanndI thhceeaalrlodefdft-hhJaautnddye`KdPeFlOcrAoaamtseahnstbeoncskhe4befhaacdsatu-sstaerdaeck Jausdy& PFOA ipnodtiecnattieasl Tchaartcinoongeenof.the production at the 3M plant ctoo-apurtohsotrasteofctahneceJrOM(tahretidcealtehacsesrotciifaitciantge csotnudfye)renpcreeseonnteOdccutphaattiopnaapleranadt UthreogeNnaittiaolnaClanCcaenrcse.r IJnusdtyitautet'esndleadt.e Was presented without any disclaisers or qualifiers or lisitations ATphreilpa`p9s4 and Judy wNfiaotdrh tfNoeGaIrbiatonefd hbekenrionwgTnobnrtgaounebdeTeodvteahrveyoidiinnctdeuhrsaetlsrltyeendgriesninpgonoistcec.uopnaAttaihroenoanflllcaeainrcw,eerses,paiwdtehienmnioiltogis KaPaacrrkrsnhoonulteoidngaenaddtteitnhneddaincpcaaetpeedwrastionAlhfairnsonOhtuicsoaftfaetaehnle,inawguhdotiheaintscewPiFatOshAaWanVsUe.xconelHle4enfctaalsltpae-pdterraO.c.k A t(o309beiantgtacihdeedntioflidedemaaisl)4,pWohtoenctailalledcarOrc.inoZgoebne.l atOF.IMKawrhrohinaldeirctaetdedJhuedy Hweouldodn'ctallknOouwcaWtaatan.case fron Oucataan or anyone eolfset.hat call, but have not heard anything mare cIa'svee oafsketdheJufdoylltaowpconwtiathctOuOcr.ataZeonb.el or Jeff Mandel With 3M and ses what TI HApTassarethi"soutaltohnegreto Regards, akreoeupndusC3a.ll avare of the perceptions and linkages B2a*b To: RFiotrcwhaeryding note froa AITGHERL--13COCVMI WALRATJ --ISCOCVMY 09/13/04 08:84 += Frou:EpJiuddeymWiaollroagtyh/Haskel1/CALD, 38-66504 8S0udb,jectF:orDuycoautraainnformation. learn. Judy I'll follow-up With 3M and et you know what I T#o+:* WFAoLrRwAaTrJdin-g1SnCoOtGeVMfIroa KARRHEW --ISCOCVAY 05/27/94 14:44 *o+ Froa: Bruce W. Karrh = 4.9813 * N-10480-8 009.18 EID073255 CSsAuloAbanrjnfTaalcrUD:aGunrccaaecdoacuaTtcnuaantroaoeaafntiyUconuisveGeiardvseiotnythe3ofA"wTaasptiocaatrlr.ilcekdi:sseacnSodondaaiyfn. wenHaesarkeatshaptlataNntTihnegheNsCaDny TCEHooanrrVkoaLGauaodenndyotwrhDUitEsUhseCGdootlhsdapLtacuhinc5adh5,e'msihcwe"aohluwalosdtualnddVgeitr1Lgeii%kinenitahS<:ea0nuepbhelKarnoritimn,ivnfoslcovhhmeeiwdsiSneiHieannscgeLstreTse.isstdhm,eeetssreeycocnhbaeflirn sassLotn rto thoiacAallaln'GsarrAyceKreensatcery?buTtrannassas not in: WiLL yeu Flesse ce: REIMACE noxvAX ce:SePKREEETWTERODGLYes[-.sIsSccOoOxoVMnIs Oavid L. Pest PORAROITLTECAHREESDAO.LA-.C1-3S1C03O00C0U0MWY RDeovbeertNolL.aesRite Hosowe. wes 0004.19 EID073256 52 000530 70: See Below Subject: C-8 MSDS INTEROFFICE MEMORANDUM DFartoem:: DTeeplt:Ho: M0i9c-hNaoevl-19E9.4 Ge1l1l:28am GEENLGLRM-ESEARTO AL AT ENGG (704) 362-5943 Fax 8-362-5934 (suspect - small *c* carcimogen 7) MaTrhsehaaltlt,ached MSDS for C-8 indicates that the compound causes ntoutmorlsistinedmaamsmaalsknaownnd iasnda fseudsepraelcltycacrocnitnrooglelne.d Tchairscincoogmepno,undbutis DauspkoendtHHaasskkeellll lalbababcoountsidtehresexitpoasurseuspleicmtits(stmahlely hcavcearceisntoagbelni)s.hedI fcoarrciC-n8ogeanndwhtehneythienydicsaettedthethaAtELtahnedy CcoEnGs(icdoemrmeudnitity eaxppootseunrteial gCuairdceilniongee)n.iciItyamofnottheinC-a3,pobsuittioHnaskteollcomLmabentisonandtheI suggest we discuss this compound with Haskell. TchoencCeEnGtraoftio1nsug/sleeninindroiunrkincguswtaotmeerrsmWayTPbeeflfolwueerntt,habnuttheI don't kfnionwishenotuhgehy waobuoultd hwoawshthofefy parnodcedsisschtahergefibteortahendehnvoiwromnumcehnto.f Ithaem s. ahmoewemvaetre,riacloncferronmedanythpaltanwte ctohuatldmapkoetsentoiralplryocedsissecshartghee tfhiinsish. WLiololkintghisatctohmepounnotdesfionnd itthse wKa-y776i2ntofintiheshwaIstgeewtattehre? impression cthuasttomweerswilwlillnotmotdetseecetitC-8ininthetihre waaisrteowratwearterandsysttheamts,ourbut will wiicllbebethetrheereatatsomseomecocnocenncternattriaotni?onIanadm cIonamcernontedsutrheatwhtahte Co-u8r oprbelsiegnactei.onIissugtgoesitnfotrhamtthwee sdiistceusasndthtehepoctuesnttoimaelr oefxpotshuatre of the oluirghtWHTof yisttsempotaenadtitahaltcoafrcionuorgecnuisctiotmye.rs to this compound im hIavaem caonfcienrinsehdthtahtatcwoentamianyshaavesuasppecrtoduccatrcisntoegweanrdsthhiapt iisssmuaedeifawned uprnoicnefsosremdedoncusatoDmuePro.nt Ifsittehatandcustthoenmergoedsoesoutnottohaanpdoletentthiealplryoduct with adequate precautions there could be a backlash to DuPont as e the supplier. 8 iPslseuaes.e let me know if I can be of any assistance with the C-8 2g 009.51 B10089977 | N? "0025 QA LAB WORK REQUEST WURR HEWUEST meauesTeo BY.LrNuomlneCt oars UNIT, PROJECT OR DEPT THIS WORK SUPPORTS: __Q) _4-lgGS REPORT RESULTS TO: (Name and phone number)___ J1vY\ SDAAMTEPLAENDDETSICMREIPRTEISOUNL:TS(Srameplae Pvoient,eCoont_ailnerj, Ceondtenntes,sDadte,aTnimye) _-- _-- SAFETY: (Circle One) Nomal Hydrocarbon; Acidic; Caustic; Other ___SH1n|( => ANALYSIS REQUIRED: To 4 Sur WHY IS WORK REQUIRED: . Leighboor Compla n= -_-- ANALYTICAL RESULTS: (Attach additional pages if necessary) Svve e FaFctent 12,5 Plan_ Co 1010 my fl/ Jatt ht Lohpr #1 nn Iss 1426.7 L1V540 X4 #5ny) ADNAATLEYCSTO:MPKETED:y _ FORM FOLIO NUMPER: _9002 1065 com SAMPLE DISPOSAL RETURN SAMPLE TO REQUESTER [] RETURN SAMPLE TO RETAIN [] DISPOSE OF SAMPLE [] 009.55 CA 002 Water Sample from Dry Rua, wv SSaammppllee wraesceniovtedprbeyseJrivmedHolorberctoolferdo.m EJ Tennant on April 18, 1995. pCHonosfidsearmpplHe owfassa7m.p8l.e aOcheisoptRaibviesr. pH on April 12, 1995 was 8.0 thus gCoheesmicaabloveOxy2g5enmgD/eLmasnod 1w0a1s0 1i0s10emxgt/rLe.melSyhehlilg'hs, treated waterseldom Stuhrerfeactaarnetdelteveerlgewnatss 1p2r.e5spepnmt.. This should be close to zero. Shows Tfoltoaoldedsuhsapsensdoeldidssoloifdslewsass th4a6n.8 10mmg/gL/.L. The Ohio river when not Gisivecnontthaemisnmaetleld awnidththseewdaegteeragnedntsisprheasremnftu.l. My guess is the sample CA 003 L(ewo3sT5i7oe< CChemicatho ofSolfuaHioed hiTHe /, Sampl[ei wo wir Jsuited--1-- 6/-- 95 Ralwedr tds id few co +Blefor"_ 000054 ices 5/e2/95 nreRorrIcE wasoRAou os:00m ssoscen cate: 26ape-1sss from camo a ArrasLTzoarions oop: EsuRoncen Tove: ser-2e8 T0To!o: WCGiAewLooTnoEcnRe'wb.xo.visoETraiLueAnDT TO! Ricard X KIRSCANER, an {{ swRotiromtomaua)t1s { ernscunn's cer own 0 aacxson ancrsono Subject: ATTACHED REGARDING CITIZEN coveents rtERorrIGE waHoRANO 037m once: 25-ape-19ss from: dope: SRoEfciuLsntcAsobetroocmuuasvcen TToo GAenDaavid aroya.n mn. Tele: Ioecses zoe: { rfoasseea) Subgace: Re: DRY Ru LawDrILL cdaemcrey,toRod Newell! a 61 mechanic in the Zycele A/C ares fo2F8im=nedyienisgtaetaroudmtaaytimoonrniabnogutasakniyngtmreoubilfe I vecoauilgdhthelbpe hia in having at the ZoT3aiLse1s49a61b1o1u1t. Rod 60 50 owns about 90 head of 200 acres up by the cattle. There vere Landeiis basically JDBSiaeasrlldoaehdcbsaaotmrtSo'lusuetntWcsipolrmlooefmnsptttfsaoerudtntoMccahooimsigt,nrogaazsneedekitnhfetuhretfahceftrietlihdnasftonrmemxeattimoveanss;kf,ocshioiimsced CbCoEymtTaka,zsa4t3iuonchheadstd10meinntchieosn fron the sun ott bs Tap Boies cihnatsteaigcnhaitne pToooelsT.areDmuroiangnethse .: So calves that wace scLll born and YEE8 th 1535 tuo he had ever had. his He neighbor had vas not crying ane. to ElRiAaTk to the Landfill but aid want to register it'swrpirnegsents. c$ g 000::5 3 EID007456 out, 1sHis neighbor, Sarl Tennant, Rod is quick to point RCohdbaitcheonhatshesereenacatnidonacroyllesicdtee.d Earl has dead fish made comments and frogs out to of 2tE6hfae, irnuda has thea frozen, has complained to the ONR and the a"nhdadhas had a sample tested himself and the results showed aSzSoAuCndin the water". Earl owns about 700 acres out and The landfill and also raises cacele. explainAefdtetrheRosdittuaaltkieodn.to Rmoen IwacsongtoaicntgedtoRolnooMkelionotne aLntdand gBeatck to a. We. have missed each other several times in to dTaaystand half. This morning I called George and relayed the tiensftoirnmgatoinon to hin. He assured me that surface water oaqubnaotruhtter2al8nyd.diffefGseeurolertngste frpsotamactaentdhsecetorJsmmeoanrietthoerrreeipnogrsthewodeullldtsonotathreebesrteaptoerteeadch Zaz as the health and safety of his cattle. relayedAfGteeorrgney'sdicsocmuesnstiosn other. twoithhimGeaonrdgeofIfetraeldketdo tgoatRhoedr aanndy isantfiosrfmiaetdion for him i he still had concerns. Rod vas uannddertshtaannkdfiunlg foofr the tthhee iexntfeonrtmatofionmonaintdornionwghawse paecbfeotrtae.r He Daelnltioned that he was turkey hunting this morning and foun tchheenvay down to the creek was very heavy in the run off. I Kpnaosws'ed that information onto George and asked Rod to let me if he did not ses an Laprovenent in a couple of days. anythinTghaetl'sse has aTbosuhtoualldl oIr kcnaonw.do.LetOnmee oktnhoewr icfomtehnetr,e iRsed Sproached thts Ln a very cals and professional manner and working with us. It gives us a great opportunity to improve PR status with the abutting land ovners to the lendfill. Thanks,arts 1. 08:43am wovrozca . INTEROFFICE MEMORANDUM Date: 04-Mavy--1995 from: GEORGE 0095: 2 c 3 z EID007457 Cee ReVveissed DIVISION SOTFAETENVOIFROWNEMSETNTVIARLGIPNRIOATECTION `ENVIRONMENTAL ENFORCEMENT LANDFILLINSPECTION REPORT >.sve rE ExAppiprlaitciPoanrmDiattOer_d\er=Na o. MIunincipadlAuZs36t36r20a7l Naofm Facie ity EZ DuPoct. Cay Rue, Lad Q\ Weather Cuno" `Cument Monthly Tonnage Osteoflastinspecion 3eects StatusofOperation: Active(X)Inactive ( ), NotStarted ( ), Closed ( ) Per--mitAc_reage---- Estimated disture bed acre eageattimeof inspection Rating: SM--SaMtairsgfiancatolry, U -Unsatisfactory, N/A -NotApplicable, N/O - NotObserved, N/D -Not Determined . LiUinneerrSSyysstteemmMCaonisnttreuncatnicone LeLaeacchhaatteDCoeltleeccttiioonn SSyysstteemm LeachateStorage System LLEACHATE MANAGEMENT [[s7a]] MMoonniittoorriinnggWReelplosrts f[iEas]] TSreewaetrmeHnotoPkleapn [[4xx]] SLperaacyhbaatcekTRreocaitcmuelnattiSoynstem[i[eS]a OOtthherr [a] PumpoutandTanspot [ga] Other 1sthere 3leachatedischargeinoreceivingsueam: Yes (X) No () Receiving Steam Dao Sam Outer Sanus: owavemer or|[TT T T 1 mig Lo| [TTTT7 CoAmmmrecnosmTmhae = SebaanesSous fUonmmn nodoiyeed oud wen oegsecoefsdei.mAouhesauy_ Lo EI YO VP ere ee RZIA Mec I%S . SoT Soa EA =Au RENT ARE Shwe Me uolva. TSQiund IDnatielrymCeodviaetreCover [[GCiia]] oCowraccasons [[5Z5a|] HCWo.EnxcthasimonSiaPinlsaDaniinstsppoeescadtlions FEirnoasliCono,vSeerdimentCantal, [Tis] COodnotrroCloonftrWoilndBlownMaterial[[_CSS]| ATsrbeeDsitsopsoDsiaslposal ReOvwevgeertsaitoinonDitches FOiursetCCoonnttrrooll: [[CT5=]] SOurdmgDeisDpiospsoaslal = Access Roads AOcpcereastsiCoonnstPrloaln Placementand Compaction VectorControl GReacsorMdasnagement Equement [CS| ShreFludffDdise posral [5TA]] InoftehcetriousWasteDisposal C=] ote CoAmmmeenetsn: Dimsaaes:aas TSioheetsny deoeses`asaeoeCaybo"SsTeed MbaoesevmiueenSaSsdteoennvdosD SN Ae od = Senimon aide onde. [gochede "am oAye `oud ow WsAoRgeNhINGT YNoouTaArNe hE erebywat rXEmedoheaa tshees folwi rSEeATmedaialEmeraasusres mustbetakeno~noSrTeSforste eas ox dat oe Number ofNONsissuedon le ale: Iam Co SaoNone |). CompanyRepresantativeandTite: 1 _ "ud 2 =. iteEee Sa One Io Prone MISRS White Copy -District Yellow Copy - aspecor PakCogy -Chartesion Goldearod -Facily 1 000559 000239 | \ fet wire : rr ed PR TEvoV: frnr INTEROFPICE MEMORAKDON fens ppnr nko Hopp loan on of ee - Aperd ' Date: 02-May-1995 03:00pm 7 Prom: SWTAELVTAERRTM.STEWART - TE7 L DTeaplt:bo: (P3P0D4-)SH8E6A3L-E4A271 TO: Distribution List Subject: MEETING - LANDFILL ISSUES THERE WILL BE A MEETING ON THURSDAY, 5/4 FROM 10:00 A.M. TO 12:00 NOON INMY OFFICE TO DISCUSS ISSUES CONCERNING THE DRY RUN AND LOCAL LANDFILLS. THE TOPICS WILL INCUDE: DRY FM 1) STATUS OF BLACKWATER IN THE POND AND STREAM 2) FOAM INRUNBOTHON ANDOFF OUR PROPERTY 3) C8 sume LOCAL : - 1) NEW PERMIT REQUIREMENTS 2) COMPLIANCE ORDER 3) STRATEGY - ACCEPT OR APPEAL LET MEKNOW IF OTHER ITEMS SHOULDBEADDED TO THEAGENDA. `THANKS. EY 000:81 : = s8 EmO0s0sos g | : Loaizall Ko|m 4 ub afeo ed Daw swws ST @< &s) oAmmavo -- ENVIoROmNeMrElNaTAgL/e GASTON CAPERTON GOVERNOR DIVISION OF ENVIRONMENTAL PROTECTION 1304 Goose Run Road Fairmont, WV 26554-1390 September 25, 1995 Mr. W. M. Stewart SWEPae.I0sn..hiionrBDgoatxEboonnnv1ti21rW7dooenrkmseNnetmaolursConatnrdolComCpoannsyultant Parkersburg, WV 26102-1217 LAIDLEY ELI McCOY.PR.D, ORECTOR Re: Solid Waste/NPDES Water Pollution Control Permit Application No. WV0076244, Dry Run Landfill deelcldnci This agency's May 16, 1994 field investigation revealed numerous ls" uskraitnhgs poration of che Dry Run danafiti Although your company was advised of these deficiencies at that time, March 23, 1995 and May 3, 1995 field investigations conducted 21 an inspector from the Environmental Enforcement group revealed measures had not been taken to correct ihe deficiencies. below, are of These deficiencies, which are discussed in detail concern not "a, because of Son-ceaplisies with the operational Management requirements of Title Regulations (SWMR), but 47, Series 38, aiso because Solid Waste the structural integrity of included but the landfill could be effected. were not necessarily limited to Said deficiencies the following: sparse vegetative cover, poorly defined benches which were not providing `adequate routing'of Itormuater and leachate thus causing numerous erosional gulleys on the landfill surface, lack of interceptor channels to properly route stormwater and leachate fo _the surface impoundment, lack of a leachate collection system, wlaasctkeoflifsturftahciecknweastseers.diveSrasiidond chanineenlcsi,es anadreexpcriemsasriivley soduleidto the design of design. Psuerrpvoiscee,s otfhisa actgohenenscyu,llatniTdnfeigqlul efsitwrsmhihcahvthmiatynsygtoeubxrueppcegormtrpiaasdneyeidcnonltanrda`ofcritlTltHhies four letter dated June 9, 1995 above referenced Environmental indicates that in response to the Enforcement inspections, diversion c2arhreaeaanneatlonsdaihfdaurvteihnebrdemreoanriend,iunggdrtwaoaintperrpeivpeFenrstomhratuvhnee-onabreeetano. tihnesAtlaacclhltoeiudvgheitnlhaentsdheefilflill efforts are commendable, meet the Teguiremants of be advised that diversion channels must Section 4.5.2.b. of the SWMR as further rienfsetraelnlcaetdioninoSfedcrtaiionn Cp.i2p.ebs.1d.oesbelnoowt. prAelcsloudebethaedvpilsaecdemtehnatt tofhea leachate collection system (see Section C.2.e. below) . Telephone:Of(f3i0c4e) o3f6W7a-t2e7r24ReFsaox:ur(c3e04s) 367-2727 | . 000-33 . 00 cn - . MPra.geSttweowart SAupbpsleiqcuaetnitontoNo.theWvM0a07y62146,4 w1a9s94cofnideulcdterde.viewB,aseadtuhpoornougthhesreeview of Tirhenevvrieeesfwtosir,gea,tainotdnhset,hefsoMalailrdocwhianpgp23l,iicnaf1to99ir5mo,antihaoannsd bMeaeyn 3,fou1n9d95toFibeeld incomplete. is needed to continue the pFerfoecreesnsciendg obfeloAwpplciocrarteisopnondNo.toWVt0h0e7s6e24o4f. theNotCelastshatF atphpelisceacttiioonn:s Am.i9nim-izPartoivoindepdreotgarialmedwhiicnhforshmaaltlionincrleugdaerdipnugtretshceibwlaestematerials. Also provide details of the waste minimization programs which ,. osfhalwlastienclrueddeuctaiodne,scrreiupstei,onreocfyctlhiengt,ecahnndoloegnieregsyanrdecmoevtehroydowlhoigcihes are applicable to the wastes being disposed. wBi.l1;lb.Con-sTihset aofppalpipcraotxiiomnatreelsyves2l3s% tslhuadtget,he28s%ludfgielterilatledr uater. As the rilter press has subsequeitly been placed acinandkteo sot |. poeprecreanttiaogne,s.provide actual sludge, filter aid, and water Bl.e2t.ter- dAsateidndSiecpatteedmbeirn increased dramatically r14e,vis1e99d4,Att%abcihom-esnotli7dssuobfmitthteedswliutdgheyhoauvre pufsuant'to the recently started operation tolfraetaattemrfeintltotetrphleapnrutersisftretorom)4d.te8ow%a2t0e(4rr-e3sf0le%urdegansecedrferfoiemnrtAe.hnCec.ewdaHsuIstnteowAnatstt'aecrh3a/1s/n8t87. Q. Tthhee aimnocurnetaseofinslbuidogseluddigseposceodncesnitnrcaetitohne afsilwteelrlpraesssinbcerceaamsees in boapcetreartiiaonaalndhaivreonaspuplafriednetlyrecfaeurseendcedtheinpryeosuernAcperiolf a13n,aer1o9b95icand MbWiVao0ys0s71o62l2,i4d41s9,b9e5ymolouedtritfeciroesmd.pantyBoecsiahnuocsuoelrdpoofrhaatvteehersdaeirqdaumeasstltieucddgetihnaacstrePCaoesnredmiiittnioNon. saG.lb1uo.dvgeeofrhePafeevrrimennigcteadNob.i3o/m1W/aV8s08s076ol2fe4t4ttehrea.lcloonwCscoenncotunrrlaryetniftoolnryrtwehifetehdriesntpchoeesdalinofthe pTlhoeedaricefhfiaocbraistl,iiotnythirasenqaulaeygssetin,scyo`yfroeutqrhueecsotmfspialtnthyeartsahsiouduc/lhsdlbhueadvgeecomnsiduxubtcmutiretedt.edbya uAfptoririllitzhie1n4,gp'atr1ha9em88e.tTeorxsi3cwiietniydgihcCtahtaderrdayctiensroiMlrsi.tdiscA.oCfL.etaHhceuhsitnfgoinl'tPserrocleaedltudtr/eesrlud(daTgtCeLePd) mixture shall also be determined. Cp.rlo.vci.de=bAosrintghislogasgenancdy whealslncoonrsetcrourcdtioofnWeilnlfoMrWm-a1t2i8o,n pfloreasseaid __. well. dai.nf2df.eatr.he1on.stei=awthIeit.chisArluesnfoce,lreenapcrleewahs1ie9c94hexccpoolnnaditinotuirtoshnesi.vnodliTuchmaeetreecfa1ol9rc9e1u,icatopinlodeniastsieaonnds how they were derived. Po 00954 EID012673 : uPra.gesttehwreaert R"ierngataverridvnaielngbobtSetetocwmte"ie,onntahpAepe-asroAsliodftobDrliaanwcdikincgaltienMe67a7annda(rAettahteawcdhhaimcsehhnetdwa1s1l)i,nfeiltlhleeaqbeled pBrrrodicloecrdauttreoesvm.aatsetreIifadlitsshpeoustaaislls.iuzmepdtIifofntohriissfiailsnlsciuontgmrpetacisto,nuelpillseacososrerpeilceatcp,eelmbpnlteeheaTMse cn bSeotlwideenblatchke sloilniedanbdlacikndliicnaeteantdhetsheigndiafsihceadncLeineo.f the interval uCa.pn2pi.rfaoo.vr4en.dabn=ydScetohcmitspiaoncatgee6dn.1c.yo5n.einoffworoittthielnagSy,eWrRtohfartecqulaiarycaepst',haCtounnsliiessstsnionogmtohvoeefrwiase o pufhenerdmeerealnbatliienretbhysaunraflaiceeaxcho1af0t-e7eaccctonl/lseecctis1ohnalilflsey."sbeteAmpslparsteihdeorlatnaodndfgiirnlailtdieadwlasovneort aCllsapyoscaalp ospheorualtdiobnes,ins"ittalIsledchltso maigneimniczye pa'eprlcsiotliaotniotnhaotfa one foot precipitation through the waste material. aFIernfeeaarcecsnotcruedddayncaiendeewnifcotiohttyisnceglcatyizoanctaepr3i.1aa2ln.sd oatfottbueoheuftosioultmiz,Seodpparoofivo]irdetchoaeverbaboorvreow si(nuafaflcieccsoisreednratntcorepastowiiioltnhalceSoevceirtniotsnhuipcp3ko.8nr.et2s,sofwofislulcthhbeeiSsWcHopRnr,soviidtdeeersdte)d.piptrsNoovtioefdintfgheastt - abdloesrtoienrgntsionedsehtatlehlremibreneequutitirhleedizienndufmobrfemorratoitfohinstteosptubrpepoistdese.riorvReedtfeesfrtrobtmoortie3ns.8gt.s2p.iatnsdto maaunrsdetabobsretiundagyvs.a.ilNaboSltaeeidttohianptfroosrvumifadfteiicointehnesthtaqlelumapnbotariatriiynecsclouodvfeedrborirenrfoetwrheemnacbceoedrrrioiawnls tSheicstiosnecCt.i2o.n4.b8u.t also .the final cover requirements referenced in e"l.ti2h.neai.ns5au,trefaCc.p2eo.nadw.ii6ln,lg bEo.en3.ctfhr.eo,ismueEr.d3f.atgco.epr-aonvTdhiedteoaadpiprl1e%icctaotisou2%rnfasiclneodpiewcaatttoeerd that to SdLuiirvffte.ar"cseionvHoawtdeeivrtecrhf,elsowtohtnehNreaoiyutgheh1rs,thsei1d99ef4i,olflttahenhdeMaofrvicellhr"t23th,oe "f19am9ci5en,inoaifnzdethethe gs Mbsealnyocphe3,dss1ou9ff95fitchfeiieenlitdalnydifnitvloealsltrisguearctftiaocEneasmertesv)eaooltuedwnadltlhattdheeffiosnsiedtdesofoorftharetehenot tslohamenedflioalfnldfwithlhilucshwhahalivclehowieisxnpgorseresudunlowftfaisntgeto imnatnFleouwrmideairlroseu.cstleyTrhosoaiscoernoabslesncgthhueelslefyyashceichof Soarboesueadrrvedefdienieotdnhertdohseindboeetncochfoenstt.aheinTlhaaenrdsefufifolfrliec,aisenptothoeslblseonpceohcectlfoeichaty lUeSachate rfieondutetesirincggenpetofodrtrocunhpoafrnfonveiltdsoetwhhreiocuhstuimrnafgsactoef aslistmooprobmuewnaddtmeeenvrtealnofdpoerdltertaeocahtacmtoeennttit.noue It must be determined if slope drains should be utilized to 000.45 EIDOI267 MPra.geStfeowuarrt hriFo3aau,vibdioegnntgerswruimnlOiolfnfefdFsuuflctrfhhoiamlta]ntdhselcopabelecnudclrhaaeistnisotnosarivenetrneierefcdyeeipdnt.gorTphrcaohtva.nindeeenlesS.pertoaplIojfseedidt ahnadtcaslecruelatdiroanisnsaacrceocrhdeniiontrglniyen.etdeendd,edppruorvpiidsee:apprIofpriifatfss hpeelreicimmiilnsed YZPaootuuerrrJiseatslacsfefarfieanyfnoorltem,epdl1a9tc9heed S3:5a50, '5rosiantial wfriinietladecrcroetrvhdiaeatwn,cienMdrwi.ivtihdGueaoslrugrev1eiifWccoyhyetloowefivwcaahtsitooefns|/| A Ssuurrfvaecyei,ngParcotviivdietiiensf.orfomaptrioonviddeetapirloipnegr tdhreainiamgpeleomfenttahteioLnandofriri]|- dEbDeIeetonsapcciehrlerieslbdyetpcmoloeanaanssstsuruvrruieecestweetdamocahptboeoepfuxrniossdvcteaiirldnteegakebpnreonpctehoriydservawaiemnlpalgeedx:eifsitniBenrdgovainide a pSrreeoacpiononlsseetcdriueecaltreelvdya,tbieIonnncdshicafshtoarilnlgtheebeacfdhreosnrite1g%cnaoann=dtse1td0bra0ucbckyte(doloefrtbteeaenarcc.mh'ho.rereIceSnoaxdnciphccaeanrtdueecdted rFfeeeaccncoocinnhlssittt(rranuutoccettteeeddqrtahibanetangcbehe)n,fcohueaasnrddshaalIlsnlotedrbiecreepsctlteoirpoencdshafnornfoemlfslf:orwonNtfootrteoetsbohasactk fo each IS(ihSseeEeorsSeaeclcotnaisrtoernaucCt.(be2se.denbec.hb1pe.ansrchahargelesrlgaaprsbhhedailnrlogutebidentdeetrsociegapnntaotriendctheaPrnhcnaeespletor21iczoishnign)eCh)a : dSSeguascvicagesnsiasotinevdeofPshetarhsieeescIIoo,mfplPbehetanescdehesIfIiTlbo,lveelrerotlewcyf.ir,nfegegunancPrtehdidailsnegthPIehsaphsraelolpIo).sbeedEach sfDeooOacEFcthiPFeorhdno.a.,vseideFI.otrheNeoatciehnftoPhrhaamstaet,iAotntparpcorvhiemdveeinotuts1h2leyiasrbeofvieenraoenurnfecfqDeriuadcewisietinnmegtdthNsiisens7f7airreiassteison A dESiihnsiispsstocosiayantelgeraldoalnirsepaasotpmsaluabaslintlairbvteeiyaewdeeaxtnpder2rems)isneedtdheaussfiainngaflaaccntoonarfpipogfruorvsaeatdfiemotenythoooffd.t1)hethe Zt39hfPi.stofhpeurtpahneoaslefyislwilhs.i.chpCrsaohlvalciludlemaeatpxiitnoetnnthsdaebllferaonfmdofritmlhlesotsioelsctopifroonpteuhcettiilfsiislzledwteoifloiiriheed safety shall also be included. utilized to genrate the feceoitor YTjqghmaeepBfoguuMulnapddympnuee1rn6np,ttosws1sha9.os9u4lfdAfitilbeletlehddadwtrriaeittvnhiiemedewseodriye'omvsueerlnaitclooewmdapndtathnheytahtwSeaertsdehifemaoderuvnspitpsseecerdsr.vsCituhnhragafttaomcioetmhnely CEfinheevepbeorrsreotcsrieeignnoaetrtnaitt5oi9nviednisopsfepcotysooirunrgpcroeofsmepwnaatsntyeduirmniafntogerrmtiehadelstMhaetrhcEehnrevui23pr.oonn.m1e9n9t5Haolwfeiveelrd: a that no special measures were taken' ts dzain the 00055 vo EID012675 ' 7|/ ,_" fe 1; 7 MFra.gestfeiwveart Pcnr oAifsmptwohauesntdeMmaenymtat1e6(,roitah1l9es9r4 tthhfaeinreleduiptosrnenvwiaehtwiurcahrlewvaedsarlaeibdneaigntegh)atepfrftheiecotrendattoutrhpaalltacdeamteen:t pSdSfrerodapiitmehneeranlgtyelsadnorfdiafsiitnlhaeledc:pcooonnucdleIdrnnwsabusetfofipacoftoifhreei,cnsttetaddhg.reeanicpnyboalngaddsececmtoohfeuenltdtshetnorofuticvmtahpusaortvuaeenldmmbaeaitnenetntcelgiriicty wSraiaitvdhiinneplabtceheeimneganrteu,atiloiinfzeatddhediftuoipropnedristposoustrahfleaceatoreiaimtppsorueunvlditmoieumnsatltyehasuftoioeltxippsraiennddee.dforthe dbjieasnpdmotasiialnllt,lainfeTodhredpuaurprippnolgsiecsaftiioloflnintghr.ie"sfeNlroeettnteceerts,h'attchoatnSsetcaitti"uostnleop4e:P6h.oa3fs.ea1.:Ia2.owfiolftlhe tt3hh:1ee. SgrWaAIdlXesoreofqnuoittrheeesthfaittnhaaltSecsstluioropfneasce6.o1fs.hw5a.ioalr.kDin.ontgoeffxaccteehseedsShW3:aH1iR.lrneoqBtueinercxehcseesecdhat mfiuinsnttaolbceosnussripfdaaecceerdatdiotoonnaotushseuenrxecperetedhpaat3r:1it;nhgethstihlseopmerasepqouifrrewefomerernketincnegBdusftaincbeestheatnaakaebnotvhee pyiahnriactghhreasphahab.iolvebPepraorvcailgdereaarplthyh:e ifncodrliolcsoaswtiendsgecotbnienotcnhhetpoldeastcnaaivllissewtofhemaapltoyrcpeaiftcieaorlnesnceodf bsecnaclhe shall woifhnicctlhyupdieschaaellrlosbieionnncchlucddorenatirinotalsgeum'pasttloeorpieainltsweorr(ckpeirpnotgvoirdfecahcead;noncepullmasennwthivioincehwtthoat epCorrroonspeioros;nedacnotdontrbcoerlosuspti-rlsoitezecectdti)io:onnptowlialnslcvailneaowtobtfeotrsycepaiqcluaeilreobfdenaicfht:syeupricochasliiosnbennocth WpiEgltlecntoitonb,e (rperqouviirdeeddoicfumseuncthatiisonnotthpartopeofsoesdiontoCboenturtoillipzreodt)e.ction csa.up2rp.frbao.cx1ei.nateFulny-onttdhhheraeseMeayrfoede1e6t,ddea1e9p9c4htahnfnrieoelulgdhwhiitnhcveheswtianisgtpaeltaicmoaentserrieisvaelaleodn that the sATpoopuultteihcearstnuirofsnaicdeeNo.rofuWnV-t0oh0ne76af2ri4lo4lundadraettahe,ad Adsuiitgveua.srtsioN1n9o,tech1a9tn8h7naetlisanldtiahcreoautgenhdeedtehdatto giahnyvdneinsvetelirssgiaotsnihoouncrhdarnenavelelsaolweodeuxlttedhnadbtebicetolnohswatdrtuhnceotte.Sdu,r'fNatochteee Mthaayt 1sd,ive1r99s4ionfield {mpoundaent (see Cct.hh2ea.nbnc.eh3la.sn)nealTrsheebsaehiponpuglnicosnahtoiwAontntaoncihnAmcteotnrtarcehc1mt0elnywtitsht11a..dteestaNitohltaset adnidveprrosfiiolnes that in of DaSaurcysecstsotredmddaeusnrciciagnepnga,bvlipetachaoknosSftdericutspcricteohv,naerngo4tep.ieSnr.gfa2r.tfobeml.oAawa.tndonoltmfeoaasitthanentyaaiSnp5W3aR-raytetraohurafn,t-otfy2heo4u-crhdoionsutcprrooomspaalny srrevaqaiulniefraselmliennedtvi.ecnatt.eFdurNtoohtueerrmtDorhraaewt,inigStecMit8s4i1ounnc(l4Ae.ta5tr.a2c.whbhm.eeBtn.hteto10f)tthmheeeedrtSaWiMtnRhaisge s2r5ae-fqyeueliaryre,st2het4haphteoaukdridviersraciahnifaoarnlglechaafnvrenonemtl:sthseThhaceiorlnetfhroairvbeeu.tithyneoguwrcaatcpeoarmcspihatenydytoBfarspoeamssa Pprovide'the information required by Section 4:5.2.b.C. Of the . 0005 EIDO12676 { HY#' 4 .qt" {Ql W AY MPra.geStseiwxart rSSheWofMueRlrdefnocyreodutrheincdosimapviaednrysildoeenttteecrrhmadinonneelnsotthartmeefetethreenthcdeeidvreeriqsnuiioyrnoeumrcehnJatunsnneelofs5 4:5.2.b.C., submit the information required by 4.5.2.5.c. letter. Section alternative diversion channels. fag Adiitnvtdeairccshaimtoeendntdoin1t3cAhtitnaiccsohrmsrehenoctwtnly11onroerAftertaeanncychemosetnhtetrha1t1Draaaswicnrsgoascchso-nsitesacitnneiecodn of the within vtwehhereitfhaeyprpltiAhcatatttaictohhnme.endtivFeu13rrstochneornmtcoahriaenn,nseltahehdaestreersqmuuififrneiadctiieoinnntfoccraamnpanatocitiotnbyetmotaodepass SsaoagifelenlcyyConrtsheeeqruve2as5tt-isyoeantrh,Sater2va4i-cpherooucrbeedruuartieniflaialzplepdroevvteoendtd.ebtyerTtmhhieerneeUfnoitrtheee,d lSottchaaittseison caahlnasdnonsetilozsindgerteefnreomrtiennoceneldytheoifnlCco.hc2aa.ntani.eo5ln.sanatbdoovdseii.vzeirntgAtosfaurmfiiannctieemrucrmeu,pntootnrh.e but wdafanroldallilnaoaavwsgeierntaghgaeerfeaasacrlteoocarposenwthmorefuirsbsttuhtdeibinevgaerirtensoacilocsunoudnretfdcrhaaicinbennuetrtliuhsnne-goaanrnt;eaolysmtsaouixrsifb:meaucmel,oscruamartinfencadioc;mneuma,s dSOiyfsefcnhtcauryrgiveen,ninuLmebcseurbcsio;crrefrseapeitonnfpadlielnrgsaemrcouounnncdto.rsfrdBoeampsteand,2u5p`-aoynnrd,2p4a-sthehkra.nfaaltsyetssoirsmo.rstuhne 2bLenodgaidgniidveiencrastaienoddnosnchhaaapnenspella(sntrvsiihaeanwiglumlbaaepr doofertestrcrmaailpneeezdo1,i/da=lS)a1i00dofc{hioanrntneearllsmeoprstehoarll Fxgroporasnsedaecsdhectiscinaotlneers)ceoptftootryapciaccnuadrladtitevrlelyrasnriqeoufnlearrcehnacanenndetlth,reaihpreizlcoohicdaatslihoanicslh:anbnee"lPsr.ovide dnienusfmiobgremnraetdvieolinon:ciptlaytnheivniaeccwur,beaigcperofvoeifedtetpheeirnctsoeancbtolrneidbufbtoairsnmegdtwhaeUtpeofrnoslhaleodw2,5i-nygtrh,e SS2EE4i-zIhnorgCuKsltaorr)mi,nedvdiecenapttt,eh trohfaeckchtasymipnzeeelo,nf dstyetpcyetpieoo)nf,L(ittnhriiancpgken(zeogsirsdaaslosf:olrifnaibnrgi,ctor mnFaaoxxriimncuuhammnvnseelllosopceiutt(iyflti/(zfftie)ns,gt pfebaorbtrtisocemfcwooirndmde)hl,in`imainnngdi,mwupisrdotshvliodpoeef s(ifdte/7cs)i,opes. minimum StthnhaiancdklnoserssiseoqnuasanldutEfoiiLlit5z3e,trdp5o3ci-o1n0td%e,tsepraamncidinngggretfahoetrercdeesntithgeanrnlio1nf0%e.thseiAgLpiLensterlcesesptor ndedteedrinvianreadioinf Shuts rsion, ccghheaaonntnneeexlltssi,leshsaIlhflouilbtde ipsrbeodvueittdieelrd.is"izneedd7%itnahuatshsetge'iaonittseeoxrtbcieelpetor gsSehaoottuieloxdntailbleeeuftsoihrloiuczlhedodo,ndoitnpgrboevsiadiuedtilttiyhzpeeed(t,sy]p.ep(rso)v"iifdteoftbse'udfefutitecirilneiinznteeddraattnhdiatonale accordingly. tf.hre2i:ibSi.Wl2M.iRerr-etqPuroiobrveeisdettehtlayltpTeefdoaTMrndsDoialqusantrhitaoyvtien(gBpRoaAuTnpdSHseopferolneacisrs)e).thao8nfh5,.5, of : 005Ga5i ,:% EIDO1267 7 . OA~~ V , 4we 7 + MPra.geStseewvaernt balanisdmeedfusurhtaplholenrmbsoeoriela,dadneiadnldyitsoceastm,eaind(teitafeirnimtianiessowdilheettephrHemrionfeldi6m.e0t.hwaitTlhlleibrmeeefouirtsei,lized necessary) the amount to be utilized in pounds per acre. if.tu2sr.tbhm.ea3rx,miomru=em,AsdaaistlhyeeldTeoivtsaatclehdarSgBuOesDp,efnrdToOemCd,OSuaotnllidedtsCONoDl.icmo0in0t1acteintotynrp,aitciaaolnnldsy exceeds have bneoetnfoublsfeilrlviendg (istesq sienctteinodnedCip2u:rhp.ojs,e. "thBeesaudrfvaicseedItmhpaotuntdhmeentsurifsace SiEimRp.oT "undE mToentd,etmurstniEnmeeieatifetAhsaeid gdeosriergqnuiarrneedmqeunT itrsemE aernetsN beoifnE gSemcetti,oSntsa ene pSrhoalcledbuereuatiplpirzoevde.d bTyhetrheefoUrnei,tedproSvtiadteesdoScoiulmenCtoantsieornvation Service Ei(nncvvaielrscoutnlimagetaintotinaosln, rEdenrvfaeowarilcneegdmse,ntthavetirnbtsihpaegeec)dtiosrr'ceshgaarMrgadeyisng3,frsuo1cm5h9.5thefAidseilvtdehresion cdSehutarenfrnamecilensiinmrgpeofueinfrdeztnehcneetd,reiqnsuaiylroduerdmiesnJctuhsnaerofg3esSTeecmttutisdotrnsbsere4.i5rn.oc2ul.tucde.edAd.tow(hCcet)nh; e d4ii:mv5pe.o2ru.snid.omAne.n(tcgh)atno(nBep),lrsovaisndhdeou4l.idm5p.ir2no.sv.teAed.a(dsge)bdei(mC)ernoaturateetdiobnaerinocgounntdmreottl.h.e Nsoutrefactehat If it is ddee0ttaeuirplngeirdnaeddedrattvhheiantgssutrhfcealcereaerqluiyimrpeoimunendndiatcesanttianrgefocnchooatnngfbeoesrinngUwhiimetcthh, Ws3a1ip1rdov`ibdeenade dEroeecqvuuiimszeeendmtedanettsisio.gnn (oCcfoanlctcuhurelraetsniutorlnfysa,,CevVeitrmhbpaogtuehn)edmteronetviismneeddeitcsdateetnhetihmartesq(upirrtheoevmiednets of the SWMR. cIhtanigsedtheconacguernrceyn'ts Therefore, provide wuriintsdheerrpsotdneatdnadiirlnesgc.otnhsattructtheionrisinerAusgtursutctu1r9e93.vas psCl.te2r.aubsc.et5u,rceon-fiiAsrtmatacs1uh5c"mhe.ndtiamNIoef.tenor1t3,stieinendldiicpcaiatpteees. tihtsaItftyttphheeisdainisdschcdaoirragrmeeectte,r. Cr.e2q.uci.r1e.d n-otItonislythtoe pwrroivtiedre'sacocpeisnsiontothtahte waorhakuilngrofaadceibsut also Tgthoeearlpaerfoovofridee17ipn=rdoitc1e0a0ct7teiho(anourlfaorromaoadrr(eesa)sexppirannedvpeildoanussvlciyaleewu)t.oinlizaStemadatipfoonhravaniinugsm'pbaoesrasl. rr(oeoafnederaponnecresda1i00dby'pfsleatentativmoiinneiwmnuummam)pb.erssh.PalrloAvliasdloesohparbuoelviidrneodaiadcaLptryeopdfiicflaoelr(se)ach haul ccrohraaodns(nsse-)ls,sectsiihfoounalpdpolfibcetahbeilnehc.aluuldedroaidn(sc)r.oss-Isnetcetricoenpstoorfantdhedhiavuelrsion NSoetcetiotnhat4.5a.c3c.ebs.s orfoadtshemuSsWMtR.be dAsesirgenqeudireidn abyccoSredctainocneswi4t.h5.1.b.D. Coin EIDO12678 sy MPra.geSteeiwghatrt Ju Ii 4. + rt1 dCpaurenlaadviken4rda.tig5,s.e3c.hwdbahi.ritFgcc.hehessoohffaalnltd hce1-ubySle eWvaWRerU,rm,NtEp2Tor4epdo-evhnoiiudnregscraaailrncecu-alclaaltpieonvsesd.oofcuFpmoaersnstisinungcgh tthheat ffeoertm tpheer diameter esfxeopclrolenosdwsienbdgaseiidn nUinpfchoesnor--cyarb_e 2m5---aytrti,hneip2dol4ea-snnhiog:uvnirewSv,teolropmcr.iotvehyiEmdEe>in isn utiasnle LoL eDininttvrueymr,ienoeiunlsveevraCttoiaoetnleedvoafctoiproorniungtoaftoefpdo'imennetttraylo,fpidspiiest.cehacHroOgRoeEr,)dinaCanoltdneencgssrteihtos:ef piSpiec, pe, poinc of coordinates of point of discharge. cf.bi2se.eldrd.v1ei.dn,vdesuEtr.i3i.gnAag.titoh-nesT,Mhaeytahpa16pt,'lsioc1la9i9t4di,onwMasactroecrhreisc23t,bleyi1n9rg9e5f,perleaancncededsN,aiyn asa3,igwha1es995 p4fl;oa6oc:t2e:dl2i.fiCtn.s.laoyfeTrhtsihsenopStrWoMecRxecwdehueircdehinignretnqwouotireifsenettchoaimtnpldsieoaplntichde. wwTaihstetheaSbseohmvatelilolfbiecld biIoanxnvedesesitliafgnedadtimowenthsailchrperavoredeaulcedtdisf.tihcauAtllttvhaostuotgehCmoamtpetahercitaaplpsslucihcvaetar3iaonbleairingngsdiccaartdebsoard tm(ihpmaritenfiaezravatabisloytneelemifinfnioinrmatitszea)atrimeoantiepnrriooagrlrdsaemrwhtiioschsiunabrseetffaednctitif.aflicgur1yle,tatrseeedrucvceoamsptaect 2tu8hteilsilazaiendddfmiaalstle.rSieacltPsiroonvpiods4ee.6.ta2h.etah.rsCei.azte otrfoequttihhreaesbStutrlhulacdttouzraeanrlw8h1i5incthCeagtrisiecrypiloflar compactor or other equipment of equivalent weight be utilised. Sfug2'%gae2sit C.2.d.1. Ttr.heTivhceekaleasdrpeRleidigichsatptoisofenodotianslciofrftriseelcwdtelryeInsvbteeasittneigsgauttthiiaoltniszleradya.efresrsnucpedto in wwmaahtsietcrehiasllhisafltlretfbheeircekinnmcepesldsemmeiunntsetCd.2n.otdot.1ce.oxmcpaerleeyd thickness. wtiwtoh fteehti.s difficult Describe mSoelsisdures treoquciormepmaecntt. teac thtihee die.nv2s.eudlf:of4pi.mceien-nttAofdfeotrthaetihliePsdhapsnuearsrproaosftei.dveesiTighsneantneeaedrdredabteinavcseheAsmtutaspcrthemvreienoftuesrl1y2so isthe referenced in Section C.2.a.5. #70 cSliaonazndnadiddiicfftaiiitltoeisnE'swi.hsderoneodtw'agsgeatnneheer,ailshleystoauctpkipplliiilzceeaddtidodunurriirnneggferiiennnccclleeasmmeennttthawwteeaattthhheeerr, + 9$16-:2(:b41r.9a79v.4inf-giRHeeGlg3dasr)dri,envgiaelwt,htoheuitghslisusdungcoehtwfmaiaslrlkneaodrceasinbaiocnstdriicvcseatdeoudnrisoannlgdAttdthraeacwhMimanyegn.t 1[AY efIfinflelacdtdaeirdet,aionwtahsetouqtupiarlnoitvziietddyi,ngofparosvltiuiddmgeeeafduritashmpeoorsidezudraitnaignodnwhbiytchehwthyitpchehe ssulcuhd'gveas and quantity of materials mixed with the sludge prior to disposal. . 009146 EIDO12679 uFri.gesntienveare FSpCo.aay2ck.tedorn.iu'8aia.lclhs=tohifetPersyostovi.uit"dre"esoSutosraneifdnfDigrmaeiwntnitdnnaiegtcviaaoHtyenesdsc1sot.nhdtaerts"1oiolag3n0camhceFaeaiessesuriraaoetns`sureetrvroiesewb:ecoWumenm:deer-7),+ AsiflSni'vettehshsetetriiaggSpauaptmtliaiiolcontanstciovoofonnu'olprdrionavnd)eiidceacStuomeanmsdaduractitthceaeitdnbguy"bbooitulnhheicSwhiaFliildtnhaoesnyniclteeywsi.tbosre bisana'elrauebtmoiret,edAd:c ames omitted: OSCofno3nd8a2u4cfete,mempdpoorrrueaapdrroeinirllaylySnagccChllboooss"reefddruotuaaurrreSeeas.e"caopvrSeiBrhooarrdmryaoftoweFraseieriaeeildsirnsSagLia:itndeLicresos=vissd*ohNeeeo1raeien'lcbtieshiaxolanric SPBrrieotveiltdceeimipnotthrearqyufainnCatolivteirceosvreeroqfuirrbeeofmererrneotnwscemdarteefirneiraSelnesccetdmiounsitnC.bt3he.iasarvsse.ieicbetobitigCnnatitceo cCTfo.ral2vn.la0egs.cteti]igoTanthsieuosrnMyfsaasycceeen1v6wt,uhanildc1aeh9d9r4al,ryieinanMgalprirctkehheesley23nf,dciulels19o9fta5vo,ehatu:hmaeendroTTuMahsaceykrseao3g,sofrpaet1,99gin5on,eacsfhhieeetled BadCaoiutllreleireinicvgatalittsoehnehtNehsfaiyoyssrtsep3mr6,oabnmlu1esa9mt9d,4dibtsNfrii.openllaaodlcSeod1ivn1vfuieEpcsothonifgvtawahtaseisottenexaitrmshsaacattilenrgaihawyallesstschcseinsaTtrpsilvaecresd. SodLfaaeiatdSceehrcasattyieisnotinefga14ot.us5hh.eaf4ir.lso2rm.obeptehoerdfedtssheiitesgein,ieSnWdM`wRchi,rinchta`hcTtwcoioldrTledetaabencecrhemaliGsvntigitLlohitfzhfeetldhecatmilonrosenmqcuslioasetmeesn,cs [jp StLLthaaaenstdcfihIioaaltnnledo?f1Pf1el1rtofnuome'rosmdhUaSasnliclAiern'mgbyaCp"drrCeeootsgretrpreasmdnionfbeeyndZttnihgteliFrenodWenaartt"sehHeiyvsdaehrpaxolsillsotgPiLxienpcgeurBtisvimielstiiehusesesscdsii.oe a jv| uTiphtoenrdetephsreiegsnernetpqsruoipTteehrmeetniutelsst-ioomffateStheecftoijooetnapcr4hian.tt5e.o4fc.o7lt,hleeScdhtiailsolpnosbsayblstIeanmsc:erspbeasreadved dcsielhRtaeteeyortsmtGiahpneS,ehdaHtEcoLupoPtsaioplmiuiolcdz,eiilncgancaduntcahplveyuesfgfiseistn.aadlteirviLceveoeandccfohivagfeturreroantiHintoohwnpelapsRcrhaeoav:slirlnagsaIniapssuehotan.leb}hdafbcoeaot PgEtrhunoibagcnrkianttmeeh.seesd,,f'eAaamcoalhbxeasistmseuetmrhcaottdlahiiiaslcfcyktinnoeolnsue'ssashcyhhasaateytceetnhiedobinesu'cthisalisirgzghdeetdeEmdu'XisftEijf)buceshteisFst"aoiTlenicdlrsbetyedthe pScRoeyolrtsltteooecrnmtalyitboeundttopasdyllsseptoteeesnrtb;mheien"neslooittczahaitenteghdtaothwfisicetkpchniEeipisneossntohlef$o0ct3al.hte4eea:dcrhl'waeAita:etchh(cia3)otnlelFtechaceqotuliilloteenecastchiaottnheat tS$lyhrosasattsdeeimnmt.ghseptGplPilretnoaghvcoihuda1tet3e"CcSrcFauolslcshluuielcncatgtti:iicoolnnos"nAeslyisaSnocedtpriareconavgitsieidhneo'gfeoctashluaScttuufpliplacoetiraitaconhntaasntcteaiipccnaiodcpliialctteaeyctdtiinogn unodecrolnytiinnugevatsotefumnactteiroinalefofceccutri:vely should settiement of the RoLvoexeurtlisineebguctotfhuerlaeelnatchifarnteeesgarraeivatalyy. efxrt"oeNmnltethaeotfnalttaehnedfCisolellrlieeacsrteiaoofn isPyhsactsreeintiIcmabulseencthoes a 000.71 EIDo0I2680 MPra.geStteenwart AFtaseonfdedCrhiaeessnpscootesocdap,ilatoifeondptSeherwecaottriidkooiinnsnspgoCs.efa3xal.tc3ee:nas5rd.eraef,ifrnoeamrtlhelentchbeeredevbraaimesnperlrSeaoeddfcetaitPhhoeansedCi.s21p.eao.smsai.inaalrea S2spcnhradailloelrthpelttlolarc=tehrde1e0l0ap7itlmeamdc(eeodmwrieoanarttkemilonyGrgfeprftiaehcoxaeprsal.ntsdoaecdthThanetaersacefrooilreelseocntoifoanPphiiasmabmpneeedcvIisiIaecwhseoirmniyecchnhetsor ddtiihvveeerrlsseiiaoocnnhaccthheaanncnnoeellllsse;,ctaainnoddn csuylsvteermt,s.itsIrsncotaueltreic)negptiotnrodiccihanattneenrepSiieopp:itnngd DtiiTgnof culverts shall be numbered with' each hcp(hracaovrnvioninsedgsle-,saeicdnrtieitvfoaeenbrrssle)ienocnefsohcrathmloalntanhbeeedle,dtseausaibinlmgdeindtctvuedledrvlaewofricotnir.gt.yeaFcohDrettaaypicelhedocfudlrivanewteiarnr.glssptor Stslyoopcpeoen,dofbimanasvteeedrrtiueadplonelferavoma2t5-iwyohrni,chof2i{ti-nhcriosmsictnoogmrpmofsleevoadwn,,itn,ainctdsuibtsilicenndvgioFtscehmte.eettdbpiret,4r the 2si0nindadbvieatchtaueittoiinnilgniotztfeehrdecoeupfittongortereitrndhfgeiatcfcellhoeewbas.ec.thawteAeAellsnsocooplrltihoeenvcdlitiedicaeoacnthedateetthaeciolltelydpeecdtriosfowinmnegSbsyesctienmi tdSIheosetiaelcrehomcavtiteenireolydncionlsiglyfesgcttaeiomotneaxndtsiysltteheeniusanndndee.reitdyheeidng1)Tessubcbengtirwraeedesenoy,soe1teiahnnen.g'deli3e)iaInecthshmaeoycassttempsand hSproeooavrdiedsletoisirseatiiniosntahvnletaeasdtfsefidol,mrtaeptreamcrchaioitaofesliyrsnigabtlesh.eaiedcvyaIpfletuy(aipstte)i(nis)3gf.opabdereIttfeiurcitmtliielniiezsdmeodtdvehesamaotneednmtinaendd gsaiechnocattoteerrdxciteJniipsglttleoeyrx.ftsainldsnTeeedLdRiaeuvdsen,trotsbsipeonneeceddideeittdtye,crhtaehpisre.oovotiydpoIeefe'(Jsgst)euofgifesircedieietlnaetrmrIiaanteindosnaadtlehsdat cor tpachrcaootvriddgieenogtrleayxt.tiiolnealeisfnoort-cnheoeodseidn,g psraoivdidteypes(usf)tf:oicibeIenftutiitrlatiiizsoedndesicaeoncdmined aiIn:ns2v.Sehecs.cattuiisg-oiantnAigso3.nct2soh.nediiMonftadiriToccinhatstl2ee3nd,o't4t6h1,aa99tl5Sl,eotrwhieaaebnslddeisNcaihnyars3g,teat1ef99rw5oamtfeOiruestlldertefNeop.enc0e0d1 cCnoorntecaetpnmrteornvatitdiiiosnngsfsuourbftsfheierrcvieerdnetfaltelceOtauectdhlaebttye tthreeI,atemlteehnveta.tseudrfanBcOeDeu.tfiiCmoopDio.eunncadnmdentToCis No. 00% during the ifsc four SmSaeycosccntettepihntos,anbols4fe.a.5i1.d919.5cA.soonfctehCTenoitntrcslaueetrniftoa4r7nca,setiwSoiienmlrsplioeousfn1dit5mk8hee,inlstyGrmdiooamuegpsnnadciwttnauotsdtereerccaomnritesaiinronce.na. 1naE) Protection . 0607575 '= EIDO12681 ' Mr. Stewart Page eleven Ley 2, . sRheaglullatbieonesvaleufafteecdtivfeorJutnheei1r,po1t9e9ntisatlatetso c"aeuxsiestigrnogunidmupaotuenrdments Stcspohohoaetaneltdnlatemisibainelagtntiafokornreem.qnuusgitrtrooWeubhmeneeedrlntweriamegittonerearoetfneics,toi=tnaettldoamwtfiihonterahtdc8iae3oo.gnn0rlt.,eiasnmeTirhnpeoarfratsyecisfecoaoinmrctheeee,nSxiIieNswt.Rhthi.sec,hthSceauIhtrcsftemaigecosen tIbyEepedi(etst)eirsmtiodneebtdeerumiitfnielgdiezoettdehxatatndqilueoptrweoixvltliidlebeervuaittliillizbeadutiinlitsheed,lipnreorvisdyesteenm:ti type(s). If it is determined that geoteoxntaillee foisr cnohtoosniecnegsssaariyd, ftehrteotveairbdoeviesndurifcefafitceeirdeenntctehdartaBtOSiDuo,lnfalCOeCDo,natcraconoldrdiThnaOgsGlyc.boenecneYnuotturrialtiMizaoeynds1.2t,o 1995 reduce Therefore, As use of supcrhoviidseJeareMlayteraia"lstoDpatgaapS"afmeetaysusrhee,etprfoovridtehedeptroadiulcetd. information regarding indicated in your May all 12, steps beinginvestigated =~ 1995 letter - to el. minate as was the black wTeattuerrndoifschBOaDr,geCOfDr,omantdheTOfCilltoaraeccaeptthaebrleeb'ycorenscuelnttirnagtiionnsthe t:h3e-2s.o3i;l borArvoaiwlaarbelae ssotiuldiecsoverrefesrhaelnlcedbeidnetSeecrtmiionnedCb.y3c.o4no.ductingW mCo.3d.ecl.lin-gIptroigsratmhispreavgienocuys'lsy rbeefleireefntcheadt iuntiSleicztiaotniCon.7o.fe.thweouHlEdLP hbayvethibseeSnecmtoiroen.appTrhoeprreifaotree,foritpriosvirdeiqnugesttehde tihnaftormsaaitdionprreogqeuainrebda uthteilipazreadgrtaapkhingbelionwt.o cSohnosuildderyaotuirocngtmhpeandyefbiecliieenvceiesthartefethreendcaetda in garegenelenircaabytleewdilalsbydaacttchaeeptgmeenttehheroadtuteridelfbiezyraetntihcoeendHoEiLfnPAstmatoiaddcemhlemlteihnnotgdp1rp9orgoirvsaimdas,e.dthtihsat you Note Sepang, that if provide detailed rationale in support the method referenced in Attachment of 19 said method. is utilized, tthaekendefiinctioenaccicoeusntr.eferenced in the paragraph below must be gil be iy 2. As the May 16,1954, March 23, 1995, and Hay Attachment 19 indicates that "slope at the surface of each cell w3,ate1r9,95thfeiewlrditienrvedsoteisgatniootnsconrceuvreawlietdhntuhmiesrouasssuamrpetaisono.f ponded' Attachment 19 also states that "the area is covered with an impermeable remaining 16.9 acres clay (1x10-7 cm/sec) of fill which is ppsaapelipradlcmieecdacabotiviielnorintayco6in"ontfdaciioc1nmaxs1tp0ea-sdc6et.eetpdhatArlolaottythheeeord.u"gchgorvaAHesotrswt,eamvcaeththreme,re.inatAltt15aicnhsimtneednaitdcate6exshoifbtihttahste a revealed a sparse vegetative cover. May 16 field review It shoul also be noted that surface run-on must also be considered in your evaluation. nEe.2c.ees.sar-yTh"etoampapilnitcaaitnioncomsptaatcetsionthaantda f6o"r dcuosvteranisd d3ePbprLiisedcoanstrol mwdahutereinrnigdaelStaenaraimtd,isnJiecnrogimcpcdaocsvt.eironi.sIntdoicbaeteapfpalciteodr.s wAhliscoh daersecrciobnesihdeorwedcover 000475 EID012682 HPra.geStteuweairvte E.4.a. - E.5.8.1. Describe use of - Provide name, each type of address, and equipment utilized. qualifications of the landfill contractor. OE.7i. dust c-ovSeerctiiosnsappEl.7i.ebd. asandnecEe.7s.sca.ry itnodimcaaitentatihnatcoampsaicxt-iionnchathhifcokr that waansdtedsebrairse thickness ccoonvterroeld aisn wsoionndyaspeproisosdisblwehiwliethE.7a.hm.iniimnadnicates ox over refeorfenc6e"dofincEo.m7p.abc.tedandcovE.e7r.cm.ateirsiatlh.e saImnediccaartte siofyasdo!il = referenced in E.7.h. contifct Teh sections C12.0.. and 6.Soaa nce nedapplication: E.10.a.2. - Section have been disposed concentrations less C.3. than of Attachment 20 indicates S0PPM are to be disposed. pcs having If PCBs in the pus. `please trovife the types na quantities of wastes containing addition to the dates they were PCBs which disposed. were disposed in If PCBs were not Adtitsapcohsmeedntin 29theinpdaiscta,tepsletahsaet confirm maximum such. 1ift thiScekcnteisosnesC.4O.fotfen feet Therefore, please reconciie: having a ieee, not exceeding 3:1 will be maintained. This is in ScoevcetrionmatCe.1r4i.al swtialtles bethaatppla iemdinitomutmhetheinctkinreses soolfid6" waosftecomapraeacted faoQpnepccleeiscesaaatcrihyontwoowrhkmiiancignhtadsaityna.tceosmptahicastticaoonn6f"alnidscotisflowricdtouhvsetrSecaitnsdioaGnpepblEr.i7ie.sd of the caosntrol in windy periods. Therefore, please reconcile. Section F.3. of is to be placed Attachment 20 indicates over completed sections two feet of soil cover of the fill. Verify that "completed" grade which will rseeccetiivoens noreafdedrittioonlailftwsaswtheichmathearviealrse.ached final Quarterly by Permit Monitoring Well Reports No. WV0076244 reference (QMWRS) submitted as Teguired that statistical comparisons the data provided background well 14 for are downgradient wells not meaningful as 6A, 12A, and 14 monitors 13A with of aquifer. Therefore, groundwater JTeriey your company contends that in the aquifer monitored a different background 2nd 13A should be by wells 6A, 12A, measured for the fidresftinfedouarsqutahretearvseraignethoef dsaactahparbatsme.ecis specifically the period the first quarter 1991. covering the second quarter 1990 through Be advised that the SWMR Iequire `that Hbtohawacstkvgeraror,uendthhyeJrrSooWugMneRdoulaoatigelirocwallbyaaclkuigptrgyorbuaenddidegenrttoeuronfmdiwnthaeedterd.isqpusoaaslmaipltlyinargteoaw.beells based on sampling of wells that are not hydrogeslogically ubapcgkrgardoiuenndt gorfoutnhdewadtiesrposqaulalairteyathwahtereisotasherrewperlelssentwailtliveproovride 00057 E1D012683 e ------ e -------------- . MPra.gesttheiwratreten muoprgeradrieepnrtesevenltlast.ive lnootcatbeedutiimlmiezdeidatetloy "tthhearneftorhea,t apsrowveildlesd dedtoewrnmgirnaediebnatckgofroutnhde beAy, hy1d2Ar,ogeaonldol1i3caalslcyh dgirsopuonsdawlataerreaq,ualtihcehy. mu st dHgTi4hhs7eip4rso0asf,aao5glr%esn,tcaryheeoaywt.'ihlealrrSehwcoenoluonllts(disdl)yeoorcuamrtuteshdtecomubiptemaimnlaeytidizilaealittezieceoltdny: otdofowFnvGogeerrLllaltidshziieseWnAcN"pWieorAosiecA'altnshda,e/eor gdMerHmo=ou4nnAsdtw(raiatnteerldideautthaoatf inscaointdshetrweaulqclut(iisfn)egrwnimelwolniwetalodlreseq)du,atbyeiltyMWmOpu6srAto,vibMdeUe-12A, HW-13A. and dBSSofaecscuvetmadieroniunotpuao5snt.i5.oad1ne.rcaijvoouinfsestwitohfeofyfintSghMeARptphSleailRcvlaaotwlpisvroenorvfiNoodor.erdtWmhVote0dh0iaw7fta6ii2cvs4aue4trr,ieoiowncratieimvsnoetdrpisrfoivocifadteido.n pSSrehocovtuiildodensyosuu4rf.4f,iCcoim4e.p6na.tn2y.jbdu.seAts,iifrieacnatdtoi4o.pn1u.2r.s2ueawpapievaerrstoofbetahpepsreopsreicattieo.ns, Q3AAus.pa7pl.lvi7ais.tc7ya0tifCinoodnntithcreNaoot.leSdMWPRVli.Oan0n7t6ch2io4sn4siamsgutesennctyt'iswnicltFuhedberthueaarQyrueaq4,luiirt1ey9m94eAnstslseetrtaoenfrc,eS/ection eCBxoypmrplelesitsatenedcreadaDdtieevsidisirNoeonv,teomAbieirrnci3P0no,eirlau1tt9ei9o0nsotloCiodnRt.iLrf.oiledWCemsoemermt,ihsascCirhoyinel,fa,tyyou aqdsifuiraasulnppyto.sisetesid.eTsah|etroIefftfhodmerieetsD,hpraoycsiraRnyludlniaactslieaavntedeslfiliriluflpa.imeataslhhIlafchaarsbsvy,alinaoplttraeobvblsieeiderenulpeddaiaacstshpehaosbshieaaidnsi,dcybeen please indicate accordingly. ts2oe2a,l1bse391iarmopiulnnesdmpeewncettleilodsntboyiMW-tn6hsitasanldlaHgWes-nuGrcAfy.acreeTvhseeearalelefsdortaerh,oeunpldraocvtkhiedosefemsewuaerlsfluasrc.ee oAIbtnttdaaiiccnhaetmdeentwfhoiNroc.hsem1l4io-caranetnfiuoeanrlenicsleesuatchiSalttirezeeadmanaSflaoymrspiclsio.nlglecPtoiiontnsof1 tahned s2.ample R2Abehosedvoeeutarabcoirevleseeqduearndnseatqreurdefasottuiiernvdfeo(,4ri)mnawftchoioeroprmniea.etsiaopnopPfrloteposarasimeCaehtiseetu,fob,mmisytGharlftalihtecteeancortcoiifogominWpnaaatnlateyrmtcyhoepy of cF19oa9ni6tr,imnoun8at0. tofhfaitcetheinraenvieewxpeofditAipopulsicamtainonnerNob.utWpV0r0i7o6r244o mJaaynusry 11, 000575 ' : : EIDO1268 ? ' ER  uPea.gestfeowuarrtteen SShoonueladceynoeu hataveTaaddn)y Tesi questions concerning the above, please Sincerely, OFFICE OF WATER RESOURCES JGB/3b cc: Cindy Musser, Insp., Qe 4Bioee John G. Britvec, Geologist Industrial Branch SW Dist. BR 000.7wr5 EIDOL. 2685 || INTEROPFICE MEMORANDUM Date: From: DTeeplt:No: C0R5A-IDGec-K19D9I5LLO1N1:29am DFlIuLoLrOoNpCrKoducts 304-863-4972 To: Distribution List Subject: Meeting Notes - C-8 at Dry Run ATemfeloent+inwgaswtaes htehladt oins Nproovpeomsbeedr t3o0 bteo dliasncdufsislletdheataccDerpytaRbuln.e C-T8hosleeveilns for a(tPtoewnedran&ceSewrveirceesW)a,ltJoShtnewaDrotughatnyd D(aCnenWterablerLa(bE)n,viraonndmeRnotgaelr),ZipWfoeold,y EIdreJlaamneds, and Craig Dillon (feflon#). bZyiptDeolughptryesefnotredC-d8atlaeveolns.variDoeutsailTsefloofn*thweasstaemplseasmpleexstrtahcattedwearree erxetcroarcdteeddin rboeofkereNon.ceEeSx6t5r3a8ctpiaogne d1a23ta(fDuorungihstyhedLogb?y).QualDiantyWeAbnearlytailcsaolprLoavbidonedbiaos-cake. Summary of the data is as follows: SAMPLE DESCRIPTION C-P8OLYLMEEVREL EXWTARTAECRTEDEXTC-R8ACTLIEOVNEL BRM|_p _ RMas 150-1 Fine Powder Trench Scrap - undried 59 0.48 150-2 Granular Vacuum System Scrap - dry 2 0.08 150-3 PFA from Process K test dryer - dry 1 0.04 150-4 FEP-4100 from Line 3 - dry 7 0.04 150-5 1 ppm blank , - 1.04 NA Bio-cake sample (Quality Analytical) 0.5-1.0 0.004 Dtohuagthttyheexatnralaycstiesd tmheethsoadmpulseedtbhaytQQuuaalliittyyAnAanlayltytiiccaalldiafnfaleyrzeedd.froWmebtehre nmeottheodd uWseebderbyinDdoiucgahtteyd tonhattheappproolyxmiemrateslamypl7esp.oundBsaspeedroynetahreofbloC--8cakies canuarlryesnitsl,y landfilled at Dry Run due to bio-cake. UbesinlgantdhfeillteesdtartesDurlytsRuna.s aIgnuiadded,ititohne, graonuypmealgrteeeddstchraatp GPFrAanuolrarFEPscrcaapn cbaen twlhoaeunlddfeixlibtleedsscirdaaetpoDmfryattehRureni.aelxtgrFeuonrdeerrPFaAta,enddthabitesyotnwhdoeule(dxgiebtneesriasdlcleryapofcmubatethsee)r.ihaulmFigodernheeFEraPat,'tterdtehaiastter garnodupbeytohnadt t(hgeeneproatlelnytiasllablsa,ndsfhirleld,amocuubnetss).of tIthewsaessctrheapcomnasteenrsiuaslsofwoutlhde not significantly impact C-8 levels at Dry Run. TFhoirsFwianse Pboausdeedr/oDnistpheerstieosnt, rneosupltrsoceasnsd salcsroaponwiplrlocbeessalcloonwfeidguartatDiroyn.Run.There is concern that the process configuration would not allow for distinct 009475 EIDO16730 sPeopuadreart/iDoinspeofrsiC-o8n amnudstnboen-Cd-i8sposscerda,p. theInf athliasrgmeatearmioaulntsohfoulfdinbieshetdestFeidnefor CJ-r8oupandthahtandTlefeldono*n acnontiinnduievitdoualdribavseist.he Istalewasofalasllo tshcerapcontsoenrseudsuceofthtehe need for landfilling. 00057 oh '- Si &iDO16731 < . : 12/23/95 notes from Dawn Jackson a AJBiem CFfreotumthmea,tiievnehEddelekiihflnarssdompDaoNEiiRasreslOofncfTioienncngtena,actnthteecdaadlbelDroee,urdtmTiehwnoamtttaehosred,ayfarlteaohabew.oiunStgtaTtafeernocaamnltlDubttohoanlttd'she E R Eer e eia ehaefeviLhacietet),hh'atdashnhedGoounJDreeed,pftfc.bouMntctofaccwrtAiagtdrhhyiiocsututollltdosucarahtelii.smfDaNtcCoRtriuocomfanfl.iltcoelm,edC,rwTuehmKninnccoahawnlitlnegd hoe 2 haa come background info on Mr. Teanant. TTSeeineenmaaelnditcoeutntotlidtyh.Cbruem"Wfhitevhnea,CtrunbuemmtepurieoneunnsedtdhheeiemrmodhnaotdhwsnbeooenfnnApupmrobiielsrosna,enddtOhicentottbhoeetra,l wFiotuhndOcotneobemreabzeiDnrgy Rtuhne. lasCtrumtimteoldthaTtennTaenntnantthastaiidf htehawtouheldhad contact the DNR office when he finds a fresh carcass, the DNR whaiiltledtdoaonielaadteindsgrsmubeeirnanotfahleyssBuiceshl.laenvai(llCylrseuemsariewnahdeincinatte1h9de8r8et.o)wmaes tahvatirutshekDiNlRling PThDeneendrnieaMcnaotvcmaeasdaslsaconahenpdarpcoJreviceiamsidecneCcrduelmes.vOeefvlermHaeeolfrcsuva.rei0ryd0y57itnshpapptetmch,eihfisiDacrnydvkaitRtneuhdranst satontrfaheelaydmspe,iitsaiwtlahssat t"onot ITeineeadayruee aanldeeThsaarieddatvheatwiDtuphon5tgwaalslontsreoaftinhgydrtohgeenlapnedrfoixlildep.onds Wthhnie.nlfCersnuommmaenoantsekesdcalodTuelndtnhaagtnitvehetohwiomsuhlasdroenm'ethihseslhapowtveitrthehanhEaielspyosrcitastttloien.afonyowCniretuhm the eopledatheidn tthhaact tthhee DDNNRR wtoouullddn'dCo aaddcriessssuethseampclaettloen aissfuree,shbudteer cazcase. miienmafbCeoruutmospc(rhweeiythnurwmehbionetmrrooodufurcrtWuiHmoEonCr)shascsohauwtnodretkdheedveDroNynR astymplaetashtetiocneapnrdojteocltd struggles with. He oSauildactahalti"cuosntaifctihneghuesarsvasfraomcMoru.rteTseynnacanltl,agaainnd.he said that he BHSeeomeaaltsshkoiendgamsektehdaitfmeMwre.sdpToeecnianfnaincatanlamllyaysyiisfhavwoeef ssreeen tarnedatmiinsginttheerpproentdesd,witahnd the materials that Mr. Tennant mentioned. I told him that I'd get back to him. I talked with Ron Meloon and Woody Ireland, and Woody pointed out mDtSoohrntaettahtalamwyriasnretecnoioocfnt,hAeampneryDriEcPltu.rr1ey1a,WtomtoaeodnnydtchpaatHnlhgsaeotaremrteahaecymaoPhlnHalgveedoftohoemctechepuharyrrpodaenrmddoe,tgaeesrnDsurtpoeurrhteeoipxnoiveradtlseeydas CGSeeoveenedcrlyYutoTdnueaenasytdchsahacyith/neTgdihutullrewisakdsedauyrab.ieanitngigRfootndahoennaeonsrdumeaWmvloeegorradysycThuaatetrr/eeTmahcatuhymree.cnhktaivnmegaylweihdtavhTeeBnonbsaeneotn toto BIankeconscelnuses.iona,ndDaswhne wliosvheessheNEr. jTobe,nnashnet haopveeszytMheartrythCesherisntomtaess. go g ous EID010289 g 60 060:37 INTEAGFFICE MEMORANDUM OFartoen:: R27o-gMearr-o.159Z8ipt0e2l:50pm EOT Oept: zFilouroreoproducts Ted Mo: 304-sed.2567 70: 7 addressees Gor GERALD L KewiEDY KENNEDY AT AY AT HOAX) Subject: Phone conversation with Gerry Kenney AXtetmanecdhye.d aSriencethe1 4naotneostofgooadphHointeh scoonaveorfsatcihoenssIwarredcse,ntlysehyadhawviethnoGterGroyt the Story completely correct. By this note, I an asking Gerry to correct any arror in note taking on ay part. PGa0r4Ganrrey the botton Line ia that item 1 is not good news and items 283 are Roger. C055 EID073253 G8 Toxsesty ro: Bone conversation with Gerry Kennedy on 3/20/96 uG1)-n8de3rMcsotnacanendndtiHrnoagst.cihosTnths'eyar(er1a0n0r0uannaniicn`rgUongts/ecashlte)sdutltheoadtfOuWClA.l8ySegyaxnvpteahnedesqiucsiuvrotceGskatln.oreTTshoeuxyiitcsiftoyuonndgeatnohigh Toxicity. They are currently collaborating on why this happens. WtihhnaedtriecaCt-Ti8hoinscoutWlhiadltlbCeg-o8clinacsosutlihdefiefbdeutaua8frfee4citslianrnggoetOWc"AlC,FearTc,haercbiuwntoorgstethni.scasies sthceanafirrisotis 2t)he3MsiagnndiiHcoaancchestofhavteheprCUoPproasnetd traotthpeanAcPrHeEatitco LSoeonkcaratcotnhceerhnusm.an relevance of G3L)aonva3l1Ms0.%has`bReehsciuorlnetfdsiraoafnedte.hpiiTsdheeneifofsloaromtegisawtroertkoetrhartPeOlPotoUhkLeATaaItfOfNeIcMwtas(s19r94e11p)%o0rKtoeexrdskRebirynehtdohresWieutnohetldaMtienn. Tatatkeecntsina1r9e93n4o1t9e8d3.and again no relationanipe of C-8 exposure To Normonal showed tAhatFeloonolky 1aofthethepr8ostcarsaetse scaasnce8rsG-3notwoerdkeirn. the 1991 Uofiinn study 3 plans to publish this work. > EID073254 00s NE INTEROFFICE MEMORANDUM Date: From: DTeeplt:No: W1A0L-STeEpR-1M.996ST0E4W:A5R9Tpm SPTPEDW-ASRHTEAGEA (304) 863-4271 TO: See Below Subject: DRY RUN LANDFILL COMPLAINT U.S. EPA,I RHEAGVIEONHADIITIWOOFFCIOCNIVAELRSSATRIEOGNASRDISNIGNCEA YCEOSMTPELRADIANYT R(E9C/9E)IVWEIDTH CFORRORMEMCRT.IVEEAARCLTTIEONNANGTR.OUPBOATNHDMASRAYRAHBECCKA,SPARRE,PREFSROEMNTITNHGE STUHPEERRFCURNAD RAELMLOEVGAELD TEHNAFTORC1E5M0ENCTATTALNED ODIIELDSAESCTAIONRESIUNLDTICOAFTEWDATTEHRE FCLOOMWPLAAICNRTOSS HIS APRVOEPTERETRYINAFRRIOAMNOU(RNOLNAANMDEF)ILLT.HATHETEOEFTFHEREEDXAAMSINPERDOOFFROMA STHTEATEDMEEANDTCAFTRTOLME SHOWED SIGNS THEY OBFOTHFLUROERQIUDEESTEEDXPONSAUMREES. OF THE STATE PEOPLE WE WERE WPOERRKMIITNGWWRIITTHERAANDNDICGIANVDEY MTUHSESMERT,HETHNEAMEESNFOOFRCJEOMHENNTBRIINTSVPEECC,TORO.UR MS. CASPTAHREIENPDAICAITSEDTAKSIHNEGWOTUHLEDCBOEMPLFAOILNLTOWVIENRGYUPSERWIIOTUHSLBYOTAHNODFITTHEWNA.S TSWTOATWEEDEKBSY MFSR.OMCNAOSWP.ARSHTEHATINSDHIECATEEXDPECSTHEEDWTOOULDVISLIETT MTEHEKNSOITWEWHAEBNO,UTAND TSOHMAET OTFHETHSETATBEACKWGORUOLUDNDBEAABSOKUETDTHTEO SPAIRTTUIACTIIPOANTEA.NDIINFDIILCLEADTEDHETRHAITN WOEN WOULD COOIPLELRATKEEEWPITYHOUTHIENMFOIRNMEDINWVHEESNTIGIATHIENAGR TMOHREEMAATBTOEURT.THIS. Distribution: TO: H. DAVID RAMSEY, JR. CCCC:: MRAOYNNAALRDDWSMEEALTOOONN, JR CC: LYNWOOD K. IRELAND CCCC:: DGAEWRNALDD JAACPKLSOOENGER cCcC:: HChaRrAYlesHODT.GESAlt CCCC:: GRAORBYERTW. L.KLERSIETLCHEY CCCC:: DGAEONRIGEEL WAOWYETBOWEIRCH ( RAMSEY ) (( MEEALTOONOSNSRW) ) ( IRELAND ) (( JPALCOKESGOEDRD ) ) (( AHLOTDGE) SHR ) (( RKLIETSCEHLEGRWL )) ( WEBERDA ) ( WOYTOWIG ) O0LEs EID010291 | INTEROPPICE MEMORANDUM : DFartoem:: T1h6o-mSaesp-1R.996Wal0d2r:o2n3pm Dept: WAPPLDD-RPOOTWRER/SERVICE Tel No: 304-863-2489 TTOO:: RLYONNWAOLODDWK.MEILROENLAND (( MIERLEOLOANNDRN) ) cScE: DRrARALA wKIeReSnCHNER, JR {( vKaIsRaSrCoHnRA) ) Subject: Dry Run Landfill 09/16/96 oIbssearwvantoiIoenxtspo.ousreed1d) DarreyTahseR.unneLw2)alnydTfsiholewlnrgitrpoa-dsrasayppsaeneddeddmaiidtsechgertsohewwienfrgoelwleodlwoliinngganda agcoodthejotbimoef),holtdheindgisbcahcakrgmeostfroofm tthheemtwhaesrumno-sotflfy (cilteawra.s r3a)iniTnhge dluoevertopaondsmvaalsl asmtoiulnltveorfySgolriedesn wiinththesomreunosflfi.ght4)disTchoelroerawtaison asonmdepefrosaimsitnigngcodmoiwngnsdtorweanmipnatsottthheeloouvtefralplo.nd fI roinmstthreuctuepdperthepond Tohpeerawatsotretwoapsutcoampqlueacretlyofcovaenrteid-,foeaxmceipntthwehatuphpaedr bpeonedn.dep5)osited during the morning hours. Any questions, give me a call. ' Tom 0094.85 EIDo16848 63 000549 | INTEROFFICE MEMORANDUM DFartoem:: Dept: Tel No: 0Th7o-mOacst-1R.996Wal0d1r:o5n5pm WALDROTR PPD-POWER/SERVICE 304-863-2489 TO: RONALD W MELOON TO: LYNWOOD K. IRELAND ( MELOONRW ) ( IRELAND) CC: RICHARD A KIRSCHNER, JR CC: DANIEL A. WEBER ( KIRSCHRA ) ( WEBERDA ) Subject: Ory Run Landfill couple ofI tthoiunrgesd tthheatOrIymaRduen cloarnrdeficltliontshistooa.fternoon and found a the 1) The exit pipe. outfall It also had some appeared tcoonspiedresriasbtleinftohaem in and stream around down to tahbeoutpontdhevi5a00thefooatirlelvienle. andI added about about a quart a pint to the of anti-foam outfall exit to itself. The foam began to immediately disipate. face of t2)he aIctailvseo ffioluln.d sAompeparsemnatlllyatrheeastroafshexphoadsedlaitnrasuhncoovnertehde amlaltewreieaklenbde.foreI hienstlrefutctefdorthteheldaanydfainldl hoepertaotlodrmetohecowvoeurldtheget it done. grass grMoowsitngofonthtehesreacnedntltyhosseeedpeldaceasreatshathavheavea good been crop of exposed by the the proencdesnt harvaeinslowtsillof be4 wrheeseeleedredtrtahcikssweienk.themThaesmeitadoWwosuldbelow aprpepseeanrt.thatAnysomqeuoensetioinss,Stiglilvermuennaingcaltlh.at area When we are not Ton 000.2% EID039281 | INTEROFFICE MEMORANDUM DFartoem:: Dept: Tel No: W1A5L-TOcEtR-1M.996STE0W3A:R4T9pm STEWART (P3P0D4-)SH8E6A3R-E4A271 T0: Distribution List Subject: EPA AUDIT ENVIRONME1NTRAELCEMIAVNEADGEAMEPNHTONTEHICSALLAFTFERRONMOOMNR. (K1E0V/1I5N)SCIONTFTO,RMPIRNCG ME THAT HOEURANDRDYARNUONTHELRANDEFPAILLPERFSORONTHWEOULNDEXBTESCEOVNEDRUACLTIDANYGS.ANHEINSIPNEDCITCIAOTNEDOFTHAT TIHTEWOIUNLSDP_ESCTTAIROTN WTAHSISTAHFETERRENSOUOLNT.OF MR. TENNANT'S COMPLAINT AND THAT SAMPLINGTAHTE TIHNESPLEACNTDIFOINLLW,ILALNDINSVAOMLVPELINVGIEWDIRNIGNKTIHNEG WSIATTEE,R WEEXLTLESNSIIVNE THE VICINITY. 1 INDICATED THAT WE WANTED TO SPLIT SAMPLES OF ANY TAKEN ATMRO.URSCLOATNTDFIDLILD.NOT WANT TO COME TO THE PLANT BUT WAS 4 - GTOHIENGINDSIPREECCTTIOLNY.TOIFTTHHEERLEANDAFRIELLA.NY IQUWEISLTLIOKNESE,P PYOLUEASIENFCOARLMLE.D ABOUT 665435 EID024318 BN GASTON CAPERTON GoveRnor DIVISION OF ENVIRONMENTAL PROTECTION 1N0itMrco,JuWnVki2n5R1o4a3d October 15, 1996 LADLEorERLecMeTcoany, Pho. Mr. W. M. Stewart Senior Eavironmental Control Consultant `EWLasDhiunPgotnotndWeoNrekmsours and Company P.0. Box 1217 Parkersburg, West Virginia 26102 Re: Dry Run Landfill (WV/NPDES Permit (WV/NPDES Permit No. WV0001275) No. WV0076244) and Washington Works facility Dear Mr. Stewart: DHuoPwoenvte'rs,E.oLapveeDrruatPtiohoenntspaodsfet tNsheeevmeDroarulyrsmRouannnthdLsa,CnodifmnipslpalencatynodrhsatswheiatlWhwaDasyhEsiPnbgehteaonvneaWoovbarslkeursevdefadcciislteiitrzyie.onusoDfusrhWioenrsgttcnoVumiimrneggrisnoiuiasn. inspections, DEP employees noticed, among other violations, the following: 1. bOlnackseavaerdaoldoocrcoausisonlse,acDhuatPeotnotbhearselaelalsoewdedf,raonmditcsoDntriynuReusntLoaanldlSoiwl,lianltaorDgerfylRouwno,f in violationof its NPDES Permit and the West Virginia CodeofState Regulations, 2. OintssWeavsehrianlgotcocnasWioornsk,sDfuaPciolnittydiinstcohtahregeOdhiToefRliovne,rD,elinrovino,lNatyiloononfaintdswNaPxDbEeaSdsPferrmoimt and the West Virginia Codeof State Regulations; 3. Orunn-soefvfefrraolmocfclaoswiionngsa,cDruoPsosntthheaDsrfayiRleudn,aLnanddafpiplalraenndtlhyacsofnatiilneudetsotcooflalielc,ttoanpdrterveeaatt olfeSacthaattee Rgeegnuelraattieodnbs;y the Dry RunLandi, inviolationof theWestVirgiCnoidea: 4 DOEnPsetvheartatlheoqcucaalsiitoynso,f DthuePloenatchhaatsegfielneedr,ataenddbayptphareeDnrtlyyRcuonntLiannudeisltlohfaasie,xtcoeneotdiefdy WtheesdtesViirggnicnaipaacCiotdyoeftofheSttarteeaRtemgeunltastyisotnesm;, in violatoifotnsNPDES Permit and the 005.24 EID012733 Mr. WM, Stewart October 15, 1996 Page2 Ss. On several occasions, DuPonthas failed, and apparently continues to fail, to properly compact the wastes disposed at the Virginia Code of State Regulations; Dry Run Landfill, in violation of the West 6. On numerous occasions, Du Dry Run Landfill in greater Pont has deposited, concentrations than and continues to deposit, waste the concentrations approved by in the DEP, in violationofits NPDES Permit and the West Virginia CodeofState Regulations; 7 On several occasions, DuPont has failed to properly operate and maintain the Dry Rua Landfill, in violationofits NPDES Permit. 8. DuPont has failed, and continues to fai, to retrofit the Dry Run Landfill surface impoundmentwith alinersystemandleakdetectionsystem,inviolation of the West Virginia Code ofState Regulations; 9. On numerous occasions, DuPont has allowed the effluent from the Dry Run Landfill 10exceedthewater quality standardisn, violatofitohneWestVirg Coi deonfSitaate Regulations; 10. Onnumerous occasions,DuPonthasallowedthe effluentfromtheDryRunLandfill 10 exceedthe discharge limitations established in its NPDES Permit, in violation of its NPDES Permit; and 11. On several occasions,DuPonthasfailed,and continues to fail, tocomplywitheach and every conditionofits NPDES Permit, in violation ofits NPDES Permit. Due to the foregoing violationsatthe Washington Works facility and Dry Run Landfill, DEP intends to file relief a to caivdidlraecstsiocnurargeanitnsatnDdupProonstpeicntitvhee Circuit Court of Wood C violations and will ask oun for ty. the The agency will seek injunctive assessment of civil penalties for current and past violations. Acopy of adraft complaint is attached. 1 have instructed DEP'sOffice ofLegal Services to initiate formal proceedings against DuPont in circuit courtby nolaterthan January 15, 1997. potential resolution ofthe enforcement action Should before a DuPontwishto eater into complaint is filed, please negotiations contact DEP to explore. attomeys Matthew Crum or Scott Goldman at (304) 558-9160. Vey $f yous, Bojac Laidley Eli McCoy, Ph.D. Director 009425 E1DO12734 IN THE CIRCUIT COURT OF WOOD COUNTY, STATE OF WEST VIRGINIA WLeAsItDVLiErgYinEiLaIDiMvcisCiOonY,ofDirector, Environmental Protection, Plaindff, DRAFT v. Civil Action E. I. DuPONT DE NEMOURS & COMPANY, INC. Defendant. COMPLAINT INTRODUCTION PlaintiffLaidley Eli McCoy, Director, West Virginia DivisionofEnvironmental Protection ("DEP"), by counsel, alleges the following: 1 `Thisis a civil action brought undertheWaterPollutionControlAct, WestVirginia Code 22-11-1 to -28 (1995) ("WPCA") aod the Solid Waste Management Act, West Virginia Code 22-15-1 to -20 (1995) (*SWMA"), against Defendant E.I. DuPont De Nemours and Company, Incorporated, based on violations of the WPCA, SWMA, and the regulations promulgated thereunder forinjunctiverelief, theassessmentof civil penalties,andattorneys fees. 009.2% EIDO012735 PARTIES 2. Plaintiff, Laidley Eli McCoy, for and onbehalfof the State of West Virginia, is the duly appointed Director of DEP, and is thereby authorized by the WPCA, and the regulations promulgated thereunder, 10 enforce the water pollution control laws and regulations of this Ste. Specifically, W. Va. Code 22-11-22 states: `Any person who violates any provision of any permit issued under orsubjectto the dporlolvairssipoensrodfa(ytohfesWucPhCviAo]latisiosnu,bjaencdt taonyapceirvislonpewnhalotyvinooltatteos eaxncyeperdovtiesnitohnooufstahnids. artoirocflaney rule. .. is subject to acivilpenalty not toexceedtenthousand. dollars per day of such violation. Any such civil penalty may be imposed and collected only bya civil action instituted by the director [of DEP] in the circuit courtofthecountyinwhichtheviolationoccurredorisoccurringorofthe county in which the watersthereofare polluted as the result of such violation. Upon application by the director, the circuit courts of this state or the judges otfthhe epirnovrvaicsaietoinosoonfmtfahyisbyairtnijculnec,ttihoencruolmepsoefltchoemp[leiaavnicreownimtehataanldequnajloiitny]viboolaartidoonsr dtihreepcrtoovri,siefofnlsuoenfttlhiimsiatrattiicolnes,,otrhae ntyeromrsdeanrodfctohndeitdioinsorfeaoncfybtpoeaorrmdri,tagnrdanttheedvuenndueer of any such action shall be the county in which the violation or noncompliance exists as the or is taking place or in any county in which resultofsuch violation or noncompliance. the watersthereofare polluted 3. Additionally, Director McCoy is authorized by the SWMA and the regulations promulgated thereunder, to enforce the solid waste management laws and regulationsofthis State. Specifically, W. Va. Code 22-15-15(d) and () state: ru(@l)eoArnoyrdpeerrsiosnsuwehdopuvriosluaatnetstaony[tphreovSiWsiMoAn Yofi[stshuebSjeWcMtAtLo,ac(iavlinlypepnearlmtiytnoortatnoy exceed twenty-fivethousanddollars for each dayofsuch violation, which penalty osr ihnbtehareceicrlocvueilrtecdouirntoacfivKialnaactwihoaneCiotuhnetriy.nthecourtwherein theviolationoccurs (6)Thediremacysteeokarn injunction,ormay instiatcuivtielactionagainst any person in violation of issued pursuant to this any provisionsofthis article. article or any permit, rule or order 2 000527 EID012736 ' --- v 4. Defendant E. I. DuPont De Nemours & Company ("Defendant"), is a corporation duly authorized to conduct business in the State of West Virginia. Defendant owns and operates. a facility ("Washington Works") in Wood County, West Virginia, which produces plastic and acrylic resins. Defendant also owns and operates a noo-hazardous waste landfill ("Dry Run Landfill") in Wood County, West Virginia, that serves the Washington Works facility. At all pertinent times hereto, Defendant was and is doing businessinWashington, Wood County, West Virginia. 5. Under the WPCA aod SWMA, the definitionofthe term "person" includes "any industrial user, public or private corporation, institution, association, firm or company organized. or existing under the lawsofthis or any other stateor country." W. Va. Code 22-11-3(15) and 15-2(22). Defeadant is a "person" as defined under the WPCA and SWMA. JURISDICTION AND VENUE 6. This Honorable Court has jurisdiction over this action pursuant to W. Va. Code 22-1122 and 22-15-15(9). 7. Venue is proper in this court pursuant to W. Va. Code 22-11-22 and 22-15 15(d) because Defendant's Washington Works facility and Dry Run Landfill are located in Wood `Countyandbecausetheviolationsreferencedhereinoccurredorareoccurringin Wood County. STATEMENT OF FACTS 8. Defendantwasoriginallyauthorizedto operatethe DryRunLandfillin 1982 through issuance of permit No. IWL-6282-82 by the DepartofmNaetunratl Resources ("DNR"), 3 039.2% |a : EID012737 predecessor to DEP. Such permit authorized Defendant to discharge a specific amount and type of pollutants into Dry Run,a tributaryofthe North ForkofLee Creek, which is a tributary of the Ohio River. Pursuantot W. Va. Code 22-11-3(23), Dry Run, the North Fork of Lee Creek, and the Ohio River are all "waters"ofthe State. 9. On Jamuary 12, 1990, DNR reissued IWL-6282-82 to Defendant as Solid `Waste/National Pollutant Discharge Elimination System ("SW/NPDES") Permit No. WV0076244. As written, the SW/NPDES Permit was scheduled to expire on January 11, 1995. A copy of SW/NPDES Permit No. WV0076244 is attached hereto as Exhibit 1. 10. Solid Waste/National Pollutant Discharge Elimination System Permit No. `WV0076244 incorporated by reference, a5 a term and condition thereof, information subtitted by Defendant with SW/NPDES Application No. WVO0076244, as well as information contained. in correspondence from Defendant dated August 10, 1987; September 15, 1987; March 1, 1988; April 14, 1988; March 16, 1989; and May 9, 1989. See Exhibit 1, page 1. 11. Under the federal Clean Water Act, 33 U.S.C. 1251, esteq. and the WPCA, the. State of West Virginia, through DEP, is authorized to regulate discharges into the watersofthe State of West Virginia through implementaotfitohen National Pollutant Discharge Elimination System ("NPDES") Program. Specifically, the NPDES Program is "the [olational program for : issuing, denying, modifying, revoking and reissuing, suspending, revoking, monitoring and enforcing permits, and imposing and enforcing pretreatment requirements under Sections 307, 318, 402, and 405 of [the federal Clean Water Act], including any approved (s]tate program." Ses National Pollutant Discharge Elimination System (NPDES) Program, ("NPDES Program"), `West Virginia Codeof State Regulations ("CSR"), Title 47, Series 10 2.27 (1993). 4 EID012738 069.23 12. On February 16, 1990, Defendant appealed the terms and conditions of SW/NPDES Permit No. WV0076244 to the Water Resources Board, predecessor to the Environmental Quality Board. The appeal wasresolvedby the Board's eatryofanagreed order dated March 12, 1991, 2nd resulted in a corresponding modificationofSW/NPDES Permit No. WV0076244. The agreed order is anached hereto Exhibit 2. 13. Byletterdated January 11, 1995, DEPextended the expidatreoafStW/iNPoDEnS Permit No. WV0076244 from Jaauary 11, 1995, to Jamuary 11, 1996. 14. By letter dated January 3, 1996, DEP conditionally extended the expiration date ofSW/NPDES Permit No. WV0U7624t4o September 11, 1996. Such extension was conditioned `upon Defendant providing DEP with additional information regarding its Dry Run Landfill. 15. By lener dated August 22, 1996, DEP extended the expiration date of SW/NPDES Permit No. WV0076244 to December 11, 1996. 16. In additiontotheDryRunLandfill, Defendantalsoownsandoperatesthe `Washington Works facility whichproduces plastic and acrylic resins. On September 30, 1994, DEP reissued NPDES Permit No. WV0001279 to Defendant for its Washington Works facility, such permit authorizing Defendant to discharge a specific amount and typeofpollutants directly into the Ohio River. NPDES Permit No. WV0001279 is attached hereto as Exhibit 3. Violations of ConditionCsONUotNATllIowable in State Waters 17. Plaintiff hereby realleges and incorporates the allegations set forth in paragraphs 1-16 abovaes if fully restatedherein. s : 00aIan EIDOI2739 A. N . 18. Pursuant to the Requirements Governing Water Quality Standards (*Water Quality Standards"), 46 CSR 1 HACER 3 (1996), entitled "Conditions Not Allowable in State Waters," SNtoateseswhaalglec,auisndeustthreiraelinwaosrtem,atoerrioatlhleyrcownatsrtiebsutperetsoe.n.t i.ndaisntyinocftltyheviwsiabtleersfolfoatthineg osrlusdegtetlebaabnlekssoolindst,hseubspoernodmed. so..lidos,]dsocrusm,infotahme,viocrioniiltyy slicks of the . w.at. e[rds]e.po.si.ts[oorr] [d]istinctly visible color. 19. OnMarch 23, 1995, Cynthia J. Musser, Inspector, EnvironmentalEaforcement, DEP, inspected the Dry Run landfill. During the inspection, a flow of very black and odorous leachatewasemanatingfrom thesubject landfilland enteringDryRun,thusdiscoloringDryRun and imparting an odor thereto. 20. On May 3, 1995, Inspector Musser conducted an inspection of Defendant's Dry RunLaosn `Theleachate fromthe landfill remainedodorousandblack,andthedischargefrom thesubject andi intoDryRunwasodorous, turbid,andgreenwithalgae, thusdiscoloringDry Run and imparting an odor thereto. 21. OnAugust 13, 1996, Inspector MussercondictedaninspectionofDefendsat's Dry Run Landfill. The leachatefromthe landfill remained odorous and black, and the discharge from the subject landfill into Dry Run was odorous, turbid, and green with algae, thus discoloring Dry Run and impartingan odor thereto. 22. On August 20, 1996, Inspector Supervisor Charles A. Moses, Inspector James C. Laise, Jr., and Inspector Musser conducted a river patrol of the Ohio River in the vicinity of Defendant's Washington Works facility. During the river parol, the inspectors sampled deposits onthebottomoftheOhio Riverandalong theriver'sbanksimmediatelybelowOutfall 002of the 6 009505 EID012740 Washington Works facility. The sample contained beads made of Nylon, Delron and Teflon - all materials manufactured at the Washington Works faciliy. 23. During the August 20, 1996, Ohio River patrol, the inspectors likewise sampled deposits along the banks of the Ohio River immediately below Oufall 003 of the Washington `Works facility. The sample contained beads made of Nylon, Delron and Teflon- all materials `magufactured at the Washington Works facility. 24. During the August 20, 1996, Ohio River patrol, the inspectors sampled deposits onthebottofothme OhioRiverbelowOutfall005ofthe Washington Works facility. The bottom deposit sample yielded beads which contained Teflon and Delron - both materials manufacrured at the Washington Works facility. 25. During the August 20, 1996, Ohio River patrol, the inspectors observed floating solids onthe OhioRiverandalongthebanksof the OhioRiver whichwere determinedtobe 2 mixture of Teflon and wax and which bad been discharged from Outfll 005ofthe Washington Works facility. The floating solids were located along the West Virginia river bank of the Ohio River for approximatelyone-halfmile below Outfall 005. 26. On March 23, 1995, May 3, 1995, and August 13, 1996, Defendant was in violation of Water Quality Standards 46 CSR 1 3, (1996) "Conditions Not Allowable in State Waters," bydischarging aturbid flowfromDryRunLandfillintoDryRun,such flow constituting the discharge of distinctly visible colors, turbid conditions, and odors in waters of the State. 27. On August 20, 1996, Defendant was in violation of Water Quality Standards, 46 CSR 1 3, (1996) "Conditions Not Allowable inStateWaters," by discharging beadsofmaterial 7 069585 EIDO12731 : manufactured at Defendant's facility, from three separate discharge points, into the OhioRiver, waters of the Sate. Such deposition of material constituted the illegal discharge of seleable solids into waters ofthe State as well as the impermissible deposition of materials on the`bottom ofthe subject stream. 28. On August 20, 1996, Defendant was in violation of Water Quality Standards, 46 CSR 1 3, (1996) "Conditions Not Allowable in State Waters," by discharging a floating or suspended mixtureof Teflon and wax, materials manufactured at Defendant's `Washington Works facility, into the Ohio River. Such discharge constituted the illegal placement of distinctly visible floating or suspended solids into watersofthe sate. Fallure to Prevent Run-oCffOaUnNdTCoIlOlect and Treat Leachate 29. Plaintiff hereby realleges and incorporates the allegations set forth in paragraphs 1-28 aboveas ffullyrestatedherein. 30. Solid Waste Management Regulations ("SWMR") 47 CSR 38 4.8.1.band d (1996), entitled Leachate Management," state: o4f.t8h.e1f.abcAilaityylwihqeuriedwachtiicvhecwoamsteesdiinscpoonstaalocptewriatthiwonasstaereoorcaccucrurmiunlgamtuessitnbeahpaonrdtlieodn aDElPe]acihnatweraintidnpgr.operly treated . . .unlessotherwiseapprovedbythedirector[of operations. 4.8.1.d Inthe caseofan industrial landfill, the leachate collection and treatment facilitymustbeinplaceand operablepriortothecommencementoflandfill 005507 EIDO12742 31. Solid Waste Management Regulation, 47 CSR 38 4.5.2.b.A. (1996), ented "Run-on Control System, sates: (an)d Pmaeirnmusiitn:s ofall SWLFs [solid waste landfill] must design, coastruct, operate, (di)sposAalraurae-aoinnccloundtirnogltshyeasctteimvecappoarbtlieonooffptrheevSenWtLinFg dfulroiwngopnetoakadniyscphaarrtgeoffrtohme atleast a 25-year, 24-hour stom. 32. DuringaMay 16,504, field reviewofthe Dry Run Landfill conducted by John 3 G. Britvec, Geologist, OffofiWacteer Resources, DEP, and laspector Musser, Mr. Britvec and A InspectorMusserobservedthatDefendantbadnotnsalled asystem which wouldcollectaodtreat leachate, 2s required by SWMR, 47 CSR 38 4.8.1(.d55). 33. Duringbe May16,1994, field review, Mi. Bitesaod ospecor Muss observed aeDetediot1d oc sled iverson dices thefly, a seidbySWMR, 47 CSR 38 54.5.25.A. (1996). 34. During the May 16, 199, id review 1d on ite occasions, DEP personnel advised Defendant's managerial personnel thta leachate collection system and diversion ditches must be installed at the subject landfill 35. DutrheiMarnch2g3, 1995, insopftheeDrcyRtuniLaondsnill Defenddiadnnott Jp have acollectionsystemortreatmentfucilty tocollec ortreat leachategeneratedbythe DryRun " Landfill, as requirbeyd SWMR, 47 CSR 38 4.8.1.d (1996). 36. During the March23, 1995, inspection, Defendant did pot have diversion ditches in place tore-directsurfaceflowofrun-on awayfrom theworkingsurfaceofthe landsil, as required by SWMR, 47 CSR 38 4.5.2.b.A (1996). 9 000% EIDO12743 ' 37. Upon information and belief, in April 1995, Defendant constructed two diversion ditches above the Dry Run Landfill to prevent run-on from flowing across the landfill 38. During the August 13, 1996, inspection of the Dry Run Landfill the diversion a ditch on the upper sideofthe landfill was not properly maintained by Defendant, as required by SWMR, 47 CSR 38 4.5.2.b.A. (1996). 7 39. During the August 13, 1996, inspectionofthe Dry Run Landfill the facility did 5 aot have eschae collection system installed, as required by SWMR 47 CSR 38 4.8.1.4. (1996). 40. From May 16, 1994, until August 13, 1996, and upon informationandbelief, to 4} the present date, Defendant has been in violation ofSWMR 47 CSR 38 4.8.1.4. (1996), for I failuretoinstal aleachatecollectionsystem. 5 , 41. From May 16, 1994untilApril 1995,Defendantwasinviolation ofSWMR47 JS CSR 38 4.5.2.b.A. (1996),forfailure to design, construct and operate a run-on control system. 42. On August 13, 1996, and, upon information and belief, to the present date, \ Defendant was and is in violationofSWMR 47 CSR 38 4.5.2.b.A. (1996), for failure to maintain a rua-on control system. COUNT II Failure to Notify of Violations 43. Plaintiffhereby realleges and incorporates the allegations set forth in paragraphs 1-42 aboveasiffullyrestatedherein. 44. Solid Waste Management Regulation 47 CSR 38 4.8.1] (1996), specifying notification requirements, states: 10 6350 . g EID012744 S s`tTehpespteormbiettteaekemnusitf.i.m.me[doi]apteeraltyinoontoiffythteheldeiarcehcattoert(roefatDmEePnt] faancidlidteysucrnidbeer rtehmisedriualle tchaenno[tfepdreeravle]ntCtlheeafnaciWliattyefrroAmct.. a.n[dv)itohleatirnugletsheatnedrmsreogfulitastipoenrsmitp,ro(mSuWlgMaRt]e,d thereunder, thereunder; or or W. . .. Va. Code 22-11 and [cJausing surface water the rules pollution and regulations or groundwater promulgated degradation, contamination, or pollution. Further, Solid Waste Management Regulation 47 CSR 38 4.8.L.] (1996), states: st`eThpespteorbmiettteaekmuesnt imif.m..e(dtilahetfealcyilniottyiifsytgheendeirraetcitnogra[qoufaDliEtPyo]ranqdudesacrniobtfelreieamcethdaityael. thatexceedsthe designcapacityofthetreatmentsystem. 45. Defendantbas failed to notify DEPthatthe operatofitohne DryRunLandfill exceeded the design capacityofthe landfills treatment system and that, as a result, such facility was in violation of the terms and conditions of the SW/NPDES permit, the WPCA, and regulations promulgated thereunder. 46. Uponinformaantdbieloienf, Defendantcontinuestofail to notify DEP whenthe qualityofthe leachate generated by the Dry Run Landfill exceeds the capacityofthe treatment system, thus causing violations of established discharge limits into Dry Run. 47. On numerousoccasionsDefendanthasbeenand,uponinformaandtbielioefn, still is in violoafStWiMRo4n7 CSR 38 4.8.1 (1996), for failure to notify DEP when operations of its facility exceeded the design capacity of is treatment system. COUNT IV Failure to Adequately Compact 48. Plaintiffhereby realleges and incorporates the allegations set forth in paragraphs 1-47 above as if fully restated herein. un 009: EIDO12745 . : J P) gre 49. Solid Waste Management Regulation 47 CSR 38 4.6.2.0.C, "Layering 1nd Compaction," (1996) provides: Solid waste must be placed in layers not exceeding two (2) feet in depth and ccoommppaaccttiendgwiabtihliatym. inimum of three (3) passes with . . . equipment of [effective] 50. During the May 3, 1995, inspection, Defendant was compacting the wastes in the Dry Run Landfill in layers exceedingtwofeetindepth. 51. During the August 13, 1996, inspection, Defendant was continuing to compact the `wastes in the Dry Run Landfill in layers exceeding two feet in depth. 52. On May 3, 1995, and August 13, 1996, and upon information and belief, to the present day, Defendant violated and continues to violate SWMR, 47 CSR 38 4.6.2.2.C. (1996), "Layering and Compaction," by failing to properly compact the wastes disposed ia the Dry Run Landfill. Changing Composition of WCaOsUteNTWiVthout Proper Authorization 53. Plaintiffereby realleges and incorporates the allegations set forth in paragraphs 1-52 aboveasiffullyrestatedberein. 54. Section G.1oftheSW/NPDES Permit No. WV0076244states: 'OWnVlOy07t6he24w4aasntedimnatthereilaelsersdpaectiefditehde i1nst(dSaWyo/NfPMDaErSc]h P1e9r8m8imtayApbpelidciastipoonsNeiod.n the landfill 55. Section C.4 of SW/NPDES Permit No. WVOU76244 stats: This Permit may be modified, revoked and reissued, suspended, or revoked for cause. The filing of a request by the permittee for a permit modification, 5 12 - g 069.67 EID012746 = revocation, anticipated and reissuance noncompliance, doorersenvooctasttiaoynaonryanpeormittciondfiotiifoncp.laannetdcihaongens or (Emphasis added.) $6. By leter dated September 14, 1994, Defendant informed DEP that it had changed. the composition of wastes being disposed at its Dry Run Landfill. 57. During mid-1994, Defendant did dramatically alter the composition of wastes being disposed at the Dry Run Landfill. wot Fo 58. From mid-1994 through, upon information and belief, the present date, Defendant hasdisposedandcontinuestodisposeofwasteattheDry RunLandfill,thecompositionofwhich differs substantially from that which was specified in Defendant's SW/NPDES Permit application 20d subsequently authorized in the SW/NPDES Permit No. WV0076244 without having obtained prior approval through apermit modification, in violationofSW/NPDES Permit No. WV0076244 G.1. COUNT VI Failure to Properly Operate and Maintain Facility 59. Plaintiffhereby realleges and incorporates the allegations set forth in paragraphs 1-58 above asiffully restatedberein. . 60. SectionD.1ofSW/NPDES Permit No. WV0076244, entitled "Proper Operation and Maintenance," states: Tsyhsetepmesromiftttereshealalaattnadmlcloenttinrmoeltsp.r.o.pwehrilcyhoaperreaintsetaanlldedmoairnutsaiendbalylthfaecpielirtmeisttaened to achieve compliance with the conditionsofthis permit. ; 13 i egos EIDO12747 : , | i ob 47 wt \ 6l. On May 1, 1995, upon information and belief, 3 drain valve for he sedimentleachate pond located at the Dry Run Landfill was opened to lower the levelofthepond. The drain valve remained open until May 3, 1995. From May 1 until May 3, 198,34 a result of Defendant opening the drain valve, an indeterminate amount of untreated leachate p 5 discharged directly into Dry Run. 62. During the May 3, 1995, inspection, the discharge/sediment pond was approximately three (3) feet ower than the ponds normal elevation. This condition resulted from Defendant' failure to correctly operate such pond. 63. From May 1 to May 3, 1995, Defendant was in violation of SW/NPDES Permit No. WV0076244, D.1, by failing to properly maintain and operate the drain valve on its sedimeateactate pood. Failure to Use a LeachatCeOLiUnNerTaVnIdI Leak Detection System 64. Plaintiff bereby realleges and incorporates the allegations set forth in paragraphs 1-63 aboveasiffullyrestatedherein. 65. Solid Waste Management Regulati4o7n CSR 38 4.8.3.c.B. (1996), sexing forth requirements forsurficeimpoundment, statesthatsurface impoundments, such as.the sediment/leachate pond at the Dry Run Landfill: 2mde0utdsecttabieolcnesaokyndssetttreeucmct.tieoSdnuwrsifytashcteealimimanpesorpusrynesdstmceermniobtesfdciaumrnrien[nitSlmWyuiMmnRo]ufmsteuwtshota(et2i)dtlohiennreobrteshaacnlvdoesleaildneeoarrks. draettreoofiftttheidstorucloen.form to this section within six (6) months following the effective. 14 00%. " B EIDO12748 8 g 66. The Defendant has failed to construct a lining for its sedimeat/leachate pond at the Dry Rua Landfill 67. The surface impoundment used by Defeodant to treat leachate has not been closed or rewoficed to properly treat and collect the leachate and does not use a leak detection system. 68. Defendant bas violated SWMR, 47 CSR 38 4.8.3.c.B. (1996), by operating the Dry Rua Landfill without retrofitting the surface impoundment with a liner system and leak. detection system. 69. Uponinformationand belief, Defendant continues to violate SWMR, 47.CSR 38 4.83.c.B. (1996), by operating the Dry Run Landfill without retrofitting the surface impoundment with a liner system and leak detection system. Violations of COUNT VII Numeric Water Quality Standards 70. Plaintiff hereby realleges and incorporates the allegations set forth in paragraphs 1-69 above asiffully restated herein. 71. Section C.12 of SW/NPDES Permit No. WV0076244, "Water Quality", staes: `qTuhaeleiftfylsuteanntdcaorvdesreaddbopytetdhibsyptehremi(tEnmvaiyronnomtenctaaulseQuaalviitoyl]atBioonarodf.applicable water 72. Section G.8ofSW/NPDES Permit No. WV0076244 requires Defendant to sample: Dry Run approximately one thousand feet (1000 .) downstream of Outlet 001 for several water quality standard parameters and submit such results on the "Monthly Stream Sampling Report Form." 15 03ALY EIDO12749 73. The water quality sndard for the conceatraion of tol iron in Dry Rua established in the Water Quality Sndards, 46 CSR 1, App. E.. 8.15 (1995), is 1.5 milligrams of iron per 1.0 liter ofwater (1.5 mg/l). 74. The water quality standard for the concentration of manganese in Dry Rua established in the WaterQuality Standards, 46 CSR 1, App. E., 8.17 (1995), is 1.0 mg/l. 75. Results submitted by Defendaonnt its Monthly Stream Sampling Report Forms for May, 1995, July 1995, September 1995, Jamuary 1996, and March 1996 showed the stream contained 4.8 mg/l, 1.7 mg/l, 1.9 mg/l, 6.0 mg/l, and 3.7 mg/loftotal iron, respectively - all exceeding the 1.5 mg/l total iron water quality standard. 76. Results submited by Defendaoant its Monthly Stream Sampling Report Forms for February 1995, April 1995,andJuly 1995, showed thestreamcontained 2.5 mg/l, 1.1 mg/l, and 1.9 m/l of manganese, respectively - all exceeding the 1.0 mg/l manganese water quality standard. 77. Onat least eight separate occasions, Defendant has violated SW/NPDES Permit No. WV0076244, Section C.12, "Water Quality," by exceeding numericwater quality standards. 78. Upon information and belief, Defendant continues to occasionally violate SW/NPDES Permit No. WV0076244, Section C. 12, "Water Quality," by continuing to exceed the numeric water quality standards. COUNT IX Violations of Discharge Limitations 16 ~ 000s 55 EID012750 79. Plaintiff hereby realleges and incorporates the allegations set forth in paragraphs 1-78 above asiffully restated berein. 80. Section E.2.a ofSW/NPDESPermitNo. WV0076244, entitled "Reporting, states: PMeornmiittotreiengshRalelposrutbm(iDtMeRa)chimndoinctathinagcicnotredrinmgstooftchoenceennctlroasteidonf,oramnadt/,ora qDuiasntcihtairegs,e the values determined otof bteheinctohnestpiltaunetntesfflluiesntie(ds)i.n Part A.1 [of the Permit] analytically 81. Section A.l of SW/NPDES Permit No. WV0076244, entitled "Discharge Limitations and Monitoring Requiremeats," establishes amaximumdaily discharge limit for total suspended solids ("TSS") as 60 mg/l forOutlet001. 8. Section A.l of SW/NPDES Permit No. WV0076244, eatitied "Discharge Limitations and Monitoring Requiremeats," establishes a maximumdaily discharge limit for total iron 257.0mg/landan average monthlydischargelimitfortotaliromas 3.5mg/l. 83. Defendant's required Discharge Monitoring Reports ("DMRS") that were seat to DEP for January 1995, May 1995, and July 1995 show the effluent of the Dry Run Landfill contained TSS concentrationsof64 mg/l, 190 mg/l, and 75 mel, respectively - all exceeding the maximum daily discharge limit for TSS concentrations set forth in SW/NPDES Permit No. `WV0076244 A.1. Copiesofthe DMRs for 1995 and 1996 are attached hereto as Exhibit 5. 8. The DMRs submited by DefenfdoraMnaty 1995 and May 1996 showed the efflueatoftheDry RunLandfillcontainedtotalironconcenotf8r.7amtg/ilaondn3.s6 mg/l, respectively -bothexceeding theaveragemonthly discharge limitfortoaliron concentrations set forth in SW/NPDES Permit No. WV0076244 A.1. Seg Exhibit S. 1 000025 EIDO12751 85. Upon atleast five separate occasions, Defendant has violated SW/NPDES Permit No. WV0076244, A.1, "Discharge Limitations and Monitoring Requirements," by exceeding the oaly two discharge limitations that were specifically established in SW/NPDES Permit No. WV0076244. 86. Upon information and belief, Defendant continues to violate SW/NPDES Permit No. WV0076244, A.1, "Discharge Limitations and Monitoring Requirements, by exceeding the only two discharge limitations that were specifically established in SW/NPDES Permit No. WV0076244. COUNT X Duty to Comply 87. Plaintiffherebyreallegesandincorporatesthe allegationssetforthinparagraphs 1-86aboveasiffully restated herein. 88. SectionC.1.a of SW/NPDES Permit No. WV0076244,entitled "Duty to Comply" states: T`nhoencopmeplrimaintcee comnustsittutceosmaplviyolawtiitohnofaltl heco[nfdeidteiroanlsCloefanthWiasteprerAmcitt]. andP(eSrtmaitte WPCA] and is grounds for enforcement action." 89. Issuance of SW/NPDES Permit No. WV0076244 was based, in part, upon information submitted by Defendant with SW/NPDES Application No. WV0076244, as well as informationcontainedincorrespondence from Defendant dated August 10, 1987, September 15, 1987, March 1, 1988, April 14, 1988, March 16, 1989, and May 9, 1989. A copyofSW/NPDES Application No. WV0076244, dated August 10, 1987, is attached hereto as Exhibit 6. 18 5 000555 EIDO12752 z : 90. Inthe information submitted by Defendant on August 10, 1987, Defendant stated that the surfaceofthe Dry Run Landfill would be crowned to provide 3 1% to 2% slope to eliminate ponding on the surfaceofthe landfill and to direct surface waterto diversion ditches on cither side of the landfill. Ses Exhibit 6, page 7. 91. Inthe information submitted by Defendant on August 10, 1987, Defendant stated that compaction would be provided by a dozer operator who would spread the waste material in Layers up to two feet thick. See Exhibit 6, page 7. 92. DutrheMiarnch2g1, 1995,inspection,Defendantwasnotproviding a 1%to 2% crown to prevent ponding on the surface of the landfill as stated in Defendant's SW/NPDES Application No. WV007624. 93. DutrheiMarnch2g1, 1995, inspection, Defendantwasnotadequatelycompacting the wastes at Dry Run Landfill, as staied in Defendant's SW/NPDES Application No. WV0076244. 94. During the May 3, 1995, inspection, Defendant was not providing a 1% to 2% crown to prevent ponding on the surface of the landfill, as stated in Defeadaat's SW/NPDES Application No. WV0076244. 95. DuringtheMay3, 1995, inspection, Defendant was not adequately compacting the wastes at DryRunLandfil, as stated in Defendant's SW/NPDES Application No. WV0076244. 96. DutrheAiugunst1g3, 1996, inspection, Defweasnpodtpraovindintga 1%to 2% crown topreventpondingonthesurfaceofthelandfill,asstatedinDefendant's SW/NPDES Application No. WV0076244. 19 . 000355 EIDOI2753 v 97. During the August 13, 199, inspection, Defendantwas not adequately compacting the wastes at Dry Ru Landfill, as stated in Defendant's SW/NPDES Application No. WV0076204. 98. Upon at least six separate occasions, Defendant bas violated SW/NPDES Permit No. WV0076244 C.1, by failing to comply with every condition of the subject permit. 99. Upon information and belief, Defendant contimues to violate SW/NPDES Permit No. WV0076244 C.1, by failing to comply with every conditionofthe subject permit. PRAYER FOR RELIEF WHEREFORE,pursuantto West Virginia Code 22-16, 22-114, 2-11-12, 22-11-15, 2211-22, 2215-5, 22-15-10, 20d 22-15-15, SW/NPDES Permit No. WY0076244 C.1 and C.14, and otherwise, Plain, Laidley Eli McCoy, Director, West Virginia Division of EnvironmentalProtection,praysforanOrder ofJudgment againsttheDefendant, E. I. DuPont de Nemours & Company, that: 1. Prelimicarily and permancaly enjoins Defendanta its Dry Run Landfill from violating the Water Pollution Control Act, W. Va. Code 22-111 to 28, the regulations promulgated thereunder,theSolid Waste Management Act, W. Va. Code 22-15-1 to -20, the : rulesandregulationspromulgatedthereunder,SW/NPDESPermit No. WVO0076244,andanyand al othereavisonmenltawasl,rules,orregulationswhichDefendantmightbecurreatly violating; 2. PreliminaryandpermaneatyenjoinstheDefendantfromplacingwastematerials attheDryRunLandfill untilsuch timeastheDefendantbasinstalled aproperly constructed 20 . EIDOL27S4 069345 : landfill and leachate treatment facility, including a a lined impoundment, to prevent the current and future degradationofthe waters and soilsofthe State of West Virginia; 3. Orders Defendant to constructa systemofditches aod other permanent, mechanical devices to prevent water from running onto the Dry Run Landfill and mixing with the waste deposited therein; 4. Levies acivil penalty nott excesd $10,000(tea thousand dollars) per day against Defendant, as specifically authorized by the West Virginia Water Pollution Control Act, at W. Va. Code 22-1122, for each of the Defendant's violations of SW/NPDES Permit No. WV0076244, the West Virginia Water Pollution Control Act, and the accompanying rules and regulations; 5. Levies:civilpenalty nottoexceed$25,000(twetahoutsayndd-ollfarsi)pevrdeay againstDefendant,asspecifically authorizedbytheWestVirginiaSolid WasteManagementAct, at W. Va. Code 22-15-15(d), for eachofthe Defendant's violations of SW/NPDES Permit No. WV0076244, the West Virginia Solid Waste Management Act, and the accompanying rules and regulations; 6. Leviesacivil penaltynotto exceed $10,000 (teathousanddollars)perday against Defendant, asspecificallyauthorized by SW/NPDES Permit No. WV0076244 C.14(2), for each ofthe Defendant's violationsofSW/NPDES Permit No. WV0076244, the federal Water Pollution Control Act, the West Virginia Water Pollution Control Act, and the accompanying rules and regulations; 21 & g EID012755 = 0G0R1sE 1 -- . + 7. Awards to Plaintiiftsf costs and disbursements, including reasonable attorneys fees, incurred in this action, as specifically provided by the West Virginia Solid WasteManagement Act, at W. Va. Code 22-15-15(g); and 8. Awards such further relief that this Honorable Court deems appropriate. BY COUNSEL: Respectfully submitted, LAIDLEY ELI McCOY, Director, West Virginia Division of Environmental Protection MATTHEW B. CRUM, DEPUTY CHIEF SCOTT D. GOLDMAN, ASSISTANT CHIEF OFFICE OF LEGAL SERVICES WEST VIRGINIA DIVISION OF ENVIRONMENTAL PROTECTION 1356 Hansford Street Charleston, West Virginia 25301 Telephone: 304-558-9160 2 000317 EID012756 Co  ORY RUN LANDFILL LEACHATE COLLECTION AND TRANSPORT To WASHINGTON HORKS (Letter, W. M. Stewart to Barbara S. Taylor, dated11/8/96) BCC: IP.n MTucrGne:e, Legal, 08065-1 TUHR. .D.LiRtamtsleey RR.. WW.l A. HM eloSotnewa/rtL. Kirschner K. Ireland T In TTarn:ant JRL. JL.. MRietncthienyk G0.. AW.oyWteobweirch hew: 15633-3 0005319 2 z EIDO10842 : OomSueeee etosps November 8, 1996 CERTIFIED WAIL RETURN RECEIPT REQUESTED Charleston, W 25311-1088 Ms. Barbara S. Taylor, Chief Office of Water Resources WV Division of Environmental Protection 1201 Greenbrier Street Dear Hs. Taylor: RE: Letter, L. E. McCoy to W. M. Stewart, dated October 15, 1996 . syste described in this letter will be used until design modifications generated ThatisDrlyetRtuenr Lisandtfoililnfoanrdm ytoruanospforoturitplatnosWatsohicnogltloenctWolrekaschaftoer treatment in our bio-oxidation wastewater treatment Tacility. The interim csopmepclieftieedd ainnd oaurreDriyn RoupneraLtainodnf.ill permit renewal application have been Currently, approximately 15 - 20 thousand gallons per day of landfill leachate is collected in a leachate collection system servicing the sbeoptatroamteporptiipeondiosfchtahregeasctitovea fislulrfaacreea.inpoThuinsdmesnytste(mupdprearinpsandt)hrofuogrh three striexa-timnecnht.pipeWetphratopwoislel tgorarvoiuttye dthreainthrienetoeaxnisatbionvge-dgirsocuhnadrge50,l0i0n0esgailnltaona modular collection tank to be located above the upper pond (refer to bAtotTatc-htmoegnetthe1rfdoersilgoncatfiaocni)l.itatTeasnkasdsiemmebnsliyonast tahree 3s8i'te.x 38' x 4'9* and the zzg be clearedPrainodr ptroepearreecdt.ingThtehetatnaknk,wiltlhebearesaetaobnovae oonfe-tfhoeotupcpoemrpapcotneddwiclllay g ptsaounbes-ltbsaabsiceolmiapzprepirsotexhdeimaaoftreeal1y6psr4a2i`uogrextog42a'lpvlaaincniezmseeidznet.stoefeIltfhwenielcclelsasbyaerbyas,suep.pgroarvtTeehlde btwyialnlk wbaellused " galvanized 2* x 2* x 1/8" and 2" x 2* x 3/16" steel angle and galvanized tension cables. A 10 mil geotextile material will be placed over the tension cables prior to installing the 20 mil HOPE tank liner. A photograph of a typical modular tank is included as Attachment 2. Stormwater will be routed around the tank into the upper pond. EID010843 06030 . @ iran ' Ms. Barbara S. Taylor, Chief -2- November 8, 1996 to Washington orks for treatment primarily during daylight hours. transfer Athe3-HlPeacshuabtmeerssihbrloueghwelalpprpoumxpimwaitlellybe500moufneteetdofintswiod-eintchheuntadnekrgtroound plastic pipe Just east of to a 5,000 the closed gallon tanker asbestos fill truck area. located at the The well pump top of the hill, will deliver between 50-60 gpm of flow and will take approximately 90 minutes to fill a tank truck. We estimate three to five tankers per day will betransported The 50,000 gallon collection tank is sized to provide two feet of fitreweiblolardnotapdovewriflilllbedupruimnpgedthteo niitgshtm.inimTuhem ccaoplalceicttyioneacthankdawyiltlo beensure that inspected for leaks on a daily basis. leachate An NPDES permit modification request to process the through our site wastewater treatment facility will collected be submitted under separate cover letter. proposed Wientreerqiuneslteawcrhiattteenpuampppirnogvaslysttoenprsoocetehdatwiwtehmaiynsbteaglilnatiloenachoafteour collection and transport to Washington Works. ' If you have any questions or need additional information, please call me on 863-4271. Very truly yours, . Attachments hew: 15633-2 W. H. Stewart Sr. Environmental Control Consultant Washington Works cc: OMsf.ficCeinodfy MEunvs.serEnforcement JOofhfnicGe.ofBrWiattveecr Resources $2 Div. of Env. Protection Industrial Waste Section 2311 Ohio Avenue 1304 Goose Run Road Parkersburg, WV 26101 Fairmont, WV 26554 WMaitchearelReAs,ouZrecfeos/Waste Management i Environmental Enforcement 1356 Hansford Street Charleston, WV 25301-1401 0007 EN D010844 .) . RaKoOTG7s ws i Lo = i < g uw oc o8 gT3 2: = 3 < 57 pr ls J A <C Io o> [as w<0 2.8 Je a = <53 Ir os wg ow a wonF QoXx z onmw wer<e Jo o< lf Sf /i/i [s/f fi ii AiIAi 5 -- sa Toaw -- =3 OHa -- wxoO awa Ho /. ZS5h0 -errr]REE SSeoso<ddi le,. Sam J Sail i gry 1 iHPHEi dA ," N Li AA anoifa) =z \ \NS aazo Sa ag =3S & ol NNNN =a woO NORNNS sw 3 &x 3 > : NON wg NONN I EZ 2Zz CIax=Zzw owa = { "~OO."N\ a = * S<3 HO2W wa = = \\ (= i EIDO10845 23228 [00<D | LL ec 0Zo TO. FO . Ranwui0r0 wag = . iberdeng BUR EN eg Sl RYE Ll EN IN a ASRPeagRd:iWE|la; )| SAA 3e5 g 5Rr 0Ee 8N aL . E J mayt FThN A RpTtAEEtRe FREE | iii 4 RENE AE oad oo Sa lh 5 ae Rai: fl In <i ELIA x ar a SAESEREAC || |i1l40k 5 17: oA S SR 5 | BRC ECrd 5 HEE E :| g3 |AR a T N e SSRN4 | 3 f 2= 2 TArT ANARRCR S CrE PE A SRAl |(5 2 PN eeoni AR 8 SEE OeUR CHR | 12 <f| EtEEe REhShe OeyY fI gS etAsRS PPigR)Se eS SE ER IQ FS ERs S 2 a 223 3 | [ho GREER| TEC EEA z Sa A i Rak SE | I] Pore apt Laai RERENsR SRE= i is CBE weet aE : EEL LR AN RY] - Rll HE g IS TE oy JwEeRE a ne CCL eN re E E ET ERS= ER ones 3 7. IRNLN NCSTl HIA NS l PRTr Ea aston carenron `Governor DIVISION OF ENVIRONMENTAL PROTECTION No1v0emMbcJeurnk2i7n, Ro1a9d96 Nitro, WV 25143-2506 wore tu uecr, mo, OIRECTOR DMWuraf.so.HhniH..tngDtaDovanivdidWoRrRakmmssesy,ey, SSuuppeerriinntteennddee:nt orcore Srivpoorsun2ey1303 Post Office Box 1217 Parkersburg, West Virginia 26102 Dear Mr. Ramsey: I vas very pleased that ve could reach a settlement in Program concept ith Governor Undervood's staff. wisi sisi ine principal on opportunity, the Dry Run Landfill issue. assuming I will, to discuss As the soon as I have small business an loan abrordayngoef athmeeeptrionpgo:sal. Once that occurs, I will call you and pErnovgirraoAmns.meinttIafsltwaenPrdaosjreencotws),ucwctiehlselsf$u5ble0,0ai0nv0aielSsaEtbPalbel(iSstuohpipnclgaepmtiehtneatlailprzoegrtahme, loan that will this constitute an end to DuPont's commitment. loan program should not be adopted, I will In the event that contact you to decide how to redirect the Supplemental Environmental Project funding in the manner we have discussed. work with you directly to develop the new In this case, I will SEP, including other funding opportunities from appreciate your assistance DuPont as per our discussions. I in this matter. Should you have do questions, please feel free to call me at 304-759-0515. Singhrely, g7 idley Z McCoy, "Ph.D. Directo; LEM: jrb ce: Matthew crus, Deputy Chief, oLs a CARS EID012824 December 13,199 rPj AeGg Ere vormae ra Marmagiemeent nc [fPrararcriar.fi2eA 19103 Pc OMsn.-SScaernaehCCoaosrpdairnator US. Environmental Protection Agency 8R4e1giCohnes3tnut Philadelphia. PBuAild1i9n1g07 Subject: Field Trip Report Preliminary Assessment TDD Number 03-9609.0013 Dry Run/N. Fork Lee Creek Bovine Site `Washington, Wood County, West Virginia Dear Ms. Caspar: PRC Environmental Management, Inc. (PRC), is submitting the enclosed trip report for the Dry Run/N. Fork Lee Creek Bovine site under the Site Assessment Technical Assistance (SATA) contract labor hour pool. Contract Number 68-55-3002. If you have any questions about this report or need additional information, please contact me at (215) 656-8703. Sincere! ~o SA PKreovjienctSMeoannager Enclosure Gc: CBialtleHBargoecl.k,PPRRCC SATA Dedicated Team (cover leer only) 005.07 @--=" USFW C15 PRELFIIEMLIDNATRRIYPARSESPEOSRSTMENT WADSRHYINRGUNT/ONN.,FWOOROKDLECEOUCNRTEYE,KWBEOSVTINVEIRSGIITNEIA Prepared for: U.S. ENVIRONMENTRAegLioPnR3OTECTION AGENCY P8hi4l1adCehlepshaiaa,utPBAuil1d9i1n0g7 DEaPtAe PRreegpiaorned `TCDonDtraNcutmNbuemrber Prepared by TOenl-eSpcheonneeCNoourmdbienartor D3ecember 13. 1996 6083-.5956-0390-000213 PRC Environmental Management, Inc 1(K5ev)in65S6c-o8m7)03 (Sa1r5a)h 5C6a6s-p3a2r83 00:25 USFW C15 TABLE OF CONTENTS Section Page 10 INTRODUCTION . 3 1 20 BACKGROUND . . . 1 30 SITE ACTIVITIES . . 1 40 DATAEVALUATION . et sen eeraery eaves n 50 CONCLUSIONS AND RECOMMENDATIONS srtaerneaeeaens 12 Appendix A SITE PHOTOGRAPHS B SAMPLE CHAIN-OF-CUSTODY RECORDS LANCASTER LABORATORY SAMPLE ANALYSIS REPORT Bigure I 2 FIGURES SieLocatonMap .......... SampleLocationMap ........ rodraesesseryios soervas Page 3 wae 6 Table | 2 3 4 TABLES Page SamandpAnallysiis Sunmmgary vans correiaae 7 Field Measurements... oes ross n Summary of Laboratory Analytical Results (Aqueous Samples) -... 3 Summary of Laboratory Analytical Results (Sediment Samples) ............ 13 USFW 015! ; 000.29 -- 10 INTRODUCTION PRC Environmental Management, Inc. (PRC), was sked by the U.S. Environmental Protection Agency (EPA) to conduct 2 preliminary assessment at the Dry Run/N. Fork Lee Creek Bovine sit. in Washington, Wood County. West Virginia. The work was conducted under Contract Number 68-553002, Technical Direction Document Number 03-9609-0013. The purpose of the preliminary assessment was 10 investigate a citizen's complaint that hazardous materials are presen in the surface water and sediments of Dry Run, a ibutry of the North Fork of Lee Creek, a wibuary to the Ohio River. 20 BACKGROUND Mr. Wilber Tennant, the cirizen who placed the complaint, claims that contaminants are discharging into Dry Run from 2 landfill owned by the E. I. DuPont Company (DuPom). Dry Run flows across Mr. Tenant's land befor it discharges to the North Fork of Lee Creek. Mr. Tennant raises cae for beefonhis landandhiscadritnkfreom Dry Run. Mr.Tennantallegesthatthenumerousdeaths, blindness, and other illnesses suffered by his herd are directly acributable to the comaminans in Dry Run. He also aaributes someofthe health-related problems experienced by membersofhis family to these contaminants 3.0 SITE ACTIVITIES The following summary describes field activities conducted to investigate Mr. Tennant' allegations. Qstober15,1996 `At about 1000 hours. PRC represeniatives Mr. Kevin Scon and Ms. Alicia Shultz arrived at the West Virginia Deparment of Natural Resources (WVDNR) in Parkersburg, West Virginia, where they met with Ms. Cynthia Musser. an enforcement officer for the West Virginia Deparument of Environmental Protection (WVDEP). The PRC personnel reviewed the sute's files perining to the Dry Run landfill while awaiting the arrival of EPA Region 3 representaive, Ms. Sarah Caspar. The Dry Run Landsil, as determined by the file review, is an active industrial solid waste landfill owned and operated by DuPont and the potential source of contamination entering Dry Run. The landfil is used by DuPont to 1 060-35 USFW 015 vontare dispose of waste that DuPont identifies as nonhazardous waste generated a its Washington Works facility located in Washington Boriom, West Virginia. The landfill i located in Washington, West Virginia, about 10 miles south of the Washington Works facility. The approximate location of the Dry Run landfill is shown in the site location map provided 2s Figure 1. The landfill permit application filed with the WVDEP lis wastes deposited at the landfill as fly ash and bottom ash from the facility's nonhazardous waste incinerator, "biosolids" (fer cake) from the facilits industrial wastewater treatment operation, polyamides. acrylics. polyacetyl polyvinyl buryral, polyethylene terephthalate cardboard, and construction debris. `While at the WVDNR office, Mr. Scot placed a phone call to Mr. Tennant and arranged a meeting berween EPA, PRC, and Mr. Tennant at the Tennant residence. Mr. Scot also contacted Mr. Walt Stewart, environmental manager for the DuPont Washington Works facility, to gain access to the Dry Run landfill. During the conversation berween Mr. Scott and Mr. Stewart, Mr. Stewart indicated that DuPont would like to obtain split samples of all samples collected during the site assessment. He also requested a meeting at his office before EPA and PRC conducied the sie assessment. EPA representative Ms. Caspar arrived at the WVDNR Parkersburg office at about 1500 bours. After further review of the sute files, EPA and PRC persounel departed the WVDNR office and traveled to the Tennant residence in Washington, West Virginia. During the meeting between EPA, PRC, and Ms. Tennant, Mr. Tennant indicatedthatmore than200caulefromhis herd havediedinthepast 2 years from uninown health problems. He also said that be observed other dead wildlife n or near Dry Run, including, minnows, frogs, crows, raccoons, and deer. Mr. Tennant auributes the deathsofhis cale and the wildlife 10 exposure to the contaminants in Dry Run through ingestion and direct contact. While at the Tennant residence, Mr. Tennant showed the EPA and PRC personnel a cow skull that he had saved. Mostofthe teeth in the skull showed black suining and were easily removed fromthe jaw bone. According to Mr. Tennant, the discolorationofthe cow's teeth was indicative of fluoride contamination. He also indicated that mostofthe cate in his herd were or are affected similarly. EPA and PRC personnel traveled with Mr. Tennant and his daughter Amy to Dry Run, near its confluence with the North Fork of Lee Creek. Dead minnows were observed in Dry Run a short distance upstream from the confluence of the two water bodies. An oil-like sheen was also observed on the water when stream sediments were disturbed. A whitish-colored foam also was observed on the USFW 0160 2 000011 inv ar Go CER 158 5 ii | == ers HEE UY NE ENE A I > He Area, NI | nN 8 LA = Pa $5 i N EN d SCN 3 vi SE Ces SUE SIA T iFTeo SHJf AY< ,A i a SA ME sewer surface of the water at several locations along Dry Run. PRC took photographs of locations along the run that showed visible signs of conuamination. The photographs taken by PRC during the site assessment are included in Auachment A. Mr. Tennant used a video camera to collect additional photographic documentation of stream contamination. PRC observed that the condition of the stream continued to degrade as they moved upstream, closer to the landfill. October 16,1996 `At about 0900 hours, EPA and PRC personnel met with Mr. Stewart at the DuPont Washington Works facility. Also present at the meeting were Mr. Daniel Weber, senior environmental engineer at the facility. Mr.Richard Kirschner, chemist and wastewater reaumeat plant engineer, and Tom Waldrea, supervisor of operations at the Dry Run landfill. During the meeting, EPA and PRC informed the DuPont personnel of the site assessment sampling objectives and schedule. Mr. Steward suggested that EPA and PRC personnel be shown the landfill and leachate ponds in the morning and rewurn after lunch to collect samples. Before traveling o the landfill, EPA and PRC personnel reviewed DuPon's files and analytical daa pertaining to the landfill and Dry Run. At about 1100 hours, EPA. PRC. and DuPont personnel depared the Washington Works facility for the landfill. The Dry Run landfil is located off interstate Route 68, about 10 miles south of the DuPont facility. While at the landfilla tractor trailer load of fly ash was dumped onto the upper lit of the landfill. A heavy equipment operator, operating a bulldozer, spread the fly ash across the lit. The bulldozer operator appeared to be the only worker preseat atthe landfill during our visit. Failure to meet lift height and compaction specifications were noted as permit violations in several of the inspection reports prepared by Ms. Musser forthesae. Based on PRC observations during the site visit, the current lift height appeared (0 be above the 2+foot permit limit. Additionally, the waste `material did not appear adequately compacted. A sample of the wastewater treatment plant sludge was not obuained as planned because this material had been covered with fly ash and compacted before EPA and PRC personnel's arrival. Downgradien from the landfill were two leachate collection ponds. A steady stream of leachate was discharging into the upper pond from a single oufall at the footofthe landfill. According to DuPont. the flow rate of the leachate was approximately 20,000 gallons per day, and the outfall accounts for USFW 016: ` 08d.1% Imana0 nearly all of the flow in Dry Run. An aeration system was in operation in the upper leachate collection pond. The system was powered by a diesel-powered air compressor, located west of the lower leachate collection pond. DuPont indicated that the aeration system is presently alternated between the upper and lower collection ponds. Mr. Weber indicated that DuPont was installing a permanent electrical system for continuous operation of the acration system. Photographs of the leachate collection ponds. and leachate discharge oudall are included in Appendix A `At about 1265 hours, all personnel broke for lunch. DuPont agreed to meet EPA and PRC personnel back at the landfill at about 1400 hours. After returning to the landfill, PRC personnel prepared to collect a sampleofthe leachate from the outfall atthe foot of the landfill Atabout 1500 hours, leachate sample L-1 wascollectedatthis location. A sample location map is provided as Figure 2. A suffcieat volumeofthe leachate was collected for multiple analytical parameters, including the target compound list (TCL) of volatile organic compounds (VOC) and semivolatile organic compounds (SVOC); and the target analyte lst (TAL) of metals and cyanide: and fluoride, formaldehyde, and sulfate. The sample was collected in containers specific to eachofthe analytical parameters or laboratory conducting the analysis. tniialy, the PRC sampling team had difficulty obuining a viable sample for the VOC analysis due to a reaction between the leachate and the hydrochloric acid preservative in the sample vials. The reaction produced gas bubbles, which prevented the samplers from obtaining a sample with no headspace (as required by sampling and analytical protocols). The preservative was removed from the sample vials, and a viable sample was obained. Three separate laboratories were conmacted to analyze the samples for the various analytical parameters. Two EPA contract laboratory program (CLP) laboratories. American Analytical and Technical Services, Inc., and TMA/Skinner and Sherman Labs. Inc... were contracted to analyze for the TCL organic compounds and TAL inorganic compounds. respectively. Lancaster Laboratories, a PRC-subcontracted laboratory, was contracted to analyze samples for fluoride. formaldehyde. and sulfate. A summary of the sample collection information is presented in Table | In addition to the laboratory<ontracted analytical parameters, the leachate samples were screeoed in the field by PRC for pH. temperature. and dissolved oxygen concentration. Due to an instrument 5 000% USFW 0162 J | =z i - Le . | /= |Ii y zz == =3 35:8 E=H Sao {i 2 . 3L3E -- 1lsd BH 5g | Ih 35 REEg EH {| | I - | > 2 | 1I 3%= : TO iL EE7 z z z on ; : = 3i E3 LF 3 z53 gsc a T ENS 5 EI Z| sees USFW 0164 Bi Tne in BIE A es 5LS: 8i4l:h:||i: = FH AH : BL Br: |: i Bl ii; gC| iee|: :i GsGfi akELEEREEE|L] :3 ili 11453 3 . IE EE EaEH HEEHLR |rFRE ElEEl z EE (ge At [3 [3] & ~ ppFf pef t f i Bi $i8 iHL511 12 EEE EL 1 ii il Lilal Eli Is i HH EEE | t5fFHi] F iid hn: | 0: 1 { I llllE lils TsdE Tolls = | BL sl 1i gg: |: H3E1:3 |2; ay i: |: of joan a si Ee : i SU Ie | | E[E [E iE [3 : i Belole4l1y3 [23 { i 33 i. TLEEE eaeJE Lele i 2 a HERE EE : : FH 2 H iL {HER EEE Fell nad Ee ini FeHrE 2 B53 i ml HE pi elt pf jd EE 1 iillis ERE 21]F 2 3 i 8.3/1 EH - iilds EAHAF IE Ee] 3 TIiii! iilE338 on usFTMwotes. i' J: 5 Iz ; i |i ii aglz 3 [5 P37 8I: E11 E GEEE 1 e P1 E: UE E5[5E|2R15EE: Iif i RE jeg sJii. BE JE EEE HEH { LH i i FiE i i OBBEE pry = ! . : 9Ei;y ele | Eee) Il 21H I= ERE E fet3 | TT 1 1: ih = = ati is [=gaes jee =2 31. 55 |i : ii1 i $y:f. 5328% ge2zog : 4 i HH FE 858 1 SESSEER oro 3 2g usFWoOtE malfunciion, however. pH measurements were not obained. Dissalved oxygen and temperature measuremens for the samples were recorded in the logbook and are summarized in Table 2. At about 1540 hours, sediment sample SD-1 was collected from the upper leachate cllecion bank. A sufficient volume of sample was collected for the same set of analytical parameters as described above AC 1600 hours, PRC personnel collected leachate sample L-2 from the discharge pipe of the lower leachate collection pond. The outfall isa routine sample collection station for DuPont ad is identified 25 No. 001 by a sign siaked in the ground near th outfall. From this location, the leachate flows a shor: distance through an underground culvert and empies io Dry Run, Sediment sample LD-2 was collected in the same vicinity as L2. Background surface water and sediment samples were collected from a small unnamed wibutary of Dry Run, which converged with Dry Run several hundredfeetdownstream from Outfall No. 001. Aqueous sample BKGAQ and sediment sample BKGSEDI were collected at about 1730, Berween 1800 and 1830 hours, PRC personne collected aqueous sample DRIKAQI and sediment sample DRIKSED! from alocaton along Dry Run about 1,000 feet downstreamofOuttall No. 001. "This location is a routine sampling station for DuPont. A thick film was observed on the surface of the creek at this location. A violet reaction occurred again in the sample bole when PRC personnel anempied o collect a water sample for VOC analysis. PRC emptied the preservative from the sample via and recollected the sample. Aqueous and sediment split samples were again provided to DuPor. TABLE 2 DRY RUN/NF.IFELODRKMELAESEUCRREEMEEKNTBOSVINE SITE [em repTia Utica Lene :PeECeolm;EonRY [T r oxera Tr wre f J Ta owwn]]| 10 080729 USFW 0168 mart7 DuPont personnel were provided with split samples for eachofthe locations sampled by PRC. At `about 1830 hours, all personnel sample paperwork. All samples departed the were logged site. onto PRC personnel returned to the laboratory-appropriatechain-of hotel custody complete (COC) the records, identified with sampl-specific sample tags. and placed into coolers in preparation for shipment to the appropriate laboratory. Copies of th EPA organic and the inorganic raffc report and COC records are provided in Appendix B. . At about 0900 hours, EPAsPnidEpacsonnelreamedGED Waging Wors facil to mer Stewie. Evt p Me:Seedh fing svecontuced he previous day. Ms.Shu signed he goroploge1d06record the li warps, Sfficially relinquishing the samples to DuPGi.AFSbopt 3000 bouEPrAsaaTdPRC.persone departed the Washington Works facility and traveled io the WVDNRoffice in Parkersburg, West Virginia, to gather additional information about the site. Ms. Musser was unavailable, and the EPA and PRC personnel departed shortly after their arrival. PRC personnel completed sample shipment preparations and traveled to the local Federal Express office to ship the samples. At about 1230 hours, PRC personnel departed Parkersburg, West Virginia to rem to Philadelphia, Pennsylvania. 4.0 DATA EVALUATION `Table 3 the ste summarizes assessment. fluoride, formaldehyde, and sulfate analytical data from samples The results of anlyses of the samples were compared with EPA collected during numeric removal action levels (RAL) for contaminated drinking-water sites, EPA Region 3 risk-based concentrations (RBC) for up water (developed by Roy Smith, EPA toxicologist), and background sample concentrations. No concentrations of fluoride, formaldehyde, or sulfate exceeded eitherofthe EPA action limits or guidelines. Fluoride was observed at concentrations above background in both of the leachate samples and in the downsteam sample. Fluoride was detected at concentrationsof220 and 160 micrograms per liter (ug/L) in leachate samples L-1 and L-2, respectively, and at a concentration of 130 ug/L in sample DRIAQI. Fluoride was not detected in the background sample (BKGAQI). The highest concentrationofsulfate (34.500 ug/L) was detected in the background sample. USFW 0169 un 0CO-i0 ooTrn gAPT TanLe 3 SUMMARY OF LDARBYORROATNO.RYFOARNKALLYETEICCRAELERKESBUOLVTISNE(ASQTTUEEOUS SAMPLES) [ms| ER ET ara feet | Sd Egat ens = i (De Gat etn JOE1A ENTE Saba |cn oe eeros. IE Fe SAE [Foote |NA | 220 Jul]20[ 1604<i0[ 0[ 100] [Formaaiyee|so0| 730 [wi]&B7] <sT<sf--<s| 5| sur. e+ Jo ooe st] | == awatt |lun apt + Nos econ NA No Applicable WL Micograms per ler <doE oLoolii ero[Soasoi Table 4 presents a summary of fluoride, formaldehyde, and sulfate analytical data from samples of the `sediment collected during the site assessment. The results of analysesofthe samples were compared `with EPA Region 3 RBCs for fish and to background sample concentrations. Fluoride was detected at concentrations of 396 and 411 milligrams per kilogram (mg/kg) in sediment samples LD-1 and LD-2, respectively; 335 mg/kg in the downstream sediment sample (DRIKSED1); and 198 mg/kg in the background sample (BKGSEDI). The fluoride concentrations in these samples are significantly above the EPA guidance level of 81 mg/kg. Tables Fluoride concentrations that exceeded EPA limits are shaded in AppendixC provides te Lancaster Laboratories Sample Analysis Report or th aqueous and sediment samples. The analytical results for the samples submited to the CLP laboratories are no included i this `evaluation. Upon receipt and evaluation of the remaining sample analytical data, PRC will prepare and submit to EPA an addendum to this trip report. USFW 0170 12 0005.15 AI3O TrgN RPT TABLE SUMMARY OF LABORATORY ANALYTICAL RESULTS (SEDIMENT SAMPLES) DRY RUN/N. FORK LEE CREEK BOVINE SITE EEE eam [Dips cyShi} Tuvinh|tIMIS PARSER poe Aids evo] CE alae rr ON | [Fone | [Formatechyee| sin oN [opie emseninent iene | Jagng|es| os[o4 [ <o7[or | boswe wa [stywl 61|260] ma| ms| os | Nos: , ESSE. | `PSDeodirmeenltcismamnmpalteoomantnytitcaal* FictesedarEePpreesreiresdasredrm!yawediegtnresults. oRNA NNooomaarmnoptedoe eke Milgrampor opm - % by wt Percem by weight - = . . 5.0 RECOMMENDATIONS - - Based on the limited sample analytical data available to PRC at the present time, PRC recommends that an in-depth evaluation of the CLP analytical data be conducted before conducting further sampling at the site. Ifthe evaluation of the CLP daa shows that additional sampling is warranted, PRC will make this recommendation to the EPA. USFW 0171 13 e000 I9eOTrNeR3PT Co GASTON CAPERTON GOVERNOR LSp a DIVISION OF ENVIRONMENTAL PROTECTION 1356 Hansford Street Charleston, WV 25301-1401 LAIDLEY ELI McCOY. PhD. DIRECTOR ORDER ISSUED UNDER THE WATER POLLUTION CONTROL ACT WEST VIRGIN!NIA CODEE,, CHAPT]ER 22, ARTARITICC] LE 11 THE SOLID WASTE MANAGEMENT ACT WEST VIRGINIA CODE, CHAPTER 22, ARTICLE 15 ORDER NO. 3850 RERCECEEIIVVEEDD ANZ 1997 spies DATE: December 31, 1996 TO: Mr. H. David Ramsey, Jr. E. I. Du Pont de Nemours and Company Washington Works Post Office Box 1217 Parkersburg, West Virginia 26102-1217 Avention: Mr. Ramsey, Jr. `This order is issued by the Director ofthe West Virginia Division of Environmental Protection (or "WVDEP"), through his authorized representatives, under the authorityofthe West Virginia Code, as amended (hereinafter, the CodeTM), Chapter 22, Article 11 and Chapter 22, Article 15 to E. I. Dupont de Nemours and Company (hereinafter Dupont"). FINDINGS OF FACT `WashinAgtsona resulta Works result facility of inspections by authorized conducted at Dupont's representativesofthe Dry Run Landfill and the Director and in support of this Order, the Director of the West Virginia Division of Environmental Protectionhereby finds the following: Telephone:O(f3f0i4c)eoSf58L.e9g1a6l0SFearxv:i(c3e0s4) 5884255 G0 1E Page 2 H. David Ramsey, Ir. E. I. Dupont de Nemours and Company December 31, 1996 and A. Chapter Dupont is 22, Article a person as defined in 15, Section 2. Dupont Chapter 22, Article 11, Section is 2 corporation duly authorized 3 of the Code to conduct business Works") in in the State of West Virginia; and Wood County, West Virginia. owns and operates Dupont also owns a facility (~Washington and operates a non-hazardous waste landfill ("Dry Run Landfill"), `Washington Works facility. also in Wood County, West Virginia, which serves the VirginiaB.NationDaulpPoonltluitsanatutDhiosrcihzaedrgteo Eolpiemriantaetithoen DSrysytReumn(L*aSndWf/ilWlVuNnPdDeErSS"ol)idPeWramsitte/NWo.est WV 0076244. The permit authorizes Dupont to discharge a specified amount and type of pollutant into Dry Run, a tributary of the North Fork of Lee Creek. which is a ibutary of WthoerOkhsiofacRiilviteyr,.whDiucphonatllaolwsso thhoeldfsacailiWtyVtNoPdDisEchSarPgeermaistpeNcoi.fiWedV0am0o1u2n7t9anfdorttyhpeeWoafsphoiinlguttaonnt into the Ohio River. C. Authorized representatives of the Director conducted an inspection of the Dry Run Landfill on March 23, 1995, May 3, 1995 and August 13, 1996 and noted a discolored leachate flowing from the landfill into Dry Run. D. Authorized representativesofthe Director conducted an inspection of the Ohio River in the vicinity of the Washington Works facility on August 20, 1996. The inspectors noted solids of wax and polymeric materials of the type manufactured at the Washington `Works facility in the Ohio River and its banks. E. Authorized representativesofthe Director inspected the Dry Run Landfill on May 16, 1994, March 23, 1995 and August 13, 1996 and noted the absence of a leachate collection system. Inspectors also noted an absence of diversion ditches during the May 16 and March 23 inspections. F. Subsequent to the inspection, Dupont constructed two diversion ditches above the landfill to prevent run-on from flowing across the landfill. Dupont incorporated designs for a leachate Tandfil. collection system into the permit application for renewal of the permit for the G. Authorized representatives of the Director inspected the compaction procedures used at the landfill on May 3 and August 13, 1996 and noted that the wastes were being compacted in layers exceeding two feet in depth. wastes H. being Dupont disposed notified the WVDEP in September 1994 of a at the landfill. Such wastes were disposed of change in the at the landfill ratio of through September 1996. Office of Legal Services Telephone: (304) 558-9160 Fax: (304) 5584255 aools 03:15 " PH.agDea3vid Ramsey. Jr DE.ecI.emDbuepron3t1,de19N9e%mours and Company landfill I does noRtepurseeseanlteaatkivdeesteocftitohne sDyisrteectmoorrhaavleinenro.tedDutphaotnttheinscuorrfpaocreatiemdpdoeusnidgmnsenftorat the leak detection landfill. and liner systems into the permit application for renewal of the permit for the near J. the Authorized representatives of the landfill on May 3, 1995 and noted that Director the water inspected level was the leachate pond located approximately three (3) feet below normal elevation. of the pond. Dupont had opened a drain value in preparation for treatment K. discharge limitsWawteerreqeuxalcieteydesdtanfdoarrdTsotwaelrSeuesxpceeneddeeddSaotliDdsr,y mRaunngaLnaensdefi,llanadndirpoenrmasicreported on Dupont's Monthly Discharge Monitoring Reports. 1995, MLa.y 3, A1u9t9h5oarnizdeAdurgeupsrtes1e3n,tat1i9v9e6s aonfdthneotDeidretchtaotr2i1ns-p2e%ctcedrotwhen lwaandsfinloltopnroMvairdcehd t2o1, prevent ponding on the surface of the landfill REQUIREMENTS OF ORDER Now, in accordance with Chapter 22, Article 15, Section 15 and Chapter 22, Article D1i1,reScetcotrioasn f1oSlloofwtshe Code, it is hereby agreed between the parties and ordered by the In seclemen of all issues in the Findings of Fact, Dupont agrees to the following: of filter 1c. ake Immediately upon the effective date of from the Washington Works wastewater this Order, Dupont shall treatment system at the cease disposal Dry Run Luanndlfislulc.h Dtuimpeonats will the refrain from future disposal instalation and operation of of all such filter cake at the Dry Run improvements to the landfill s Landfill required under the SW/WVNPDES completed. Permit o be issued by the WVDEP for the subject landfill are leachate2.generaItmemdeadtiattheelDyruypRounnthLeanedfffielcltiavneddattreanosfpotrhtisitOrfdorert,reDautpmoenntt tsohatlhle cWoalslehcitntghteon mWoodrikfiscawtaisotneswaotfetrhetrWeaasthmeinntgtfaocnilWitoyrukpsonWVapNprPoDvaElSofpeWrVmiDtEoPoaflltohwesuncehcetsrseaaruymepnetr.miDtupont wreialccmoennttinfuaceiltiotycoulnlieclttshuecihnslteaalclhaattieonaannddtorpaenrsapotritonitotfoatllheimWparsohvienmgetnotnsWtortkhse wlaantdefrill as TelephoneO:ff(i30c4e)o5f58L.a3g1a6l0SFearxv:i(c3e0s4) 5584255 oaagy Page d H. David Ramsey, Jr ED.ec1.emDbuepron3t1,de19N9e6mours and Company required under the SW/WVNPDES landfill are completed. Permits to be issued by the WVDEP for the subject 3. maintenance Immediately upon the on the diversion ditches effective date of this currently in place at tOhredeDrr,yDRuuponnLtansdhfaillllpaesrfnoercmesssuacrhy for the controlled landfill. flowof surface water through such ditches and away from the active face of ctehretiWfaitede4.rmaQiulaloiWrtiysthhMailanlnthahaginredtmyed(en3lt0i)vFeduranytdosatohfcehtoehfcefkiecfoeffeoctftwiEovn-evhdiuarntodenrmeoedfntthails oErndfeorr,cDeumpeontntfowrildlespeonsdi viina payable to "West Virginia Division of Environmental thousand Protection." dollars (5200,000) : 0 the 5. benefit Dupont will perform a of the environment but wshuipcphlesmheanltlanlotenbveirdoinrmecetnetdaltopwraorjdecstf(acSilEitPat)ingto accrue caDoguneptnorcniytb'urtseiscopnoomnopsfliifbialfentycfeotrhwoiduteshvaesnltdoaptdiuotnlolgrayrasnodf(/$or5re0g,iu0ml0ap0tl)oermtyeonrateniqnueigsrcaermloeownatnasc.pcroDougunrptaotmnotbewilhlelmdafkoer athe neontvibreoennmednetvaellocpoemdp,litahencfeiftbyy small business. thousand dollars If by May ($50,000) 1, 1997 such a held in escrow designed to facilitate loan program has will be returned to 2aDcumpnuoottniatllelassyndhacaacnnepaftliatfbetrlyre-attShioEvuePsaSbnEydPdJousllhlyaalrl1s,b(e1$95d90e7,v,0e0lD0o)u.ppeodnItbnetwtihwleleeesvneenntdthetvhipaaatrctteihretesi,fpiawerhdtiicesh fsahiallltobneegvoatliuaetde MdealniavegremtoenthteFouffnidceaocfhEencvkifroornmfeinfttaytlhEounsfaonrdcedmolelnatrsfo(r5d0e.p0o0s0i)t ipnaytahbelWeattoer"mWaQieulsaltoirVtiywriglilnhiaand Division of Environmental Protection." GENERAL PROVISIONS dleegfaelnsaeust1,.hofraicttys,WoatVshDewreEltPlhaarnsetsthehorsvreeiseghnatlulmtreoirgaahittsseedaanisdn atdhebefaseFinissnedfsionrwghssiupcopfhoFrtathcietny.gmsauychhalvegealpuarustuhaonrtittyooarny `CUhnadpetrert2h.2is2,OrAdretDriuc,pleoDnu1tp5,ohneStreecabtgiyroewneas1i5vteoasunndidtseCrhrtiagaphktteertaol2la2ap,cpteAiaroltnistchlrieseq1ou1ri,dreeSrdecubtnyidoetnrh2et1theeorfpmrtsohveainCsdoidoen,s of mrcoeangddaeirtdiiinonngtshtiohsifOstrOhdirsedreOrra.dnedrHroaewnseedvrevceorsn,saeDlnutpriotgonhttasnddaonewdsildnleonftoeatndscmeosinttaevasantiyltahfbealcejtuurailsdoirctliegoanolfdtehteermDiinraetcitoonrs regarding liability and Telephone:O(f3f0i4c)e5o5f8L-e9g1a6l0SFearxv:i(c3e0s4) 5584255 0Q0nY Page 5 H. David Ramsey, Jr. E. 1. Dupont de Nemours December 31, 1996 and Company responsibility administrative ionracniyvilp,rotcoeeendfionrgcse rtehgiasrOdridnegr.these facilities other than proceedings, either 3. notification froTmhitsheOrAdgeerncbyectohmatesDuepffoencttihvaesosnattihsefadcattoeriilnydciocamtpeldetaendd shall terminate upon all tasks set forth in the requirements of the Order. 122i lag Effective Date L2p an0) [nn N`aWetsteVirginia Divitsilonio}f Environmental Protection A. 4 2 S-oi : EN.amIleDupont de Nemours and Company i Te Plant Superintendent Tide Telephone:O(f3f0i4c)e5o5f8L.e9g1a6l0SFearxv:ic(3e0s4) 584255 0gs'S5 BF PO=f3250 E.I DU PONoTwDtE N-vEiMroOoUnRsSamAenND COMPANY =ge wats QuadyMgnt ENINGTON, GELANARE 15018 T I Suna 12/iss STIS eneenaobiionioe #Boostree BS25TIARTTREScofOGFunekWnIEvNSiTRoRNDVNIERNGTIANLIAPROT orvas ere sar Sa NITRG WV'ES1GS |Ir 13S te BN y sianzsion 03110020a5aPe ra38m788577 5% 3 E.I. DU PONMrTEuLcDEtT,N-vEiSMoEoOLnUARRsESaTmAo0eN%eD COMPANY Se 12/1696 f snWoe BS2TI6AP7TTAEofOGFuREKWNIEVNSITRORNDVMIERNGTIANLIAPROT | Se NITRO WV E3ies 7893531 swmasss0,000.00 orvi wren 0nsar "ame EA0S ti yrsinnzssie 103413100209 aar38pi78857r7as 000527 70 060.20 | INTEROFF ICE MEMORANDIN DFartoea:: TDeelpt:No: 0RO3N-AJLaDn-1W99M7EL0O4N:20pm KEPELOPOasNRY 304-863-4753 10: Distribution List Subject: Leachate to the Biobond > LeaEacrhlaytethfirsomafDtreyrnRouonnbawceksutocctehsesfnuelwlydebwraotuegrhitngourfacfiilristty.full load intendALLtopucmopnst,inueequihpamnednltingandlealcohgaitseticosvewrortkheedweweelkle.nd.AY this point we wy Om [SEERER EID029946 @UPORD DuPont Haskell Laboratory January 9, 1997 HAZARD CHARACTERIZATION FOR HUMAN HEALTH C8 EXPOSURE CAS REGISTRY NO. 3825-26-1 Prepared by: L. B. Biegel, Ph.D. Senior Research Toxicologist ! 009%5% 8 Lee0808 HAZARD CHARACCATSERREIGZIASTTIROYNNFOO.R38H25U-M26A-1N HEALTH C8 EXPOSURE Table of Contents J I. MAMMALIAN TOXICOLOGY crvE 3 LL. ACULE TOXICITY SIUBIES corres: 3 11D. ACUtE Dermal TOXIC worms LLd. Acute Lhaltion TOXIGHY srs 121.16Su.bcAhCroUnEicIJTOEXCIOCNHYTOSXAICSHSY v.cvvrerrurrearrrevrrrreenmrrrsrnmsnresmmrsrrnsmmesmnmmemnmeonmoemmseosn 1 1.2.8. SUbCHIONC OFal TOXICHY rors oes, T 1.2.5. SubchrOniC INRAIEtON TOXIC ..ryrrrrrrrmrsemmemsn 10 1.2.c. Subchronic 1.3. DeVEIOPMENtal Dermal TORIC TOXICHY usr rnin 10 LL FL IL.16M.ECThArBonOiLcITOSXMIGi.tYccnodovONcCrOsBnErRsICsIsYsv smssssme omsmnmr memsesr msmmsne sonnen 13 19 HLEEMECHANISMS OF ACTION... rcsrmssmenemmmenemmmsmsmn--mn--n 20 TILL. 1.2. Investigation ofC85' Investigationof C8s' Effect Effect Oonn TtehsetLiIcVuElTa.r.Le.y.di.gcC.erllr.r.o..m.r.r..r.r.mooswmrmmonnnr 20 21 IV.113,CLIInvNeIstCiAgaLtiRoEnoPfOCR8TSS' EOfFfecHtUoMnAthNe PEAXNPCOISEURRSE..w.c.....r..rrmmsrrsmmrno 2222. a A VL`VIDL.ISCDUiSSSICOUNSOOFFSTIEANTOGDEDPtOOITNGATNSS .v .....ccers remrremrrs rmrrmsnemennsmnnn 2233 V1.2. VL3. TDiusmcoursssiAosnosofcDiiaftfeedrWeintchesC8iniSnpheceieR s-Speca ific St ensitive ities .. ........ ........ .... 24 24 VL... SignificanceofC8-Induced Rodent Tumor to Human Risk................. 24 3&3 2 Lo 009niy EID08080Y . HAZARD CHARACCATSERREIGZIASTTIROYNNFO.OR38H25U-M26A-1N HEALTH C8 EXPOSURE INTRODUCTION "This document is a Hazard Characterizationof C8 for human health. C8 is also known as ammonium perfluorooctanoate (AFPO; CAS # 3825-261) and is the primary ingredient in FC-143 FLUORAD Brand Fluorochemical Surfactant. Within this document the chemical will be referred to as C8. However, it is acknowledged that many ofthe studies discussed actually tested the product FC143, which is a mixtureofseveral straight-chain perfluorocarboxylic acids containing approximately 93.0-97.0% C8. I. MAMMALIAN TOXICOLOGY LL. Acute Toxicity Studies La. Acute Oral Toxicity Numerous acute oral toxicity studies, in several species (rats, mice, guinea pigs, dogs), have been conducted with C8 (see Table I-1). The results of the various studies havebeen consistent in their results. Administration ofa single dose of 12 mg/kg to 3 rats produced no clinical signsoftoxicity. Studies demonstrate that newborn and older adult ats appeatrobemore seasitive than weanlings and young adults. Additionally, while mice and rats appear to be equally sensitive to the acute toxicity of C8, guinea pigs are more sensitive than mice of rats. In the rat, acute oral exposure generally results in enlarged livers, elevationsofliver enzyme levels, gastrointestinal irritation, and weight loss. C8 is considered to have moderate acute oral toxicity. Inaddition tothenumerous studies listed below, several other studies were `conducted which investigated the effectsof C8 alone or on animals pre-exposed to other chemicals or drugs. Pre-treatment ofrats with phenoberbital sodium or proadifen hydrochloride does not result in an alterationofthe LDsoof C8 (478 mg/kg). Pre or postdcoosmipnagrewidtthoDraotws edoxsed1-wXit2h-CC18laolnonEex.chAansgtuedRyewsaisn acton1d0u0c0tmedg/tkogderteedrumciendeitfheprmeo-rtality treatment with ethanol (a single doseof60% ora 15% aqueous solution (v/v) in drinking water for 14 days) modifies the effectsof C8 on liver weight. This study determined that pre-treatment with ethanol did not alter C8's effect on liver to body weight ratios. 3 e00es2s z & g EID080810 PL RA 3 Si 0 | ii | CEs faol sbo j$p3 meesmsemn smpmssrkabs iap5l EE EE1E F5 RZ Rp 55 TE iy Biz3 WC Bfz)aiE | 158003,02: 1Pik EBpLE Bh Sg . 523 n 9s5m5en5 a % Heei HsI1d 5.s 8 - 8 BREtaaEa eeid: 1 Oo HI BTL IEE :z Cog HPRARe E aHr gfLy te grrr aay Hosen | | oan EIDOS0811 HAZARD CHARACCATSERREIGZIASTTIROYNNFO.OR38H25U-M26A-1N HEALTH C8 EXPOSURE LLb. Acute Dermal Toxicity `Acute dermal toxicity and irritation studies in rats and rabbits have been conducted with C8. C8 is considered to be mild - moderately irritating to theskinand `moderately toxic by the dermal routeofexposure. Rat skin showed less iritation than raadbdbiittioanndtoidnegremnaelrailrrtihteateifonfescetvsewraelreclminoircealpsriognnsooufncteodxiicnitmyalweesrethoabnseirnvfeedmailnebso.thInrats awnedt raanbdbliotrssitnariensepdopnesreitneoalC8areeax,pocsyuarneo.sisTh(ersabebiotbsseorulvya)t,iodnisarirnhcelaud(readbbbiotdsyonwleyi)g,hltetlohsasr,gy (rabbits only), labored breathing (rabbits only), and chromodacryorrhea (rats at 7500 mg/kg) Table12 SUMMARY OF ACUTE DERMAL TOXICITY/IRRITATION STUDIES WITH C8 TSETope TTI. R Si1AbDE i,arpien Spm Waeddee Dee (@pke) Er 5 W000 RAS BeA e ES00, 0wd 7500 "SiAbie RS ReeS000Rad7800 Dw ERT a Qa 75Wile00) S500000,,070500,0 Rews Reems MaDe emEeh RLS FemalIeLDD s= >m750p0mgg/kg HUA WKeanR edy,D 1985) Mild skin irmiaion LMiDldSsin immiatgion THLE LSegg er 43/44 w3021000000 a 100 H(KeunLedy,A1985) 09R7e5po0rAtBN0o4.8S aod abraded sis * 1580) a YG SNR VdVRaHLA Slightmoderate itionst48 bours Llc. AcuteOcularToxicity bemoderEayteeliyrrirtiattaiotninsgttudoitehseienyrea.bbIintssthiallvaeiboneoefn scoolnidduCc8teidntwoitrhabCb8i.tcCy8esipsrcoodnusciededred to = `rmeocdeedreadtoevceortmiemael.opPacriotmyp,triwsa, sanhdoicfonntjhugenectyievirteids.ucTehdetsheeeofcfuelcatrseaffnedcptsrogvriaddueadllaymore 2 g rapid recovery. In addition to the eye irritation studies that have been conducted, rats $ 09.5% EID080s12 HAZARDCHARACCATSERRIEGZIASTTIROYNNFO.OR3H82U52M6A-1NHEALTH C8 EXPOSURE wexhpiocshewdetroeCm8icdruorsicnogpai4c-ahlloyuerviidnehnatla4t2iodnapyesripoodste-xchixbpiotseude.comeal opacity and ulceration, Tae 13 SUMMARY OF EYE IRRITATION STUDIES WITH C$ Sem ERw DGgw) Rem RE ts T Umamedor Reese ------asm (1 uwaavsahsehde)d, MoMdoedraetresietvsere cornea opacity AdMoaderue conjunctivitis MCiolrdevlasocpualcariitzyation Washed eSyleightmodest coral apaciy AT aSalyisghtmoderate conjuncivits Aled Mid conjunctival rdacss Hai SSwaeshded Usaibed oMyeoder iation rCoinsjunciviis Washed eye BiNco.TlkIa395Raper (Griffit1h98a0o)d Loss, ATd"a4n6 eyes were fieof maton L1.d. Acute Inhalation Toxicity exposurAectuotCe8inbhyalianthiaolnattoixoinciistycosrnusdiideesreind atotsbehahvieghbleyetnoxciocn,dwuicttheda 4w-ihtohuCr3a.ppArcouxtiemate hlietghhaelr,colnlceanttsradtiieodnw(iAtLhiCn)4i8nhaotusrosoff0.e8xpmogs/uLr.e.AtAtcocnocnecnetnrtartaitoinosonsfb2e.t2wmegen/L0.C388aanndd in0.c8r3eamsge/dlLiCv8e,r-rtatos-beoxdpyewreiiegnhcetdraatnioiwnihtiiaclwherietguhrnleodstsoftohlelhoiwignhgeeaxpdoofsutrheeannodrmeanlrange: 42 days post-exposure. Additionally, allratsexposed to 0.81mg/L C8andhigher showed comeal opecity and corrosion. $z i g Leonpa.uls EIDO80S13 HAZARD CHARACCATSERREIGZIASTTIROYNNFO.OR38H25U-M26A-1N HEALTH C8 EXPOSURE Table 14 SUMMARY OF ACUTE INHALATION STUDIES WITH C8 Seem TRC Wedd eas Co(mmglmL)un 038,"0h8o1,w0o8p3,o2w2s,4e3,57 Res Reem ShLwCAo=L0C9=80mpRgmLgl (KeaseAdLyT,eOtSal, 1986) RT Gy Gp GSmL EyeNaneddraesipicuiory imitation (Gr 198a0d)Cog, LLe. Acute Injection Toxicity `Acute toxicity ofC8 when administered by intraperitoneal injection was assessed in mice (3M, 1979). The LDso by intraperitoneal injectioninmice is 192 mg/kg. 1.2. Subchronic Toxicity Studies 1.2.2.SubchronicOral Toxicity Numerous subchronic oral toxicity studies in several species (rats, mice, and monkeys), have been conducted with C8 (see Table I-5). The resultsofthe various studies have been quite consistent in their results. Administration of C8 in the dietorby daily gastric intubation produced death at concentrations of 1000ppm and higher for rats and mice and at 30 mg/kg/day for monkeys. The primary target organ for toxic responses in all species studied is the liver. C8 produces increased liver weights, increased liver enzyme activity, hepatocellular hypertrophy, and hepatic peroxisome proliferation. In addition to the numerous studies listed below, other studies were conducted `which investigatedthemechaonfiacstiomnof C8.Thesestudies are summarized in Section IIL. Mechanisms ofAction. ! . Pry S2s EIDOSO:814 Ef if 3 2 5 3 B2 ALyR| FE i BRI2 E_R PPaothi oRgDfoodpr hodlin J ELoGiE BER 22 ify 2fo Eil feBiraaligd Hayl gdiyg Hinil fi EE|l B[3p2 aaflg i oi 2G:i2l: lnmif : 33 s| EiERG: Hisin ii : i 11 Tz ii; p SLwE,rf ,zPolgai , ;Fo : PE: FL fr orci I REECET Epaa sprig: 0 mE of . een in EIDO080815 is i is i iHeIR1E0s HHGL Hosi Caadil Edd ol i ip BRE oI (`| EELEfehis a i EsiHlRl sEiEjl h HEe LE 2 ful lB) bd HL: B0og)og phndnaE! HhRy H Ig E die ro Boilie 1 i: gg] =z 2 5 s 5 1 gf : oo ; ' EN 5 jit g 2 32 3 ie = . : 5i i i3 | i ity 000m: 1 EID0S0816 HAZARD CHARA`CCTASERRIEZGAITSiTCRiYsNFO.OR38H25U-M26A-1N HEALTH C3 EXPOSURE 1.2. Subchronic Inhalation Toxicity Similar to the oral toxicity studies, inhalation exposure to C8 produces reduced body weight, increased liver weights, increases in plasma enzymes indicativeofliver injury, and pathological lesions in the liver. Measurementofthe blood fluoride levels (indicativeofthe presenceofC8) determined that the blood half-life of C8 in the rat is 57 days following inhalation exposure. Table 16 SUMMARY OF SUBCHRONIC INHALATION TOXICITY STUDIES WITH C8 IN THE RAT "SGT (sexSidaose) Ceemwmies (R@yks)es Rees wr ith a 42-day fof 6 houriday oDfoboedyweigy Ghtemaintaineedydvuerheie 42n-dgay T recovery irnedciocvaetriyveopefrilovdeatin8j3u;riynpcrreaesesdcuppla(ats0ma28cudzayyesmes offohlloweingpthe aasitncterxepaososeudrleci;vgerrywaeniugtlhatsde,eagoesoaccru;aloanr. eTfhfeelctisvewreerfefeocbtssewrevreed.not observedair 14,32,or 42 daysofrecovery. De ead i Wd HAO wdiatyrheacnov8e4r-y for boursiday pweliacgshatzs,ynomoecuslairnedfifceacttisvoeobsferlivveed;jinucrrye;ased (Ken158He6a)ldleyta,l, 2n0cdrceeaastedrlloivbeurlwaeihgehpattsoctel>lu8lamryE/y'pe,rpreonplboybualnadr dTahyerleivceorveefrfyecptesrwioedr.ereversible followi82n8gDodescereraesleadiewdiptrhetsienmcdeourfinCg8tah trheecbolvoeorydp,ewrhiiocdbhut wNasOsAilEl=Ldet|emct/awbl"ea,faelrib8o4dugahy1s3opf premcovery. oerxgpaonsoufrieuo0ri|demyv/aas'detected immediatly following 12.c. Subehronic Dermal Toxicity Table 1-`7T)h.e sSiumbiclharrontiocthdeeromraallttooxxiicciittyysotfCudi8es,hadserbmeaelnesxtupdoiseudreintothCe8raptraondducreasbbrietd(usceeed binojduyrywaenigdhlte,siinoncsreiansetdhelliivveerr.weiMgehatssu,rienmcerenatsoefsbilnopoldasfmlauoernidzeylmeevselisnidincdaitciavteiovfeloifvtehre deprremsaelnceexopfosCu8r)e.deAtcerommipnaerditshoanttohfetbhleoodderhmaallf-elxipfeosoufrCe8stiunditchse troatthie5f-e7eddianygssftouldlioewsing z leadstotheconcltuhatsthieroatensof absorption of C8bythesetworoutes are not g significantly different. g Ss 0 Coons EID080817 HAZARD CHARACTERIZATION FOR HUMAN HEALTH C8 EXPOSURE TET wTitohd1234 day recovery Hg Rade wIi0edxpos1u4re dayrocovery Tae 16 SUMMARY OF SUBCHRONIC INHALATION TOXICITY STUDIES WITH C8 IN THE RAT (WisSexedomne) TS Male Ra Co(wmakem)a b20o,u2r0s0d,ey2,0500 for dayseck (Rmeyel) Sboidy weiiagihtonaa>230200;0;inrcerveeasedprlaesdmia on cliavrerymweesigihndsicaattiv2eo0;fbievpeartioncjeulryl;arincressed ebffyectps abeserarvnteddrnecorospishy 120; 80 ocular Tfohlelolwiivnegfaf4c2t-sdawyerreecgoevneerryalpleyriroedvearsib2l0e0. Dwhoiscehredlatoed pcrersewniectehostfimtCed8ueriidtnegtbhleoroedc,overy Tpeorvioedyb.ut was sll detectable he 42 days of Reema (KeAaaeLdyS, O1985) H(seAx not specified) 10 Rabbits 001000, 2000 Ealoao oF a3000 OF a 1000,0 64 510d0ayfuoirm6ehcokursday, S Reversu iblleeverc lesdwucetrr ieon5.a4e,b6o.d,y4w.eipgphtm; Bolrood m1a4l,e1s3a4a2d810d.a1y,so1f2.t1h,e18sdtu3dy.,5 freosrpfecetmiavleelys.t7, k0r97L9Ri0elApbBoorOtm4iSoSn,e," March 15, 1981 13. Developmental Toxicity Developmental toxicity studies have been conducted in rats and rabbits (See Table 1-7). The original developmental toxicity study in ras indicated that C8 might be a `tweerraetocgoenndiunctreasd.toHcolwaerivfeyrt,hebercesauulst.e tThheereasdudlittsiwonearlesqtuuedsiteisodniadbnloe,tcaodndfiitriomnalthsetuordiigeisnal result. Overall, C8 is not considered to be uniquely hazardous to the conceptus. alteratio`nTsh.e tIwnothae orriogifenqauleassttuisdoyn, twheerleeaasppaalrteernattiloennss caobnnsoirsmtaeldiotfietsheanfdolslkoewleitnagl: large ens cleft,darkstreakrunning %to %of thewaythroughtheleas;ordisorganilzeensd fibers. Inthesubsequentstudies,the lensalterationswere determinedto beanartifact created in the lens during frechand sectioning. Processing Bouin's-fixed fetal heads that wesesreeattiralilmymeeldimoinnaetiethdetrhsiisdaertofftechte. oErxba,miinnasttieoadnoofftthheroeuygehsotfheocfefnstperrionfgtuhseinegyef,ocal illumination, indirect ophthalmoscopy, and slitlamp microscopy were also used and did soittesdoentetchteafniyrsCt8l-uremlbaatrevdeertyeebraalteeirnatiroantss.anTdh1e3srkielbestianl ralatbebriattsi.oBnsotinhcolfutdheedsoesaslitfiecraattiioonns 2z are considered to represeat stress-related changes indirectly related to C8-administration. g 3s U eoonen `EIDOS0S18 HAZARDCHARA`CCTASERREIGZIASTTIROYNNFO.OR3H82U5M-2A6-N1HEALTH C8 EXPOSURE Table 17 SUMMARY OF DEVELOPMENTALREPRODUCTIVE TOXICITY STUDIES WITH C8" Spm Comeswmes Ree 75(#Ri.adosse5) 0.7510.0, 150mgks Reduced marl bgo/dkygweightgaa 5d (#ouspecified) bygavage calibnincalosrigmsoaafl:2wi5xiatcaiidye1a5s0150; eye Reem 3M ReporMOT assy) ERE TO0mg bygavage TT Mweeigahtlgaidne;ano ddeeveclroipemednmtaatletroixailciBtoy dory TTT(SHtaLpleTs, tal, sbuormalites observed. 1984) 12a 100mpkgbygavige weMaitgehrtnagladiena;t2h0s,ldereaiocnsrimneaptoeasrtnpsaalrbetuomdd,y ovciuablialrietfyf,egctrsowotbhsrearev,eodr.development. No RG (aotspecified) Gi08, 30 bygavage TSO my MeimlbdreaoyoaaobSgot;rmCaolHgSrxodssiafiencdin,gs, `o0bsmearlvfeodrimnatilolngsr'o.upFse.taDlleetnsefrimnidtoinbwneeegdr3se. prroecespsinrg artotriafcdatc,t.muaNlocee/ftefmailfoevnreaotveiaoc,riets, wieigmhtsp. lsats,ncotrpoaraltutei,oofetnal 06SSITMRROLaIpOe,r1981 REG 20, mg byiahalation tVoxiicsiety 1d19e.a9d;No2teorvearttmoefagfeecltnswierce ocbsemrvebdiaraatyoxyoifcittohyewea-xspoofbsseedergvreoaduaps2l;1; processingarifacts wereobservedon leas. (HSupUls,Ical. 1984) by gavage C8 was not embryotoxico teratogenic' MToaiyci2t4y,1Sh9e9e6t, Preguantrasweredosedbygavageoadays6-15ofpregaaacy. Prerabgbitsoweraedonsedtby b.. gSavaageocndroanyDis6a-yf1281oioffpcgreegseataiaodcny.. cd.A Puspisgnsifiacanct rohingidhaeyrfi3nc5iipdoescntcpeeoarfutdmhe.skeletalfinding "onesteroabrasmissing",occurredinthehigh Fduorstehegrromuopr.e,Tthhiesiwncaisdenmcienoofrtshkieleftianldinegdriradtnoontdnifdfwe afsrnoomttchoeocsoindterroeldgramoaulpfoorrtmhati3olnoiwnert-ilsevseuldy. reammentgroups. Theincidencesofskeletalfindingsassociatedwithdelayedossificationand ib e. sTbheerraetwiaosnswaesuraeisntoctadlilfyfseirgeanitfaicmaonnigntchreearsaiimatehnetingcrioduepnscaenodfcon3trroilbssi.nthehighdose groupaxd13 Ftihbasnsipnutrhreecdointrtohlesm,ithdedyoasreegnrootucpo.nWshidielreedthewfbientdeirnagtsoageensiicgcnhifaincgaentsloyrgmraelaftoerrimnattihoenstr,eraattehdearntihmeaylasre `considered 0representstest-elazedchanges 0compoundadministration. z> g g 2 _ oopig; EDOM - HAZARD CHARA`CCATSERREIGZIASTTIROYNNFO.OR38H25U-M26A-1N HEALTH C8 EXPOSURE. 14. Reproductive Toxicity No information is available on the reproductive toxicityofC8 1S. Mutagenicity Ithas been demonstrated that C8 is oot mutagenic in a variety ofmutagenicity tests (See Table 1-9). Table 19 SUMMARY OF MUTAGENICITY STUDIES WITH C8 IN THE RAT SGT SmGDees Res Reem ceTrAeLvSi3s7i,aeTDA4LySe3a8s,t,1w0idtThAaIo0dDw)iataodu.t `meabolc scsvaton. RmG icronuOcleEus TT 600,800w,aaed 10d0o0smegd/WkglanBd0b0,o4o00, mahorurrosawfweradsoesvianlgu.aiedat 24,48and72 CK RE sberation cwhroiamaodstwoimtahlhosubtermmeattaiobnosliicncCtHivOagcoenll.s "rWansifosrmationGasEsey Asasdacydwtafxoicciltly ia CstIoHma1a0TiIo/n2pcooilcoanayl cells. Eu LBIFeProoje1c,t12907838, (Gr1is98af0d)fLoisss, GRRE TT 1i7n3g88W04i5d5,e, May 16,1996 NG i A1p7r3il88205,413979,6 LNEo evi3d3eagcaeolfceolwrSarnissfioerdmiactiiyon T a Minnesoi ta Envoe ifron. Pa`iAnprLialbs,, T12998412, 16. Chronic Toxicity and Oncogenicity `The chronic toxicity and oncogenicity ofC8 has been investigated in two 2-year feedingstudies inrats (see Table 1-10). E g 5 0085s EID0S0820 HAZARD CHARAACSTERREIZGAITSITONNFo.OR36H2U3.M2A6:N HEALTH C EXPOSURE Tae 110 SUMMARY OF CHRONIC TOXICITY AND ONCOGENICITY STUDIES WITH C8 IN RATS TTR (mean ally intake, mg/day) OW15,W20p4 m15 mgku/day) Deconnssumepiolniyncreased siaR . DevescnE paredheodasee d 0T 281Ce ROO! ny RvaBluCes.couTnatcsr,ehaesemdogllivoebriwne,iaghdtsh,emvaetroccreilt. (April 1981-May 1983) hNyopterctornospihdye,reddegiebaeercaaicoinzoagnedanieccrosis. SMe Op S00a acosnsumdptionB.odIynwcereiagshed estradnidofloloevdels. Ipannccrreeaasteidciancciindaernceeolfalidvoerr,eLseydig cll and ( DuPontC MaRl -1596k 5846) In the original study, in-lfe findings consistedof a dose dependent decrease in `mean body weight gain and increase in food consumptioninmales, and aslight treammenterelatedincreasein the incidence ofataxiain females. No increase in mortality was observed. C3-related hematologic alteration included decreased red blood cell counts, hemoglobin and hematocrit values observed at various times throughout the 2yeartest period. However, the decreasesinerythrocyte counts were observed earlyi the studyand did not progress into generalized anemia. Histopathologically, C8-associated alterations were observed in the liver. These changes were characterized by increased leinvyetrhwreoicgyhttesc,ouhnytpse,rttrhoephheyp,athiecpaatlotceerlaltuilonasr wdeegreeneorbasteirovne,daenadrlnyecirnostihse.stAusdywaintdh tshheowed litle progression over the remainderofthe 2-year study. The incidenceoftumors was relatively low, and the typesofneoplasms found were not differeat from the tumor profiles commonly observed in geriatric rats. Hepatocellular tumors were slightly increasiend the 300 ppm males, howevenort,o the exteat that would be expected considering the morphological evidenceof hepatocellular stimulation observed at the 1year necropsy. The incidenceoftesticular Leydig cell adenomas (0/50, 3/50, and 7/50 at 0,30, and 300 ppm, respectively) was suggestive of a compound-relaced effect. However, because the incidence was within the historical control range, it was not considered to be a compound-related effect. Basedonthe tumor incidence,typesof tumors,timeoftumorappearance, and the survival rate atthe 2yeartimepoint, the o0v2e8r1aCllROc01o2)n.cHlowwueavssetrih,aiotnCtn8hiwsaosringointaclasrtcuidnyo,gesnoimceoinftthheeraptat(hRoilkoegriLcaalbofriantdoirnyg,s were equivocal (liver and Leydig cell tumors), even when evaluated by an outside laboratory, and therefore a second 2-year study was conducted to clarify some ofthese findings. `The second study included many mechanistic endpoints to help determine the `mechanismoftumor formation (DuPont MR-S686, Cook, etal, 1994). In addition to the pardolliifbeirtautmiocnon(tBr-oolx,i8dasteicoonnadctciovnittry)olawnadsceplaliprr-ofleidfteoratthieonC(8BgrrdoUu,p.6-dPaeyrooxsimsootmiec pumps) E z H EID080821 ee0ass HAZARD CHARAR CTERIZATIOe N FORmHeUMwA)Ns HEALTH C8 o EXPOSURE `lwuetrieenmiezainsgurheodrmionntehe(LliHv)e,r afonldlitcelsetss.timSuelartuimnghhoorrmmoonneele(vFeSlsH)(taenstdosptreorloancet,ine)stwreadrieola,iso I`mnecarseuarseedd.reIlnatteirviemlisvaecrriwfeiicgeshtwsewreerpeerofbosremrevdedatin3t-hmeoCn8t-htrientaetrevdalrsatsa.s wHeelplaatsicatox| imdoantthi.on caecltlivpirtoyliwfaesraatlisoon winacsrenaostedsiignnitfhiecaCn8t-ltyrienactreedarsaetds iant talhletCi8m-etrpeoianttesd. gIrnoucpo.ntrCa8std,ihdenpoattic significandy alter the rateofLeydig cell B-oxidation or Leydig cell proliferation. tMhoereraotveoerf, htehpeatraitceBo-foxBi-doaxtiidoant,ioinrrienspLeecytidvieog fcetllrseawtamsenatp.prSoexriummatteelsyto2s0t-etriomnee,s FlSesHs,than prolactin, and LHlevelswere unchangedinthe C8-treated rats when compared to the ctornetartoeldsr.atTshaetr1e,w3,er6e,,9,ho1w2e,v1e5r,, 1s8iagnnidfi2c1antmoinntchresa.seHsiisntospeartuhomleosgtircaadlioelvallevuealtsioinn rtehveeCa3le-d `trceoamtpeodurnadt-sr.elBaatseeddioncnrtehaesedsatian,ltihveer,LeLyedyidgigceclelllt,uamnodrspaanpcpreeaarttioc abceindaurecteolthteumors in C8cacoimnbairnacetlilotnuofmeorlsevaarteerdeleastterdadtiooalnleivneclrseaasnedirnesdeurcuemd cprhoollaecctyisntolekvienlisn. (TChCeKp)anlcerveelast.ic IL. METABOLISM of C8Niunmvearrioouuss sspteucdiieess.haAvdedibteieonnaclolyn,dusctutdeidesinhvaevsteibgaeteinngcotnheduecxtcerdetwiiotnhaenxdpdoissepdosition b`weoernkenrosteadt,awmhaenruefaasctruerpirnodgupcltainvtewshaitcuhs pinrofdeumcaelsesC8d.idSneoxthaanvdesapneceifefsedcitoffnereexnccreesthioanveor dCi8s,powshiitlieonmainleratrsa.tsRaabnbdiftesm(abloethhasmesxteesr)s, efxecmraelteerCat8s,maonrdemsallowelhya.msMtiecres (rbaoptihdlsyeexxecsr)ete. ebxlcoroedteleCve8lseviennanmoerxepossleodwlwyo.rkCe8raslhsoowheads athlatontgheli-fliefeiinnhmuemannsis.greMaetaesrutrheamnen1t.5ofyeaCr8s. ILL. Animal Studies and ra`bTbhietse.xcSrteutdiioensahnadvdeisalpsoosiitnivoenostfigCa8tedhatshebeinefnluienvnecseotifgraoteudtienrofaetxsp,omsiucree,.hTamhsetseers. studies are summarized below. injectiIoLnL.a.FeMmaalleesaenxdcrfeetmeadleesrsaetnstiwaelrley a1d0m0i%noisfttehreedardamdiinoilsatbeerleedddCo8sebbyyin2t4rahvoeunrosu,s w`ewrhielneomtadleetsehcatadbelxecarfetteerd1o7ndlayy2si0n%othfethfeemaadlmeisn,iwshtielreeadtdo3s6ed.ayRsamdiaolaecstihvaedti2s.su8e%orfestihduees LYaCbiornatthoerylidverru,g1M.e1t%abinoltihsemplRaespmoartan1d-2l0ow(e1r98bu0t).detectable levels in other organs (Riker observIeLdLbi.n aSsetxuddyioffferraetnsc,esmiicnet,hheaemxsctreertsi,onanadndradbibsiptoss.itMiaolnoefarnaddifoelmaableeleadniCm8alwseorfeeach pr 5 sp2e4c,i48e,s w7e2,r9e6d,osaenddb1y20gahovuargsepwoistt-hdo1s0imngg./kAgniC8m,alasndwuererthaienadnsfaeccreiefsicweed,reacnodlblleocoteddaantd g 1s eesidy EID030822 HAZARD CHARACTERIZATION FOR HUMAN HEALTH CY EXPOSURE tissues were analyzed. The urine and fecesofrabbits was also collected at 144 and 168 hours post-dosing, and rabbits were sacrificed at 168 hours. The female rat and male hamster had excreted over 99%ofthe administered dose at the timeofsacrifice. The male rat and the femalehamsterhad excreted 39 and 60% of the administered dose, respectively, at the imeofsacrifice. Both sexes of rabbits excreted the C8 as rapidly and completely as the female rat and male hamster. The male and female mice retained substantial amountsofthe total administered radioactivity in their tissuesatthe timeofsacrifice, only excreting 21%ofthe administered dose at 120 hours post-dosing (HL 62-82) IL1.. Cholestyramine, a non-absorbable anion-exchange resin, was demonstrated to protect rats from the acute lethal effoefcCt8 when administered within 2 hours of C8 dosing (HL 828-81). A second study was conducted to investigate the effect ofcholestyramine on the `emlailmeirnaattsioanndofm'iCc-eCw8er(e10gimvge/nkcghoblyesgtayvraagmei)nfer(o1m00ra0tsmga/ndkgmibcyeg(avHaLge4)052-482h)o.urAsduafltter dosing with 'C-C8. The cholestyramine did not enhance the elimination of C8 via the feces, urine,or exhaled air. Similarly, Dowex lon Exchange Resin was also able to rehdouurcseatfhteer adcoustienglewthiatlheCff8ecntoofsiCg8n.soWfheenhnarnactesdanedlimmiincaetiwoenroefgCi8v,enviDaotwheexfecerse,siunri2n4e or exhaled air, were observed (HL 405-82). To further investigate the useofcholestyramitneo enhance C8 elimination, athird sivt.u)daynwdatshecnonwdeurcetefdedindireattss.coInntatihinsinsgtu4dy%, crahtoslweesrtyerdaomsineedfwoirth14'd"aCy-sC.8 T(1h3e.3 mg/kg, by cholestyramine increased the eliminationof C8 via the feces by 9.8 fold and decreased the concentrationof C8 foundinthe liver, plasma, and red blood cells (Johnson,etal., 1984). ILL4. A seriesofexperiments was conducted toevaluatethe uptake and clearance 0f C8fromthe blood ofmale and female (pregnant and non-pregnant) rats following oral exposure, and inhalation exposure. `The uptake and clearanceof C8 from the bloodoffemale rats followinga single oraldosewasrapid,withpeakreached 1-2hourspost-traendavitrtmuaeltnottal clearabnyc2e4 hours.Adose-responsewasdemonstratedwithnoapparentchanges in blood C8 levels following multiple oral dosing. The slower clearance rate in male rats `was demonstrated followinga single oral dose. Thesamegeneral statements apply bflololoodwlienvgelisnhwailtahtiinon|ehxopuosruarfet.erAcesssiantgiloen6o-fbeoxuproisnuhrael;attihoen meaxtpeorsiuarlerraepsiudlltyecdliena:repdeafkrom theblood;the number ofexposuresdidnotaffectbloodlevels;andmaleratscleared the z compound much more slowly. Pregnant and non-pregnant rats showed similar C8 blood 2 g 1 esas EPO80823 242080 PH CASTRB REGILSA OTRNY NO,338H25U.M26A-1NHEALTH C8 EXPOSURE leexvpeelrsifmoelnltoswairneg seuitmhmearroirazledorbienlhoawl.ation exposure (HL 593-91). Specificsofthe ILLe.1. Oral administration-Blood levelsof C8 as a functionof time post-dosing. (female rats) C8 levels of 14ppmwere seen 15 minutes following administration of C8. These levels peaked at 30 ppm at 1-2 hours, dropped to 26 ppm by 8 hours, and to 0.7 and 0.045 ppm at 24 and 168 hours, respectively. C8 is absorbed and rapidly cleared from the `blood of female rats given a single oral dose. IL.1.e.2. Oral administration-Blood levels of C8 asa functionof dose (female rats) C8 levels 30 minutes following administration of2.5 -- 150 mg/kg ranged from 3 -162 ppm. The same dose response was observed at 24 hours with blood levels ranging eflraotme0d.t1o2t-he18ampopumn.tTohfeCr8easdpmoinnsiestwearsedl.inear. The levelof C8 in the blood is directly I(fLe1r.nea3l.e rOatrsa)l administration-Blood levelsof C8 as a function of number of doses Blood levels infemalerats given I versus 11dosesofC8 were not considerably different. Concentrations at 15 minutes following administration were 14 and 17 ppm for 1 and 11 doses, respectively. At 30 minutes C8 concentrations were 16 and 25 ppm; at 8 `hours 26 and 13 ppm;at 24hours, 0.7 and 0.8 ppm;andat 168 hours, 0.045 and 0.10 ppm for 1 and 11 doses, respectively. C8 does not appear to accumulate in the blood of female rats following repeated oral administration. The numberoftreatments does not appear to influence the C8 blood level. IL1.ef.e4m.alOerraaltsa)dministration-Blood levels of C8 folloawsiinnglge 25 mg/kg dose (male and -- imefollowCiongusrin)gleoraldose. % "M5 BalloeoRdaLs ev oFfee Cm8al (lxpepRsma)ss 284 5 0267 --_ 18 0 005 C8isretainedinthe bloodofmalerats to agreaterextentthanfemalerats. IL1.rea.t5s.) Inhalation exposure-Blood levels of C8 as a functionoftime post-exposure (female C8levels of 96ppmwereobserved15minutes following asingle 6-hour exposureto 10 mg C8/m'. The levelwasmaintainedthrough 1hour,fellto `approximately70 ppm at 8hours, 52ppmat24hours,anddroppedto 0.39 ppmat 168 : z > g 7 Toes EIDOS0S24 HAZARD CHARA`CCATSERREIGZIASTTIROYNNFOO.R,36S25U-M26A-1N HEALTH C8 EXPOSURE hours post-cxposure. This same general pattem was observedinrats exposed to either 0t.o1bolroo|dmsga/mmp'l.inTghfeolllaogwpihngasae6s-eheonurfoilnlhoawliantgioonraelxpeoxspuorseur(erawthaesr ntohtanobasseirnvgelde hdeorsee datuea given time). C8 is absorbed and rapidly cleared from the blood of female rats following a single inhalation exposure. IL1.e.6. Inhalation exposure -Blood levelsof C8 as a functionofdose (female rats) TT BTl achloe vegsagdlRelCiGpm hlioGnoeurpyo)ntede ___(AFFoT lovhgepoTangrae"nCin ig -- E 2 g 2 me m 7 OR&E 23 0o3ise 0o)se 72 `The response is linear at 30 minutes. C8 blood levels are directly related to the amountof C8 inhaled. At the high concentration used, the clearance rate is somewhat slower than observed at the lower levels. This suggests massive overloads in the clearance system. ILLe.7. Inhalation exposure -Blood levelsof C8 followinag single 6 hour exposure to 10 mg/m' (male and female rats) Tek Bella oC --m %2 w 157 28 11892 72 C8isretainedinthebloodofmaleratsto agreaterextentthanfemalerats following inhalation exposure. ILLe8. Oral administration-Blood levelsof C8 following a single 25 mg/kg dose (pregnant and non-pregnant female rats) "Time llovingsage onldose -- Go% w 28 Blood Rol CiGom eoou1m6Ra NoepemBer 32 3a female rCa8tcs.learancefollowingoraldosing issimilarinpregnantandnon-pregnant g g 1 000070 EID00825 HAZARD CE4FCAACSTERREIGZIASTTIROYNNFO.OR38H25U-M26A-1N HEALTH CB EXPOSURE 1.1.9. Oral and Inhalation exposure -Blood levelsof C8 as a functionofnumber of exposure concentration (pregnant female rats) Time Following sagle aldose Giis) 28 2 Blood Levels ofCF Gp) p5ie exp7osures V0 Ghp1o7iiies 33 o3d 11s 2 od 1 fToimelowirang gwhales ----EE ony ed 72% a Bod LE oli GRE) s77ip 0 Si5poiies % od `When comparing the C8 levels seen at2 and 8 hours, following 10 consecutive oral doses, there appears to be aloweroiftnhge C8 blood levels. Blood levels following 1 or 10 consecutive inhalation exposures (6 hours/day) were not different. C8 does not appear to accumulate in the bloodofpregnant rats following repeated oral or inhalation exposures. 1I1., The ability of '*C-C8 to transfer through the placenta was investigated in rats (HL 61-82). Asingledose of 10 mg/kg '"C-C8wasadministered to pregnant ratsonthe 19 dayofpregnancy. Matemal blood and placental levels of '*C-C8 increased between 2 and 4 hours post-dosing,and decreased between 4 and hours post-dosing. "Taeollfov1i0gmagen dor LeeBercs ou7rs) (ug equivialnentymLblood)_ (ug equival7enty/mL tissue) hn8 212 33 IL2. HumanExposure Determinations oforganic fluorine blood levels in workers exposed to C8 in an industrial environmentwereperformed. Approximately 90%ofthe organic fluorine wes `composedofthe C8 anion. The highest levelswere foiunwonrkedrs withthe longest `work historyin luorochemical production.Themajority ofthe values remained at `approximatelythesame levelthroughoutthe 2 %yearmonitoringperiod. Monitoriongf z C8 blood levelsof a worker who was removed from the fluorochemical production site g due to high C8 blood levels (70 ppm) suggests that fluorochemicals are very slowly : 000.34 EIDOS0S26 HAZARD CHARCAACSTERRZIGZIAATTRIYONHFO.OR38H2U52M6A-1N HEALTH C8 EXPOSURE eliminated. From this limited data it is hypothesized that the %-lifeof C8 is 1.5 years in men (Ubel, et al, 1980). TT Gmw Nambwmed Bleed Ogu FluoraeLevel eIndmustrial controls L(a5b2o0rayetaorrsy epxeprossounrnee)l Plant workers Fo pH4 5 000S10.08 0042.00 1071.00 IL MECHANISMS OF ACTION C8 is not metabolizedinrats. C8 produces hepatomegaly, irduces hepatic peroxisomes in mice and rats, andhasbeen shownto produce hepatic, Leydig cell, and pancreatic acinar tumors in a 2-year feedingstudyin rats. Themale rat is more susceptible to the toxic effectsof C8 than the female rat, presumably due to the longer %life in males. Short-term studieshavebeen conducted investigating the mechanisms of action responsible for the various effects HILL. Investigationof CBs' Effect on the Liver. IIL1a. Because C8 had been shown to inducae striking hepatomegaly in rats, a study was conducted to investigate the hepatic biochemical and morphological changes associated with C8-induced hepatomegalyinrats (Pastoor,et l., 1987). In this study `maleratsweredoseddailyfor1,3,or 7dayswith SO mg C8/kgbodyweightby intragastric intubation. The total cytochrome P450 content and activity ofbenzphetamine oNf-sdmeomeotthhyleansdeopwlaassmiinccrreeatsiecduliunmt.heIlnicveornstorafstC,8t-hteresaotleudblrea,tsc,yitnodpilcaastmiingc tehnezyprmoelsi,feration glutathione S-transferase and UDP-glucuronyltransferase, were unaffected. Carnitine acetyltransferase activity was disproportionately increased relative to carnitine palmitoyl transferase activity, confirming the predominant proliferationofperoxisomes versus mitochondria. Electron microscopy confirmed the proliferative responseofthe endoplasmic reticulum, peroxisomes, and microsomes in the livers ofthe C8-treated ats. `This study also demonstrated that C8 does not possess hypolipidemic activity. TILLb. C8increasedserum estradiol concentrationsin2-week gavage studies, `andfeedingstudiesat various timepointsup to 2years. Thiswasaccompanibeyd increases in liver weights, and hepatic p-oxidation activity (Cook, etal, 1992; Cook, et al, 1994). Since peroxisome proliferators induce both B-oxidation activity and cytochrome P450 enzymes, aninvestigatwieosn conducted to determiifnCe8 increases serum estradiol levels by stimulatingaromataseactivity(Liv,et al., 1996s). Fourteen daysoftreatmentwithupto40mgC8/kg/dayproduceddose-dependentincreases inliver w`waesigehtsst,absleirshuemdebsetrtawdeieoln, easntdrahdeipolataincdahreopmaattiacsaeraocmtaivtiatsye. aActisviigtnyi.fiJcnanvtitlrioneeaxrpceorrirmeelnattison 33 usingculturedhepatocytessuggestthatthe incinrsereumaestsradeiolis atleast partly 00013n EIDOS0S2T HAZARD CHARAC8TEBRIEZNAETITORNNCYF.OR18H3U8 M26A-1N HEALTH C8 EXPOSURE dauroemtaotaasdeirceycttoecfhfercotmoenPt4h5e0liivnetrhteoeinndcorpealsaesmsiycntrheetsiicsoulfuems.tradiol through induction of HL2. Investigationof C85 Effect on Testicular Leydig Cells Because C8 produced an increased incidenceoftesticular Leydig cell tumors in a 2-year feeding study in rats, and because C8 was negative in short-term tests for genotoxicity, anon-genotoxic(hormonal mediated) mechanism for tumor formation was investigated. The studies summarized below support a hormonally-mediated mechanism of Leydig cell tumorigenesis: C8 produces an increase in hepatic aromatase activity, `which elevates serum estradiol concentrations, which in turn modulates growth factors in the testis, which results in tumor formation. IM12.e. Fourteen daysoftreatment with up to 50 mg C8/kg/day produced dosedependent increases in hepatic B-oxidation activity, and serum concentrations of estradiol, and decreases in serum testosterone concentrations, body weights, and relative `accessory sex organ weights in male rats (Cook,et al, 1992). Challenge experiments, using human chorionic gonadotropin (hCG), gondaotropin-releasing hormone (GarH), or naloxone challenges, suggest that the decrease in testosterone may be due to a lesion at the level ofthe testes, due to & decrease in the conversion of 17a-hydroxyprogesterone to androstenedione. IIL2b. Using in vitro, in vivo and ex vivo studies, C8 was examinedfor ts ability to directly affect Leydig cells in vifro using isolated Leydig cells from untreated rats, and x vivo using Leydig cells isolated from C8-treated rats. Additionally, the ability ofC8 to affect testicular interstitial fluid hormone levels and induce aromatase activity was investigated (Biegel, etal, 1995). The in vitro studies demonstrated that C8 directly inhibits testosterone production, while the ex vivo studies demonstrated that this inhibition is reversible. In the in vivo study, serum and testicular interstitial fluid estradiol were increased and testicular interstitial fluid transforming growth factor a were increased. Additionally, hepatic aromatase activity was increased while aromatase: activity levels were not affected in the testis, muscle, or fat. These data suggest that the increases in estradiol levels are primarily due to increases in aromatase activity. IlL2.c. Previous studies with C8 showeda direct effect on Leydig cells to alter steriodogenesis. It was therefore proposed that peroxisome proliferators, in general, may directlyaffectLeydigcellfunctiontoproduceLeydigcelltumors. Astudyinvestigating `whether several peroxisome proliferators (including C8), directly affect Leydig cell functioninvitrowasconducted.Thisstudyshowedthatperoxisomeproliferators,as a classofcompounds, directly modify the steroidogenic function ofLeydig cells in vitro. TahlissoianldsuocseuLgegyesdtisgtchealtlctoummpoorusnidnsvwihvioc(hLdi, ietarl,aef1f9ce9c6tbt)L.elydyig cell function in vitro may Z2Z g 21 Leeann EOS828 c AZARIL CHARCAATSESREIGZIASTTIROYNNFO.OR38525-A26-N1 HEALTH C3 TXPOSURE IIL3. Investigationof C8s" Effect on the Pancreas Several peroxisome proliferators have been shown to produce pancreatic acinar cell hyperplasia/adenocarcinomas in 2-year feeding studies, including C8. Therefore, in vitro and in vivo investigationsof C8's (in vitro only) and Wyeth-14, 643's (a model peroxisome proliferator) mechanismoftumorigenesis in the pancreas were conducted. `These mechanisms include cholecystokinin receptor agonism (CC)trKyps,in inhibition, alterations in gut fat content, cholestasis and altered bile flow/composition. Allofthese `mechanisms enhance pancreatic growth eibtybihndeingrto the CCKx receptororby ifaniclreedastionignphilbaistmtaryCpsCinK, laecveolsm.moCnB mdeidchnaotnibsimndfdoirriencctlryeatsointghepClaCsmKa CreCceKptloervealns.d iItn vivo s`ptaundcireesatwiicthtuWmyoertshb-1y4c,ho6l4e3stassuigsg,eswthitchahtmthaeysebpeerreosxpiosnsoimbeleprfoolriftehreatdoercsrperasoeduicnebile acid `output which contributes to the increase in plasma CCK levels. Therefore, for Wyeth-14, 643 (and perhaps C8), the pancreatic tumors may be secondary to hepatic cholestasis (Obourn, et al., 1997) IV. CLINICAL REPORTS OF HUMAN EXPOSURE IV.1a. Health screening examinations were offered to employees ofa 3M plant that produced C8, as well as other fluorochemicals. No health problems related to exposure: `were encountered among those examined. Additionally, no relationship was observed between deviations from normal laboratory test results and blood levelsof organic fluorine (the liver enzyme SGGT was the most frequently encountered test result `aelx,ce1e9d8i0n)g. the normal range. C8 exposure levels ranged from 0.03 to 7.6 mg/m' (Ubel, et IV.Lb. A study was madeofWashington Works employees potentially exposed to C3. Resultsof blood chemistry testing (SGOT, LDH, AP, and bilirubin) indicated no conclusive evidenceofan occupationally related health problem among workers exposed 10 C8 (Fayerweather, 1981). IV.Lc. Although C8isthe major organofluorine compound found in humans, file information is available concerning human responses to C8 exposure. Therefore, study `was conducted among 115 workers exposedto C8 occupationally (serum fluorine levels variedbetween 0 and 26 ppm, with amean of3.3). In an examinatofitohne crosssectional associations betweeC8n and hepatic enzymes, lipoproteins,andcholesterol, there was no significant clinical hepatic toxicityofthe C8 levels observed in this study (Gillilandand Mandel, 1996). Serum C8 levelswerepositively associated with estradiol ahonrdmnoengea.tivTehley ansesgoactiiavteeadswsiotcihaftrieoentbeesttwoseteenrotneestaonsdtenrootneasasnodciCa8tewdawsitshtrlountgeeirniizninoglder men. Thyroid stimulating hormone and C8 were positively associated. Prolactin and C8 `gwleurteapmoyslitoixvaelloyacaestsiocciaactiedd einndmgolduetraamtyeldpryinrkuevrisc. trTahnesaemfifneactsoefdaedcirpeoassietdy aosnCs8eriuncmreased. `Theinducotfgiaommna glutamy! transferabsye alwcasdoecrh easeodaslC8 increased. TheeffofealccohtolonHDLwasreducedas C8increased. Apositive associstion 2 Lo econ ED080829 --_-- Co HATAm RE CHa ARCAASs STIRNEIGm AISTTIROYNY N|G.SE3N 8H2U5-M2A6o 1N HEs ALTRa CE EXe POSU) RE bTheetsweeerneshueltmsogsluogbgeisnt,tmheatanC8cealflfuelcatrsvmoalluemer,eparnoddulcetuikvoecyhtoermcoounnetssawnidththCa8t twhaesliovbesreirsvneodt. aC8siagnpipfeiacrasnttosimtoeodfitfoyxihceiptaytiicnahnudmiamnsmuant ethreeCsp8onlseveeslstooxbesneorbvieodtiincsth(iGsilsltiuldayn.d aHnodwever, Mandel, 1993). V. EPIDEMIOLOGY `whereVC.L8aa.ndAortehterrosfpleucotriovecocmophoorutndmsoratraelimtaynusftaucdtyuwraesd.maRdeceoorfdesmopnlo4y2e1e8saemtpalo3yMeepslant `iwnecrleudreedviienwtehde. moOrntlaylitthyosfeolwlohwo-uwpo.rkOefdthfeor 1680moknntohwsnordemaothrse, (1376788dewaotrhkceerrst)ifwiceartees woebrseerovbetda-itnoe-de.xpOevcetreadlrlattihoefnorucanmcoebrfddeeeaattrhhsswwaass1s.i0gn(iUfbiecla,nteltyall.e,ss19t8h0a)n.expected. The and empVl.oLybm.entInaatareptlraonstpewchteirveecCo8hoarntdmoortthaelriftylusotruodyc,omaproeulnatdisonasrheimpabneutfwaecetnurmeodrtwaelritey ifnevmeaslteigwaotrekde(rGsilelmiplalnodyaenddbMeatnwdeeeln, 11994973)a.ndTh1e98c3o.hoTrhtecoanlsli-sctaeudsoesfs2t7an8d8armdailzeedanmdor7ta4l9ity riantcere(aSsMedR)cawusaes-s0p.e7c5iffoircmSaMleRsfaonrdme0.n7o7frowrofemmeanl.esT.heThSerMeRwsafsornoprsoisgtnaitfeiccaanntcleyr were 2w.e03rie4n tohbeseerxvpeodsaenddgr2oeuxppeacntde0d.d5e8iatnhtshfernoomtp-reoxsptoasteedcagnrcoeurp.. AImntohnegemxepons,ed10gyreoaurpstohfere eprmopsltaotyemceanntceirn mCo8rtparloidtuycwtihoennwcaosmapsasroecdiattoednowietmhpalosiygmneinfitcainntp3r-ofdoulcdtiionnc.reaGsieveinn the smasasloclinatuimobnebreotfwpereonstpartoedcucatnicoenrwdeoartkhsanadndptrohsetnaatteucraalncehr miusstofbtethveiodeiwsreedasyaes,htyhpeothesis Cg8en,etrhaetirnegsualntsdofntothiosvesrtuidntyearpnrdetoetdh.erIcfltihneicparlossttuatdeiecsasnucgegremsotrtthaaltitCy8exmcaeyssiniscrreealsaeted to prostate cancer mortality through endocrine alterations. VI. DISCUSSION OF ENDPOINTS VL1. Discussionof TargetOrgans dogs, re`gTahrepdlreismsaorfyrtarogeotfuoerxgptaonsfuoerer.C8T-hiendhuecpaetdottooxxiicciittyyimsatnhiefelstisiavnsimeniccrree,asreadtsl,iavnedr ``nweecirgohstiss,ofhetphateoclievlelru,laanrdhyipnedrutcrtoipohnyo,fplievreorxdiesgeonmeersat(iroatns, ainncdrmeaiscees oinnllyi)v.erMeannzyyomefst,hese epfefreicotds. wEevrieddeenmcoenofsthreaptaetdottooxbiecirteyvewrassibnloetwehveidneanntiimnasltsudwieerseinprmoovnikdeedyswiotrhhaurmeacnosv.ery g Incontrastwiththerodeat,thetarget organsinthemonkeywerethe 2& LLEC, -- "242450 CUACRACACASTSRERREEIGZISASTTTIROYYNNNO| O.OR.38ME2US5-MI2A661NLHEALTH C8 EXPOSURE tgahsetlriovienrtedsoteisnanlottraacptpaenadr ttohebereatipcruilomeanrdyotthaerlgieatlosrygsatneimn(hGurimfafnisth, aenxdpoLsounrge,to19C880).appWehairlse to modify the hepatic and immune response to xenobiotics (Gilliland and Mandel, 1996). VI.2. Discussion ofDifferences in Species-Specific Sensitivities a5aninc`rTheeasiendiunctthieonaocftipvietrioesxoifscoemrteapirnolpiefreroaxtiisoonmeb-ysxpeencoibfiiocteinczsyimsegse,noerraalslyadneitnecrrmeiasnee.d pirnotlhiefenruamtieornici alasosrocvioaltuemd ewidteha:siitnycorfepaesersoixnisnoummebserinantdhevaoflfuecmteeodf poregraonx.isPoemreosx;isaonme sicepnleclcrieteaussm.eoriWsnh.DilTNehAerastpyshnaetnnhdeosmmieisncaoenndaorlfeipvpeaerrrtgoirxcouiwlstaorhlm;yeaspnerdnoslliiiftveeirrv,attLioeotyndhiiss gnpohcteelnlu,oniamfneodnropmna,naccgrrueoiastnsieacallapciigns,ar cats, dogs and primates (including man), are predominantly non-responsive. VL3. Tumors Associated with C8 in the Rat intheraCt8whaassbfoeuennd tdoemboensatssroactieadtetdo wbietahpteurmooxrissionmteheprloilviefre,raLteoyrdiingtcheellr,ata.ndC8paencxrpeoastuirce `acinar cell. Peroxisome proliferators, in general, were initially recognitzoebde associated with hepatocarcinogenesis in rats. However, more recently peroxisome proliferators have been associated with the induction of a triad oftumors in rats: liver, Leydig cell, and pancreatic acinar cell. Hyperplasiaofthese cell types istypically `opbesreorxviesdomperiporrotloi,fearnadtoarslo(ncglowfiitbrha,tteh,eHoCFcC-c12u3,romrfetneheyolnpcllacosfie ean.apSaetvee,raalndknWyoewtnh-14,643) are reported to induce this triad of tumors in rats. Hence, this tumor profile appears to be. prcoolimfmeorantoprhs.enomenon for at least a subsetof compounds that are peroxisome V13.a. Significance of C8-Induced Rodent Tumor to Human Risk V1.3.a.l.Liver Tumors `The abundanceofdata indicates that there is a hepatocarcinogenic hazard of peroxisome proliferators to responsive species (rats the carcinogenic hazard to non-responding species, and mice) in chronic studies, such as humans, is clearly whereas Questionable. The epidemiology data, albeit limited, strongly supportthat the relevance `ofthe hepatocarcinogenic effects of C8 and other peroxisome proliferators for human hazard assessment should be considered negligible. V1.3.22. Leydig Cell Tumors Leydig cell hyperplasia and adenomas are commonly observed in Isboratory rats. `The incidenceofspontaneous Leydig cell adenomas in Crl:CDBRratsranges from `approximately0-12%by2 years of age, andrangesfromapproximately 64 -100 %in = & F344 rats. Incontrast,theratein humhaasnbeesnreported tobe approxima0t.4epleyr g * 009534 EID080831 "LARD CHARACCATSERREIGZIASTTIROYNNFOOR38S25U-M26A-1N HEALTH C5 EXPOSURE msiulglgioensat(0s.u0b0s0t0an4t%i)a.l dAilftfehroeungche aidnirtheectsucsocmepptairbiilsiotny iosfsroomdeenwthsaatntdehnuuomuasn,sthteodLaetyadig cell tpurmoodruicgeenLeesyidsi.gTcheills tius msourpspoirntreoddbeyntesptiuddeimesiobluotgayredactoamfmroonmlcyominpgoeusnteddsbtyhaht ucmleaanrslyand are not associated with Leydig cell tumorigenesisin humans. Leydig Cce8llasnadndotehreer hpyeprootxhiessoimzeedprtoolpirfoedruacetodtrohsesneottupmroordsucveiaiandcirfefaesreesnitnmpeecrhoxainsiosmmes in anthdanthteherelfiovreer truemloervsan.ceThtoehmuemcahnasnicsamnonofttbumeorciogmepnleestieslyisrunloetdcooumtp.leHtoewleyvuenrd,eristtisood, kalntoerwinngtthhaet neonnd-ogcerinnoetosxyisctecmo.mpTohuernedfsor(es,uacthhraessCh8o)ldprfoodrutcuemoLreiygdeingescielslitsuemxopresctbeyd. If tdhoissei-srtehsepocnassee,asusseesosmfeantm.argItiinsoifmpsaofrettayntaptporcooancshidiesratphperosplroipaetoefftohrethdeosqeua-nrteistpaotnisvee at the lowend ofthe observed range in determining en acceptable marginofsafety. V13.3. Pancreatic Acinar Cell Tumors the pancCr8eaasnadnodthareerhpyeprootxhiessoimzeedprtoolipfreordatuocrestdhoesneottupmroordsucveisiandcirfefaesreesnitnmpeecrohxainsiosmmes in trhealnevtahnecelitvoerhtuummaonrss.caTnhenomtebcehcaonmipslmeotfeltyumroulreidgeonute.siHsoiws enovteruntdheerrsetoisod,garnodwitnhegrweefoirgeht osfheovuilddebnectertehaatetdthseimpialnacrrleyattoicpearcoixniesrocmeel-lptruomloifresraarteorh-oirnmdounceadllLyeymeddiigacteeldl,ttuhmeorresf.ore they VIL SUMMARY guineapiCg8hstaosm6o8d0emrga/tkegaciuntaedourltalmatloxeicriattys.wiAtnh aLqDuseoosusrapnagstiengoffrCo8mp1r7o8dumcegd m/iilndkmteogle `asmoldoerwaatse d1e0r0m0amlgi/rkigt.atiIonnsiilnlraatbibointsofseonldicdliCni8cailntsoigtnhseofratbobxiitcciyteypwreordeuocbesdemrovdeedraattdeoses `hciogmheaaclutoepiancihtayl,atiriiotins,taoxnidcictoynjwuintchtiavi4t-ihs.ouTrhAeLseCoocful0a.r8emfgfe/cLtisngrtahdeuaraltl.y Sruebceehdreodn.icC.8 has inhalation exposure to C8 produced reversible liver effects at concentrations as low as 8 `tmhge/hme'p(amteaostuorexdiocafsiC7t.By6imngt/hme')r.at.OIrnalcharnodnsikcinfeabesdoirnpgtisotnudisesubicnhrraotns,icC8stupdrioedsuccoendfianrmed indcerveelaospemdeinntcaildetnocxiecofortmuumtoargsiennitcheinlsievvee,rpaalntcersetsasf,oarnmdutteasgteinsi.ciCty8.wesfoundnottobe a rodents`Thhaesrbeeela tehevftoaochunsuocmfaseenvehreaallthinovfetsutimgoartosrisn.duRecgeadrbdyipngertohxeilsivoemr,eptrhoelriefeisraatosrtsronign. atshseoscuibastieoqnueanntddpervoebleobplemelnitkofbreotdweenetn lpievreorxtiusmoomres-.proAlicfoemrbaitnora-tiinodnuocfedinlivvievrogarnodwtihn avnidro studies as well as epidemiologydata, has ledseveral investigators toconcludethat `hhepuamtaincseafpfepcetasr, taondbethienrseefnosrietitvheeosre unnornegsepnoontsoirviecatogepnetrsopxiossoeme-liptrloeliofrenraotor-induced. &g en g =080832 HAZARD CHARACCATSEBREIGZIASTTIROYNNOF.OR38H25U-M26A-1N HEALTH C8 EXPOSURE ehveepnattso,cawrhciicnhogleenaidctohatzhaerddetvoelhoupmmaennst. oEfvLiedyednicgecieslallasnodacpcanucmruelaattiicngactihnaatrtcheellintiutmiaotrisng oafrtefhreotmescthisanagnedspainnctrheeasl.iveAr.ltThohuegshe thheepsaetircelcahtainognsehsipasppneeaerdttooabletecrotnhfeihromredm,oniat licloinkterloyl t`hAadtditthieosnaelelxyt,rparheopgartaimcstmuomnoirtsoproisneg ltihteteheoarltnhoocfaCrcBi-ncoxgpeonsiecdhawzoarrkdertso haunmdarnest.rospective. CcoBhoerxtpostsuudrieesaonfdwaodrvkeersresheuxpmoasnedhetaoltCh8pefrfoecvtisd.eno evidenceofan association between opportunOiftpyrifomraerxypcosounrceienmtihnehwumoarnkspliascteh,easnldotwheclmeoadrearncaetoe-fhCig8hfarcoumtehtuomxiacnityb,lood, the regardlessofroute of exposure. gZ g 2% Leen EID080833 H4ZARD CH: ?CTAESRRIEZGAITSTIROYNNFO.OR38H25U.M36A11N HEALTH C3 EXPOSURE REFERENCES "DuPontCo,HaskellLaboratory ReportNumbers(HL): 55-61, AcuteOral Test.1961, H. Sherman. 56-61, Subacute Feeding Study.1961, H. Sherman. 123-65, Effects ofFluorocarbon Disbursing Agents on the LiversofRats andDogs. 1965, J. R. Bames and H. Sherman. 124-65, Two-Week Feeding Study. 1965, H. Sherman. 128-68,Acute Oral Test.1963, S. B. Fretz. 160-69, Acute Inhalation Dust Toxicity.1969, F. O. Tayfun and R. S. Waritz. 253-79, Inhalation Subacute.1979, G. T. Hall. 635-79, Eye Irritation Test in Rabbits. 1979, D. F. Edwards. 636-79, Skin IrritationTestonRabbits.1979, D. F. Edwards. 659-79, Skin Absorption LDso - Rabbitand Rat.1979, D. F. Edwards. 589-80, Rat Skin Absorption Subacute Study with FC-143.1980, L. S. Silber. 682-80, Skin Absorption LDso-FemaleRats. 1980, J. E. Henry. 205-81, Subacute Inhalation ToxicityofPentadecafluorooctancic Acid, Ammonium Salt.1981, S. D. Nash and M. A. Britelli. 291-81, Oral LDy; Test in Guinea Pigs.1981, J. A. Hall. 295-81, Oral LDsoTestinRats.1981, J. A. Hall. 329-81, Oral LDyyTestin Mice.1981J,. A. Hall. 560-81, Mouse Feeding Study - 14 Day.1981, L. S. Ford. 565-81,AcuteOral Toxicity ComparisonTest inRats. 1981, L. Hinckle. 567-81,Oral LDypTestinRats.1981,J.E.Heary. 2 Btu seacae PerfluorooctanBoloaotde Leiv ntheeFl emas leRat.1981, Kennedy, & n _eoniy EID080834 cAHAsZARm D CHAeRACCAo TSERREIm GZIASTTIvROYNNFoN.OR38H2o5U.M26A-s1N HEmALTsH C8aEXPOeSURlE 600-81, Liver Weight Comparison in Castrated and Ovariectomized Rats vs. Normal Rats. 1981, L. Hinckle. 537-82, Fourteen-Day Feeding Study in Male and Female Mice.1982, J. E. Henry. 788-82, Acute OralToxicity of FC-143 as a Functionof Age.1983, L. Hinckle. 138-83, C-8 Liver Weights Females. 1983, C. N. Wyle. in Rats and Mice: Oral Administration to Males and DuPont MR 5686, Investigation of Hormonally-Mediated Mechanisms for XenobioticInduced Leydig Cell Tumors in Male Rats. (1989). 3MCo.Reports: Personal communication, J. Long to P.J. Gort, January 8, 1979. 3M Report M-601 (1981). 3M Report 0681TRO110, 1981. 3M Product Toxicity Sheet, May 24, 1996. Biosearch, Inc. Report No. T1395, March 4, 1976. Corning Hazleton, 17388-0-455, May 16, 1996. Corning Hazleton, 17388-0-437, April 25, 1996. Hazleton Laboratory America, Inc. 26-87 (Submitted to EPA, TSCA 8CAP Submission, Fiche 536984). Litton Bionetics; LBI Project 20838, February 1, 1978. Riker Laboratory Drug Metabolism Report 1-20 (1980). Riker Laboratories,Report 09790AB0485, March 15, 1981. Riker Laboratory 0281CR0012, April 1981-May 1983. University ofMinnesota Environ. Path Lab, T2942, April 9, 1981. PublishedReferences: `Appl.Pharmacol, 134; 18-25. g Biegel, L. B,, R. C. M. Liu, M. E. Hurtt, and J. C. Cook (1995). Effects ofammonium `perfluorooctanoateon Leydig cellfunction: Invitro,invivo,andex vivostudies.Toxicol, Zz g 28 Loan EIDO080835 . HAZARD CHARA`CCATSERREIGZIASTTIROYNNFO.OR38E25U.M26A-1N HEALTH C8 EXPOSURE Cook, J.C, M. E. Hurt, S. R. Frame, and L. B. Biegel (1994). Mechanisms of eTxotxriachoelpoagtiisctt(usbmsoirraicntd)u1c4t,ion by peroxisome proliferators in Crl:CDBR (CD) rats. Caodoekn,omJa.sC,byS.amMm.oMnuirruamy,peSr.flRu.orForoacmtea,noaantde:M.AEp.oHssuirbtle(1e9n9d2o)c.riInned-urcetliatoenodfmLecehyadniigsmce.ll Toxicol. Appl. Pharmacol, 113: 209-217. Fayerweather, W. E, Liver study of Washington Works employees exposed to C8: Results ofblood biochemistry testing. DuPont, Epidemiology Divisionof Corporate Medical, January 15, 1981 Gilliland, F. D. and J. 5. Mandel (1993). Mortality among employees ofa `perfluorooctanoic acid production plant. J. Occup.Med. 35: 950-954. Gilliland, F. D. and J. Mandel (1996). Serum perfluorooctanoic acid and hepatic Ameenzryimceas,nJloiupropnraoltoeifnIsn,daunsdtrcihaollMeestdeircoiln:eA2s9t:u5d6yo0-f56o8c.cupationally exposed men. pGerirfffliutohr,oFo.ctDa.noaantde.J.AEm.L.oInndg.H(1y9g80.)A.ssAonci.mJa,l 4t1o:xi5c7i6ty-5s8t3ud.ies with ammonium Johason, J. D,,S. J. Gibson, and R. E.Ober (1984). Cholestyramine-cnhanced fecal e{l1im4iCnaltpioenroffclaruboorn-o1o4ocirtnpraoatntasosasatieturemad[mi1n4iCsltpreartfilounoorfooactmamnoesnuilfuomnate.Fundam. Appl. Toxicol, 4: 972-976. Keanedy, Jr, G.L. (1985). Dermal toxicityofammonium perfluorooctanoate. Toxicol, Appl.Pharmacol, 81: 348-355. : IKnehnanleadtyio.nJTro,xiGc.Li.t,y Go.fATm.mHaolnl,iMu.mRP.erBfriltutoerlloio,cJt.anRo.atBea.meEsd,.CanhdemH..TCo.xCihce,a24((11928)6:).1325 1329. Kenedy Jr, G. L. (1987). Increase in mouse liver weight following feeding of 3a0m0m.onium perfluorooctanoste and related fluorochemicals.Toxicol,Letters 39: 295- Liu,R.C. M, C.Hahn,and M. E. Hurtt 199T6h8edi)re.cteffectofhepaticperoxisome proliferators on rat Leydig cell function in vitro. Fundam,Appl.Toxicol, 30: 102-108. g Liu, RC. M,, M.E. HuJ.Cr.Cotok,,end L. B. Biegel(19E9ffe6cto)ft.he pacetriovxitiysoinmeadpurlotlimfaelcaetoCrr, la:mCmDoBnRi(uCmDp)erraftlsu. orFoocutanonaAtpepd(lC.8)Ta,oxoincmhoelp.3at0i:c 2a2r0o-m2a2t8a.se 2 s Gaon EID080836 | HAZARD CHARACCATSERREIGZIASTTIROYNNFOO.R38H25U-M26A-1N HEALTH C8 EXPOSURE (O1b9o9u7)r.n,MJe.cDh.a,nSi.sRm.sFfroarmteh,eRp.anHc.reBaetlilcJorn,cDo.geSn. iLcoenfgfencetcsokfet,hGe.pSe.rEolxliisototmeanpdroJl.ifC.eraCtooork `Wyeth 14, 643. ToxaindAcpploiedlPhaormagcoloygy 145: 425-436. mPaosrtpohoorl,oTg.icPa.l,Ks.tuPd.ieLseoef,aM.mmAo.nPierurmi,paenrdflPu.orJ.ooGicltlaineosa(t1e9-8i7n)d.ucBeidohcehpeamtiocamlegaanldy and peroxisome proliferation. Expear ndMiolemcule ar Pnathtoloagy4l7: 98-109. Perkins, R. G. (1992). Investigationofammonium perfluorooctanote effect on hormone levels and peroxisomal proliferation in the rat.TThoexicologist 12(1): 52. tSetraaplteosg,enRi.c Ep.o,teBn.tiAa.loBfuragmesmso,nainudmW.peDrf.lKueorronosct(1a9n8o4a)t.e (TAhPeFeOm)briyno-tfheetraalt.toFxuincidtaymaenndtal and Applied Toxicology 4: 429-440. Ube, F. A, S. D. Sorenson, and D. E. Roach (1980). Health statusofplant workers ex5p89o.sedto fluorochemicals-a preliminary report. Am.Ind.Hyg.Assoc,J.41(8): 584- gg g 30 } casa.s EID030837 Date: 11/16/99 5: BOGDANMS Time: 11:09:28 OGDANMS \\server\name PSCRIPT Page Separator DRAFT General HumaPnroHpeoaslatlh taondCoEnndvuicrtonamental Effects Risk Analysis on C-8 Pupose: eTnhveirpounrmpeonsteorfotmisexpprosoujreecttofsoC-e8vadluuraitnegtmhaeniusfakcsttuoreh,umraannspheoari,thpraondducttheuse. aSenmdiqduiasnptoistaatoifvCe-e8s.tiTmhaeteasnoalyksiss wislolbtehactoenxdpuocstuerdesinyaiefladsihngiotnhethhaitgwhielstprroisvkisde Gaenvelboepeidc.enRtfiisekdsafnrdomremcaonmumfeancdtautrei,ontsraonnsproerdtuacnidngptrhoeduscetriusskes wcialndbeeveloped in atewranyattihvaet.wilTfhaeciptraotjeecftuwtiulrebceomcponadruicsioends oinftrirsekseepsarttism.atTedhfofrrsptotwenotiwaillCb-e8 cchoanrdaucctteendzeind.paTrahleef,inianlwphairtchwihludmeavnelhoepalctohncalnudsieocnosloogniceaxlproisskusrewsiltlhbaet cStornattreigbiuetse athnedhailglheemsattiivseks csaonbtheatdreevceloompmeedn.daTthioenpsroojreicstks mesatniamgateemdetnottake 12 mbeolnotwhswitlorceoqmupilreetcealfarboomratthieotnimweiotfh anpaprtoiporni.ateTphleanEtxppeorssuornneela.nal(yTsheesdlaitsetesd prosentod assume a Feb. 1, 1997S8Uapproval date.) S1cope:Human Heal Risk A Hazard dentfication anTiamselTine Est 8C0o0s0ts) Hcraiztiacraldsoxtiolhtyumeannhdeapltohofwiirlelbneevtarnecsveietwoedhuamnadnsuhemamlatrhiizsekdwiinltbheiisdeecnttiiofnie.d Tahnde TpohteentHiaaslkedlolsitmoxeitcatrysstuombmeaursyewdiflorbeinutpedrsapteecdieassepxatrrtaopfotlaitsiotnaosfk.isk wi be discussed. 8. TDhoesed-Reosponsse Aenaclhy-asriascrtrisetcssofCp-8wolbneevaslua3te0e0d9.7Thismayinc4l3u2d0e0 cdwoehnvederulecotpnieencdgebsbaseasnrecydh.moAanprtpkhreodpolrisikeealtayenmadolodyssieemsoeftteaorcistdoeonnrt.itiTynthneeor-spophbeacsriemerasvceeoxdktiarnadepvtoeilracstsieooenffCwfi-el8cawliselvoealblseso bapeprreovaicehweesd.wiIl pboessdiebvlee,lorpueddimteonftaarcyiaptheysiinotleorgsipceaclileys-beaxsterdappohlaatrimoancookfirnisekt.icRsisks vs dose relationshwipislbe developedinthis phase C. EaRixerpabososomunera,ebdlArenianelkxyipsnoigsswuarteers,cednearrmiaols,afnordCo-t8hewriolrbaeldiengveesl9to1ip3oen0d1.p8a7tThhwiasyas.e kInetay1ke6sr,to0a0ti0necslaunded frdruoarnmasttpiohorentps,lopafrnoetdxiupcoetstuuosrheee,wlaiplncdbhaewradasectvteeelrdoiipzseeptdo.hsaelHsaaoespexkrepalotsiwouinrlsew.poarTtkhhwewibahuyssaifnnoearsssmsawinigulnfepadrcotpvueirrdisenogn,(s) HTa`hesexkpseeecldtleadwtuiatpwhpdiealrtbcaeotonabcnuolnacfteneitdlr.iadMmtiotieonfntsoneorCftcahCrel-eso8etIeenxctphhonesiuaqrfufeeessc,tmdeaedypmeebndediuiansge(tadhlt,eowaacvtaaellrca,busilolaitt)y.eof data. Thecostassociatedwit thi takincudeonyHaskepersonnel ime. D. RRiisskksChwairlabcteesriuzmamtairoinzed according to the major routess2o1f1e5xp7osure (a,1w6a.t0e0r0, dermal, otheroral) or eachC-8application (manufacture, transport,productuse, z `dispcosaol).nThectroietskhsenwidoltsbee-rcehsaapraocnttseerriiezleaotdbioynnschoismpp.aTrhiinsgmtehtehliokdeilysgexpeosnuree rrefaerled Z2 Leann EID080839 : DRAFT I10n.f2o5rm8atMionahaortfwEigxlphoiesluprned. tThetchheaorapcetreartiizoantsioanndwielxpproosvuirdee phaethriwsakymsatnhaagleprrewsienht mhaedheigohfespotterinstki.alTshkeschpaorsaecdtbryzaCt-o3nsalewrimlatiisvoesa.nabl ulre comparisons to be I 8AEcologiDHcaoazslaerf-dReecistgpsonotnfsiecaAtnoanlysis CC.. REixspkosCuhrareacAtnearliyzsaitsion I Recommendations on Risk Management Strategies and AteTroatnvess aso cecpoelroagdicoanlsrceTocheuipdtsorbssee,cttiaBornageswteielddeotvonaftlheueadstescatnaaellyclsatersvg.eesrttlehsycekoimsmkefsnrddtaheteinoltneesadswtcloosbhteu.mmTaahndisehweiaallsfbtoeawanidvcehry Siafocive exercise (nanaive) and wil require some inpu rom the plant peopl. 000585 . g g [EID080840 L INTEROFFICE NENORANDUN : DFartoem:: DW0AE9NB-IEJERuLDnA-A1.997WEB09E:R32am EOT DTeelpt:Mo: E8-N8G6I3N-E4E4R1I5NG POLYMERS To: 7 addressees CC: 3 addressees Subject: EPA REGION I11 ECOSYSTEM ASSESSHENT OF DRY RUN CREEK 06s. i 0 Epos 7 Fv1, THIS EPA, MPOHRINLIANDGE,LPHWIOAO)DY FOIRREALBAONUDTAANDHA[LFMETHOUWRITHTOSARREAVIECWASPHAERR (REGION I11 PLANS TO OBTAIN SCRAEMEPKL.ES TNHEEEDEPDURTPOOSECONOFDUCTTHISANASESCEOSLSOMGEINCTAL IRSISTKO ALSOSOEKSSFMOERNTPOOTFENTTHIEALORY RUN CTOOXNITNASMINWAHITCIHONMAIYN BTEHEREDSRYPONRSUINBLCEREEFKORDRTHAEINAOGBESERANVDEDIDDEECNLTIINFEY APNODTENTIAL APSHYASIOSLOOUGRICECALOFABWANTOERRMALAINTDIEFSOODI.N CATTLE WHICH USE THE DRY RUN CREEK AREA SARA FROM AND A TODAY TEAM OF THROUGH 4 TO 5 FRIDAY PTOEOPCLOELLWEICLTL SABEMPLIENS THFEOR DRTYHE RURNISCKREASESKESASRMEEANT. WSEOMEWOUSLADMPLREESCEIWVIELLABECOPTYAKEONF OTNHEDUDPATOANTREPSRUOLPTESR.TY A(NADS ASNARAASIMDEEN,TIOSNHEEDALTSHOAT PPLEARNFSORTMOEDSAETNDMIUSCHISGOAMNE SITNAFTOER.M)ATION ON RESULTS OF COW TISSUE ANALYSES SSEADRIAMEPNRTO,VIDWEADTEMREAANDCOBPIYOTOAF (AANDIRMAAFLTSPWEOCRIKMEPNLSA)N FFORROMCOTHLELECDTRIYNGRUNSOICLR,EEK. AADDCIOPTYIONOAFLTHIINSFOWROMRAKTIOPNLANNOHTASSUBMEMEANRIZSEEDNTITNOTHTIHSE ANODTDER.ESSES AND CONTAINS BDARSAEFDT OWNORKOURPLADNI,SCULSISSITOENDSBTEHLIOSW MAROERNITNHGE WTIYTPHESSAOFRASAANMDPLIANGREVWIHIECWHOFWILTLHEBE PTEHREFSOERMSEADM.PLESV.ARIONUOST ATLOLXICSIATMYPLEASSSEWSILSLMENBTESTAAKNDENANFARLOYMSDEUSPOWNITLLPBREOPEMRADTEY AONND EXACT SAMPLING LOCATIONS HAVE NOT YET BEEN DETERMINED. - OBTAIN FIVE SEDIMENT AND SURFACE WATER SAMPLES FOR TOXICITY TESTING. - UFSAETDHEAFDORMITNONXOIWCSI,TYEATERSTTHIWNOGR.MS AND "HYALELLA TO BE ~ PERFORM BENTHIC SURVEYS WHERE SAMPLES ARE TAKEN. - WPAETREFRORMSAMEPLLEICNTGROSLHOCOACTKIOFNISS.H SAMPLING FOR TISSUE ANALYSIS AT SURFACE - OBTAIN FROG EGGS FOR ANALYSIS OR LIVE ADULT FROGS FOR BREEDING. - COLLECT GRASS SAMPLES FOR ANALYSIS. - CWOORLKLECPTLANS)MALFLORANTIIMSASLUSE A(NDAELEYRSIMSO.USEEAXNADMINMEEADJOAWW VBOONLEESIAMNPDLITEEDEBTAHSEFDORON DISCOLORATION. - UPSOETEDNTAITAALOBHTEAALITNHEDEFAFBEOVCETSANODN AAPPRLOBYINT,O RAEDF-OTOADICLHEDAIHNAWMKO,DELANTDORAESDSEFSOSX. ST ADRAIDINNTDISCEAETEDTHITSHERMEENTWIOOUNLDEDBEINANTHEATTWEOMRPKTPTLAON.CATCH THESE ANIMALS BUT w : THE WORK PLAN CONCLUDES WITH A LIST OF QUESTIONS, WHICH THE STUDY IS DESIGNED 17 TO TESTABLE HYPOTHESES, HELP ANSWER. OR COG 35 EIDO17891 73 000589 * Potesta & Associates, Inc. Telephone: (304) 3574990 Engineers and Environmental Consultants Fax. (304) 3574988 TT UniversityofCharleston,CoxHall, 2300MacCorkleAvenueS.E., Charleston, WV25308 July 28, 1997 +2wnertnzuekoorv,e Mr. Daniel Weber Senior Engineer E.L DuPont DeNemours and Company Washington Works, Building | P.O. Box 1217 Parkersburg, West Virginia 26102 Sub 35s Dear Mr. Weber: RE: DRuepsopnotn,seDrtyo ARfufniliLaatneddlColnPsterrumcittiAopnplTircaadteisonF,ouFnodraUtsieonatcoPumbmleinctHseaornintgh,e Trades [was asked Foundation to offer my regarding thoughts on thefourcomments made the Dry Run Landsill draft permit. by the These Affiliated Construction comments are offered gweintehroaultirnensaetaurrceh.inMg ythfeirssptetchiofiucghftediertahlatanDdu/Poornsttastheoustladtuntte oarteremgputlattoiorne,spaonnddatroetihnetseenqdueedsttioobnes iatnttehgerihtey,arwihnig,chbuwtillletbteheadadgreenscsyedainnswtheeratgheenmc.yT'hsefsoermaarleraecscpuosnasteiotnosctohmamtecnhtasl.lenge the agency's COMMEN1T aTchceorddraanftceawliltohwsstaftoerrengeulwatliaonndsf,iallndonsttaotpe sohfouelxdisntoitnagl.loTwhea leaxnidsStiilngonltahndefairlleam,uwshtibceh icslaolsreedadiyn impacted as is indicated by the elevated fluoride levels. backinTg"hoeffaacinleitwycheallsonnotobreaegnacinlsotsaendeoxuits,tainngewceclelilniostbheeirncgaasdesd.edT.hTehree sitsanteobaprsoahlilbiotwieodn a"gpaiigngsyt rite.guTlhaetidonisrealcltooiwsrbgeisvteenngaignreeeartindgeajludogfefmleexnitbsiltiotybteomcaondteroolnifnadcuisltirtiiaels swauscthesa.s tThihs.e cTohdeeeaxnidsttihneg aernecaohuarsabgeeesntchoeveinrfeidltarantdigorn aodfedraainndwahtaesra, nwehxiccelhlernetssulttasnidnolfevaecgheattaetifoonr.maIttisonno.taAnsoptehne hnoelwetcheallt oefxpEannvdisrothnemelnetacahlatPercootlelcetcitoinon(sDyEsPt)emhawsillapsperrovevetdhetshaemuesepuorfpothsiesassyastleinmerfosrysftuetmu.reTghreouDnidvwiastieorn c tprhoete1c0tyioena,rssoit iwtislhlotualkde steorcvoevaesratnheadoelqdufaatceilciatpyowfitthh ethoelnd efwacicleiltly.anTdhaesosoncliyatneedgaitmipveerivsisouueshlearyeeri.s : 000: 30 EID052803 , Mr. Daniel Weber Page 2 July 28, 1997 IfIT occurrence. uTndheersretgaunldattihoensfascptescciofryrewchtalty,atfhaeciflliutoyriisdetovdaoluwehienntmheongirtoournidnwgawteelrlswasshoawoenleetviatmeed levels. [would assume that the agency and the company are following the procedures as required. Ifelevated fluoride levels are shown to be a problem, the appropriate action will be taken. Act is encouraging DuPont to move to a "green fields" site for the new cell. The agency slhogoiucladlleyncboeuirnagtheetsheamuesepoflatcheotsoeaefxfiescttitnhgeibnedussttrcioanltrsoiltepsotsositbhleed.egree possible. The waste should COMMEN2T. Additional treatmentofleachate to mestwater quality limits. `The available information on qualityofthe discharge into Dry Run is based uponthequantity and quality of the leachate, as well as the efficiency of the existing treatment system. Those performance levels cannot be used to estimate the effectiveness ofthe new system. The new system, `with its larger area and baffled aeration area, is expected to have higher removal efficiencies. In the event that the limits cannot be met, DuPont can eithertruckthe leachattoe their plant on the Ohio River (I to the ex assume they ha apv ermeit modification in place isting site. Thereisnoproofthat the new system to allow will not this) meet or add additional treatment the limits. The bottom line is DuPont will have to meet them or apply to Environmental Quality Board (EQB) for a variance for Dry Run. It is a compliance issueifthey fail to meet the limits. COMMENT3 Limits for fecal coliform, boron and formaldehyde. The director must first determine that these materials are, or may be, discharged at a level to contribute to an excursionofthe water quality standards. The director or his representatives have reviewed the information and determined that they do not need to be limited at this time. The agency should evaluate the effectiveness of the new system and, if additional limits are needed, modify the permit accordingly. Thereare boron or formaldehyde. EPA suggested am nowaterquality standards promulg bient goals are not regulations until ated by adopted the by EQB for the EQB. `The inclusionofthese as limits are discretionary onthepaorftt he agency. They can be added if they are felt to be a problem. COMMENT WET testing on 2 continuing basis. Potesta & Associates, Inc. : [IEREEY EIDO52804  Me Daniel Weber Page3 July 28,1997 `The agency is requiring the initial whole effluent toxicity (WET) testing on the facility. It Iistisstaanwdaasrtdeoprfarcteiscoeurtcoedsistocornetqiuniuree sthuacthrteeqstuiinrgemwehnet,n isthdoouelsd ntootxiacpiptyeabretsohboewanpnrootblteomb.eTahperaogbelnemc.y tchaen aetffalnuyentt.imeSthaokuelWd EthTteeasgtesoncnythdeeecfifdleuetnhta.t tTohxeiciatgyenicsyacnanisrseuqeuiorfecDounPcoernnt,tothdeopWerEmTittcesatns obne `modified to require it, but to require it where there is no history oftoxicity problems is useless. Tam available to discuss these issues further,if you feel that wouldbe helpful. sus' LEMsrs ce: Mr. Ronald R. Potesta Mr. Mark Kiser 7 J Zz Laidley Eli McCoy : Potesta & Associates, Inc. 8 000nsn EID052805 oo 74 009585 CONFIDENTIAL C AnticipaDtreydRuQnuesLtainodnfsill-- TaFsIkNALTea(m1/29/97) A. Genmeral Information / Physical Features / Operation 1. Wchoynstwrauscnt'etd,a alnidnewrhyinsistaltlheedWVwDhEe?n mtahkeinlganydofuillinswtaasll one now? (Quoted material is from the draft permit.) TRheegullaatnidofnisllofper1m9i90t apnrdeda"ttehde dtehesigSnolirdequWiarsetmeenMtasnagofemetnhte SWMR a1rlaendnfoiwllbeitnogiimpnrcoovrepogrraotuenddwianttoertphreotdeecstiigonn..of the Dry Rum 2. How long will you be operating the landfill? Por the foreseeable future. | 3. aWhneonthetrhearceuar,reaotpencelalnotisherfulcle,il?vill you expand the landfill to Deceocniosmiiocnaslabcoountsideexrpaatnisoinosn ainndthtehefurteugruelawtiilolns/dreepqeunidreumpeonnts in effect at the time. 4. Why were those new tanks installed at the landfill? TTohiscolplreacctticleeacishatreequfiorredtrabnysptohretSttaotetheinSitthee ifnotrerdiimspousnatli.l modifications required by the new permit are completed. 5. Wahsathe'asbouhtaulalilngthtehewiwnadsbtleowdnowntratoshthtehatlacnodmfielsl?off Boso's trucks dAlilrttfrurcokmseaxrceavactovieornesd,duwriitnhg cthuerreenxtcepctoinosntroufctitornuckactliovaidtsy.of Btlhoawtinwge mcaatnerfioalllowi-supu.nusuPalleas-e- cwael'ld 8l6i3k-e20t0o0.be contacted 80 6. mWoharte asbeocuutre?illegal dumpings at night? Why isn't the landfill OPpreortaetceteddobnylyldoucrkiednggadtaey.lighNto shocuhresd.uledIfaycotuivwiittyneasfsteranydark. activity after hours, please contact us at 863-2000. 7. oIftheyrouldaondfsiulclhs?a good job, how come you had to close down your LLoectaalrtl-a-ndfTihlelam-o-unrteacofhedplacsaptaiccitwya.ste being landfilled has dceocnrseoalsieddatoevderfortheecyoenaormsi,c and landfill reasons. operations are being Cadet EID0g1089 2 {general formation, continued 8. Aacrteorysoutghoatingusetdo stotargto delusmepwihnegrei?nto Dry Run some of the bad only Run. nomhazardous solid waste materials are landfilled at Dry . 9. Why were materials taken to Letart in the first place? Teflon* because wastes of the wpoetreentsieaglregatatetdhe ftriommeotfhorera walsatnedfmialtlerfiiarles rinevsoullvteimnegntfroofm Ttehfelodni*spowsaaslteofinhoatlpaonldyfimlelr wfaisrtee.hadThtehe potential to is no longer release dangerous landfilled, there ifsumneso. lonSgiencreahnoteedpoltyomesregrwaesgtaete the Teflon wastes. . 10. What determines what is landfilled and what is incinerated? Tawnod hfaancdtloirnsg.primFairrsitl,y wiintfhlueonucrewatshteedmeitenrimmiinzaattiioonn: effpoerrtm,ittwieng prIoycetsosraesusemucohr nreocnyhcalzeardwohuastevwaesrtewemacatne.rialNexats, pwoessitbrlyetothat is . abcocielpetrab(lAePB)andsopetrhamtitwteedcafnorrbeucronvienrgheiantouvraluaeltefronratpelanftuelsteam npereodcse.ssedFintahlrloyu,ghnotnhehaAzFaBrdoaurse wlaasntdefilmlaetde.rials which can't be 11. Leachate a. What is leachate? Any liquid that might have contacted disposed waste. b. WWhayshiinsgttohne WSotraktse rfoerquidirsipnogsatlh?at yWhoauttirsanstphoeritr cloenaccehrant?e to mTohdisifipcraatcitoincse riesqurierqeudirbeyd btyhetnheewSpteartmeitinartehecoimnptleertiemd.until Tshuespecnodnecdernsoliisdsa,bouatnd subcihochceomnidciatlionosxygaesn idreomnancdontienntu,nlitnoetdal lthaendfgirlolundowpaetreatriotnos.theThgereaStteastte iesxteinntteproessstiebdlei,n panrdotweectianrge complying. . . s3 EID081090 : BLLDRERY EN C Leachate, continued c. How long will you be hauling leachate out? Wies dcoonm'ptletken.ow -- at least until the new permit comstruction 4. Do you have DOH or DOT approval to haul leachate? Trheequiorpeemreanttisonfofrorhhaauulilnigngnotnhheazlaeradcohuastemamteeertisalasl.l SStuacthe croemqpuliiraenmceen,tseticn.clude licensed drivers, weight limit e. I saw it leak out on the road: did you report the leak? MNaoterreicaolrdhoafuleadnyisleamko:mhavzeahridcoluess. inHsopweecvteerd, foifr cionntceegrrnietdy,. : let us know. Call 863-2000. . Is your contractor licensed to transport the leachate? MAleseot,s aclolntrraecqtu,irenmoetntcsommweirtchiianlhihsauleexri.sting PSC license. B. Black Water Issues 1. Why did the vater turn black and smelly? Tbheiesn wraessoalvetdempfoorraraypprsoixtiumaattieolny (tawboouyteafrisv.e moTnhtehsc)olotrhatandhasodor wseurlfeidcea.usedAerbaytitnhge ptrheespeonncdesof-- itrhoantsuisl,fidbeubbalnidnghydariorgetnhrough rtheeappweaatreerd--sinecleimaienrataetdionthbeegcaonlorinaJnudneodo1r9,95.and they have not 2. What effect did it have on the ecology of the stream? nFergeaqtuievnet simtpraecatm osnurvtheeilwlialndcleifheasoprrovveigdeteadtinooneovfidetnhecearoefa.a 3. wIef byeou'svueremeysosuewdonu'ptimnestsheuppasatgawiinthinthsaotmebloatchekrwawtaeyr?, how can Wleandafriellcontofidceonmtplythwatithournewworrkeguwliatthiotnhse, WViDnEPcomtboinuaptgriaodnewittheh . Sitnactree,asewdillroeunthinaencesurthveeiolvlearnaclel (ompoemriattoriionng)ofretqheuizfeadcilbiytyt.he . g . 065.2. EID01091 te c. contents / Materials Lanmdfilled 1. bWehiatngcpalracicneodgeinns,thehaz*adrudmop?us wastes, toxic wastes, etc., are mThaeterliaanldfirlelquiisrinagnosnpheacziaarldohuasndlsionlgidisw,astase wleanddfeislclr.ibedThe only etahrolsieerd,iraescbtelsytoesx,powsheidchtoisit.conHsoiwdeevreerd, aapsobessstiobsleiscaracihnaozgaernd to opnrloypewrhleynanitd bisuriiendthoer aweitr, anidt cparnesebnetsinnhoalehda.zardW.hen handled 2. pWhaartameetlesres?is Wihnatthaartenl'atndfyiolulretphoarttiinsg?mot om . the list of 19 mWeustdisrpeopsoertofthoeinrlyamtohuonstesmaatnenurailallys; swpeecairfeiedsubijnectthetpoermit; we uopnearnantoiuonncse.d inspections by the.WVDEP to monitor landfill 3. gIosintgheirnetofeDrrtyilRiuzme?r or other chemicals in the landfill vater 2CodndsifsetretnitliwzeirthfSrotmatetimreegutolattiiomnestoandestraebcloimsmehndvaetgieotnast,ionwe do growth. We use no pesticides or herbicides. D. Toxicity / Other Harmful Effects 1. Is the antifoam additive toxic? Nsop.ecifEiCc-a2t1i0on(sA.ntif(oMaSmD)S sisheeutsedis ionnacfciloer;damnicneerwailthoimla.n)ufacturer 2. Iisn tith?e algae poisomous to cattle if they drink water with algae The algae are not harmful. . b(lRueep-ogrrteefnaxaeldgaferobmloHoasmketlhlatLacbaniscauonsefilleetharlegaporidsionnginfgr;eshmoswtater pFruorbtlheermmsorree,porittedishalviekeolcycutrhratedthiinsnoqrutehsetrionnpwlaoiunlsd bsetataessk.ed . cfornotmactthsisaplegrasepeicntitvhee: str"eIafm,lewaocuhladtethferopmolyoluurtedlaanldgfailelin the stream be toxic to cattle?" Suggested answer: To-date, bmeetiwteheenr tthhee DlEaPndnfiolrltahendEpPoAorhasaniemsatlabhleiaslhtehd.)a connection : L0GPOR0. 3 EID081092 s- D. Toxicity / Other Harmful Effects, continued 3. cIsonttahemignraotuenddwgartoeurndwnaetaerrtgheet lianntdofilmly cdornitnakmiinngatweadt?er?If so, will (Quoted material is from the draft permit.) ADuprnoyanlyRsguirnsousnoidftweaqthueaasrrtmreoertllaytcigavruesoeudtnodwabaatscetkragtrdioastutanidca*glhrlaosyunrsdiewgvanetiaeflriecdantthatimptahcet concentrations. 4. cIsomiintgpoosustibolfeyotuhratlasnodmfeilclhemaincdalcautshiantgyohuarmd?on't know about is Iftorisa lunalrigkeelnyu,mbesrinocfe ptohessipbeirlmiittiersequiinretshe.qluaanrdtfeirllly In addition, we do several nonspecific chemical and slceraceheantien.g biological ootrxegystagsne,incmdeocmnaarinbtdoo)nr,si)n.gCODsuc(hchienmdiciaclatoorxypgaernamdeetmaenrds),asanBdODTo(Cbio(cthoeramlical Wliatndhfirlelgaorpdertaoticoanusiisngchaaursmi,ngweharhma.ve on vegetation or wildlife. Wmoe heavviedeonbcseertvheatd mtohe impact W1e993c.onduThcetedrestuheltsStwaetre'eswistthainndaredstaacbultieshetdoxilicmiittys.testing in S. dCeagnratdhee ntoonhoatzhaerrdotuhsinmgsatetrhiatalscoutlhdatbeyomuorpeuthaiznarydoouurs?landfill M(attheartiails,s bpulraiceedd gion observed to degrade tthheataonxaeyrgoebniccanennovtiropnemneetnrtatoef) ahalvaendfbieleln extremely slowly. Excavations at mumicipal mlfaoatoneddrsfitiaullflsfsshtahtvaheatt uwenhcapvouevterseiudnrtvoisvuecthdhe iiDtnetrmaysctRausnfornLaenwddsecfpaiadlpelesr.sareaTnhdatevalreiasotusas dtruehrmeaaybilnweo.utlodo Iaflpopwaenaytrodbseeogrdsaeldtoarwtilimyoennttpharalot.dutchtesirfcoornmceednttrhaattiownesrewohuarlmdful, 6. Alraendftihlelr?e hIafmfsuol, bwhaecrteeridaoesinitthecowmeatefrromdisc--hartghee ffriolmtertchaeke? pbWeeermchiahtveeckrineoqnugirrfeeoasrsonmtohantttohlabsyelmwieoelnvlietoatrshiantogthtefhroerrpeafreiascmaaeltepcrrosol.bilfoermm., Tshoewen'elwl 009:h2E3: EIDO81093, i "6 L D. Toxicity / Other Harmful Effects, continued 7. W1hayndfdiolnl'tanydouwhtyellyoue'vreeryosnoewoarbrouitedthaebouCt-8 itc?oming out of your goCuo-r8v',erTneomrfelnaotmnm+oaganerineucamy.,peADrulfPtlouhonortuogohccotnCa-tm8rooalitsse,intotivsorlaeugnsutulararftiaelcdytbabnyetcaaunusyseed in of oteuhxerperhliieegvnheclesinwdtieettrhenacltheadnsdtalantidnagtrhdeist.laatnBdfatishleeldPloaanrneto,unrowte4h0aaryrmeefaurclso.nfoifNdoent(11that effect in our employees has been observed to-date. Atdodoitailoanramlinginffoorrmtahteiongenfeorralourpubulsiec:that may be too detailed or oIfrgaC-n8wwoeurled bteo htaheveliavenre.gatWievehhaevaeltcholliempcatcetd, eptihedemtiaorlgoetgic data oloafneniamcolahuilarvteerceamrtcpcoalinoncytoeehgereesnWi.VsoDvEenPWro.ehtihhgaevheelrirfeetphooafrnteetdxhpeetcphtleeadnp.tr,eseCan-n8cde itoshfeaCiowngecaikdiennctehe . EB. Filtercake Issues 1. What exactly is filtercake? vPfarisoltmteertcbhiaeoksesoiltiiesdsaw,ascmtoienccrveoanottrergraatnetidrsemafstomremfnrtoofmpltsahlneutd.gveasttIethatwiastiescromrpetomroseveaedtdmeofnt plant, fly ash, and water. It is different from sludge in that excess water is removed and fly ash is added. Tmhuenicciopmaplonewnatssteofwatfeirltetrrceaaktemenatreplsainmtislarandtocotmhmoosenlyproediutcheedr by disposed of. in municipal landfills or applied as fertilizer. 2. Wshtayrtdidtaykoinugstitop todistpheosNionrgthofwesftielrtnercLaaknedfiilnl?the landfilland mTohdiisfipcraatcitoincse risequrierqeudirbeyd btyhetnheewSpteatremitinartehecoimnptleertiemd.until 3. How much filtercake have you put in the landfill? tons: 1994--568.57 1995--3,888.27 1996--3,952.81 4. How long did you dispose of filtercake in the landfill? From late August 1994 to mid-November 1996 I i 000.27 EID081094 } 000.:00 75 . snare mesons -- ---- - . (AN) 7CAy ---- ssoakn5i. SaprenRgeer, PmoD. ao 0-8 rion wisMieIchacSeolnesTu.eneHrE ozronne,e wiPmh:.iD.at nesponse sens ae orfEincveicStoneEnatearlseRneysponhsemTeesn cSaentnetrer 08a. 0c USFW 0579 TAOFBCONLTENETS ESFORBABLES o. teeter USTORFIGURES o sw SECTION e vii TECHNICAL APPROACH. SUMMARY OF FIELD EFFORTRESULTS,AxDPRELIMINARY RISKSCREEN ....... 10 INTRODUCTION . ER PPPS eee BO Ia BE estate RC reer eeeoeeeenn MEMODOUOOY : 21 Soil Sampl eosin rr enone ' 3 39 S Smaae irnt gSm une g.S ....ao ...p...l ...o .e. g SerrrrrrtcrreT innnaT . "ol 34 BS Del Vee Wl Sigg BlogSumpley oes . BL SmMamma Snay 352 VesewioaSamplag Bo 333 34 FAdCioelMmactreoanve.se.t.ra.e .Su.gi.i.g................. TelyTeg Td 28.1 362 Eteeniafoceeidaa((pBivaortTTtooxxiicwictT yoTere wms).s..s.c .e . 37 Se3o6v3lasPEinmipplreesnpDroenceomMaimiscosTionx.i.y_.. Tes...) FE Satt Operating Prose s a Domematon 5 383 383 SFuealpdlSeaPmapclkianggiosgo,tSAhispmaain,TSoresg,tPreaseva.ion,.wd.Handing 3 Be Mellmdiey 30 RESUL TT J HE TSe..n.s.o.l...a.n.t...dimen ArT as D 6 BB eT 6 0005 USFWos80 302 TALMetls. Loon soniye 7 313 Pesicides/PCBs srs sere bbhtss pats 3 314 VOCs ..... crgonnens srressretitsiese 8 5.15 ToulFluoride sobeser stearate. Le 5.6 Orgasofivorides snsseerpessias cs 3.1.7 ToulOrganic CarbonandGrainSizeofSoil20d Sediment... 10 38 WaterQuality PAAMESTs eee 10 3.19 Bovine Fecal Samples+ -...uiniiiii ieee IO 32 Biotic SamanpdTislsueiASAlnYSiSg o.oo... eeittiiieii 10 32.1 Beathic Macroiaverebrat+e+s ... +++ evunii ees 1] - 322 MABEL. 2 323 Fan... . ssrrresssvesatstsacennun rnold 324 BARWON ....iiitniiiii ie 13 325 VeRRHOR...... iii. 1 33 Hiswlogicalassayofsmallmammalliverand kidney ....................14 34 TORRY TERE eeveeee eee eee 14 40 SUMMARY OF PRELIMINARY ECOLOGICAL RISK ASSESSMENT SCREEN 15 500 DISCUSSION ...oiuueeeeete teat ee eee e eee 1S SECTION It 10 20 ECOLORISGK AISSCESSAMELNT .......................eeeu. 16 INTRODUCTION .... rorrrssvesitrristtees snes aunssine BE LI Objective ovine srorsevone 16 12 Sie Background... rrreresssrtstersacsinncnselh PROBLEM FORMULATION ......iiitneiiiinnniiiiia., 16 21 EcolRioskgAsisescsmaentl srrrrssvorass erste assna dh 22 idemoifthfeCointacminaanttsoifCOonGenrD. ........................17 23 Exposure CRAREIEAZANOD oo... oeiii eis tl 24 HazardCharactToexicritiy AzSaSEiSSo:n/ +... ..................17 241 Fluoride . errsssvrrres cost opassnsall 242 OMEROMU+O..R.AES evita 1B 243 AWRED oele 13 244 Amenic sertsssrrrssssarbbs betas paesrans sed 248 BeylUm .eiii 19 003505 = USFW 0581 22476 TE CCoorpomyiug, me S tren, .- tt SE0 FL hae Mig, C e re, "eran, 1 a,e 28 25 EP1432 iNangyg zg CC ee e Ce Cre cen ER ey - 26 tt pong re a2 2.8 S ,y tegeTC netee , Creel tires 29 S em 251 on Cee CH Heren,, Trt 292 phipog Sl y yaliesg SDRerpreesegl, ATT rea, te. 26 OfBeas. averteprycgeye.29 293 Fatheay`.Mianoy, Pim 4 aps Amer py Te rgfa ephayy, Promeias) oRepre senta, of FishComa ' 256 = oT -- omcating gigsp,i 29 S 298 E ny 299 Short.sgjeq Shrew Blarina g b 5 as J <0 2910 SAIFur MMaemrmya, ce VE Cne "eres (bic, Parneviicaucgy a Representa,of -. 37 ectivorey "FlToS gpr,om, en Ce rl Rebresenaive oRy EHeTrbivore, Tree Cee ell Tree ea 0o404 42 Organofivorides Ce ee . a 43 Aluminum . sorortearreottts pa snnes El = 44 Amemic Ce - ca 45 Beyllivm..... aereennnn rest g a 46 Chromium .......iiieiiiiinns - rea 47 COPREr eine eds 48 HOB ilies 49 Lad . 4S 410 Manganese freer 46 411 Nickel oon 46 G12 VAG. d6 a1 zis . an dT - 5.0 RISK CHARACTERIZATION .....veiiiiniiit iii. 41 5.1 Benthiclavenebrate Community Struc and Function ..................&7 - 52 Soil laveCommmunistyeStrubcurre anad Fiusieon .................... 4 53 Fish Communities a 48 54 Wormeesting Birds oo. .iiuii ie " - 5.5 Camivorous Birds 88 5.6 CamMiammvalso(Temr esiciollyu feeds i0g) .........................48 57 PIGiVOroWSMAMAS eit 4 53 Omaivorous Mammals ............ err 49 59 losectivorous Mammals iii kl 5.10 Herbivorous MARAIS iit 49 60 UNCERTAINTY ANALYSIS ................. . Ce 70 CONCLUSIONS .... a 50 7.1 Benthic Invenebrate Community Structureand Function ............. 50 72 Soil lavertebrate Community Structureand Fuoction ....................5%0 73 Fish COMMUNES .....evttiiiiei LLL SE 7.4 WOMmeMing BItdS outta SL 7.5 CamivorousBirds ..... LS 76 Camivorous Mammals .......... SPR st 77 Piscivorous Mammals ........... rrr 8 78 Omaivorous Mammals ..... = ee cst 089.25 USFW 0583 30 TTooo ecroors Maammmgy CUT, summary. Te Cree APPENDIAX to 2 5 Srl MaDuma Sa he APPENDI5X Tee . fore Reger APPENDIX Te Tory Testing Repos APPENDIX p Te a FldNaes APPENDIX Sisied Anas ttt . Ce 069.05 LIST OF TABLES NUMBER IOLE : Conesaion of BNA's a Water 2 Coneesaionof BNAa'Sasl. 5 Concenuionof BNiAnSi'ness . Concescaions ofMeaaWlesr s ReofCosnsesnsofMeas iSi c Ress ofCoscenaionofMeiaSelinse ' Ress of he Analysis fo PeicideilaWPaCteBr . Ress of he Ansys fo Pesiide/PCa iSoil 5 Ress of Assis ox PesiidinrSePdiCmeBac . 0 VOA CosceataiaiWoanrs u VOA Cescesaions i So 2 VOA ConcessiniSeodinmesnt 5 Coneenaons of ForindWaete i Conceneaions of Flore iSoi is [EY p-- i Ress ofte rgano-fuerice AsalyssinSediment " Concerns of TOC i Soi EB Ress of heAnsys or Grain SieinSil Conceeuions of TiOSedCimes 0 Resuls ofteAnsys for Gran iein Semen u 1a Sin Water Qual Parameters 2 Concenstions of Bromide, Chloride, Nite, Phosphor, and Safe in Wate [IL USFW 0585 23 2 CConcentrayign, Of BNg:s @ ts fp 2 FecySample Fel Sy, Conerg 2% Frequenc, yOf Fluorige. 8 Fecyy,Samp 27 ang.Abundage, OfBenge les Ar 28 Conceatryjon, Of Mery. ey Concentygign in SengMammy PH Cott, efyFluorMigaez@zSyay1pM,,azzy,, Fl 2 Comet Pe TPiTti Fiige Tig 3 FECOfotpteyy Fi Tig 3s CFPECf oep n or PToALriMgerEoEnsvo Tie is , Concentrao Eton Tie rie ECoPneCntorntiotgn,oOffPMege;inVegVetearigan WhRecut of hoenpPlt Tig, ite-foooforfeiqToMoruaspeyg)TeSsctreRenenu Merton yi, ts yg, Mon ju Clon, 0 Wet Wega Tue, 4g = N fan oy NUMBER ' LIST OF FIGURES me Sampling Ste Map. [RENE USFW 0587 SECTIONL RTIESCKHNSICCRAELENAPPROACH, SUMMARY OF FIELD EFFORT RESULTS, AND PRELIMINARY 10 INTRODUCTION 11 Objective TAhgeesoebyjecRteigvieoonfIThisRpermoovjalewcPartsotgorapmroivnidceontdeuchcaiincagl 0supepvaolruattoitohne oUf.Se.colEoagviicraolnimekasiarloPmrfaegcieodn oCfonaamseifiltli.onTohfeseofl,orserdeismuelce,d ainndthweactoelrlaetcuaownoorfksionig,bseeedfiptraotd,ucstuirofnacferwmtelroc,ataeodddboiwo gsraamdpileeess pfroriscmoanytagmionaalntofantahleyspersoj2e8ctd swoel,ss0e:di1m)esd,e2n0dyscuorfnatcaemiwnaatnetrsfporresleacbso,ra2t)ordye(toexmiicniye etshtinxg.tcThoef Conamizaion. 12d 3) produce a ecologicalriskassesment based 0 te collected aa. . 12 Sie Buckgrowd a"onTfhdtehhesietfeaUir.smSa.bwaEsoPrfkAliaenldglbaeeugemifenprgrotouhdasutcccotominpornlaamfiiaonsranwlsioacdaetbebdeieinWaegWsdatissVkciihrngagironginea,dDfWoeomopdaanCroitundnuoysft,rNiWaatlYu.lraanldTRheesooouwwraoceseeds pbryihmaeryDusPoourwcteocforwpaortaetifoonr.hii ocaDtrey,RuTnh.e fDarrymeRrumn afliowssttraotunguhmeherofuasrmeear'tss,probpieardtayesasa,d b1s23d oditshcehrarugneudsuialolDlreysReusnorbsoemrvtehde iDnubPiosobterldaanrle.reIcbyas aalrsboubaebenlere(p0orhieedcaoncamfisnana'nsd wiiltdlairfee celaltse.ave also occurred i te area, whichmaybeassciaied with the brormaliis observed ia he 20 METHODOLOGY e"Tchoeloagipcparloarcihskusaesdseisnsmteinstsdo(cUu.Sm.entEPfoAllo19w9e7d).curBaa:sedU.So.n EhPeAprgoubildearnaceffoormudleastiigonninpghaassed ocfontduectriinsgk assssseessssmmeenntt. deAsis,rechaeingf-ollelvoewlinEg RfAedwassudcyondwuacsiedcoandkuectetdhetfoieplrdoviinvdeestdigaaationne,ctaesdlifonecodmatpsle0t0e shiee icnonthaemicasualie,onhawdasbeaevnairaebpolreiperdiporrio(0r htoeiesfoarc.ivaNtuimoenrous ish and wildlife kills, in addition t problems 20 Soil Sampling Saruerafa(cFeigsuoirles1a)m.plSeasmpwleerearceoalslewcetreed satel4ecseadmpblaeseadroensdailsoanngceDrfyoRmutmheaandsinfonoewtraelflerenacne asapee 1h0eidsterneatmabecdo.namTihnraenescroepnlcieciatceatsiaomnplgersawdeer.e aSkaemnpliinngeawcahsscaomnpcleinntgrawteeda.inReeplmiecaatdeowsasmpsllionngg lfoorcasiaomnpsliwnegrethdreotueghrmtihneeudsebyogfr3idrdainndgotmheumsbameprlsinagblaer,eaSaanmdplrianngdogmrlidy ncohdoeossiwnegethdreeeicgirmiidoseoddbeys using 4 random sumbers ubie 1S0u9rfa6ciencshoeissoafmpthleessowleraecccoorldliencgte1d0 uEsRinTgC2/dReEcAonCtaSmainndataerdd sOipseirlaetsisngtePlrorceodwuerle o(rSOsPp)00#n20f1r2o,m Shiel Sampling. All oi samples were analyzedfo ol organic carbon (TOC): gain sae: ges aie ' o0 in USFW 0588 cliostmp(oTuAnLd)s;metTaClsL; vToClaLtilpeesoircgdaneisc/PcCBosm:pouTnCdLs B(aVsOe,CS)N,eurtaol,l 12d Acid fluoride, Exracuble (BNAS) and organofiuoride cinom0pouendasr.woArddmit(iooKniaclHYsi(lexw.asAcovlelegcetueaddofnrosmamtpelesawmapslealosoodke eclnoseasttetxochheofsttreeasmoiblesdafmoprliunsge zodes 22 Sediment Sampling 2S0eddiamneentarseaampilneLseeweCrreeecko.lleSciaemdpalearseaamspwleeraerseealocsuiesdiebaisnedDroya Rduiss,inocneefrreofmertenecelasndafmipllleoauvela, dienpaonsiatinoenmapleroeasidaelnoinfgy tahecosniarmeiamnabnetd.conceauraion gradient. Sampling was concentrated 1 te `AAlvlesaecdhimseanmp:slaemspaltiinong,wsaesdicmoenndtucwtaesdcaoclcloerideidngfr0omEtRheTCo/pREiAnCcheSsOuPsi4n2g0316c,ecSoendaimmiennastSeadpcloiwnegl.. d"iThveidseadmpilnetowtahsecaoprparpoopsriiadeisiaomapldeeccoonntaaimoienrastefdoSr-cgaacllaoincaslisalzeaslsysees,l bucAkdedti,iohnoalmosgeedniimzeendt,waansd - `cHoylalleecltlesdsitnetchaewrheofleeresnecdeimaerenat,bTioraisbsuatya.ry A, Trbuuary B. Area I, 10d Area IV, for use ia 3 23 Surface Water Sampling Ssuarmfpalcee wscaattieornss.amplSeusrfwaecreewcaotlleerctseadmaptlleoscawteiornes wcahlilcehciceodrdriersepcolnydeidstto etawcoh oLf-lheerspeovleynprsocpyileenne VboOulCe)s faozralmyesaeslsasanpaelrysEeRsTaCn/dRnEoACI-SlOiPe 4gl2a0s1s3,boSwulrfsac(oeFWoartgearniScam(ip.l.i.ngB.NAWSa,tePsesstaimcpildees/PwCeBrS,e choelescaimepdleprr.iorOtnoecoslalmepclteiang esxecdhimleonctatsioanmpwlaess faendreudpsttrroeuagmhof30a.n4y5smtriecarmondi(suumr)dafnlceesicnatuesedfieblyd wpreiroer atnoaTlyAzLedmuenafllseraendal.ysiAsl:laslumtphleesreamzaailnyiznegdTfAorLmmeeaallsswesarmeplpersesaernvdeadllbyheadodrignagni4c0spaemrpcleenst nTiAtrLicm2e6adluaanalayspisHwoafslpersesBearnve2d ianftehretseamspalmepwlaeswaobsiafnierde.d.ThAellfsiurrfeadcesawmaptleer ssaumbpilmeisedwefroer bsruobmmiidtee,dmfiorcaT,ALsulmefaal,s,andTCphLosBpNhaAtse,anTaClyLsesP.estAcdiddiei/oPnCaBls,saTmpClLe VwaOsCsk,ecnhloinritdeh, tfelfoerriecnec,e aprheaas,eT(robxuiarcyteAs.t Tebuary B, Asea ll, 0d Area IV, for se in a Pimephales promelas aquasous Wtoatmeeraqsuurleiytpeamrpaemreatneurrse wienredemgeraeseusreCedlssiiunsg(aHC)o.rbpaH>, wdaistseolqvueadlioyxymegteenr, (mTihlleigmreatmesr wpaers slieedr ((Vm)a)/.L).Teeconmdeutceirivwiays[cmaillilbirmahtoesd ppreirocrentiamnedtearfi(e@rundhatoasiceoml)le]c.tiooxni.datIino-snitruedwuactteironqupaoltietnytidalaa[vwolatss "wTahneseHroirbiebdaTMfrwoamstuhseidgiinalacdciosrpdlaanyceoftthheemHanourfbacaaTMureinrt'osoapfereadtilnoggbmoaonkuaalt.th time of collection. 24 Drinking Water Well Sampling W25atoeurliwzaeds asbaomvpe.ledSfarmopmleasd0ribnekianngawlaytzeerd wweelrleotnaktehne rTeonmna2nttpfatrhma.t wPaasralmoectaetreds dwiercetlaynaolayztehde pump head ahe the wel had been purged for a period of approximately five mines. 2 009.3% USFW 058 25 Biologic Sumpliog 250 Small Mammal Sucy cSmoenlttalalmsinmaaannmtdsm.atlToisusswleuvreoebruircddoeelnl3sc0ideodf10sfmreaolvmlamlhauemamsiaiseltsotCopaadpbeoptleeadrgomiincnaelsbtoHdweyecrtbesucroodfmepneaxlrpeoevsdeultrsoeosf10TtsAiLe caoclcloercdtaendcefrwoimhtEeRTcCef/eRrcEsAceC aDrreaaf.t Marimal Sampling and Processing. SAtlalndafiredldOpterraaptpiinngg Parcocieddusre wSeOrPe 4c2o03n9v,eSnci1 lRFooocuardionwnasspimpiiAlaagfrifmaterhaegsdriowdwwearhesabeesistatabballsiitsshhhaeetddoobsneasriveeefdeianrloaocrneegatasreecaoslroeecsaaptmaendcdoJirunmstd1too0rth(eeFingsuaorrie s1ao.mfplTbiornyng. asreuefraefrraecDnercwye aaRtrueena,fwraaosnmdchDborescyeanuRusbnee.ciat uwTsahesetohleuesaBigadaeboitfheptreaerseweaastptphwiaatasgcoSpuzelmrdiiolbdae140d2idrhehtcdeliyncrnhafpeupeionsgcaeodffdbeyn rwveaaqrsuiieprdeerdafmoornmcgeadperwxricenhgaosMfuuftfshieeciuuemnatpSupamercbeiaeaslroasnfadmpawamapsmsablassseedifonrognsiactsn.eielaAalllgeasvpiolsfudwtoienmre.e asSnpugapccildhion1ng3 evfbeisactieiaedpdaaallnya,dnodrnbecaekaead bweeciemtsohsraanrriyo.lnlge1dR0oedtcoosvn3ecnredeidpn eahaennaevblenuiwnregr.meixDatuburerilene.gdrTwahpeicathhpeesck5swp.erseaacpcssh,ewccekrerdae' sumbbeers.isapgeicnigeasr,eaanodErtperocoefscsaipnugr.ewhile ithefed0dtheawerernstened nsoci, waFeoirnghesa.cebhodratynoivalmsaeelma,apdl,plramilalrtemogapele,drfacoarsmhieenaegtgt,(heAlpsipveeecnrrdwoiepxisgyAh,)s.,daaBnuoddfyKrimodemoccrtyiecwsesiigpnhectcluiwdmeiernnge tlmaobleelbawoadssy ancliodvnetrrenatnsed oKficdtnhoeoenytg(ahrssetpdodraioanxeseshiiemendtrae.llDryuar0c.5gienwagectrhee)rneewcmerrooevpersdyeamfonrvoyemdbafrcoohrmhsaiplteoicpeiamstewhneo.lroeSgenisoosaieoansnoaofeose ReTehrfeearsleencbciuefofnPesartewhdeofrloeorgmpyall(aincA.eRdPP)irnefasoerlrahvbieesdlteoldpiva4ehs0ol-aonmgdLicKgailldanseesvyavlisuaaeltciiaoonnn.dspwTreherseeertsveuemdbsmnwiiitnesgd 1s(00cpaeenricwemnsat stiupbidmiatnaeldysfiosr,homogenization ad TAL meal, oral lorie, perce mse, and percent 252 Vegeuton Sampling sVVeaegmgeepttlaaittniigoonnloAcwsaatssieosncssomlewlneactsteFtdiaerblgdeytePhdraonftdoorcofrloe.rsirdeTusheiedaunmealoysasntiss.yssbiuGsnrdapasenrtsEagmrRapTslseCs/swRseaErAeoCbtsaeSkreOvnPedio4a2e0aa3cl8h 2ps5tl6ea3mnss3a:ftrhhoeemshsaoemileismgumrreifddaicneawotdieetsvhi3cai5nditethyecoosfnoiatlhmesiasnmosipleldessafmwpeelr.iengaAknlelond.seamTwpehlreeesscwbooelvrleeecgatenrdaolubynysdecdpuotoririnogSsAtooLef meals, onal Mluorice, percent moisture, an percent pics 253 Aquatic Macroinveribrate Sumpling 3 000-3"5 USFW 0590 T#2h0e32infBaeunntahlicmaMcarcorioaivnevmeerbireabtreaiceomSmaumnpliitnygw1i0sdsUa.mSp.ledEPpAer (D1r3a6f3t,E1R9T85C,/R1EndAC19S90O).P iMoivcersotiigaavteinozn,bramtaecrsoaimapvleersiewberraieecsowlelreeiddefofrineevdal1u5atoirongaonficsmosmmauntitiympsiwaugceedue0.812 is 0.5 iseldiimmeetnetrsa(mpwlmi)ngsileovce.ationAs (tFoilguorfe 1r.ee replicaes were collected fom each of fve cAelnotnimgehtaenrdsleadl,l, Dw-iftrha0m.e5kiacmknemte,shmewaassuruisnegd.appTrhoexiomeattewliys4u5secdentoimdseerusrdwisduebmaeardge2d0 Vegetation and debris 1nd collct dislodged vertebrates. Exch replicate collection wis wpeerrfeomramnesdtoevreerdatou5si0f0oarm aproelayaedhcylaecahesjaamsplainndgplroecsateirovne.d wBieahti3e70avpeerrcieenbtat2e-parmoppalseasl solution. . - apotlyeethlyalbeoarsatporayn,wtihtehjsuasmtpelaeowuagshrwiantseed aiddcleed1an0awlaltoew32cdomppllaeceeddiisape3rswihointeofh12ex m1at8eri5a.l 2wikriatyheanpdani.nspLeacrigde fdorebain,acshieodueos,acldigiotahgeorregxatnriasnmeso.usAmlaltoerrigaalnsiswmesrepircekmeodvferdomfrhoem pcaorwdeerdeonideantaibfoierdao(0ryhebelnocwhesstheepto.skTihveesyiziedeomidfIifedethrisotnoorymiscagleeovefl,heeaourmgearnaiisemd,s 1an0dd osrageaniosfmtsaxwoeproemiicdeknmiofweldedugseinogfatpperogprroiuaptedteatxeornmionmeidc trehfelreevnecleosfainddesaifriceatpirone.seTnhte' sCounbtsraomlpl(eQAwe/rQeC)idreeaqiufiireedmbeyatasosfetcoeodsiondnivoidrueal atnoalmyeseits.the Qual ityAssurance!Quality 25.4 Fish Collection F`ciaslh fwleuroreidceo.lAlecCteodfffroembDarryryRupnowoerdeedtebramciknpeacbkoedlycbauorsdheonckleervewlsasofsTedAaLndmeoaplersaiaendd 2c5pepreatritnhgetmhaenueflaecctiurrsehro'cskeirnsatnrudctoinoensindTihveidusaalmpcloillnegcttienagmsrcioatsseidsefdishofwainthe i3nddiivpidrueatl. Sfitsuhnwneedrefsidhenwteirfieedpltaoctehdeilno2w5e-sgaalxloonnboumcikcetlefvielledpowsitihblseiteinwattheer.fieFdolalnodwilnvge csopleleccitmieonn,s wsoelruiorenleaansdedr.ewVomuecdhe0r tahnedEdReaTd/sRpEeAciCmebnisolwogeircealprleasbeorravteodrwyifhor1codnifitrmaftoiromnalocfebfiyedled tmaexaoln,omtioclnauloyrsiedse., F%ishlitpiisdsu2enwda%s hmoomiosguerneizaendalaynsdiss.ubmined t the laboratory or TAL 26 Toxiciy Testing 261 Eiseniafoeida (Earworm) Toxiciy Tests sFaimvpelesosilwesraempalkeesnweinrehetamkeenadfoorwesvaamlpulaitnigonrienssanaleoanrgtDnrwyorRmutnoxaincditoynteesitn. iForuerfeorfentchee mmoeraadloitwyaarnedaagsroouwlsiniendaacbhovoe. fheThteesttesstolwsawsarsuennfuomrer3atpeedr.iodEoafrt2h8wcoaryms,tiastsuwehirecshulitimneg mforiosmtueraechanoaflytshies.raFimgeurne |wadseasulbtmieneedarfotrhTwoArLm mtoexailcsit.yoteuslt sfolluorsiadmep,li%nglilpoicda,t0occs. 5 262 Hycllla azteca (Amphipod) Toxicky Tess ` eaiiy USFW 0591 sFaimveplseesdiwmeeraettsaamkpelieansDwreyrReuamkaenadfoorneevaialuaaifoenfeiraeaancaemaprehaipstordeatm.oxicTihyetetset.st wFaosusroufatohre e2paeurmeiroadteodf.10Fdiagyusr,eat1wdheitacihlsitnhee ammoprhuilpioyd3t0odxicgirtoywttehsiseedaicmhesotf skaemptlesitngseldoicmateinotnss.was 2.6.3 Pimephales promelas (Missow) Toxicity Tests FFiovuer osurffhaecesawmaptleersswaemrpeletsakweenirenDtarkyenRufonraenvdaluoaetioinn airae2fefraetnhecaedamrieanssoewamt,oxicTithyetetsets.t wwaatserrsuwaafsorenaumpeerraitoedd.of F7idgauyrse,|adtecwahlischtheimfaethmeoardtamliintyno2w04togxriocwiayhteisnt ewaactherofsatmhpelitensgt locations. 27 Sampling Equipment Decosuaminstion sTuhbeseqfuoelaltowtiongsasmapmlipnlgiinngteequifoplmleonwtingdencuomneiraimcianlatsieoqnuenpcreo:cedure was employed prior to and 21.. pohnypsihcoaslprheameovdaeltergeat wash 43..1p0ortpaebrlecewnattenrrrcizsaecid risse . 5. distilled wate rinse 6. solveat rinse [acetone] 7. airdry 28 Suntard Operating Procedures 28.1 Documenation Documentation was conducted in accordance wihth following SOPs: ""EERRTTCCI/RREEAACC SSOOPP ##24000021,, LSaomgpbloeokDoDcoucmuemresnatiaitoinon "ERTC/REAC SOP #4005, Chain of Custody Procedures 282 Sample Packaging, Shipment, Storage, Preservation, and Handling Sample packagicg, accordance with te sfohlilpomweinntg, SsOtPosr:age, preservation and handling were conducted in "ERTC/REAC "ERTCIREAC SSOOPP #22000034,, SSaammppllee SPtaocrkaaggei,nPgraensedrSvahtiipomneantnd Handling 283 Field Sampling and Analytical Techniques. Field sampling following SOPs: actviies and field analytics were conducted ia accordance with the ERTC/REAC SOP 42001, General Field Sampling Guidelines 5 006-15 USFW 0592 ""EERRTTCC//RREEAACC SSOOPP 4#22000056,, SQauamlpiltiynAgsEsquuriapnmceen/tQuDaelcioyniCaorrmuirnoalriSoanmples ""EERRTTCC//RREEAACC SSOOPP ##22001132,, SSauirlfaScaempWlaitnegr Sampling --REERATCC/SROEPAC#20S2O9,P #S2m0a1l6l,MSaerduimmaelntTSraampppliinngg.and Processing "REAC SOP 42032, Beruhic Sampling 284 Health and Safery Health and Safery was conducted in accordance with the followiag SOPs: <"EERRTTCC//RREEAACC SOP SOP 3001,REAC Health 43012,REACHealth and and Safety Safety Program Policy end Implementation Guidelines a: Hazardous Waste Sites "ERTCIREAC SOP 43020, Inclement Weather, Hea Stress and Cold Stress 30 RESULTS 30 Water, Soil, and Sediment Analysis 301 BNA `SurfaceWater Analysisofthe surface water samples from Dry Run, the reference sizeam, and Les Creek Tprroidbuucaerdy onBlylooncaetidoentecctoinotnaionnedtheansunedsatrmdaiBedNAcosnccane.amaAtiosnampolfe 2takuegn/iLn tohfe UBipsp(e2r- EindcilyuldhienrgyDupnhkihnaolwantea.lkanIen aandddiatilokne,aencuommeproouunsdsTewnetrdeivfeoluyndIdiennttiefiesdurCfaocmepwoautnerdssa(mTpIlCess) Results for ia Table 1 the and BNA analysisofsurface in Appeodix B. water samples akei ia ia Dry Run are presented Well Water l`iTth.e sSaemvpelrealtaTkIeCnsatwetrhee TiednenniafnitedF,ahromwweevlelrpornoldyucoende noof dtehteedcteitoencstefdrcomomtphoeusnadnsdacrodulBdNbAe. tweenltlatwiavteleyrcshaamrapclteertiazkeednanatditdheenTteifnineadnt3safanramlkiesnper.esenRteesdultins Tfaobrlteie| BanNdAiannAaplypseinsodifxthBe.. sail `Analysis of the surface soil samples from the meadows adjacent (0 the streambed and the reference meadow area produced a few isolated bits from the sandard BNA lst. rFelfueorreannctehesanmeplweass. deCtaercbtaezdoalteanweasstdiemtaetcetdedcoatncaenntersattiimoanteodf c2o3ncuegn/tKrastiionnoonfe 4o1f utge/Ktgreien 2o6n.e aondtfh30tuhge/ekgAsineaon|esosilasm.plDeivfnr-obmurayrlepahiIaI,laotnewsaasmpdleteecftreodmatazczoanctehnrterea,tiaonnds towfo22o.f 2t7h.e 2 teshtriemeatseadmpcloenscefnraotmioanrseaofI2V7, respectively. Bis(2-Edhylhexyhphthalate and 62 ug/Kgin one sample from Area Ill was and derected at one sample 6 009.15 USFW 059 clUfoarmoscpmeo,uAnnvcdeossycwIooeVf.rnehaepfDsoeiauonmldpcleyieaupshf,heoidsamilcaaereedaI,wsVao.sls1rdssuseia,cied.do,b2m,m rePxeGiEs,tTeididsc,om sceaandoa n of 1300 samples is preseted ia Table 230d i Apes 5. Ress foto pho seo FS Sedimeng opArzotadluicyesidnonfhletyAhevaesfeedIwiVnsseoesdlisemademnptdleessasmcpifloeonms 2oif0ecBfNivmAe scdioempG1o0oudnedwsso. Ecyberyphiaue ws detect ln he Are fDfaosposoecma soaions . ctConrrsokae,cnurafcioseominparoonufs,n2dyssueyveaKemsre.e, ,oNfoteDsircyaRa,ndsmsbyedldden,ecsoaIesmTrapomdo,edinrdm:ttewslSee.smfppoaotgi,eo1mo0sasncr; AS isa3pAlpepse.adiRx el fo he BfNoAundcaiytse oDfreyciRumse:sLsipeiCerse.pandrwepnmsgae 302 TAL MeNas . ebfAerollreydlnesiodncs,odasttcehaetdesemidituiumrc,2 aewcnaodtneboetfre,tshmrd eaeledrerrseysad,fmorprloiemcsfkDefelro,yrrsTReeAuLde,,wimhne,ersseifsveer,yeem,saelapimn,iaedrLeesreCer:ee assul cf0mo4eirrneinsuccmasw,ieaormanepltiuenseh,eidcDcaraiylpncReihuoesn,lCcGroeapetpedekrsd,wiaactmsner,sis,o,ampelceoss.pe,O, F1moea.nIg3oaosf,dpeoopssnri,asein, Cres. ungte rere sens Ra2Nuu4lnmilaaoiheuemow,sesprbeeicieemusiemes,cucceroadecedeiinnuicrmha,LieecoeonfspCiproelferei.rdnons,iimmp,algensoe.sni,OumF1,dhmesaTnnopgoefp,aspbory0sspoams,nscodE0,e: pDreecseunltdedienlTsaloef te3nTdAinLAmppeenscinan5.ys in fered nd nse wes samples se ell Wer CeaWomenpnlllcuee.mwnac,taeAtrasotisniavmmmeap,enlyse,daurlwfeureomfimo.r,thhe3ebxewr0reeylmllvaliiiounnamid,nhigecuIamsdTmesivseuarmns,s cnfhorrrommdiweuacms,isdcnaoynbz,endmaasrm2oemonfered in Appendin 5. ofTAL meetssrpresent est 10s ' 009.45 USFW 0594 Sail Three replicate surface soll samples from te four Dry Run meadow areas aad the rseefleerieunmce, mseilavdero,waaordeaGawlelrieumanwaelryzeedooftordeTieAcLtedmeainlsa.zy Aosfttihmeossyoi.l csaamdpmlieus.m, Omenrec-urwya,y ahsiaglhyesrisinoAfrevaar[iIanccoempdaerteerdmitonetdhe trheatfersoeialcemaarnegaa,sbeustetcheonscaemnzeaat5iotnossewegroeresdi1gufairceaasatIy, Ico.ncaenntdraItVio(nps=0f.r09o4m).the AortehearIarbeaadsthreanhgiignhgesftrmoema6n3m0a0ng1a3n1e0semgc/okngc.entFruarttihoenrwiretshulmtesaonf the TAL metals asaysis of site and referecce soil samples are preseaied in Table aad Appendix B. Sediment wSeerveeunkseendiimaetnhte ssuacmpalremsbewdeorfeDsruybRmuicae,dofnoerwTaAsLwamkeetdailnsLaecaelyCsrise.ek,F1i0vedoofntehweassamtpalkeesn winertehegortefdeerteenccteedsienaamn.yofAtmhiemosnedyi,mecnatdsmaimupmle,s.merIcnurcyo,mpsaerliesaoieum(,0 stielvelre,velasd metahsaulrleidu.m in the Lee Creek sample, it appears the Dry Run Creek reach may be cariched in `amlaunmgianneusme,, arnsiecnkiecl,, bpaoruisusmi,umc,alcsioudmi,umc,hrvoamniaudimu,m,cobaanldt,zicnoep.perB,asierdono,aletahde, rmesauglntseosfituhme, aluminum, barium, chromium, coball, copper, iron. lead, mangasese, nickel, vasadium, daeacdsezaisnec waintahlysiinsc.reatsheiraeg dailsstoanacpepefarrosm1t0hebelaandfigleln.eraFlurwtehaerd raestultsmeoaflthceonTcAenLtrmateiaolnss azalyss ofsite and refereace sediment samples are presentedi Table and Appeadix B. 3.13 Pesticides/PCBs " No pesticides or PCBs were detectedin the Dry Run samples, the Lez Creek sample, or iz the reference stream sample (Table 7; Appendix B) oil Nopesticidesor PCB were deteced in the Dry Run meadow samples, ofin the reference meadow samples (Table 8; Appendix B). `Sediment Naohpeesrteifceidreesncoer sPuCeBasm wsearmepldeet(eTcatbeldei9n,tAheppDernydiRxunB).samples, the Lee Creek sample, or 3.14 VOCs Wage CNroeevkolastaimlpeleo,rgoarniicn tcharbroenfecroemncpeousntdresamwesraempdleete(cTtaebdlein1t0h;eADprpyenRduinx Bs)a.mples, the Lee 8 000.3 or USFW 059 Sail TtoricDhrloyrofRluunoroamethcaonnecewdaisaidieotnescterdainagienvgeryfrsooiml s0a.m9ple10ke3.a6 inutgheg.meadoInwsaadddjiaicoeant te4wacugh/lKogr.oetbNeoaeotwhaesr dveotleacdtleed oirngoaneicrcepalribcoantecAormepaouInIdssoiwlesraempdleeteaciteadcoinactehaeirDartyioRnuonf. asazmapllyessi,otfhesitLeeaenCdrreeefkerseaomcpelseo,ilosfaimaplthees reference seam are presented in sample. Table 11 Resuls of ise and Appecdix VOC B. Sediment wAacestodneetewctaesddaet ta ecocnictneeatrhdreatAiroenaoIfV0s.a5mupgl/eakgt aconcentration ia te Area III of 7.2 ug/Kg. sample. `No Chloroform otker volatile oorrgainnitchcearrbeofenrceonmceposutnedasmwesrameplde.eteRecsiutlttehsdeofDrtyheRVuOaCsamapnalleyss,isthoefLseieteCaredekresfaemrpelnec.e sediment samples are presentedin Table 12 10d Appeadix B. 3.0.5 Toul Fluoride Water / Well Water . Fsleuoarmidesawmpalse,nootfdientetchetewdelila sthaempDlreyaRkuen s0aamtphleeTs,entnheanLteefaCrrmee(kTasbalmepl13e;. AtphpeeraedfiecreaB)c.e soll Fluoride was detected in the Dry Run meadow and in the reference meadow samples. Soll finluAorriedae Icloln.ceTnhterrateiaonpsperaarng10edbefrpoomsaalioswicoafly18s0igmngi/fikcganitndAirffeeareInVce1s0iaa hitogthalofso3il70flmugor/ikdge cosesauration. Resultsofthe soi fluoride analysis are presented in Table 14 and Appendix 5. Sediment Fluoride was detected in the Dry Runcreekbedand in the reference creekbed samples, bu fot IV in Lee Creek. sampling area Fluoride concentrations ranged from a low of 290 (0 a high of 450 mg/kg in the Upper Tributary mg/kg in the A sampling Area asa. FwliutohriindcerweaassinngotdidsettaenccteefdrionmtLeheelCarnedefikl.l.OvSeerdailml,enftlsuosraimdeplceodncieantthreatiDornys RtuenndCtroedeekcrreeaasceh saepdpiemaernttoflbveoreindreicahnaeldyswiistharfeluporreisdeen,tewdhiicnhTaibslneot1SfaonunddininApLpeeendCriexekB.. Results of the 3.16 Organofivorides Sediment hBiegchauvsoelaoifltmyetohfodsoolmoegystapnrdoabrldes,ms,onslpyecailfiimcailtleyidnsuoibtueionfinogrgaapnporfolpuroiraitdeesctaonmdpaordusn,dsaccdoutlhde. be scanned for in the sediment samples. These compounds are presered in Table 16. OF Ge lis tat was analyzed for (Tewaflvoroethylene, hexafivoropropylenc, ? 060..55 USFW 0596 CChhlloorrood-i1f,l1i.r1a.m2e3c.b3asAee,xaplevrorlouporroopcayscel,obuasned. |_-PCehclfolruoo-r1o.i1o,b2u.n2y,leatse)a,fivsorooeetbaosfe, h1eLozrlgyasniosfiosniredpeorcioemdpo1unTdbslweer1e62d0e4iiecainAdpnpesodeixsBe.dimens. Resuls of ee orpasoflvorids 3.1.7 Toul Organic Carbon and Gra Size of Sol and Sedimeat 1S2udm1m2arAipepseoofdtBioax.l oTrOgaCniinctchaerbsoonlnradnggedrfarosmizaenanaavleysriasgeaoewproefse5n.t6e%diinATablrelsl1sa7o-l2s0 i0a1T0abalveer18a.geThiOgChoifnt9h.e2isneAdriemeaatIVrasoniglesd. fSriolmg2alnowsoifz 1d.e9r%ziiaaLteoenCsreweekstuom3mairgihzeodf 215% in Avea IV. Seimeot gra size deiemination is preseed a Table 20. 308 Water Quay Parameters . eWamtpeerranquriel,itry opiarda,metcehrlsoriidnec,luadiiaoige,pHp.hoscpohoadteu,ci0vidy,sulrfuibeiwdiays,medaissusorlevdeidnohxeygDera.y wReirmeCiretekcornedsuc,iitvheiyr1f0edrsculefasteeacmoc,eoardrianoLneedecCrreeaeske.dTwhiedmiocsressosuibaglediosbtsaenrcveatfiroonsm `BDeealsaunrdfeimlela.tsO0thderanpaalryasmeesteares parpepesaeraetdd tioTbaeblienst2e1aenxpdec2t2e.d range. Resuls of hese = 3.09 Bovise Fecal Samples = iSnitxhfeecdailgessatmipvleesprwoerdeuckeofnhteo dafefseectmeidnciafdeemvironmenial copaminans were showiag axa mPhge/ckogl. wAadsidteotnecatleyd,in&-amlleishiyxlfpehceanlalsawmapsledseexciceodnciennaulaliioxnssarmapnlgeisnginfrcoomnce2n.t6ra0tio8n.s0 cFounnsgeinnirfarioomn 9o5f t3o0 1m1y0/kmsy./kg. AdBdieinonzao iancfidorwmaasiodnetiesctperdesiesciweod ionf Ttahbelseam2p3le2s2d3i3n `Appedin B. Tal Meals SAolduimuimn,uvma,nabdairuimu,m,1ncdaltciinuem,wecroeppdeer,ciirdon,inltehaed,femcaalgnseamspiluems,. mAadndgiatnieonsael, ipfoorsesaiio.n presented in Table 2 and in Appendix B. Eusride Fluoride was not decid in any of the fecal samples (Table 25: Appeadis 3). 32 Biotic SamplingandTissue Analysis 521 Beatic Macrolaverbrates 10 - 005.55 USFW 0597 AOftoeas,oft2h7retwoansam1 iOcliggorcobuapcsiw,e|reMcoollelc,ed|Tfurrobmeltleran,loc3aCtirounsstsaacmepal,ed1(dTa2b1leIns26e)c.t. sCaale.opieOrfiathwhilcahnwees,reherepdreosemateid bgyro7uapr,a.in TtheremsDipoiferwiiaonwoemriecredpirveesresaittye,d bwyer4eaGxea iTr=copGteeriEap,h0emderMoepfiaelroipatewrearewerreephreeslceeads dbiyver3sexgaro.upsTahned Pwleerceopireeripar,esHcemaiibpydtearcae o"rhetrweo1x9aa.xaTwheeregrceoaltleescttead.xogFomeic wwdvaeaerwseirrcye wsaesrovbesedravedocaa:ihoensf|erGeoaucgehloIcVa,ti1o2n4, bifetrleonwceesitndisveormsiotynewadisveorbssietryvbeedcaweleotceaiornfeIrVacwehelroecat1i1onxnad lwoecrateiocnosl1lecIe,d.I, Tahned IloVcawtiaosn.primanly due to te preseace of a eater umber of are axa ate former T(raeploicuamtbeerA)of0in2di6viaduallosccaotlolnectIeVd (preerplriecpaltiecas).rangTeodefroobmse2r0v3edadheeasrieyfoefreinedilvoicdautailosn : ({aExraou(gThaobultet2h6)s.udTyheresaumiserpircsamlalrylydohweinraneeaorfaltchlelemcutmeedriralomabthue nsududoayfoaorcleyaeinscelvuerdaels Laencsacdraonctuos1rgdanisvmlsiadaed.wWeehernepprreessseetd,bhye2se1a0sda w39e1eintdyipviicdaulallys,heresmpoecsttivoeluym.eriOablelry Lsespao.philncelbuidai.ngBePeesr,la1.54CPheiurodroalmiindnaoep,hiFiya,lwelels, pthreesTeunsbaetlamroisat,loacnadti1o0ns3 iensceotnxsciss, Sfiegpairfeiscaenattbepyrdopfoirvteoionsf.eweInr igenadeirvail,dumaolass:maorsat lcooclalteicotnesd. wFeorreerxealmatpilvee,lyorfatrheea1n2d9woerle {oavxootnoomfiivce oibndsievrivdaunalcse,s,134bywseirxe10re1p0risndciavitdbueaydls,on1e5ibnydiv1i1du1a0l,2036indwievrideuarlesp,re2s0cdate1d3 bbyy sreaer han 21 individuals SCehvierraolnotamxiadw,er1endcolAlseccltieddafero(mTaablllelo2c6a)t.ionsSesvaermaplletdsianclwuedrieogoLxeuccoolrlreicctae,d Pferormesa,ll Algocaabtuiso,nsHbyuatllwlear,e3bnrdoTaudrlbyerleaprrieas.entOefdthreoauigsehaoxtaotbesedrraviendagae oinnlclyudoinneglLoecapttiaopnh,lfeobuar,, {forcolmudtihneg rEelfmeirdeancce, lSocciavtiiodna.c, TPhreeamdoosltincaoopmhmioln, d2i0sdriSibcuaitoinomGybisdearevewderweascoolneeciWehderonely3 uHyadrowpassyccholel,ecLtiemdoionphelialtdiavce,lyNliogwroniuam,bernds,Ce2rnadoaptofneiwdaloccawteiroens.colFloercteedxaimnpflree,queEnltmliydaaes,d iHaislceorwidnauem,bePrrse.sdoSliimnilnaarplhy.il,LiSpcoagioommpyhisd,aeD,ynisdciPdhacy,iaCuwrecrueldcaoel,icEeldmiidnsel,owScniunmibdeare,s arly one locaton. FRievseultfiunngcifornaolm ftheeedipnrgesgenrcoeuposfwserleicdolelecatnedd Hfyroamlltlhe, DormyaiRvournesdrwsienraegeth(eTadbolmeiz2a6)n.t fscurnacpteirosnawlegrreocuopnsatismtoesntt cloolclateicotnesd.frAolmthaolluogchatlieossnsdionmitneasnr,udcyaorlleeacaonr-dgaitnhcrleudresdahned mPraedfaetsorsLewueerroecudtoami1ndantLepattolpohclaetbiioan.s TIhaesddomIlinaannd swcerraeperrewprsestehneseadyplriymaLreiulcyrobcyust.he sorely Perlesta Tuhleio.veraanldl saescsoensdslmyenotn otfhezacalnogiacalolfcyboionsldoigiiocnsalfceotmpfooncuesnetssoin itghheteovfalubaitiao.n ofHhabbiiast, un 009.29 USFW 0598 aa8 the30prdinccainpabledeutseerdniasnaantgeonferbiaollopgriecdalicpoortenotfiabli,olsoegtischalecsonadgiecifoonr.isHiiegrphrqeuiaalgitbiyosbuarbvieayt. wsuiblllseu1pp0odrohfilgihtlqeucaolnesebqiuoelnocgei.cal Hcoomwmeuvneirt,ie1ss a3ndharbeispaondseecslitnoemsiinnorquaallitteyr,atidoinssczwrialalbblee bcioollloegcitceadltoigmeptahierr,meenmtpirreiscualils.relaWrihoensnhiphsabcaina baendquabniiolfoigeidcaalnddasaubsaerqeuesnytsltyemuasteidcalfloyr wscarteecrasihnegditmapatctdraainndsdhisecrDirmiynaRtuinngswtautdeyraqreuaalbiaysebfefeecatsmofdriofmiebdabaisata dreegsrualdtaotfiopn.as Tahned preseat 32d use, paricularly with respect 0 cane grazing aod other agriculural pracices, 5rowueglhatreeplacseirimaegaotfbycosmpmeecriecsiarlesanidstindourstardiaalpifeadci0legr.azTinhge, loorssoelfirmiipnaartiiaonn bveygegartaizoinn,g as several consequeaces that shoud be considered when evaluating te distribution of benthic macroiaverbraes and macroinvenebrates ia the current say. - qTuahleitayorafitnhabelbeabbiioloagicaaplarptoitceunltaiarlloocfataosnw.rTehameDofryriRvueraisswpudryiamraerayssdieuteartmeidniend abryurtahle area uslized primarily for graziag cate and, although historic indications of grazing are `weivtihdenat,csoimgpnliefitcealnyt poopretnioncsanoofptyhearnidpaerixapnosaeredasroielm. ainPovretgieounastedo,f tahned DthreyreRaurne fderawiaaraegaes, cBoomumgunhitsyo.mewThhaettdaesgorandoemdi, dsiuvpeprosrittyaasnudrpnruimseiargilcyaldiavbeurnsedaanncde aopfptahreenmlaycrrooibnuvsetrtaeqburaatiiec was relatively bigh at the refercace area. In contrat, the diversity and abundasce at locations I. 11, III, and IV was reduced substantially. Since habitat considerations at all locations in Dry Run are similar, the presence of contaminationa the lanes locations may be significant. 322 Mammal aFnodurmsepaedcioews joufmspmianlgl mmiacmem)awlesre(mceauagdhotwdvuorliensg, tshbeotrrta-pipliendg sehffroerw.s, Wwhhiotlee-fbooodtieedsmwiecree, submitted for lipid, TAL metal and tol fluoride analysis. e"TxhterermaeplpyinlgowefrfoarpspirenvgeasluecdceastsilenaAstreonae Ii,mhpoeruaarneta ineeadresotbstehrevlaatnidonf,l wohutifcahll,waass ctohemrpearweads 1`0matyheinodtihcearteaarenaes.colTohgiiscails htihgrhelyx irFrieegludlanrecgriovpesnietsheisdeinmiiilfairedhasbeivteatrsalprseisgeninfticsaintte-pwirdoeb,laenmds. wsihtrhewtshessammapllledmafmrmoamlsallcolalreecatsedishnotwheedmbelaadcokweneardeaasndadjdaecgeenasertoarDirngy Rtueent.h. ShorSth-raeiwls Cceonmtmtoianlayrehaavleighwthabtroiws nkicoolwonr.asThcheesbtlnauctk,timpopetdedte,etah,ndWhdeegreenetrhaeteixntgrteemeethpooibnstesrvoefdthien whais smtiudsysiansgenthoetlneofrKmiadlnleyy,oabnsderavneodthienrsahrpepwesa.redOn0ehmaeveadaondwevxotlrea skiadmnpelyedoffarnomexttrea alroebae on the right kidaey., independent ofthe adrenals. SHuLffiacnideAntrneuambIeVrfsorofsamteisatdicoawl cvoolmepsarwiesroenscaoufghitssfureomcotnhceenRterfaetrieonncse. ALriepai,d AcronecaenIli,raAtrieoan of meadow voles was significantly depressed in the Reference Area, Arza Il, and Area Ill, cloomwpeariendheto RtehafseroebnsceervAerdeain, AArreeaa IIVL (apn<d0A.0r0e1a).I, BcaormipuamrecodntcoentuhaastioobnsewravsedsiignniAfriecaantIlVy. 2 685. 05 USFW 0599 (p=0.087. {Sourtfsiainesaiaclumcboemrpsaorifsohnos.rTihersehrweewrsewueoredicfaeuegchtcefsroimbtoedyRecfoepscesecaeaiAroenaoafnpdidA,veTaAILl Zeal, 10d fluoride n shrews hea from ese two areas R37e.s2u9l,sonfdhien cAappppeiandginsuBc.essR,esTulAtsLameetaplrs,es1edaifbseyodrisdpeecaineasly1s2isd CaaepppirensgelooiceadtiioanTables 323 Fa FcoosuerrsopeedicnieAroefaishorwehree RcefoerlenecefArroems.DrCyreReukachinubAsracnsd1faIiLl, nddacTsV.weNroefcilslewceireed chuAbre,aFIaVn.ciCarneeeks,chucbesnm3aldsroinveerrcolhluerbss, w2e0rdelcaoclklencotseed idaacaerewe1re1alClrceetkedchfuabAs,reraivIer - Fiipsh.suTmAplLedmdeuarlinagdthfleloerciudofiasmhliynsgse.fforAt cnomDproysiRteemswaemrpeles(uabt iwars ftoarkewnhoulreibnogdy4 biorical fish Kill a Dry Run was als saalyzed. `"`SaAillnycuesmiicssruecemok,nccaherunsbtesrnaiwtcee,rdebtoarhnieudomin,flfybreesrmpyielaclitieiusnmgc, boceomvbwamelotet,nnoitralosln,ethlreceaeodns,caemmnpailniagntagonnelssocea,itaioGtnaisl,slsisuupimes,ctiie1csa.5l \TanaandiuImV.werLiekeswiigsief,iccoantcyebnigahteonisncofrthesceehmbkesalfsroimn aArreeaa]IIhacnrtecoksechsuabmspwleerfeahAirgehaesr ((r2e0nd,oswihintAsveea IcVo.nsCeonavaetrosnelsy,icnaAdrmeiaumIVssnidgnsiilfviecrancdoyncebnitgrhaetriotnhsansthhooswe emhedeasruerveersien R`Aud.eanWeaorrerI.(0 hIneslpiatenolftiarserbeeisnugldtossedclweiatrht3shigfniisfhiciannhtalbyihiinghueprpearmoreuanctheosfaefaDrly caonncenttrhaotsieonin te lower reaches, There were no] differesce {a lipid or Muoride Results of the chemical analyses sre presened in Tales 30.32 ad in Appeadix B. 324 Esbwom sToolsseamrepplleiscateOenea-rwwaoyrsmnlsyasmpsleosf wvaerrieanpcreodwuacseudefdroom elxocohkoffortshigeniafricwaontrdmiofexeinsctsesitn (Ciastsumeicuomnacnedntarliloinusmbceotnwceeenntraetsirohnswoirnmtsheeexspeostewdor1m0 seaucheowfatshesifgiaviefiscoialndryebaiegnhters.n iweereAvleoswe|rexipnowsourremssatankehnofsreomitn AereraesfeIr,en1ce aIeVa,,bourtttheenRdeefderenicnecrseosilsse, wiChobianlcrleesvienlsg a{fnomceheroremfeheencleandfsiolill.s tChoapnpteros1edonbiscekrevledconncewntorratmioanskewaerferhoimghtehre ionthweorrmoslarkeean exposures. CFounrctehneircarteisounlsscofprheeseeneadriwnoTrabmleisss3u3e.35anaalnydseisn Afpoprelaidpiids, 5T. AL meals and fioride 325 Vegeion 5 009.2% USFW 060C Tloacraetieonrse.pliOcantee wsaamyplaesnoaf mloefyavdasoriwiasgcsreasswawserueedtakteonloionkefacrhdoifffhereenfcievse asoipllsaatmpelsiuneg chiognhceerntirnattihoenAsraecaro|svsehgeecafiioven sthaapnliingthearAearse.a IBlaraindumIVcovecgeecaaatitoon.nbwutassismiiglnairfitcoanGtalty oSibgsueirfviceadndiyn hpilagnheesritnakteihe AtrheeaR|ef2e0rdeeacfeeraandceiaveAgrecaaatiIlo.n Manganese tan t he concentration was Area IL. ll 12d IV Vbeegeottahieorn.arCeosb.altThwearsewsiagsaitfoicadnilfyheicgshaecreiian tAerfelIuaVorivdeegeoiratliiopindtchoanncetnhattraatkioena in any of RAepspuelntdsioxf3.the TAL meals and fluoride analysis are preseated ia Tables 3638 and in 33 Histological assy of small mammal liver and Kidney jHuimstpoilnoggimciacle,anaanlydsiwshiotfefloiovetredanmdickeiTdaapcpyesdeicnioensaoofcftmheeadfoivwe Tvaolpepsi,ngshaorrte-aaiclonschlruedwesd,thmaetatdheorwe 0wedrecthoe psruebssteaancteiovefcahannegexsainlolbeioonvrkthieedroiregyh mkoirdpnheoyloogfyn.oThheeraprbovsidoeefaaaaeiccddaoeueylienviodneencaeniomfaaln, eofffhecet,hBiostwoepvaethrolwoegiacrael uwnoarbkleartoeapsrceesraaiedtien Tiambploer3a9nacnedofinthAepspeeonbdsierxvaB.t.ions. Full summaries 3.4 Toxicity Testiag - Eaghwomn Beaasretdhwooarmtshetetsotxeidciitnyaeavyaloufattiohnsooiflssoalms,pltehserceolilsec5t0edaevidtehaeceDrfyorRguraowCtrheeokr ssiuer.vivaSlurevfivfaelcswaosn e1a0r0t%hwionrmalltwoexaitcmetnetstraerpelipcraetessenainedd ginroTwaabhlera4n0geadndfrinomAp3p2e.n4di0a5C4..3%. Further resuls of the `Eatheadmiozow. Bsuarsfeadceownatteher tkoesinciiyn ehvealUupatpieornTorfisouurafrayceAwalotceartisoanmipnldeusce(d0 shgeaiffactahne:admomrianlnitoyw., iStursvpievaalrisnhtahke UlopcpaetironT.rirbauntagreyd Afrsoammp87letowa1s005%.8% Twhhielree sauprpveiavarltionbaellnoothgerrowstamhplreelsa,teidncelfufedcitnsg wtahieerr,efoerneatchee mcoirnrneloawtsedipnoaunsysioufmtchoencweanttreartisoanmsp,lheoswetavkeern tfhresoemcDorryelaRiuonnsCraereeka.o sSautrivsitvcaalllwyassignniefgiactainvtel3y hcoenc0e.n1r0ailieovnesl.in Tthheerfeerweads waastiegnsifaimcpalnets.posFiuirvtehecrorrerslasioofnthbeetfwaetehneadfamkinendowsurtvoixviaciltyanedsiarroen presentedin Table 40 and in Appeadix C. Amahizod BHyaasleedllosnactehecar,esgulotswofofthtehe10ordgaaynissomlsidwapshaisneibwihcoeldeinsetdhiemseendtimoexntiscamtpelsetswittahketnheatahmephiUppopde.r TsraimbpulteasrytaAke,n,anTdhAeroebaseIfrvleodcatnieognast.iveThgerroewtwheefefecntoweafsfestisgnoibfscearndvleyd noengastuirvveilvyalcoiraealniyedofwihteh 1 009.25 USFW 0601 Sftluroornigdeg,egaaliuvmeinausmi,cciaaolncsu,bemnawgeaeenshiuemr, ooicwkel,capdoposis:u1md, c30od msomdi,um.copFpeurr,sI,e,eraeadwTenree Cboenacmepshaiipoosd.toAxlibciotuygehsthearreepardeosnehciepdsaweTraeblceol4g0 3andafanApaptehacei0x.C10. level. Further resus of 40 SUMMARY OF PRELIMINARY ECOLOGICAL RISK ASSESSMENT SCREEN SEePdAime19n9t9,),soiHlaszanrdwqautoedecnosncweenraeigones owereebrycodtmipveiadridengd tahgeima:asRioonnsiltelCBonTcAenGcrsaciroenenmienagsvuarleudesa(Ua.cS.h Cmoanttiiexnrbayionthse ecxocmeeesdpeodndbienogchiRmeagrikosn fIolr sbeednicmhenmta,rksovla,lueasn,d wAaltlercoantatmhienainnttisalfosr ewrhiecah imvnaexglimruismk tfeesrsmeevnalauraeteldsiiead3iihael froilslkoawsinsgessemcetinotnsf.orCBoenstiea.minantfledthe inal screening process will be `Sediment cTaobnlaemi1nalnisst,s mTahxeimmaurmimcounmcecnounatcieonnrsa,iosn rreecoerdecdriatertiae, sntdexqcueletdyedchrietebrieaocfhamctaorrks vfaolruessefdoirmehnet fsorleleonwiinngg bceonmcphomuaardks,: treeafcol,locwhinrgomcioummp,oucnopdpsera,remasnilglanceosnes,ide1rdedwai5ckerli.sk fBaecctaoursse3oftweel: lfalcukoroifde,3 imi, Sarum, beryllium, cabal ron 20d vasadiz Ver "mTaabxlie1mulmisceomnacexaizmauimoncornecceonrrdaeidotnst,hebesaicthmearkxs,cadteequebaelindtcyhcemaedrkivafalcuteosrsffootweefrollcoownitnagmicooamnpso.unTdsh:e pmotienntuiaml,isckopfpcer,.12d iron. Becauseof he lack of screening benchmark, fluorideis considered 1 be 3 Sail T"Thaeblemaxliisemummaxciomnucmencroancieonnratifoencso.rdsecdreaetnihngecrsitteriax,caasnddeqdua(lhieybcernicthemafrakctovraslufeosr sfooirl choentafmoilzlaonwtisn.g cofotmhpeouancdks:odfausnriesan,iagbebreynlcihumma,rck,hrhoemifuoml,locwoipnpgerc,omrpoonunledasd,rmeansgealnecsoen,sivdaenraeddiausm,iakndfaicnteo.rs B3ecwaeulsle fluoride aad wichlorollueromethane. 50 DISCUSSION "aTthehedaDsrygeRneenrsCerdeedkursitneg.thMeifniiemladlelfy.orthseuegsguelsttstohfttthheerseedairmeepnoteannidalwpartoebltermsicsotctiaettedsuwgigtehscopnodiietniioanls puraoblleomfstien tahsedtfe,arsw.ithtSoosmeelmeveeallssprsopgereasrsiivnelhyigdherr toswepitcpohnceiernetnrsaitngigonsdiisntabnicoetfsrsoammtpeledannedariestartehae CLoinkecweinster,aisoendsimaenats staomspelesdaminplDerdy Rfuurnthenreadrotwhnesliaendafmi.ll ouAtfalplrealpipmeianrartyo shcarveeenhigohferpoftleunoraildeiasnkdfmaectoarlss bSeuggpersetssenthtataoewerll.probDlaeras,gasptehceirfeidcaldluyreilnegvattheed flieevledlsefofforltowriille,beorfugrothfelruarniacleyz,edantdhsrooumgeh m3eablass.elmianye ecological risk asessment for he Dry Rus Creek sie 15 009.24 USFW 0602 SECTION! ECOLOGICAL RISK ASSESSMENT 10 INTRODUCTION LL Objecive AehgeeennacbyjcRseiogviboofnsiedIsilzimareinsc,konasdnsudectwsiasntgnereaanwtae3vsafwloourapktriioonvngidobefeetp!oetpcernhotiidauelctseiucoponploofgraitrcmatllhtoercaetaUet.dSd,duoeEwantvoigzerxoaindsimteeianntgtolcofPvraemlsissndfiaionlnt Sndovesdtimienw,atatuwteareevcaotlel,i0e4fboirolsabosraamtpolreystwoexreiccolsliecgte,d fTrhceoinnafmoirmnanttionnlgyasbeesretdaddsioalgsteidsimeenltd, for was incorporated ao ia 2ecological risk assessment (ore Dry Run Creek st. 12 Sie Buckgrowd TThieeshiaesifl3edwosrukmisnrgoubsecfopmrpoldauicntsiownifharhmelWoecsatedViinegWiaisakiDnegpiaornu,neWaotoodf NCoauuarrayl,RWeVso.urcTehseaowaedhre oUft.hSe rEPaAioalneg.ingtotaDtrscoRnuanm.ipaDnrtysRusnz fbleoiwnsg rdoiuscghhatrhgeed ffarrmoemr'2sapirnodpusetrryial12adaidf3llproiwmaareyd sboyurtcheeofDuwpaonrt {faoinsishaenrtde.aeTihevefcarymearnmcabiuntbaliensttohtahencuomnearmoiunsadnetastas,tbalienddaiessc,haanrdgeodbiesro uDaruysuRaulanfersosmestheobDsueravneed JRaunndfslilnceIntaeddictoinosnttruocteisoneobfmtoermlaanldifeisl. numerous ish 1d wide kills ave also been repored a Dry! 20 PROBLEM FORMULATION "cfTodhneistnatrimfsicknaaainostn.osf CeDOusrCwisanssgadmnetdhseeigncpnoremtedplaitrmoiinesavoarnlyuoartifeshtkehemaspasoxteesinsmtmuieanmltc,tohnrtcehaeetnstprtraootebicolonelmoogfifCcoaOrlmCurslecaewtpiittoohnrsapcrfcorecopemtseesdxpbionescnulrcuedhemtdoasrtithsee. Tahcseionlfoogrimaetlifoencwpatsohreanndutseeitsdpperonpyritccommpelaestuereexmpeonsutreenpdpuowinatyss ofampannds exceeding benchenirks wTahrfidutrsinteotfehfeiperewliitmhiensaarbyliisskhesdetsosximceonlotgipcraolcebsesncchommaprakrse.d Blelncchhemmairckaslfaorlsyezdeimdent saonild. ssoeidliwmeernte.uasnedd TxMoeoerindgedanintnifg1y9b3pe0on,tcehLnaotminaagglhecstoawlne.mr1ei9nr9e5at,naiPsneeodrffscouroanfducretahnle.rf1oe9rv9at2lh,ueaUtp.iSro.onteEucPstAii.nogn1io9nf9g2qe,sutSaiuottnee-rbiaansoeddMe(bxUrpSoe.syuErPe19Am94o1)d9.9e5lC,ofmLoparanitggihnsdensdr Semcoraies, and direc exposure assaysfo fish, benthicand eresial nveribrais, 20 Ecological Risk Assessment {"oTisseecroeloagidcaclorinsakmaissaensss.menTthewafsolwlroiwtiinng stoipdestweermrienceotmhpelreitsekdafsosrodcisatepdrewliitmhitnhaeryexopkosusreessomfebinott:a (1) ASpelceiersa,rurteo sdeesteecrhmwianes ceocnodruocxtceodlotogilaoclateeflfiefcetshisotforysiitenfocromnattiaomnifnora,seleacntdedtiondilcoactaotre Bioconcenmation factorsfoie contaminant. (An evaluofaetcoliogoicnal receptors was pepaced. This consisted ofthe fallow: + aEnxdposmuargenisncuednaerioofs wceormeamdientaetrimoinn,edabnadsetdheontsoixtieccoloongtiacmailnamnetclheavenliss,mtsheoefxtetnhte 1 0e9.05 USFW 06 + oInndiscia,tohrespsevcaielbwieireyosefleictcedybasiendfoornmastpieocnieos pmrestehnetlaendalorr,ponsednttihlelyprpreensesnat {or exposure to it conaminants based on habit se of behavior + Exposure pathway(s) were determinedfo ech indicator species. + cEoxnpaomsiunraenatn.d effec profes were wrinin or each indicator species and exch sie QAuroitikenctha(raHcQte)rifzoartieoxnchwasspeccioensdufcteaodrawnrhgichofeixnvpoolsvuerdethsececnaalrciuolsa.tion of hazard - tBharsoeudghontthheusreeosfuscoof nisseevarluvratiaisoktnm,oihdeveCleOsCsidentifiedin he nial seven were urhr valued 22 WentofithefConitamicnanatsotfCooncnern "fTohre cthoinstasmiitenatnhtastofwpeorteentrieailnceodnctehmrwoeurgeh dtehenipreedliumsiinngartyhesciraeeln cionncalumdienamnetaslcsr,eenf.luTohriede,COaCnsd organofiuoide compounds : 23 Exposure Chanacerzaion "rTehceepotbojrescmtaivyeboefetxhpeoseexdpoosusree acsosneasmsimneantniss.Ptotdenettiearlmienxepotshuerpeap thwayh s aanrdey dmeepdeins adatnhrtoounghhwahbiicah irnd arecepnotforCsOsCpsre.senItn otnhissibea,seelxitennetecaonldogmiacaglnriinskdeaossfescmoennttam,inawtiilolnb,encodncelnuvdierdomtheantt"aalproteentniadl iEfkfe"ctexLiesvteilft(hNeOHAQELc)leeuqluaalesdaroemxcteheedmsa|x. imum ste oncentaion ind he No Obirved Apparent Ewoxpphoiscurleevetlo oCrOgaCnsismpsr.eseInntaindfodraigteotsenxipdopsoruernye svipaeccosnsviumpitnigoenstoficoonncaomulidnacatuesdefoorxagei, olinoghiigchaelr rTeehsceeapestoxropsfotmshaeeytaooflbxsiocebieycetxespvtosesredebthareosug,heirnegessitilonionfvweatneer banrd1aiidnceisides,nhtwalasindgesstieon orfsombiylie/sxeandmiimenenitdn.g 24 HazardCharscuriztionToxicity Assessment to"xToicdieteyronfitnhee hcehfefmecitsaconfadtlchosentsaymsitneamntssthoant btihoy,aftfiecst.neKcensoswalreydtgeuonfdterhstafntd,teheffmeecsc,haannidsmmosdoef aofftahcetogneonefrtahletoCxOicCosloaglilcoawlsifnrfotrhmeatsieolnecftioontohefpCOrCospirdeentsifeisedsmineSnetcteinodnpo2i.n4t.s. Next i 3 review 261 Fluoride 2I5normgaannuifcafclaorriindg caonmdpomuinndisngarheauvebicoqnturiibiunttenodautuos.thHeoewnevvierro,nmnednutsarlaolapdroocfessfelusorsiucceh, primarity trough amospheric depositioJnn. low doses, i 1s aceeped ths fuori 5 " 609-35 USFW 0804 aTroeelesirvesonefenwpeeatd anmnTaaenrd5scwnoellBna4sius2e3ps%ilp,pansweo.wisdnelsiIhe.evDoooesslfu peTrreodpSrumipkonrisoLapo,l, cp1ooarrdeniyAnmoto s,FpsseOmanK,nhowsreonav,popsaofheomoeas. eeedptitmeeinnigewacdloSyciii,, E9M0no;rpmi,cnderaeoeet9o0g:wsGdiesso.ndodeHsTrenodt19shppeonnod 242 Organofiuorides DoOrenaognieponapaeplows,etvwedenetdy.smrvai,elsvaofaiiAtn.uogAfseecIs tasu3Sicnrethelerceooncfcooensrnosf cmreheiaooarvtTouedoiasfnolupoodofrpmseeatnhpassnesspsprsoodsSuecee.dgdbuesceerveeaesseetdnmyatMeserionnanmledaadnsld faiemnthaBsdl wGseoiHgeShDtws8o,fai1s5wh9eeal7nlseaGsrAaRnoGivnce1re9a0os0eo,d 243 Amini - BoRneciaumsreiaaif oisnrsyhoenotmrooeasatidh,heltSein+ua,nu(nAtci1onb5teinfn,oiund11o6TclnmoerlpnSeenaeplry - bSeseh danhraecaocnsc henxenoofsYa.miI,t wait5e,iioqn (uATSoDR.i190). Pt aF fobpeladnoaere.ngepnpertal easeaar Tno.e Bldomnsgiafaionbofosari--nni--nomf se--sm--fod Sone oot hath ATSDR 1990 eThe lraroonasse sDaNynAmgfeomaryigYieen8etxwprienesiAronsRsndEGorp"mriiinnuefm,,riAA.lNiMnaemSasyenesnsaiemseth40 s oeeratepofdasrtinsgaodmaorleo(sRGTSatDR t199fo0t, 2ASlhoaumstaea4sk4mwadvmsrssTioh!r$s1 Gon 244 Aric SNCeavoebrenalt1r9ev3ii4enwgAaainxlsosnea.rdeeeseaasl,ewowihmneaddsis1suh(sEerratnn1em95ee.fsec(PtohocylAisso(ri1o9e7vr5)e13s900d88, rpoonergansssti,oStsovcetrookettia d4immameesaweihs ALMoeso.SoHooawnen,,eesotrooSraetlrsaeornee nes semen daar, pi 1nd 1 Concession ofaves ompoun 0927 USFW 060: n(EeiFrlrrmo19im8n8a4ns;aerAobi2c0c4ond21i9t8i1o7.n, Thae US2. EPAnd(1981)sneendit(hsoarse)t penraveadlnotn)eis fsfaoectmtores3f1or0ni7tvfesoribgarnsseisefaypgcoeonrcoetmnepa3.e(dpien17qtfuaoarlteesxpiovseAunreembfrosatAemm;eiwsehobvleeoSbooxdeys(asscoaonmlEneaenid2omnned Sorigeamnaigsamisfiacioocnobcaeums(oUftS.hEfPoAod1c98h5i.n Rowever, a 40no indiste tag 245 Bentium 12CTohmebursmotaiujoognrh.itdyBepoerfritiyhoelnboeafrgymulrolasilulpmyhSe(Breee)sbiwenaytlthlteuemae,yasvUiBpreooonnumgeehnstthhiisnwgtehwesrtesohualnntdoofseefocc,ohablnaeondinom.il p Cmhoarrd,auyotree,imnierde,tnpoholsephfnodasSttuhel,e Ggenmaanryldrsaee see.il Hwohweesr,oeelolso (ATSDR 1993a). tlDausye. otTahsacrsgsteoorcasth,eobmwicypalols,imniildarpi6etymca0tyesedlummiaanvumpe,ribeecerpydlaleimduma5mbaGyybSeineIsxoplecc(otmRepdEltSeo eRss 1ed9i9g5oh0tto "nB0erwiyalirlminuwmabeisonfmoaat gienxaspoiefcfttwceidsWrtiE,ooATbnhieofocdoeodgnraceenensaofeiosxiibeaenqny udforauendsa.snieBmsaelwsirth1mnmdec7s0sienveigdeenscleoifsoer (ATSDR 19933). msMnaodmmrsaelsdiipmaeonnsty.estA.letshsoufogrihaseeuvenraalkcoseluvoidgosisaepedoistnptotorruetslntahoednneheyggabetosetwieeoTnnooscfdscioomnfcaoemsisinearesdiinl Conceneaion1d observed txt beni organisms could ve found (ATSDR. 15938) 246 Chromium Chromium (Cca1x)is in oxidation sas ranging fom -2 0 +6, buts mt feqently iic1om9an8psv6oec8rrc.tteuadImntupobriotohotcehnersfeselraesteisrtveehallyeirsvcuetablnleydemmmwiiianvnroairln.seentrse(ey~c3n)ima,pndedhysh4derCxMoalrveyasliheosynfdatrnCo(rdx+.6ip)dweeocosxiieepdamastiiioosannbsatsatdoeisrie(pmEimesolonedr under seri conditions. Foweve,unds sno and low A conden. Cr hydroeges (rmEaniyiscrol1uc5boi8lm6ip0zl)eeaxsnidingreesm,uabitsnhaeanssceilson,iacayoCru"sgaudhnlBeoossgevonxaiiidaiSzbeaidmyptooifCCscrrsprtiherosuogvhmemomirexedinSsg ealndoanFcrtatraiioden mes sd Baris 19835: mes and Buren 1983) maTnheevsssaelntaeinalt(SsceltveeemnesnthteiLnfmo1ma9m7s6mi,alllCyhbrfyoomumniaduiminaisiilnboiengngidseSaalclimbeatncnsogth.iscoeTeh.iisnpfiottro,mbsugohnbe,cmpoioasnms. (Eisler 19863). The biomagnification and toxicity of Cr" is low relative to Cr because of w coon USFW 0606 . : . - N iascculmouwlamteiomnbrbaynaequpateimceaanbdiltteyresarnidalitpslannonscaonmdosainviiemya.ls inHotwheevleorw,er3oplahrigec dleevgerlesehaosf ubnesennodnonc.umented (isle 19863), though, the mechanismofsccumulaion remains ely C{horxoimciurmelaitsivmeultyaegesniic,ocwarncinaobgoeunitct,heantdoxticeisttyoogfniCcF,.wiAtht Chirghceoxhnicbeintginagiotnhes,reCsriost Spaetshooigaetneidcwiotrhgaanbinsomrsm,albeehnazvyimorealacimvoidyi,filcearioendsb,lodosdncphieemdiszfye,edlinogw.erheidstsoipanthcoleogy(,6 Eimoregulatry upset, erations i population scusere, and shin afphotommihens Rmuacbobpioslysfaedcchdaireiadreys Cirn tahcecusmoufltattiesdsuehsy,alcuaruosnisnegs,pecrhcoanpdirloainiynscsluelrfoistiess,(Kaundchenreuaenadl nShearbaonomv a196c7o)n.ditTihoinss,apccrumeulvateiotnnhetblnioocrnkmeagdlbalnosodpotrissoufembeutmiaerls.s.whiOcnheamreanpieremseaaibolne Gofathmsacoogntdhieetibonecwaacseltshecionnhaiiaiedntheorfeiinn.sulin production in the pancreatic Kits due 16 Cofihnmarcelolaulmsaroilvaacuduoslmes,pmihtoocnhonddarmiaalgeswveilaisnwge,llainndgyatndoplolsasosfcmiqcureofviiclt,iotnhe3fdorm1a5t8ioonf Celliningthe nephron surface (Evan tnd Dail 1976), a"Tvheeoptrreltiimsisnua,rfyolsleopweidn bCyritnhdulcieidardeospniorfatiornyflcaamnmcaetroirysrpeecausloantesdifnolbuengthtessuceareixndginogf tDoirberctonsckihnopcnoneiuamcotnwiist,h ahilgvheloylcaoempriodshilviaclhrcohmanigceasi,dattrnodphiys,aahnyddbredneigpnrotduumcoersfsokirnmautlieorns `and necrosis by a mechanism independentofany allergic response (Steven etal. 1976). 247 Copper `(CRopTpEeCrS(C1u) d9oaensd9naop1oasspi)bpleteocaharacvrienomguetna(gVeenincugporpoaplerainedsLIuRcIkSey1919907)8,).buCotppseratisesctaougse,n and acute toxicity is primarily related to this property (Hatch 1978). `rCeosppipreartoraypniegsmesntas (elDeememnatfyeoortanali. ma19l8s2)a.ndtsiasc3o5m0poensseennttioalftmoarnoynm(eFael)luoielnizzyamteons nandd f(uVnecntuiognospianlenazndymLeusckfoeryen1e9r78g)y.proEdxuccetsiosn,Ccuoninngeecsitvieontilsesaudesfotormaatcicounm,ulaantdiopnigimnenttsastuieosn, emsapeycilallye0iniantaebidllevyefhHieghlvleerve0lsosofr CaanmdodeixcfryetheepsatdiicdmoneatlabCoel.isWmh(eBnrovoekrs1c9o8n8c)e,nwzhaitcohn eHixghcCeua celeedvaeilssn allesvoel,inthhiebimteteaslsiernteialemseeabiatloictheenbzlyoomde,sca(uDseimngayhoemoetlyasl.is1a9n82d).jaunTdoixcei.c seyamlpt1o9m8s2)s.ppear when te liver sccumulates 3 to 13 imes the normal levelofCu (Demayo pArtohpoousgehd:thfeoremxaatcitomnecohfasnaibslmeoifnhaibitoi ryicsonmcoptlkenxi oewsn,witthhecfyotlolcwhirnogmmeePc-h4a5n0is(nWsiheabvee aSe.en 1fu5n7c1t)i;onimopxaiidratmieonntso(fRfeuinnceirisoanlo.f N1A98D6P)H:-acnydtionhcihbritoimoneofrheecmuceiaisoesynmdihaelstser(aMtiaornieolfm9i8x1e),d Inanucles inclusions may act 3 3 detoxifying mechanism where Ca is complexed by n 009.2% USFW 060 protein ligands, protecing eyoplasic organelles (Demayo et al. 1982), LmRuoucrmkeiendyaine1tt5as7r8ay)rC.uthtehamnosotdseernasniivmealmsanmdmaalesmpoerceiesntosiCauveoxtiocaCias.toxYicoiutyng(Vaenniumgaolpse)reesidn 248 ten rpIroroninms(aFarey)cioisnntchsoeempnmrtoodnoulfchyteimdooencogelfcosetbdeienlinancndodonitcshesenerantatililoaonlysso1f5pwSlealpnelracanesdn3tamonarjamolarrsHeotusirnacseoawifellhItoianurseeyd 2rie1ngibumilopaatoeridabnnyottcaoecxmoppemocpntleeednxttmienbcceehlaalnusliigasnrmifoixtcioadnmattaiipvnretoacpiernsoschfeososemos.ne.TshGe.endeiTrshapelorlseyt,fioaorneb,oofbito2ntg1ae0nse1t5sssptneastnotr 0foaf0ii1lnugrpeeesraiceneddntrhooefnptahtisiescbocoridhyboebsudirsfd.eonmTpheterhedmaaeysc.vhaoAnidimvseermsstoeifeltforfxaieccci,otynfbdfeogcnilntisomxwiiinctidhtoysnmcbausyespimpursooerssid|mnooily ednadmoatngeeliaanld.ceslbdraormpaigoenoofthfeerlrivoeurs(iSohnsacdkirleectlayndinBooecmigrceunlat1i9o8n4,),resting in sapiay 249 Lad aOLneddaedradnooircmgsaalnnsiotshmbasistoybmpeaiegcnnalilefyxyctteoonns8iavgrneelaytthdeeohxciugehmeesintttfiesodod(WcPihasbisncoson,nckaetnnhtdroaDutagivhoinsssc,c1w9ui9mt3ih,lhtEeisotmnearjboy1r3ip6tl0ya0no)sf the accumulation in the bony tissue ofverebrats (Eisler 19885). baPivroeelrioygciilcnaarglgevthadereissgbcrlceeu,sm.ulliIantvigoeennetaronahld,teooxrrigcmiaetntycailosef,adPbycioimndtpieofrfuaicnctudilsotnassriaencmmeoainsrgetpfhfoyexstisctaharlaencihinnefomlriugceanancliecdnPtdoo sc1eo9s8ma8pr5ot)u.inondI.ns,pTlahnnetdsm,eyPcobhunaagnh,iisbimimsbmgyartwouhwritechhobrypghraoentdoiusscyminnstghaeprtheiocmtocosstiymsvhuesrceepradecbdtliuevciettydo, smfsim(eiTsroeeasndd(tEwoaiteenr pblroecpkoirnpghytoifnosguelnfh(yHdarlyll ngdrouHpas,mpipnh1i9b7i5i)n.g the conversion of Coproperphyrinogen 10 bTmeohhreaavltiiootxriyac.lrecefhdeaunccgseedso.gfro?Hwotowhneavaneqdru,atrmiecapnraoyndduecfefteeicsvteesioeauxplhuiotbir.tgbaglenonieosrdmaschreeenmiedsxsecyeinmateehlreyattvoairrisee,dmlaeensdciohniasn.cnl1iun.dde cGaaecnucesurianmlgllmtyo,ersaPloiattyih,nehmmiabaitrtokspeotdihecethiafcnogromerasgtaoinostnh(oEifcselnheterrmael1,9n8e8ar5dv)vo.eurssAestlyyistgaefhmfeoccctocsnucrbelponroitodirohnsedemeatashr:(lEeivaeenldrs 1988), ohPrleagnartnosi0ccsa.mnauTrphraekcseoinlPttbeynt.horfoLuegpahldasncutrafntaociuenphdiaebkpieopshPiobotonfsryionnmtahsenso,ilssd,uspsl,nannesrdsgsreiollw,trhoe,swtbaeytdeu1rp0tsasokoseiortpphFtrooauncg.dh 2410 Manganese 2 080.0% USFW 060. leMangesanesevma(piMoanr)tsdseosslosetmebenckeaualryamaenafxgratenenesmieean3l8disniptnehoenrgdeaenndivcipomnramniegnactneebsumetascsoe3mrcpGoomeuprnovdnsgenfhsaovomef ocnaaisneg.orTthoe raotno osafnodilp.piRoeomonrvalfoofmmatnhganaeTsmeosipnhwearts8 moosntolreodugbhy Teoos(ioGHin10asfaTttyhess1pmeacy3ib+,ecbcioamarelo1x2if.dirzDeivpartleesneHtn.magTnehgseatnmeeesaenl(mrMary.)ExpirteMdaonimgiatnneaesesseniinan yofkof ionmnepoegunotosrigtnaoanmioocvricnogwmpiseoessosandsopfseedthinemdenoetis.sdeedpiimenenndgtsasnm,aeiTsnehlyieonnndwtehanetcceyeomfnaOyexlbceheasnimggaennipfgiacananetcsley iaootnbeeseingnaifeicdanstt(oAwTeSsDsRo1p9h90)e.vel. However, iomagaifcion in he food ha may - nShoekeaapmpeoaurntdtoobefemeanmmgiassnkeesodfesdhsiifooerrrbepneicdoenbacaerpoepseseahnremoagnbogiadneesesieyonarloneaackisneif,ovoawidriitoahbrleeli,onwwaTdithoeerne,ledOvoeneless mianngginetos rceresoesodroemdanbgyatnheesseumdbesTarapnisopn.ortTyhssem5inptrhoebgaubty(AbeTcSaDusRe 1b9o9t0h).ron 3nd 2401 Nickel mpuorrnetnibiusckneedle))clieasmnenhNdtairndc,dowmbhifinoeumdnedwaiitlhhtohethteerinsveulisermaoelnnlmtyesnutsse1fdsoouixnnidtdhneesafloorrsmsoauilltsfi.iodneNsio.cfkeaNllilcsokyhesle(sm2ua6cyh DTFeoovnreeesecaposhendnn,iinnntgdthFeenceoinrnvmeiarrnaognomaren.netsNierc(okaeulng.whilmUniadndegrh,acotiidlisco-iuclmooinfndsgieodpniosmw,eenrNtippamiarniy,ibece,ocseolsm-pebeucmmioiarnlegy aaoie snd sep to he groan: Th ypc Ni concenraton eporied nis from 4fm-p8o0raminltligcraamnsspederskiinlgog1rabmesh(amvgi/okrg)n. tTheheensvpiercioantmieonntanadndphtyssivcocahemiical0stbaiteotoafNi is ToghermioosntopfrobNaebcloenemxupmoisnuarieetdesosilo. fNTihaerertersopungohrydesaylseomnisat,heaprilmaory aofrdguso,f3Nnid aoernonpehiagtfelshoywcpeiepnlassoeibdaa,ltoanoNdni,ctrrMoeiueglhdsonolgneswxepiosgsuhuctrheh2aswvenerbeemneonicodtn1e hoinafvateneiemiaanlrgsse,x.pvoasoessdi.t,o {egos eating salivasion, and suing (ATSDR. 1996). 2412 Vanadium E{fleiemimnieznctsaO.lbTveaorneapadniibucrmiadpdooegsoenenitocfovcsaconuuarrcdneisuamirnscylaudbseuntaatcldaornwmicenxeoitnleisance$ha0,ted,eisfpfsereecvniatagleoyrissnisadncede,foTasshniedl Tiheoanveraofgveacnoandcieunmaitoonseoflvaredmiovuems xiyngoene1rdincirzusotgen,15W0himchgimparnodvens ethUsS.esgis 25200 mys (Bema cal. 1970), oThme rseoetsreooifonv.anaTdhiiumprtoocweastseursaanldlysocilooncvceurrs 35 r5e.s4ualltuobftlhTeivwaelsenhterfionrg of trhaeckmsorned- 2 009.25 USFW 060 ipsnolonuebsulrecalpaaeonnrdalvatal,hlkeaelpnirtneesoesrnomcil.esoafTnphdaeriiscmuomlaobibeiisl.lyoRfedvleacatrnieavaedseiosumoitnhiaencrisdmoiiicnlersiasollass,ff(evAcatTneSadDdRbi.yum1p9Hs9,1m:roevVdiaoenx Zinderen Bakker and Jaworski 1980). vaidnadntiahtdioinut,emm,veaspntHar,dailaunsmdyscgtorenomcwse,intnbrgiactoioconondnsicdeionnntpsal.tainoVtnanairasedmdioeurpmeenscdpoepnematmroosnnttohibenealmporoweeusrnetnptloaifnntwaaslipceescmosel.surbalIlen cmoanmcmeanltsaiobuntoftvhaencaodnicuenmtriautsiuoanlslyarfeouunsduailnltyhebelilvoewr athnd sdkeelteetailoinssluiemi(.ATTShDeRhi19g9h1e)s,t vVaannaaddiiuumm oinvetrhyeporoerspliyrabtosroyrbsyesdtnemtitsshiemiglaasritntoesottihneralmcettasan(dCatshetotnoxoivcameetcahla.n1i9s8m6)o.f . iVnatengaridciy.umDdaammaaggeedsmtahcraoipvheaogleasr minahcirboiphhaegaesbibyldoeftcrheasriensgpitrhaetomryacsryosptheamgoecmleemabrtaoneed oftherpanicles.Invivo experiments indicat thatthe mechanism of toxic ofvandium pisumbpy. inThihbsitpinugmspiosdinuecme-spsoaruysfiorumthAeTcPasae nactsoifvpmia,toewrhirialchaciraohssbicselhemesmobdriaunmcpso(cNsescihuemy ind Saunders 1978). 2015 Zine itZnirneecdu(cgZinn)bguyihsmeleesatsoleaxnoitctiiicatloynfoeoefiZndnnso.orbmMaoletahglvrloowehtihroanneedaasbrnedpcrrtionadavuetctrtesimboepnroarsieansrpy(lOaZlnnstsssoatnoncrdaagalenis1me9a8sl9s)s.sndnZdisnides iZsnniostkenliomwinnattoedb.ioaccumulateinfoodchains,because tsregulated bythebodyandexcess ZoainfndZgcnhasaibndoiuslciperrCitmaearodfyefmibecocianebnuocclyilcaenedff(eiRcnNttoeArn)faeZrnce-dwdieatpnhednmddeeacnoatxbyoerlnibzsoymnmceoesftlcehairlacciieudm((gDCNaAu)t)h.neldiHoFiasegyhn(tiGlhoeevyeeselsrs am19at8m6hm).a(lLsTu.haenPdpaaCnnoccrmreebsasisc1a9en8fd8f,ebcoKtsneainszceleuaamdenc1dc0oyVboaespntlhiVesepierctim1va9ar8cy5u)ro.lgaZetiisnoenopf<rleZflneurleoanrtxiaairllocypahicync,buiamrnudldsaneteids pinhobsopnheo.ruasndandinodtucheesmionsetreaolmsa)l(aKcaiaje(xas.of19e8n8)i.g Goifllbopniechcealuisuemdisbythea pfriicmiareynctyargoeft sCiat,e i1n58f1i)s,h. Zine toxicosis results in cesruction ofgill epithelium 3nd tsue hypoxi (Spear 25 Selectionof Assessment Endpoints Ad"TsihsseicsuitsasnnifcooenrsmGarwioiuopnh.gtaahtlehleoUrwSeed.d fdouErrPtihAnegsoeasnl-iescetcieronneecoofcsnoenoarsdisisnmaanetcnoertaaennndddpdtouhirenitnRsgettghihatonfcioer1lr1dewsBopirookln,odgeaidncadtlostTuhbeeschehqanubieicnaat oftfoyrbeeissdisep,draenmsedantomladtmftehaedalnDdurspfyil.saRhnudmn,aCygrrueasesskytshmieees.acdoTfwhoser,fsteihdteiinrsgeceaokn,mdpanoenssdteisdnsgoo.cfiLsiikveeadwriirtsiyepatorefienhsatabriieaaasls,sndAincbvlaeurdinienetgy ofirongcvauensrieesdbmrttsoeuwsravairrvdeabtkiheleiysteeylwfeeamrueennasltelgierncotiuhepedasf.snacVsisioeanssisomlfeynhtosfenetdpeyorisenitsssaf.,ortTahhvieirsaenrf,iosrakena,dstsaheqesuasasmtsiecenstpsmoLeipnsttleeadnrndepsxotiwsnnteds z 8532 USFW 0610 the specific assessment endpoint selected fo this ecological isk assessment. Ten assessment endpoints were chosen 10 evaluate the rik of conmminants at the Dry Run Creek sie: 1 protectionofbenthic invertebrate community sruerure and function 2) protecotfisooinl invertebrate community swucrure and function 5) protection of fish communities to `potential negative impact on growth, seunrsvuirvael,tohrtrediprreocdtuecxtpiovseusrueccteossc.onurminants does nok have 4) protectionofworm-cating birds 10 ensure tha ingestionof contaminantsi forage does not have: a potential negative impact on growth, survofriepvroaduclti.ve success. 5po)tperntoitaelcinoengoafticvaemiimvpoarcotusonbgirdoswoth,enssuurrveivtahla,toirnrgeepstrioodnuocfticvoentsaucmciensasn.ts in forage does not have 3 68)pportoetneicatlionnoegfactiavmeiviomrpoaucst moanmgmraowltsh,oseunrsviuvrael,thoat ingestionof contaminants reproductive success. in forage does not have 7) protectionof piscivorous mammals oensurethat ingestionof contaminants in forage does nokhave 2 potenial negative impact on growth,survival,and reproductive success. 8) protectionof omaivorausmammals 0 ensure that ingestion ofcontaminants in forage does nothave 2poteniial negative impact on growth, suravndirevproaduclti,ve success. 9) protection of nsectivorous mammals 0 ensure that ingestion ofcontaminants in forage does nok have2 negative impact on growth, survival, and reproductive success. h10a)vpaerotneecgtaioinvoefihmeprabcitvoonrogursomwtahm,msalus tro envasnudirerevtphraaotdiunlcgteis,vteiosnuocfcecsos.ntaminans in forage does not 26 ProdofTuescublteHyipotohesnes Tonhethteesmtaebclheahnyipostmhoefsecsoanrteamspiencainftictroisxkiqcu,estthieonnsuthmbearorefbeaxspeodsounrethpeaatshsweasyssmetnhtatenmdapoyineixsi.st Bfoarseadn assessment endpoin, or other factors, there may be mare than one question for each assessment endpoint. Astrreuclteuvreelsaonfdsiftuencctoinotna?minants sufiient 0 have negative effects on benthic invertebrate communicy Astvreuclteuvreelasondfsfiutnectcioonnt?aminants sufficient to have negative effects on soil invertebrate community Arerperoldeuvcetlisveofsuscitceescso?ntaminants sufficient to cause direct toxicity (0 fish growth, survival, and Ate levels of site contaminants sufficient to cause negative impacts on growth, survival, oF reproductive successof worm-eatingbirdsduetothe ingestionofcontaminated forage, soi, and water 2 009.25 - USFW 061 on the site? Arerperodleuvcealisveosfucsciteessocfoncaammiinvoarnosussubfifricdidenutetto tchaeusinegensetgiaotnoivfeciomnptaacmtisnaotendgfroorwagteh,,ssiu,rvaivnadl,waatnedr onthe sie? rAerperoldeuvcelisveosfucsciteessocfoncaammiinvaonrtosussumfafimcmieanltstdouecatuosetheneignagteisvteionimopfacctosntaomningartoewdthf,orsaugrev,ivsaoill,, aanndd water on the ste? rAerperoldeuvcelisveosfucsciteessocofnupaimsciinvaonrtosussmufafmicmiaenlts1d0uceatuosetheneignagteisvteioniomfpaccotnsaomningarroewdthf,orsaugrev,ivsaoli,, 1andd water on the ite? rAereprloedveulcseosfucsciteessocofnoummaiinvaonrtosussumffaimcmieanltstoduceatuosetheneignagteisvteionimopfaccatnsaomningtroewdhf,orsaugrev,ivsaoli,l, aanndd - water on the site? Arerperodleuvcetlisveosfucsciteessocofnitnasmeicntainvtosroussufmfiacmiemnatltsodcuaeutsoetnheegiantgievsetioinmopfacctosntoanmignraotwetdhf,orsaugrev,ivsaoll,, aanndd wer on the site? Aretperoldeuvcetlisveosfucsciteesscoofnhtearmbiinvaonrtosussumfafimcmieanltstdouceaousetheneignagteisvteioinompfacctosntoamningartoewdahf,orsaugrev,ivsaoll,, aanndd water on the site? 27 Concepmial Model `pTahtehcwoanycsep0rutahlemseoldeeclterdemlieeassounrecmoennttameinndaponitnatnsd.haAbtitthaetDcrhyarRacutnerCisrteiecks stiotei,decnotniafmyicnraitnitcaslienxtpoessuoriel mmaamymcalosm)e iinnhacbointtiancgt twhiethwosoudbesudr,fwacee(tealratahnwdnoordmpse,)na(nidedabaorveeas-ogfrotuhndsitteer.resStruibaslurrefcaecpetotresrr(esstmrailall rinecseoptmoerscaisnesh.estheeairnetaesntmiaonyalbeinegexstpioontsoofsesotdle.coAnbmoivnea-ngrtosutnhdroteurgrhesdtriiraelcrceocnetpatcotrswmitahythbe seoxiplosaendd. 0thecoinngteusmtiinonanosf tohtrhoerugahbdoivree-ctgrcoonutnadcttewriretshttrhial sroecletphteori,ngtehsetiionnciodfseunbtaslurifnagecsetitoernorefstsrioailaodrhgeanriesdmst.o food items. and the intentional ingesoftsuirfoacne water from anyofthe on-site surface drainages. a`Tvhe waooordfedtieraeresetar,yiarlipaanrdiaanvairaena,reacnedptmoersa.dowForareexaampplreo,vidsemdailsltionmcntihvaobirtoautstympaemsmthaalt mmaayy soucpcpuopryt thorneeoerhaalblittshedhaibliytaitn tsyepaersc,howfhfeoreoads,itaenms.indAivviidaunalpicsacmiivvoroersouasndmcaammmiavalremsaymaryegubleaerlxypoasveedrtsoesiatlel ccoannttaammiinnaatneidspirneym.utchehitnhceidsenatmael iwnageystai5onanofasbooivUese-dgirmoeunntd,taenrdrestthreicalorencesptuorm. opTfhtseuircfooancnseuwmaprteisomnaoyf transfer conaminans o these receptors. p`Tahtehcwoanycsep[r0uatlhmeosdeelelcteeldemseoansucroenmteanmtineanndtpoainntds.habiTthatecphraerlacitmeirniasrtyicrsitsok isdcerneteinfyicdreinttiicfailedexmpeotsaulrs,e sfeludoirmiednet,.3onidl,wraincdhlwoartoefrl.uorBoemnetthhiacnemaacsrothienvperriembarraytec,ontfashm,inaanndtsteerxrceesaeidailnginbveerntcehbrmaatrekssmianysibtee 2 00.34 USFW 0612 eexptostede0rc.ohenacmoinnaeinerdstsieodnimofenth,ecwoantaem,ionrasnotilsdofocuognhcdeie{otutnodxincithy.e sFoermtehne,puwraptoesre,soorsofiilswiesrke Coovmeerlcabtreadtewsithhtooxricitteyrelseiveallsiindveennteifbireadteisn mthaeybcoerartesFpisokn.diTnegmteosxwiiciatlyreecsespttoorsdemtaeymibneeexifpboesnetdhitco ceovneamriencatnodrsbymfy ealoeboendoerigaxnnispg1mscowohnitscahmiehnaavndetsacrcuommulfaotoeddiCngesO iionntaeC nid viiss asuiensc.idHeingtahlerigersocpihoinc oPfastolhlssctaoimtehntreifnerdenwcaera,raTsheapmathmwaayy ionvtohleveregfreoruenndcweaatreera amnesapdoorw. isTuhnekfnoolwlno,wihngowpeavtehrwatyhse Tere evaluated in tis risk asessmenc I 2B)etheDiinrveecntcberaxespoosseudirmeent I 2SoilinveDricbsratieesxposure tosoil mo Fais Dist expostouwarteer W. WomeatiIngnbigrdeofsetxviwaormns b) Incidenalingestion ofsoil Incidenalingestion ofwater : Vv. C5amiveroIusbningd oefssmatllmiamomanls b) 9 Inicniciddeennttaallininggeessttiioonn ooff woialter VI. CamivoroIunsgmesatimomnaolf small mammals B) InIcniciddeenntaalliinnggeesstiioonnooffwoialter VIL P5iscivoroIusnmagmmeaolsfftoraigeoinsh 59 Iinncciiddeennctaall iinnggeessttiioonn ooffwsaetdeirment VIL. 9OmaivoroIusnmgamemoasflftoraigeoisnh b) IInncciiddeenntaall iinnggeessttiioonn ooffwasetdeirment IX 0InsectivarIounsmgamemoafselatrtihwoornms B) IInncciiddeneanlliinnggeessttiioonn ooffsewdairment X. Herbivorous mammal . 2 008435 USFW 0613 9b) InIcnigedsetnioanloifngveesgteiaotnioofnsediment Incidental ingestion ofwater 28 Selection of Measurement Encpoints Mcheaarsacutreerimsetnicts esnedlpeocitendesasaraessmeesassmuernatblenedpeocionltosg.icaMleachsaurrsecmeernitsiecnsdptohiantasrshroeulladtebdetiontkheed v1a0luheed aseesussmeedntdeernivdepaoqiubanynitchsaetimveeexcimahteoafotfpnooxtiiecinttsyiaalnmdetehcetr,ouatendoffeoxrpmoasubraes.isMoeraseuxreeampeanltaieonndpoinhte, assessment endpoints. pMoetaesntuiraelmefonrteexnpdoposiunrtestwoerceosnealmecitneadnotn tohfecboansicserofnp.oteTnhteiaalvapirleasbeinlcsey ooffrheceepatpoprsroopnrisaitee, taonvdictihtey . sienlfeocrtmeadtiwoenraen wdheitcerhmiisnkedcatlocublaetiroensprcesocnbuievbleasodefdewxapsosu1sraenpiampworsan2tncdonssiedsersamteionnt. Eenndcppooiinnttss entiied for he site. iNenxtSies catliosn o2.5fspecific measurementendpoints thatcorespond othe assessment endpaias identified Measurement endpoints for assessment endpoint: : protectionofbenthic invertebrate communides sructure and function TcoolleevcatleudatreotmhefisvreulcotcrateioannsidnfDunrcytiRounon.ftEhxeisbienngthciocmcmoumnmiutnyicsyz,ucbternetheiacsmeavcarlouiantvederaibeaatcehsowfehree fgirvoeuplso.cations by deeming taxonomic diversicy and rough an evaluation of fnctionl feeding aSteedciam.enTthweaesnadspooicnoslloefcheedsien tceastcsh woefrehe sufrvvivaarleaansdfogrrotwotxhi. cCoelsltoiangteudsisnegdithmeenatmspahmipploeds, wHerae l31e50 Csiozlel,caiendd aontdalanoarlgyazneidcfcoarrabrogne(aTnaOlCy)t.e lTshte(TcAhLe)mimseadaylsr,esBuNlAs'sw,erPeetshtePnCBcso,reVlOaCtesd, wfiutehriodeb.sesroiend adverse biotic responses inthe toxicity tests in order to determine risk potencal. Measurement endpoints for assessment endpoint: protectionofsoil invensbrae commanity srucere and function "mTeoaedvoawlualotcatthiesonusearntdeteasntde ufsnicngiothnoe efstrhtehwBoernmi,icEsceonmimnfiocyr.asoiiltwoxaiscictoyltleesctst.edTfhreomenedapcohionftsthoef htaersgeetteasntaslwyteerelsstur(vTiAvaLl)amnedalrso,wtBhN.AC'o,llPoecsatvePdCBsso,i sVaOmCpsl,esfwlueorreidae,logrcaoilnlescitze,danndd taontaslizoregdanfiocr carbon (TOC). Measurement endpoints forassessment endpoint: pnergoattievceotfiimfopiasnchtcoonmmgunriotwi,esstuorveinvsaulr,eatnhdatrdeiprsocduecxtpiovseusruecc0escs.oniaminanis does not have z 065.35 USFW 0A14 iFnatDhreyadRumni.nnTohwe,enPdipmoeipnhtasolefstphreosmeeltaesst.s xweirceisyurevsivsalwearnedugsreodwttoh.detCeorlmlionceatheed wtaoxtiecritsyoamfptlheeswwaetreer algrsaoincosilzlee,ctaenddnodtalanoarlgyazneidccfaorrbaorgne(tTaOnaCl)y.tTelhsetch(eTmAiLst)rymedraelssu,ltsBNwAe'rse,thPeenscuoPrCrBelsa,teVdOwCish, afblsuoerrivdeed, : adverse biotic responses in te toxicity tess in order to determine isk potential. Measurement endpoints for assessment endpoint: hPraovteecatinoengoaftiwvoerimm-peaxcitnognbigrrdowsttho,ensusruvrievatlh,aat nidngreesptrioodnoucftcivoentsaumcciensas.nt in forage does not 5F5o1ofdeecdhaiinng aacrceua.muTlahteiosenlescttueddiemsewaesrueresemleenctteedntdopoeivnatluraetceerpitsokrtsopeacviieasnisptehceieAsmewrhiiccahnuotibliinz,e tTheurstde migratorius. Appropriate forage species (earthworms) were identified fo the sbove receptor, and the dieary exposureof for these, or other rcloeselcy reelaoptceodntstpaeomciienrsa.nsts was quantified and compared to existing toxicity data Measurement endpoints for assessment endpoint: hPraovteecatinoengoafticvaemiimvpoarcotusonbigrrdoswttoh,enssuurrveitvhala,t ainndgersetpiroondoufctciovnetasumcicneassn.ts in forage does not Food chain accumulation studies were selected t evaluat isk to avian species which utilize the site: jaa5m.acfieeardsiinsg. arAepap.roTphreiasteelefcotreadgemesapescuireesm(esnmtalelnmdpaomimnatlrse)cewpetorresipdeecniiesfiids tfhoer trheed-sbiolveed rheacwekpi,orB,uraenod - tdhaeadifeotratrhyeseex,poorsuortehoerfcrleocseepltyorrseloatecdonspteacmiiesn.ants was quantified and compared to existing toxicity Measurement endpoints for assessment endpoint: Protectionof camivorous mammals to ensure that ingestionof contaminants in forage does ot have a negative impact on grou, survival,andreproductive success. Food chain accumulation studies were selected to evaluate risk to mammalian species which utilize the sie and adjacent areas. The elected measurement endpoin receptor species is the red fox, Vulpes dvuilepteasr.y eAxppporsouprreioatfefroercaegpteosrpseciecson(tsmaamlilnamnatmsmwaalss)quwaenriefiieddentified for the above receptors and the Measurement endpointsforassessment endpoint: Protectionofpiscivorous mammals to ensure tht ingestionofcontaminants in forage does ot have anegative impact on growth, survival, and reproductive success - tFhoeosditcehaanidn aadcjcaucmeunltaatrieaosn. stTuhdeiesselweecrteedsmeelaesctuerdeomeenvtaelnudaptoeirnitskre1c0emptaomrsmpaelciieasnasrpetchieemsiwnhki,chMuusitleilzae evixspoon.sureAoppfrroepcreipattoersfo0raCgoenstpaemciineasnt(sfiswha)swqeuraeniifdieentdified for the above receptors and the dietary Measurement endpoints for assessment endpoint: 8 00027 - USFW 061:  Pnortotheasvieonaonfegoamtniivveoirmopuascmtaomnmgarloswttho,esnusruvrievatlh,atnidngersetpiroondoufctciovneusmuiccneasns.ts in forage does hFoeodsitcehaainndacacdujamcuelnattiaorneass.rudiTehsewseerleecsteeldecmieedatsoureevmaleunatteenridspkotionmraemcmeaptloiranspescpieecsieiss whheicrhacuctioloinz,e Pirdoenctyiofnieldotofro,r tasheamaobdoevle froercoempinoirvsoraonuds mthaemmdailetiaarny sepxecpioess.ureApopfroFperGieaptIeOrfsora(g0ecsopnectiaemsin(aanht)swwearse quanifed Measurement endpoints for assessment endpoint: : Pnortohtaevienanoefgnasteicvteiviomrpoaucstmoanmgmraolwasht,oseunrsvuirvealt,haatnidngreesptrioodnuocftiovneasmuicnceasnsts in forage does - tFhoeodsitcehaainndacacdujamcuelnatdiaorneass.tudTiehsewseerleecsteeldecmteeadstuoreevmaelnutateenrdipsokitnotmraemcmepatloirasnpescpieecsieiss wthheicshhoutritlitzxe sspherceiwe,s B(lcaarritnwaorbrmesv)icwaeurdea,dend3femdodfeorltfhoeraibnosveectrievcoerpotuosrsmaamndmatlheiadinetsapreyciecxsp.osAuprperoofprriescteeptfoorrssgteo contaminants was quantified. Measurement endpoints for assessment endpoint: Protencothiavoenaonfehgeartbiivveiormopuasctmoanmmgarloswtfho,esnusruvrievatlh,atainndgersetpiroondoufccciovneusuumcicneasnsts in forage does tFhoeosditcehaanind aadcjcaucmeunltaatrieoansstTuhdieessewleecrteesdelmeecatseudrteomeenvtaleundaptoiinstkrteocempatmormaslpeicainessspetchieesmwehaidcohwulvoilzee, (Mviecgreottautsipoenn)nswyaisvaniidceunsti,fi1e5dafmoordtehefoarhbeorvbeivroercoeupstmorasmmaanldiatnhe sdpieectiaersy. eApxpproospurrieatoefforreacgeeptsoprescie1s8 contaminants was quantified. 29 Life HistonyExposure Profile Information seRxeepcloespeetcdofrtooscpeoevncaitleausmaitwnieaornnetisnsbeteliecscatuiesdke foarfsoesmpsescsmieefvinecrta.blehTmahovepioharivsc,allpaeavbreiellsr.nyos foOfhragpaparnboipasrmiaustseew,hsoiofcxhfceiweydeirinengfohlirakbmeialttysioownearbnee siwpnhevicecirethsebsrrieasltkeecrtceeacdelpcftuoolrratthsiieoslnesicstckeoaduslfsdoersbtshemisebnaatssaseerdses:wmemansetaaidslosthow avenoalri,tmhspwohorortrmat,nttiTlhcseonhtsreierdwee,rsarrtiaiacolcno.voenr,gTmbhirenaktt,eramenceedsptrtaeoldr hfoax.wk.ThTeheavaiqaunarteiccepvteorrcespbercaitesrescleeptcoerdsfpoerctiheiss froirskthaisssiessksmaesnsteasrsem:enAtmiesrtihceafnatrhoebaidn mainndnroewd.-aiTlheed aquatic inveriebrate receptor is. xteca. 29.1 Theamphipod (Hyallela cecaa) RepresenotfaBteintvhiec Inversebraes cHosnatlalcetlawiatzhtesceadiwmaesntfsoelrecatseidgnaisfirceapnrtespeonrtiaotinovefotfhebierntlhifieccyicnlvee,reubbriaqtueistdouusedtiosttrhiebiutdiiornecitn aquatic systems, imporance 2a food tem for aquaic-invertebrate consumers, and eas of 009.35 USFW nR1A usseediinmelnatboartatthoeryDtroyxiRcuitny Cevraeleukatsiioens.. These species are also likely to occur in the surface - LifeHistory(Fvallelo greed) Trihveerastmhprhoiupgohdo,uHtyNalolretlhaacnd StouitshecAommcemroicnaal.yIfnopurnedfeirnrreedshhabwiattaet,latkheesy, sareeakmnso,wpnontdosr.eaancdh daenndsidtiitecshiens,exbcuetsgseonfer1al0l0y0inpelroswqeuranruemmbeetresr.(TU.hSe.yEmPaAy 1a9l9s4o),be foundinsloughs, marshes. THhvealylteylpaiceatlelycabsurreoewpiinbteonsthuircfadceewisteidviomreenstt,haantdfeaevdoiodnbciogahrtselipghatn.iuBlecaatuesoergoafnthieci mafteeerdiianlg. aFnrdesbhewhaatveirorsaeldichmaernatcst.erisAtviocsi,datnhceye are of ilidgehatl bteystmoorvgeanmiesnmts finotrototxhiecosleodgiimceanltevkaeleupastitohneosef organisms almost constantlyin contact with sediment contaminants (US. EPA 1993). `Rgraethoppodrs thoitntadrheispucrreuscsuamctaebalniyiussoseedxfnuoalh.oMladliensgatheelfaermgaelrtehdaunrifnegmsamlpesleaxnudshaanvde larger ont copulation. `SDeuprairnagteasmtpelmepxoursa,ritlhyemwahlileeatnhde ffeemmaallee fgeoeedsttohgrefaoomtruoalhpgteiernhigordpoerfioudp. tIomomneediwaeteekl.y Tahfeteptahier - mthaek,tfehmealtew'osremjaoirnsuapniducmo.pulaTthieon fbeegmianlse.Dsuwreienpgs ctohepuspleamtthiienomtoanl,heerrelmeaarssesusppieurm.mneaanrd . spliamcuel.aneTohueslayvreerlaegaesebsreogogdsfsirzoemohrerfeomvaildeucyta,ilnltoltaheazmtaercsaupisiu1m8,wcghgesrpeefretblrzoaotd.iobnutatkhei.s umbcaenvarry with environmental conditions and physiological sress (U.S. EPA 1994). uDnedveerlgoopiensgaesmebcroynodsmaolntd. haAttchtheadtytoiumne,gatrheekjeupvetniilnesiHdyeatlhleelfaemaatleec'sa maraersreulpeiausmeduinnitlo sthhee Sounreroburnodoidngduernivnigroenvmeernyt.tenUnddaeyrtfismveorpaebrlieodco(nUd.iSt.ioEnsP,Aea1c9h94f)e.male produces approximately fFivesytageaastealrceajhulavevneiealemsiltnagiemsa;uminsotaf9rs i6nsaanrds,7wiftohrm t1h0e8apdroel-ersecpernotdsutcatgievse; satnadgesst.agTehse8 fairnsdt higherare considered adult (fully reproductive) sages(U.S. EPA 1994). Expowre ProfileforHvallelaGteca `rSoiuntceeodfierxecptoscounrteacftorwiHtahlclolnataamziineactaedinstehdisimreinskt aisnstehsesmteonxtic,itthyeerveasluualtsoiofnthis ttheestpWriilmlarbye used to indicate exposure. 292 Earthworm (Eiseniafoerda) as RepresenoftTaertreistvrieal Invertebrates . Ehaabrittsh,woubrimqsuiwteorues sdiesltercitbeudtiaonrtehprroeusgehntoauttimveaonfythearmbeisttartisalanidnvseoritlecbornadtietsiodnuse, taondtheiimrpfoersadnicneg imiincprrofolvoirdai,nganad fmoiocrdobfaasuenaf.orcommabniynesdmawlilt-h tdiormecetdciounmt-ascitzweidthprtheedastuorrrso.unAdidnigetsaoifl eprietsuenst,s 2 potential link benveen soil contaminants aad soil-inveriebrate consumers. In addition. 0 009.09 USFW 06 exhwarms wer observed in both the waoded ind open field ares ofhe Dry Run Creek Life History Empliaacrnrthofwlliaonrreram.sndNfeemxeidtcortnoofdfaeouanoad,.atThnidhredemecopasrytiiminagmrpypolsraoanrtnetasardeofqaufnioiromedamierndetemsaadionpslsannkderoanmftartees,tlrveei:sngwpaseirl crinoonsusiegrlhvawttiithohnbvomederycyhwcaaonalirsswemhsitecaxhrteumrpueo,sotirlbyesodKielesvpetwlimotpoheidhs:i.grheEslpaaiyravtcioeonntsdeenpwexendFgseegnoonenadsloifyffusishigeohennoefnofgtaamsles.s and in sil wit api of es h4(nLec 1985). . Emocaacrnudyrhwwsoiprehcmaisuetsaarcalhneiarllmaoip,phrrooovddauircdiecsa,cnoodcvoimodonussetsp,saparehnceidnesoogresenpbercyoidctuahcleey.bvyiscSareosxs,su.ablfurteipmlraiozedtuoircoginao,nnsskwchoeomunegothu aeinsmedanLdtaoelf.,y w1Te9lh7le.7g,proopwunlaitimomnatorfean(sedaorltehcweonrtm, Aspreceie,s iatndanseyneosnceenitmdeiicdounnsilos (ofwayoruensg edEeassniihsccwadoterismoinsacnhaadtvoaenmsbaeivneedrnattlemcwpoaelyrdsaatonufsdruehreevaixtv.eimnIegn seadrmveusrcoshefpmeonopvruielraoetnaimseoilnnytsatulhrvacinovnamld,aiitoneescisonccohhovni1sduscsoaisln.. Worms may also migrate to deeper silo undergo satesofinaciviey unl nvisonmenta conditions become favorable once again (Edwards and Lofty 1977). JpSoroeolmiidefae,rsaptpeeocdsisfeesrsosomafthwroaodrwumilstngngurzmoobnweertlohofcraostueegdghjmoseuttntitsnhuferproonnltiovhfeastthcbheyianngcusoa.nntidOnuinaneclrsleyasspaeedcdiiinenss,giuescewghimatehnotust. ainpcprreoaxsiinmgatteelynu4.5mybeearrsoufnsdeegrmelnatbso.ratTohryeclonfdistpiaonnso(fEEdiwsaerndiasfaondrdLsafwyas19r7e0p)o,ried 1 oe Exnosure Profile. D(r0iisrekevcaatslscueaostnsemtearncits.wkitStouhrtvchioenvstaealmoinrngdaantgiersdomsswi.elhTei inshdsepuoepirrnesisicfdoyulelrooawuniatnlegyofseiesxxpwoipsluaar1setof1obsrecasorlntsdhuwwcoitrlemdsboeinnvtitheoides Worms to determine exposur to higher ophic level organisms. 293 Fathead Minnow (Pimephlespramela) ss Representatiovfe Fish Community Alustification cTaqahumeaptofisacithdseyaasndt,emmisir,nentiomwcopnwotaarscatsnewlic2ete5chtew8dao2eordrteehprrmoeusgfehomorauttsihtveeeoftfoiemnngciyvcclooenr,sousumbseurfisi,tshoaudnsudedessoesietosouftadiioeetnariny laboratory tock evaluations Life History ~ a 069.7. 5 USFW nae . : - "vTahreiefraytohfeahdabmitiastsnsowu,c.h5prsommaelllss,caisnwsi,deploynddsi,sgainodutsedllin Nlaokrest.h AImtesriucnacaonmdmoisnfoounadbsiennat ainndselaowmsooxfygmeondecronacteentarnadtiiognhs (grUa.dSi.enEsP.AI1s98t5o).lerant ofhigh temperature, high urbidiy, aTahceplfaatnhceoand,miAndunlotws fieperdiomnarialqyuotmiaiivnosreocutss,.woYromusn,gstmyaplilcaelulsyafeceedaonsn,daendnsot,hearlagna,imaaln,d Ths species is considered an imporaant food sourcefo oher fish and birds (U.S. EPA 1985). SAduumlmtera.heTahdemmiinnniomwusmspsapwanwniintghetsepmrpiengraaundecsopnpteianruse o1 sbepaawpnptrhorxoiumgahioeuyt m16asCt. ofTthhee aovsahrieeesgogfsthmeatfuermea.leTshceoanvteirnageegngsumibn elrl osfeaggegssofpdeervseplaowpnmepnetr,fenmdalethiesy1s00p1a0wn15r0e.peLaatregdelry afveemraalgeesambaouytlsaxy 4da0y0s.toI5n0w0acrgmgswapeterswpiatwhn.an Haamtpclheinfgootdimsuepspdley,pesnpdawonnintegmmpearyatoucrceuran3ds ucarrilnygastthheesfecsonydeayre.ar.IncSouorlveirvawlaotetrhweitthhir3dmyoedaeriratreelfaotoivdelsyupupnlyc,osmpmaownni(nUgS.usEuaPlAy o1c9c8u5r)s. ExonsProfle oSfienxcpeodsiurreecfcoonfaachewaidthmcionnntoawmsiniantehdiswartisekr aisnsheesmteonitc,ihyeevraelsuualtsioofnthsethteetprwiimlalzbyeruosueted to indicate exposure. : 29.4 American Robin (Turdus migratorius) 1s Represenativeof Worm-cating Birds sification bTehceauAsmeeroifcaisn urboibqiunitwoauss sdeilsewcrtbeudraisonreapnrdesdeineaatyivcoofmpoomsniiivoonr.ousThaendprceafmeirveanrceoufsobi5r0dis cnavmeirveobrrotuessreince6psioormniivhoirsourisskdiaestsaelslsomwesnth.isTshpiescisepsectioebseiusaeldsoiskoetlh taonoocmcnuirvaotrothuesDarnyd Run Creek sic. LifeHisory `"TChaenaAdmae,rwiicnatenrrionbginin(tThuersdoaustmhiegmraarlofisof)tohcecuUrSs.voMuegxihcoou,tamnodsCeonfttahle cAmoetriincean.alGiUvSe.natnhde tiinmcerse.aseHaibniotpaetnrehqabuiitraetmeanntdslfaowrnsb,retehdeirnogbrno'sbibnreiendcilnugderaacncgeeshsatsoefxrpesahndweadteirn, tphreotreeccteendt nfeorsetsitns,g ssewsa,mpnsd, oppreonduwcotoidvleafnodrsa,gianngdaortehase.r oTpheenseesrse.quiNeomne.nbteseairnegcormomboinnslaycmceutpyinsimmoiilsatr habitats altough proximiy o rit bearing wees is of more imporance "vTeheliprnigmairnyvfeorrcabgritnge,taecihhnoiuqguheftoheyrocboimnmsoinltyhsoepacahloonrg hseecgsroaunndd finutseianceheofbgrraonucnhde-s Sa5omweellf.uiT,hbeurtofbiun'siditehetpdruirmianrgyhfeoobdrceodnisnugmesdeaosuotnsicdoensoiftsthsembarieneldyinogfsienxvseonr.tebArastersabainnds ewexihgihbtitainlroiwcdiogemsetievtetehfefiircmieecnacybofloircfnuele,dsth(eUySo.feEnPAco1n9s9u5m).e mare than their own body 2 069.11 USFW 0619 Btreemeodriensg dtuerriinogritees bwreeceisntagbsliesshesd;bwyemvalee,rodbeinn.siMioessoffroroabgisngweochciugrhs icnlasgivteontahrsee oOrusiifdfeooofdtrhesoburreceedsinagrepleirmiiote,d.roabdiulntyrpoibailnywirlalmav1e thoeeumpmoerfaorrsagionrgssgveesnedwreoro within |to 3 kilometers (km)ofthese areas (U.S. EPA 1993). ExposureProfile AT(eUdrSur.littEoPArAmy.esra1i9ec9s5a)nv. arTyohbfeirnloomware0es3trre0po1eraecdrpeb,tooWdoiwylewhiegrfihogrhfaetgr(ion7mdg.7h37o.gm3 eatnoadn1gt3he5es.8sragplo(erUseSd.rpeEPpA.o21h9s9o3ms).e ange of (0.3 sere) wer assumed for tis isk ssssmene. ABAmfeWoroidicaiarnecgrreosbpaiionorncyearndabtfeo ofetx0hpi.esc9stpeetdc0it1o.5c(2UoSn/,sguEmBePWAi11d17a9.9y53)ag./nddAaysasowfufamotionegdin3ng7eds.t5i1o0bn8otgdeyowaofefiw0g.y14ahgrag0 "(Tch3e.d.iectaorfwtohermAsm,ersniacilas,robbienecosnsicsttespoiflsaensss,osnplildyerv)ianbdleFpirtop(o5rd.ondsoopfainvte,ridbreamt,s sSaunmduacm7,mphaeanreccdkerbneatrl,rlif,etrsei, driainsaptrbheyerrcisoepmsrp)ion(sgUi.(iSno.ensEriPnAgesp1e9a9os3o,rnt)oEthcr1hl0eai.nc9dgh3eept9 Eeoralc.en1t988pu)e.rtcenDatunrvdiengrpseoprrcniennagt, piencvceretnetbrFautets1i0ndf3al (pmeircgernstoriynvseetrscobna).isT(hUeSs,uEmPmAe.r1d9e53c)a.yFporrophoertipounrpiosreespofoirseadsi6k3 Tscssment. adie of 100% ertormswillbe asumed. AHWoonwoecdvicedorce,kna3wlilssliolbeiinungsgeeessdttii1osonn3arseiuefbosoiftth1ee0A.i4mngeperesritciceoanntoaboeifnftoceroutdlhdieenAomrseebpreairfceoadunffdooribntth(heeBeAtpmeeerraitrcaa,.n A15m9e4r)i.canAsrsobuimninig1222fogo/ddayi,ngestion ate of 117.5 g/day, th soi ingestion re for he 295 Red.uiled Hawk (Bueojamaciens) as ReprsentivofCarmivorous Birt, lustification TcCohrmeepsrosseictd.iiolndsedhaeatwvkaellwosawhssusnfdoarenttheldeisvssaebluuetacptirioeotnsn,eonefaanciddovneltiakomeilfainhacotaoidmoinovfoioncrsociuuesrseboinrscd.eduIentdheittsDirdoyineRtahurey dcoosnceentozatthionreodfctoinlteadmihnaawnktswhfiucnhdalilnoswmsalflormtahmemvaallainsisuoenwoiflcolsncparmonvitdse sinn heeufrooed LifeHistory R15e7d7)a.leThdehisawhkasbisaeithheimghlty vcaoimamblo,nabuntdhweiyderserecsodmmAomnelriycfaonuBndurnew(oBoudledsnadreFaasrreasned oCfpoGerneS.la1nA9d8n.7)a.TahpeThyoirslsnsipeticeniheasFbeiidtesprlv,aeihnnse., hpeorGwieciveeegrdr,ovfaeosw,mkatduRnudGresae,RrasnominraahrpeeeriwncehsxtsoeernnosniUvtneietuewndibnrSgoikrfeeonsr 5 000.55 1I]FW NAR2N -. wfoeoldienrg sspescuicehs),a tsempailllesm,aimnmseacltss, (aen5d.ocmciacsei,oncahlilpym,upnrkesy,srpaebcbiie)s,thbaidarse (0us0uahlelayvgyrotuonldfs offhe ground (Burton 1999). 2Thpeerberneeadnidnngessecabsuonidianrgswbyitbhotshersieaxlecso.urNsehsitps dairsepplalyasc,ecdoimn mtaollnleysfsohlilgohwreobycdkmlaetdigensg,oonr {aoltl ecaeeegags asnr codfteanorureftubreybibsodhtehd asenxensaunadfaolrltyfosreinacpopnrsoexciumtaitveelyyea3r0sd.aysI.ncuTbhaetiyoonuonfgwarae Babulronf1e9e8d9t)hemselacv4etso weeks and fledgien about 45 days (Bul and Farrand 1977; ExcosreProfile FAdeupletcimvaelley(DaenGdrafaefmaalnedrReudd-iusil1e9d83h;aUw.kSs. EaPreAr1e9p9o3)r.iedHotomeweriagnhges9v60ayfraonmd 114.82.3256 1g6. 395.36 acres (Kirkwood 1980). Smales reporied home rangeof 1T48h.e2l6aowceesstwreerpeoarsesdubmoeddyfowretihgihst roifsk0a.s9e6s0smkegnta.nd the "iTmhpeodriaenocfeawrietdhasielsesdonhaawnkdcaovnasiilsatbsiolftyma(mU.mSa.lsE,PAb.ir1d9s95r)e.pilFeo,rnthde ipnusrepctossewshiocfhtivasryisikn faastseessasrmeenrt,etpheohratotwkreawndgie.llbferoams1s3u6me0d.040c0ogn/sduamye(K1i0r0k%wosomadll19m8a0)m.mTalhse. hiFgohoesdtirnegpeosrtiieodn oofopdpironximgateelasty0i.of0o5490n0g/gg/dBaWyiwdaasyahsassubmeedefnoetshtiismartisekdfaosrstehsismsenstp.eciAeswa(tUe.rS.inEgPesAtio1n99a5t). rTeopoerxtperdesbsodtyhswveiaglhutionfun5i6t0so1fgy/idealyd, thweawtaritnegeisntigoneastrtaotiefwo$a6ns.6m4ultidpalyie(d3b6.y64thmeLUldoawye)s.t nAesoaimloiungnetstoifonsoriaeprfeodricttheedrteodb-ealeendtrhaaiwnekdicnotulhd ndoitgebsetifvoeuandctinofthaewlhiitetr.atfuoroettehdermeofoursee, hwaass bueenstorceapelocruledadte(Btehyiservaltues.l. A1s9o9i4l)infgoersttihoenwrhaiteceo-ffloesotedthmaonu2sep, erFrcooemftnthhteisovtalaued,it3 Tcooontseedrvmaotuisvee.soTloienxgpersetsisontirsatvaolfue19inpuenrictesnotfogftahy,ttohle sdiieltiwnagsestaisosnumaetdfoof 1t9hepewrhcietnet w1a9s9m3lt)oipyliiedeblsyodtleinfgoeosdtiionngeasttioon frte0.0o9fgt/hdeayw.hiTth.ifsoovtaelduemwoaussaes(s4u.m50edg/tdoayr)ep(rU.eSs.entEPthAe Caomnosutnatntoofvesroiltiemen.aiTnoedexpinretshse 0d.i0g9estiivneuTniatcsk ofogfrtahemswhoiftes-ifloopreerd gmroaumosfemtohautsreembaoidnys emioguhste,(tMheirsrvial1u9e8w7s)tdaivyiideelddbyvatlhueloofw0e.s0:0r7epgo/rgteBdWo.dyThwiesigvhatlu(e1 wag)sotfhtehnemwuhltiiep-lfioeodtbeyd he food ingesrtteiofothne red-aled hawk (400 g/day) 0 yield soil ingestion rate of2.3 way 296 Red Fox (Vulpes vulpes1)s Representative ofCamivorous Mammals Justification. cTohmepocseidtfiooxnwraelsatsievleeactbeudndaasntredpriessrebnucattiiov,e aonfd lickaemliivhooordouosfmoaccmumrarelncdeueatttoheisDrdyieRtaurny cCreoeknsitce. elsonfdcimoenattlalmioiwnsoafnnotstfeouenvadluinatsimoanlolfmacomnmtaamlintaitsisouenwiinllsiiesosoiplsr.oviIndead3diaicocnu.ratthee 3 009.015 USFW 062 dose to the red fox which allowsfoth evaluation ofcontaminants in the food source. Life Hisory lRaekde bfoorxdienrhsa,baintdopfeanmlmaenaddso(wHso,fEdmieticshibcarn1k9s8,9f;iJelodneasndawndooBdiemdegyes1,988f;enMceerrroiwts,19s87e)a. mWiatnhd tghreouenxdce(pStcihownaorfzatnhedbSrcehedwianrgzs1e9a8s1o)n.,Ardeedn{,ouxsuhaalvley nmoodipfeiremdanreontmhaonmeexibsuitngsiweocopdcohnutchke oDravfiosx d19e7n4).is dTuhgesdeursicnegntth-emabrrkeeeddidnegnssehaasvone maunldteixpcleeprtoioomnasl,leyncgoalndcewsin,taernsd(wBaairlbolueradainndg 1m0al2ensdafnrdofmemhaulnetsinwgillardeeafsen(dScthhwiasrseczenntd-mSacrkhewdahrucnzt1i9n8g1)t.eriInorayddriotimoninogutdheerirs (deJnosn,esbaontdh Bimey 1988). - o"Tphoesrseudmsf,oxmusspkrriamta,rislkyuannkso,pproordaeunnti,sibicrdcsa,miegvgosr,e,cacroinosn,umnivnegrefboordaeist,emssnaskuecsh,aasnrdabfbriosg,s (alBsaorbcoounrsaunmdeDdawvhien19i7n4;seMaesornc(J1o9n8e7s).anSdoBmiernveeyge1t9a8b8l)e. maDtuerrinsgucthiamesoffiasbaunnddannuttsfoaorde (suSpcphlwya,rtzheanrdedScfohxwawrizl 1b9u8r1y).surplus food to retum to for consumption at a later time `bMeaalreoannedlfienemrapleerfyoexaerspauisrufaollrylibfeer,wreeemnaiMnairncgthoagnetdhAeprrfirlo(memridiwin1t9e87r)t.o sGuemsmteiro.nFpeemrailoedss "aTshtefpruopmsaabroeuwte4a9netod3a6t adabyso,uw6t0itdhamyos,stleaavveertahgeindgen53indtahyess(uSuchmw,arazndanardeSscehxwuaalrleyzm1a9n8u1r)e. bhyawtkhseainfdrsotwwlisn,taernd(pMoesrsirbily1c9o8y7o)t.eNsat(uMrearlrpirted1a9t8o7r;sSocfhtwhaerrcez afnodxSacrehwfaewrzbu1t98i1n)c.luRdeedlafrogxe may live from six to en years in the wild (Schwarz and Schwarz 1981). ExpoureProfle HAdoumlterraendgfeosxvawreiygfhrformo2m425.70to1,723k5ga(cBraesrb(oMurearnid 1D9a8v7i)s 1974; Jones and Bimey 1989). T1h0e.1fo6odg/igngBeWstiidoanyrfatoers oafjtuhveernfeiloe x(U.Sr.angEePfAro1m9905.).069Tgh/egwBWeirdaiynfgoesrtaioonnrbarteeefdoinagnaadduullt.t ethdesefovrailsueesstiinmautneidsotofbge/daapy,prtohxeihmigahteesltyre0.p0o8r6ige/dgfBoWoiddiangyes(tU.iSo.n rEatPeAo1f9930.)16.g/TgoBeWx/pdraeys.s banoddythweeiwgahtetroifnge27sikogn(r2t.e7o0f0 0g.)0t8o6yige/lgd BaWfiodoadyiwngeersetimounltriapelioefd 4b3y2thge/dlaoyweasntdre3pwoartteerd oinfge1s0t0io%nsrmataellofm2a3m2.m2algsawyil(2b52e.a2smsUudmaedy.).Forthe purposes oftis risk assessment, 3 diet tAhesorieldinfogxe.stTiooneaxtpreofss2.thispevracleunetionfutnhiesotafalgiddiaey,htahsebseoelnirnegpeosrttieodn (rBteeyoerfeta2.8l.per1c9e9n4t)wfaosr maliplied by the food ingestion ate of432 g/day to yield a soi ingestion race of 12.1 gay. 29.7 Mink (Mustela vison) as RepresentativeofCamivorous Mammals ustification 3 005.14 USFW 0622 . . CThoempmoinikonwaeslsalseudnasirnerbesuetnaitoivne,of1 ckamihvearousofmoacmcmuarelncdeu 1hefsDdyieRaurny GCeoonvSceon:onuioTmneionifktcwoiomcwuhmsailnolttowstsefforvunihdletCe iohnofv ncodonfaocma nionsauinoen naw3inl asssisp.rooovIidndssacnoisoune,chue LifeHistory MU1n5ii8tk8e.daTrShadetyeiscaasnnbdte ifnoovoueenrdmwiuectihm1o0afolCrayelsfsoymNaia,bsNaAewmneMierxniicsoo,opauncdtaThneds:vsswu(gaahnsoeusits2h,deicBainyescrry nroerccoamimarnytyaGofundexn ends ipoemsidn daoyn(sHondfBmiemseey 11998889)). AFoughpmAT roruml HDneeesnmsciaanrkersKtheeatlyhamnneeoarnnswadtaecrBc,apamineddh1bey9y0e.ameiMssala(eBlee3nsdls1oy0lnddmDu1asvnssi1b9or74wo)snboHuormrcoeowsrnahnsigiecshdernbedy tmobeeinesosesncemtkeoevsyfslproawyingsh(orOeldinee(l1o9n8g)s,andBimey 198). Mink ar sfiry iSesasomnasyocodonasvofaciralylagho,eosgh,efdhi,easraykceosm,prroideinotns,(aBabcbio,ur1snnddpDlaavniss 1a9m74o).n Taboecr aBfifmmstesJso1u9e8ms8;eanMieeBraiamn19y8179)8r;eSgiocnshofroardt SAcmhewriaan(1B98a.buCr3anydfiDsahvaiss1a9j81rJopnoeriaonnd BBroemdi4n0g40oc7c3urGsayfso(miJrainusar1y9087cSacyhAwpael nwtdhSgclayrsva15i813l. gAesNtigohntpvearriioadbslaegSinngg Hvaoye aamfon11g1e7iyonusng(mBaayyboeuraondcDeedis(1S97a4rFoafnidmSecsra1r981,98f1o.nsAvnedragBeunitnyet1s98s8: Nofaigers1n9d8s7,eSschnwalrzmanarSecbhyweanrm19o81r).c (YoMuengear1e98w7e;aSneedkasrhaonudiSvh0asr w19e8e1k).s c15e8a7:iSomnelayrrsaandhaSmeedaorwt90{1x.eAckohavuegshboomsesd, 1indudosgshwvilepvreeydonupi1k8(eMeur. ek sido eed wa yer of 35 nh wild Sewer and Sevan 1381) EffectsProfile dfruoml1m91ink 1w5ei0g0hs5ems (2005.10E1F.7A30199(9)Mer 1987 US. EPA 1995). Home ranges vary Afeymaelaetmouin(fUo5.d gEePsAti1o9n9a5.e Tofo0c.a2pisg BiWsdaalyehaisn bunnssoifmgante,dtferobood nmaelseiaonnd Fre1e1w4aguiy.lAen smelowwistFienpgreesidonboidey woeifgh.t11(5530B8W1c0ay11w4a4s feopdarrgdsfioornGarte Tteaswaesmmaii(lU1ebEPhAe1o99w3e:sTpo aaprresbdosdvwalee ifnS3oi0f5g5sa0.5143 wwaatss minfgeistoionn oenawril3l73 sgiunme(,5 mUiog. For hepurposes oftis rik ssss6m1aofn10,0% % 009.015 USFW 062 2orAe5ndFinmccipierdd1eeyinbneacelimtdhse(enpad1rliimi)emnngawterasysiimnoegnecehsditaifeoonrorrhsitseeiwsdaksisoemtshseasmvmneaantlytbblCeeoeFnrvosmuntmheoironaorfep;peehserrneonsn, deersaetriveodnnoefxt.he rice level noifsimncbidyewnthailcshedmiimnekntmainygecstiiondvisecoinsnumgeperoenrme GamLoinofnguesenebatiitnoisfsvsaeiezdesiinmfpferonorptmmar4c1io0oof0nm isf1o02b3ta e0hie mnbly mguss(iAlbl(ygLeeiprsomk1i9sv7ims5accShomrinotcshhiu1rm9u8sp%)).owfoasIhnus:eeApditnegsprwpedeiucttsse abodlylsiizeeoobfde10103.m11m 1582) in secinsghki based on tawhseasslesopmrweeincnitcgtehdle.gaoTrmoietohwoerfiuesgehidtninometefn+ntg1ci0n0ntomwavarSehehinces . logWeight(5) = -5.374 + 3316 log Length (mm) c({1oKSmo1elanhtlmoalfifhdno.eoevdnAiuiS1ns9ug7es0as)nyt.divoTsnahelidrsiutmeipennorgtf to1h.e7v5sapiprmeeraddccieehncttcseBodWnmieandksaeyofhaa1s53tobfebe0een.5gr3iploorrfedfeoofpdoropohasrefalgapcegisl si3ycsaotnnesme.brevaptrievediacsesudmhptaiotn shmaodf e0tibsaesr9i.z.6eppmearecyencrtooocffmthaehee0nto.oo0tld35iinosgfess(teKecdoiilmeeenrsnmaaicnsco19rs7m0p:S . ipiFnorsureneitdtihisevocpfsugsyrrhspatobmesomsedoofoysfswieesishgdhmrtoed(m1ea8l.i,1n5)icewoaxnspsatrsseouvmserdstiehmdaei.tmteThnhetieesvvieallnuoefes(e0di0ni3m(5e)nwtdaicsgopnetsatigsnepd yeinort.she oa8fskefidsih(m1ie1sn40.dd2sadbryo)d.ythweeipghrtc,iicWmephdeeesngnerdtaitimmseonfvtfailiusnehgebissotmiyonweaiieghftlo.byTtihthihsmprfkoovoidrdioednugga ehantcosoormormneprsrs 298 Raccoon (Procyon tora) Represenaive ofOmnivorous Mammals Lugtificaion. {SoThehmeeepkcosorsnaciseinaoinnLasiweodaanitstoifvaselelleoacwbtsuenfddo1ranttheepderivseawsliueoanutaiioionnv,eofaocnodf3naiamkmiennliabvtooiorodonouisf movcaecmumsraeelnmcedenus. too1efssprdyeipeogiy accurae dose thecroancacmooinnawnhsicfh aolliouwsfnofroardgteheTehvailsusauteio3nndofccamosntwimlliannsrronayuo) Life History `0RR5eaa8ctc5ccnoodaoosnnn,dssianpardmreefsiealmrneadm.uaiarusmth-cessihz(aeKdbaauo,fmmnpiaavnroir1ce9u8sl2)aa.rnydRhaaacrcreodowanbosuondadvsawentaamtpihsr,aodufsglphonooeductpwlNaeilonsph. ferAamempreirecsa. Raccoons el heavily on surface waters for forging staes ee 57 600.15 HeEW nao : a o1f5d43)rbiu wnwaitlkerk(ieSrtnutehgire1a94c3)t,iRvaicctooonosppaorruanctiisviecparlilmyarfileyedroonm wduhsaktetvoedrawisn (aSvatiuleawbeer r(Seadnadyer1s0on(a1k9e87a)d.vaFnotaegxeamopflfee,edriancgcooopnpsorsvuinnitgineesadruarsianlgt mlaorwsthidmea(yvbeeyc1o9m4e8)c. iRvacdcuoroinnsg FTeoewdleprri1m97a5r).iolny fuk, nuts, acorns, rans, insects, frogs, crayfish,and gg (Palmer 3nd `RAadcucltoornacsciootnhsessroeustoherrmnalrleygsioanlsiaofrtyhbeuUnwiiltledcSoamteestoagreetahcetrifvoersyheoarropuernido(dsGoolfidmman d1u9r50i)n,g maatyinmgat(eKawiutfhmasenve1r9a8l2f).emMaalteisndguorcicnugresscrhosmesMsaorc(hSatndJerusnonin1s9o8u7t;hKearnufrmeaans a1n982)c.acYhomuanlge Saulmemsera,rewnhoilremaflemyanloetssmeaxtuuarlelyimatthuerfeiitnyteheai(sStanbdreeerdsionng1s9e5a1s).on but mature hte in the "sTehaesoHno(mSeanrdaenrgseono1f9a87)r.accHooomnederpaengnedssaoenttyhpeicaanlliymaalfsewahgu,ndhraebdith,ecfaorosd (rneas)oubructesa,ngaensd s3oladregepeand3fsreowngtlhyoaunsatnhdehaamohuanvteobfereensoruprocreiseidn(tSheanrdeear.soNnum19b8e7)r.s oPofpul0.1a0t.i0o.n2daennismiaelss per ha are common (Hoffman and Gotschang 1977). HRaavcecoionncsreraseefdoruenadlneyar(Seavnrdyesaaqunat1i9c87h)a.biItn.AlDaubraimnag,tahdullatstma0leyaeacsersacscowoenipgohpeudlatuipons (8.o8hkniiloognra1m97s0()k.g)A(dmueltanra4c.c3o1onksg)wwehiigleh badeuolwtefeenma2lenscdan1w2ekigg(hNuopwak5.199K9(k1m),e3andnc5o.n6s7ukmge) 0.5kg offoodperday (Newell tal. 1987). uRnadccFooownlsefree1d97p5)r. IinmaMarorynylrainsd,fuorte,staecdobronso, mgrailnasn,d,nhseecds,eafrogssc,ocmrpayefsiisih,onegogfsr(aPcaclomoenrs Burlinagcthkesbue(m1mreprrericweaensts)p,rcinrcaiylfyims(ah8deprucpenodfs).ecsntaisls(3(9 ppeerrcceennt)),, hwielrdpcehser(3yp(e1r7cepnedr)c,enfti)s,h p(2okpeerbceernrty),(rLoldeewntesly2n paenrdceUn)b,ecrom195(21).percAetn)W,asahnidnrgatcoenmstoatue ntidoefSwamtielraaxr,eaacroamcscoaonnds C&irsupslascyeed,tshe hfolarlnowdiicnagbmdsie(pa2rypceormcpeos)i,tifohn:(m9oplrlcuesncs,),mmuasrsienles wnodrmosys(t2e0r p(e4r4cepnets)c,eann)d, Echiurida worms (1 percent) Tyson 1950). sTehaesohno(mSeanrdaenrgseono1fa987r)a.ccHooomnederpaenngdess aornetphiecaanlilmyala'sfeawgeh,unhdarbeida,hecftoaordesrebsuoturrcaensg,esan5d. aladruglet 8m5a3lfeewratchcoouosnanfdouhnedcianecsoahsatvael bGeeeonrgripaorriaecdco(oSnasndiesraspopnro19x8i7m)a.teTlhye65hohmae(r=an1g8eSfEo)r ("Lhoitlzeeth1e97h9)o,mePoapnuglaetioorn ddeunslitfieesmaallessoidnetpheendsasmoenagrlayiosnatphperoaxmiomuantteloyf3r9eshoaurGces1i6nStEh)e area. Nambers of 0.190. anipmeahelcasreis common (Hoffman and Gorschang 1977). Essosure Profle Fgo/rdatyh,e p3unrdpo3sedsitofotfh8is0 rpiesrkceanstsefsosrmaegnet,fi3shbaonddy2w0eipgehrtcoefnt2clkagm,saweirnegesstuimoendr.ae oA fsoi0l.5 Minagelsitipolnyrittenhgofnge.6spieornceanteobftyh9e.4pdietehsrbyeieeclndsreespeondriemdetontrirnagcecsotoionnsa(Beeyer e0t.a0l4.7 kg19/9d1a)y.. 38 009... USFW 062: eAqudaatiliyonwadetreivIendgebstyioCnalrdaeer0an.d1B8raLuine(r1p98e3)d,yA(dLiaeyo)fw1a0s05e4 l5hewcaluaseineg amnearloe 295 Sharniled Sheew (Baring brvicauds) 3 Represeataiv ofInsecivorous Mammals Lusifiaion plTflishkaeednlissiehaahosrowyodecolafololmacpcssuihirnrisreeoecwnnts,wc,aersteahsleeyitlhveteceetnDesdrdhytuaonsRdfruaaennvpotrCredrsieesenckciabsttuieiv.oofniAinlnstehbcoottuihgvhmorotothuiesramdnaidmesdmayale s bsecoay usneoof Hasesnecses,mebnyt,astshuismisnpgectiheastmthaeyedrieeparryescoeamnpeisnsisicelocinivncovoermroptuersbirmsaeatsemssoawlh]eleynntvheynsabemare eoec: LifeHisar mwTiteahsererdsfahsineegshle,do(sbJ,ologansdne,ds smpahnaadseulwBriiesfsmaoern(yeBe:a1rx9fbe8lo8omu)os.resaynwdaioctcDthcaiuvvapeimislpelsreg1,vdaaecinaeyHyienogfwmmobaocrdesise,danbdsahdrhreyiwpaco,rmmfeonownithsin (suHhiorfvefwemseaiansrte(earMcei19vr8ei9)b.1o9t8h7)d.ayDaunridnigghhatrsdhrwoinuegsh,1t9i7t4s;esJypoeenaceri,seshamnoaduyBginhsnremyogs1t98a8fp)heesSdessofsepryenr.es iITnhmeeaehlordmyeeenarsrai,nemhoiasfytbshpeiescgiseprseecmiceasytvhahraive2es awinintadhintviihmdeauilaldsrapemraiccrepo(puSleaownayrelds.SIcn pheakFyoeoatrys, - 198) density ofon individu pes ce pers asA1en9l7adb4e)owa.iublgllheTvhmosearhsateocei,rfooesuoesddedcsiso,hensrsnseuawkmseisesno.wcnhlsaagutldlaeymvcpaearnrderfefboreosrod,ansnesmimam,lasllslamuegast,inen,maphsle,ey asieuncpopepp,o(raBnraiersvbioecpoostmn.agiovoonrress TDcaaovnniessurm1me9d7a4ty:o JcognorenseassnsedxBueipnmtyoiy21w09i8n5pt:eerrSccSehnewtavroatfzrtnzeadnsSdhmrhaSemcwamhsawrladsri,1ze9a811(n9)Bd8.a1yr)oPbuloannungrksbmanosad sDe(opsaipe,eaJnpoayisa. SPriebymiatseimlsihytlsanrdsotprcoodnusceumevdeinommmthetdquiiwcnkslyestmlorbyediitn3eascthheeripr s(voenra)s 183) a(UefSsacrishunegnvowaefarcyahssomaleanolndclda1Stnicolnhoecawaltnaeassfr1coe9eo8ndc1to)a.nmnasdrrTkutiwcontogme,odvsuhesourbtaoluyitljes(dtHosfhTrfmeeewwirisneccyrheh1se9a3bv9ei)lloywAonnthtsegihiobhuensasriwonogmeennrds {a1a9v8de7),meusliipnig nnesrta.nBcost.h nTehsesabrresbduiilntgpunneedssetriogsfrnyopeuisncsdalbrleeynbaeguatethsbytlohgia.nsrhosecpkercoeies,oitnheearecsodvues nrnes. (iBHertoeifeofdnmsie.nigsbiarpeepa1ed9ai8rn9sg:0JmoacnyoesmsmauenbdnsciBdeierininenyeac1ra9lr3yl8y)s.parniGdnegsmaainiddosenuxmpimeeneidrodibsnuotahepeesspakplr,osngatalmtnshtoeulgeyhu3ii1es-o3nm2e 3 08915 USFW nana . ayndsScwhitwhalrezr19s8i1z)e.soTfhaeppyroouxnigmaatrelfyllfyoumrattoutreen yrooumngon(eJo(n0etsraensdmBnitrnhesy o1f98a8g;e S(cBahrwbaoruzr a(nSdchDwaavrizs a1n9d74S;cShcwhawrazr1z98a1)n.d Schwarz 1981). Both sexes may breed thei frst spring Noaptousrsaulmsp,rerdaactcoorosns,offotxhees,swheoarsie-lsa,lebdobcsahirse,wskuinncklsu,deanfdishf,eraslnackaetss,, aolwtlhso,ughhawmkoss,t osfhrtihkeess,e pmruesdkatogrlsanddos n(oBtarcboonusruamnedtDhaevsihsre1w97(4o;rJaonleesasatnadllBofitmheeys1h9e88w;)Mbeercraiuese19o8ft7;heSichdwisatrazsteafnudl Syecahrwa(rSeczh1w9a81r)z. anTdheSclihfewearxzpe19c8t1a).nofcay shorv-aled shrew i the wild i approximately one ExposesProfile A1d9u87l)t.shHoorm-ealreandgesshrveawrsy wferiomgh0.f5rtoom11a2.c1e0 (3M0egmrmaims19(8g7)).(fTohnesreafnodr,Biitmweays1a9s8s5u;mMeedrtrhiant Fa sahcorottfaoi1lr)e,dsisnhcreetwhceosurledaocboimapirnis1i0n0pgehreceonnt-osfic sadimepslfirnogmlotchaetcioonntsawmisnastpedpraorxeaim(tweelayu2s0e BFoWoiddainyge)sthiaovnerbeesenrarnegpionrgiefdro(Um.S0..49EP10A0.169923)g.ramAnpearvgerraamgeoffboooddyinwgeesitgihotnpreartedaoyf (1.99g5 induanyitshaosfga/lsdoabyefonrrceopmopraireids(oUn.St.otEhPAla1t9e9r3)i.ngeTsotieoxnprraetse,stthh ffoorrmmeerr ifnogoedstiinognesrtaitoens waetrees m5u.l8t8i1p0l7i.ed byg/tdahy.lOowfeshteseepovraileudesb,otdheyhwiegihgehsttfoofod12inggreastmison10ryaieoelfd f7.o9o5dgi/ndgaeystwiiolnlabteeusseodf forthe purposes of tis risk assessment. {Ahiwsavtaelruiengiensutniiotnsaotfg/odfay,0.2t2h3eg/wgaBtWeiidnagyeshtiaosnbreaetne rweapsormiueldt(ipUlSi.edEbPyAth1e99l5)o.wesTtoreexpporretsesd b[omduyeawse)i.ght of 12 8 1 yield a water ingestion rate of 2.7 g/day (2.7 millers per day sheoislolinigenstgioneastattfooirftothehnesohpoosrstuemdwashsrueswedw.asThneotoapvaoislsabulmesodmit tihsesilmeirlaarutr,tthhteroeffotrhee, sanhimoalrmeadnseh(rSecwhwsainrccezthaeyndaSecbhowtahrzop1p98o1R)u.niAsiscoilominngievsotrieons awitthof s9a.4npegrcpernetfoefrtehnecedfioert wfoaosdreipnongedefsorrattheeoifootpnhoesssuhomr(-Baeiyleerd esthale.w1(9974.)9.5 gT/hdsavyat)oluyeiewladsasmouilltiipnlgieesdtibony rtahteehiogfh0e.s7t4 1i0d0ay.peFrocernttoheftpheurdipctooosffttehhese sfhooord-acihliendmsohdreelwiwahsiscormipskriassesdesosfemaerntthiwtowramssa.ssumed that 29.10 Meadow Vole (Microtus pennsyivanicusas) RepresentaiveofHerbivorous Mammals lustificaion d"iTehteamryecaodmpoowsivioloen.waasbusnedlaenccteedin1sNorreptrheAsemnetraitciav,eorfehfeerrbeinvcoerfooursmomiastmmreaslss,abnedcaluiseeloinfoiotds ofoccurence at the Dry RunCreeksite. " 009.15 USFW 0627 Life History B"Tihrenmeyea1d9o8w;vMoelrersiann1e98o7f)theAlltrhgoeusgahntdhmeysatrcsbmnodraenctovmomloesnlinyNfoorutnhdAmierRicaai(sJonueschnads m{onisatbmecaudloawts,edbofgesd,ss,warmopadss,ideeadimchebs, aandnnfdeInksckeerssohwosr,e(s,BhoeyuhaavnedAlDavibsee1n9K74n:oJwonne1s0 aSpnpdeaBrismteoybe19n88e; oMfetrhreiema1j9o8r7;prSecrehqwuaisriztens dforShcahbwitaartzion19(8H1)o.fFDmeeniseerv1e9g8e9a;aiJovneescoavnedr Bimey 1988). T(jhoeneosmanedrBainmgeeyof1t9h8e8)m.eaPdopouwlavtlieonsvtareineds tiosfizleucwriatthesdsrsaostni,cahlalybivae,rayntdwpooptoulfaitvieoynesairzse `Jwointehsp1ensdk pBoipmuelayti1o98n8)d.ensAicctyivliecvyeolcsceuxrcseedduirnigng1b00thvodlasypsenrdacnrigeht(.BaarnbdotuhrraoungdhDouatvitsh1y9e7a4r;. arlutnhwoauygshiutinsderretveesgteaatidvaewcnovaenrd rdueskdi(sBtairncbtoiuvreaonfdmDeaavdisow19v7a4)l.e iWnehlalbi-twioorni(notnecreecainndg tBuismseocyko19f88r)a.s,Elaalbtohroauteghspuhnedreircgalronuesntdsnreescsomamaolnsoiybubuliilnsrbiovreagrreosun(dBainrbthourcaenntdeDraovifas 1974; Jones and Bimey 1988). "The meadow vole is herbivorous, feeding primarily on grasses, sdses, legumes, bers, and crionoodmtipsvoi(dnuMeaenlrtsri(otfBat1r9eb8o7du)ir;etahniondwseDvoaemvrei,srie1ng9si7eo3cn;tsiHvlooafrnyFemasenldasntcdarnBn1ii9m8b9ae)ly.is1mB9l8hu8as;gvHreaosbfsefem(nePiorsaecpsrorpt1e98di9s)i3.nmsaTojhmoiers Species hoardsfood forth winter in above: nd below-ground caches (Meri 1987). "sTuhcecemsesaidonow(BvalrbeoiusroannedoDfatvhiesmo19s7t4)p.rliBfriecedmianmgmaoclcsu,rsprcoudruincgintgheliwearrmafeerrmloinvethisn orfaphied yoeamr (J1o1n0es11anydouBnigme(yav1e9r8a8g)i.ngTfhoeugretsotsieovennp)e(riaordbiousrboauntd2D1iGvaiyss1w9i74h;lJvoneessizaensrBainrgnienyg D1a9v8i8s) 1T9h7e0)helpless young maturerapidlyand may breed by 25Gays ofage (Barbour and (MBeaarbdoouwravnodleDsavairse 1p9r7e4v).edTuhpeosne bpryednaetaorrlsyailnclusdpeecoiwesl,ofhapwrkedsa,tosrhyrkbeisr,dsblaucnidayms,amcmroawlss, foxes. weasels, mink, ca, raccoons, skunks, possums, shrews,and snakes (Barbour and pDoapvuilsati1o9n74e;xcMeeedrsrisix1t9y8d7a)y.s oDfauegto(ShcehawvayrzpraendadtiSocnh,waorntlzy 1a98s1m)a.ll proportion of the ExaonueProfle Aradnugletomfetaidsoswpevcoileessvwaeriigesh rfoomml2e0ss0tha6n goranmsac(rMee1rr3i.21a9c8r7e;sU(SM.eErPiA11998973)),. TThheerehfoomre,. ictonwtaasminaastseudmeardeathaarea3 umseeafdaoctworvoofle1),cosuilndceotbhteaianres10c0ompperricseinntgotfhei ond-isetc fsraompmlitnhge locations was approximately 20 eres. A00f.o2o1d igniggesBtWioindratyeirsarnegpiongrfirdofmor0t3hi0s1s0p0ec3i5esg(/Ug.SB.WiEdPayA,1n993)a.mdeTaonewxparteessinhgeessetiovnaliuees in unt of g/day, he highest reporid food ingestion (i of 0.35 g/g BWiday and the wer a 669.20 USFW 0628 ingesionra 021 gl Bday were mulled by te lowes repre body weightof20 5d 3 ood neon eo7.0 ey and vats neste of 42 py (43 - p5esricee lnit nwagso emnalrutpelieofd2o.yptehrTecfeoh08oafgtaehSeioanl a(dioieisoSfoSeS7V.0agSoaTryenotomswWielSdEmYgEeoEahi1oknlrer1ne99o8o) fifo2r4 F017 gay. Fpoerrtchee pofurbpeosieseafwhaes cfoomopdricsheadinomopdlealnsi. his ik assessment, twas assumed that 100 50 ASSUMPTIONS T is ska assesmeeonmtaoveaaliuveessseuxpmopsieosns0wcaornsmimnaadnettsodcvoonudugchtohosd arnkd nsceisdsemneanltseadhiemesnetnsciengoesfti5o6n.. specific da Thuesedmnasiikmulmloafiohensc.omaminan levels messed in sediment, sil, or wate cllsted on site was Tbehpermeasesnitmsucm-wciodnecenaions of COCs repored i sedimen, soil, water, nd io were assumed ; + Ansres use factor (AUP) of1 was assumed for all species using the sc for fcding. ; . Conaminants were assumed to be 100 percent bioavailable. DietSaimprliyficcaatmipoonssoidfocnoimnpfolremadtiiosn wwaesrebpienrfeodrmferdomfoththre raecrepetofor th receptor species. However, + CAVaellunieesirrunroepgoseneabdnyrcfhtorhwaaiscnlcdoisoealnynsrpdeeciiuteeosdd.cets1teprencmeoiiendtseowxethireeccuvhsarelodun.eisccAoloxlldisubceoeofsctawheteerceofncriiatmahilnelacnyiesproeofvrciosepnweeccdieesn, eoortcmraibnolef ew10,h0eLwraDs,du(symeeddeitasonciloetnahvnaedlrmdoetsteeh)odtvsaolwureerseewaeprLpeDro,upsreitao.te2.FNoWrohpeOunbrspvoeasrlevuseesdoffAotrpicshpriaosnrikcatEsofsxfeiesccsitmteyLnwete,vreela ((oNLiOOAAeEELL))v.ailoueAAsNwfOaaArceEtoLpo.oan1n0dewaaffsaocrutosreedo1fp010icownssvpeeructiseeesd,poioecromenovdsetrLscoaownreseseptrovmOaebtdisveLerDvv,eald1u0Ae3dwvLaeOsrAsuEesLeE.dffienscethveLeerrviaesllk eeueivoiendsinepgrfiaeesneoftotoonvicemaecnhaanmsdm,roTmoxsiicnigtlyevdlouseesoroabladiniesd,roNmoloongh. eamfefreefdaicntgorssuweerse incorporated io tis isk assessment lCnosnovmeenecae,ductoynammaiknean(cindmoielsigwrearmesrpperonkeildogarapmarbtapedy wmeililgihotnpceorndtaaym;inmaen'tkgn-ddaiey.) bTyheussienwgehree formats {tsk (mgaday)=Conaminan Dose (mgkg ixeInges)tion Rae (kg/d)x /Bocyweight (<9) a 000.55 USFW 062 converseionsallovwsidietoasrystotxyiiwyeeiv.el ciFtoedforonpeustpecoiesofosbercoknverctedetona d,ailypdeoserfsor oFiRsCeediBmentLiLngestion4w1a0s,adlooseimncalyudtehdeninbte husceadlctuolaetviaolnuattedtehteerimsikneothoethoeaspdeaciileys iifnankoespfeocritfhiec toxicity dai 5 available 078 hor secehrcr tSooxminescwohennmiinngeesmtoedfetsthte epr(eesg.eanlulmevienlus.m) ar nokfoodchan accumulators, but instead are direct 40 EFFECTS PROFILE fMuartnhyerccoonntsaidmeirnaatnitosn dientteicsterdisak atshseesDsrmyenRt,unbuCtrdeoeekssniotekdeoxcnloutdheatvheebmeanschpmotaernktsi.al Tchoinstaemxicnlaundtesodfthceomncferronm. tBhaesiretdooxinetehfefercetssualrs porftehseentperedlniemixntafrlyuorriisdkea,swscehslsomernotf,lutohreolmoeltlhoawnien,gacloummpinouumn,dsarsweenriec,cboenrsyilldieurme,dcChrOoCmsiuamn,d wcoiplpebre, fruornt,helreaedvamlaunagtaendeussei,ngnifckoeold, cvhaainnaaccduaimnuudlazmitni,co.n mBodaeslesd.onCotnhteacmhienmainsttsryexrceseueldsi,nhgetsheircormesppoeuctnidvse cboemnmcuhnmiatrikessarien athsesuameqd tuoabneadateftrfreecisttirncigalreececpotsorysspteecamisstahnedDnreygaRtuivnelCyreiemkpascitte.ing species, populations, and 41 Furie Mflauuorriedretfaorlap(e19r9i0o)diodfen9ifiweedekssk.eleTahleaLndOAdeEnLtalidaebnntoimfimeadliicnitehsisinsnrautdsytwhaatsw4ermegeFxLpoksgeBdWtiodsaoy.diuAm 'suNlOtAsE.L3wLasOAcaElcLuolfatedmrg/okmgtBheWiLdOaAyEaLndusainngesatniamcacteepdtNedOcAonEvLerosifon0f.a4kcgorBWofid1a0.y Bwaislelbdeosnetdhesfoe evaluate the tisk posed by fluoride mammalian receptors aF5lelmoiwngasea1l5.m(g19F8U7k)gfoBuWniddasyi.gnifNiocanetffgercotswnwheraeteobrseedurcvteidosntin10EumrgopFeUangsBlWiidnagy.fedAasdiseutchc,ontthaisiniinkg a1s0smesesmgentBwWidllaiym.ate fluoride related isk using a LOAEL of 13 mg/kg BW/day and a NOAEL of 42 Organofuorides Ncoomsprouduinesdpwearsaifnoiunngdtinthtehediliaerryautroex.icityofgichlorofluoromethane or any other fluorinated organic 45 Aluminum aDliuxmoinneutmali.n d1r9i7nk9i)ngcownadtuectfeodr 9a0sdtuadyys tphraitoretvoalburaeteeddintgh.e Trehperohdiugchteisvtedsouscecaesdsmionifsrtaesreedxwpaosse7d7.15 ambinlolrimgalriatmisepse.rkLialloegtrala.m1b9o9d3y)wceoingdhutctpeedrada18y0(-dmagy/kdgriBnkWiIndgawayt)eraund ydidinnowthriecshulrtatisnwreerperoedxupcotsievde stoign5i5fimcaynteedBucWtiidoanyinofspaolnutmainncuomu.s lAotcotmhoistodrosaec,ivbiethyavainodrasligenfiffeicctasntwedrefeicoibtsseirnveadc,quiisnictliuodninagnda etsetteinmtaitoend oNfOlAeEamLedofre5s.p5onmsges/.kg BBaWsieddayonwitlhlesbeeruessueldtst,oaevLaOluAatEeLthoefr5i5skmpgoskegd bByWiadlauymiannudm atno mammalian receptors (Table 1) a 009. 57 Hews ann, 'NBoWiedfafyec)tsalwuemrienuobmsfeorrvfeodurwhweeenkJsa(pHaunsesseeinqueatila.we1r9e88)f.edWahdeinetqcuoanitlawineirnegf0e.d05a dpieertccenotna(i8n3imnggi0k.g1. Fpienraclelnyt,w(h1e65n mquga/iklgweBrWe/fdeadyad)ieatlucmoinnauimn,iangdec0.r13peeasreceinnte(g2g57shmegl/lkbgreBaWk/idnagys)eanlgutmhinuwma,s aobdseecrrveeads.e uinsibnogdcyhiwceikgehnts,ceogngclsuhdeleldtshuaetngdtihe,arayndleevgeglssohfel2l8.p4romdgucktgioBnWwiadsaoybsaelruvemdi.nuAm r4e3s-udlaeydfiencdidnegcrsemausdye (Huwsesiegihnt 1ga9i9n0,).feHedowientvaekre,, oannldyptlhaesmalateirneodrgmaentiacbpohloisspmohofrcusa,lc2iuwmelalndaspahnosipnhcorerausse cionuplldabsemaarcsabluctieumd B1ectahuesdeiraecrtaenfgfeecotfs coofncaelnutmriantuiomn,s wTehreeaussseocdiaatneddtNheOAenEdpLoifnotrsthwiesreeffeeccotloigsi2c2a.l8lymsgi/gknigfiBcWaintdaayn.d LreOlaAtEedLtvoaltuhees.dosAe,NOthAeEstLudoyf8b4ymHgu/sksgeiBnWeitdaaly. (a1n9d8a8)LwOaAsEuLseodf11063thmegd/ekvgelBoWp/dthaeyNwOilAl EbeLuasnedd 10 evaluate the risk posed by aluminum to avian receptors (Table 1). 4s Amenic cSaetvserianldisctautdeidesthwaetraeclhorcoantiecdowrhaicthoxdiceitteyrdmoisneedwtahse 1e.f5femtgs/okfgABsWItodmaaymm(Paelrss.hagAenstaunddyVcaohntdeurct1e9d79o)n. LInDad,ditchoant.raNnagteiornaolmRe1s0otu0rc5e0smCekoofuolefaCndanaracsdenaa(it1e.97lA8)stsutdaytecsotnhdatucmtaemdmoanlmsicinegienndeircaaltehdav3e1 oorraall d1o5s7e7)L.D,Foroft3h9e.4pumrpgo/skegsoBfWithdiasyriasnkdaasnsoersasdmoesntehteL,Dc,horfon1i0c.4vamlgu/ekfgorBtWh/edcaatywaafserus9e6dhtooucraslc(uNlAaSt.e Qs for mammals factor of 10. (1.5 mykg BWiday). This value was convened to a NOoAEL by dividing by :a . EiIsnloregra(n1i9c8A8s5)isrmeovrieewmeodbsielveertahlanstourdgiaensiicnAwshainchd mthaeyptooxsiecigyreoafteirnorrisgkanbiyc laerascehniincgalisntwoesruerfmaecaeswuarteedr.. tShtautdiseesnswietrievealsspoecdieesscriinbceldudien twhheicChaloifrogrannicaarqsueaniilca(lsicngolmepooruanlddsosweerLeDm,eoasfur47e.d6. mSgc/udkigesBiWniddicaayt)e (pHurupdossoensoeftalt.his19i8s4k)aasnsdescshmiecnkte.na(vsailnugleeoorfald3.3omsge/LkgDBWoIfd3a3ymwga/skugseBdWi0dadeyt)er(mNiAneSt1h9e7H7)Q. (0Fobrirtdhse. "This value was converted10 a NObAydiEvidLing by a accor of 10. 45 Belium GTuuyoarseerpaarlat(e1c9h3r3o)nfiecddilaertgaeryaexmposouoruefbsentruydltielsisuumsicngarrasbroenpo0arrtatetdsesaitmicloanrcemnuzsaecuiloonsskeolfea10l,e2f0f,e4c0s. o80f,th1e60,boanneds2v4a0rymign'gkgdiBreWcitdlyayw.itRhattshefreoxpmoaslulreexpcoosnucreenrlaetvieolns.devSeilmoiplaerd rriecskuelss,wweirteh rtheepofrrtaegdilibtyy Jleavceolbssoofn1(21193a3n)dw2h62o mreep'okrgteBdWsiedvaeyr.ely weakened bones in rats fed beryllium carbonate at dietary bFeorrytlilsiurmitso tahsesesshsomretnat,leaddisehrteawr.y eAxpNosOuAreELlevoefl 0o.f1010mgm/gk/gkgBWBiWd/adyaywawsasdeursiveeddtfooesmtitmhiasteLOiAskELo.f using an accepted conversion factor of 10. No suudies peruaning to the dietary toxiciry of beryllium ( avian receptors were found in the lierarure 46 Chromium " 86:.55 USFW 063 H1e0i3ndzieatndcoHansneilinnge0(,12981)0ofe2x,0po0smegd/2k-g,0w3e-tyewaerigohitd,b(r0e.e2d.i7n7g,poaris2o.f7b7lmackk sducBkWsi(dAanya)sorfubCroiopesa)s conhsveotmofieugmg-ploatyasisnigbumystuhlefatfeem[aClFesK.(HSaOtcshe2dH,du0c]klfionrgaspweerrieodtohfeanpfproex3immadastheldyive econmaoinntihnsg, tuhneclsatmhee Cinrrceosncpeonntsreat(i0oansftrihgahtthsetipmualruse.n wNeorneeofefd.thSeeCvern-codnacyoenltdrcahtiiocnkssrweesrueltteedsiendafeorraatviooindaonfceavboeitdaavnicoer bHeohwaevvioerr., Haseline eal. (1985), in 1n unpublished study reported by Eisler (19864) noes that black d5u0cmk dugckolifngns suunfsfepreecdifrieedducCerd?scurovmivpaoluanndd ianlttehreidrgdrioesw.ehTphaenpeesrcwenhtenreeduxcptoisoendi1n s1u0rvmivaol ndand3 cetiled explanationofthe alieredgrowth paerns were not availabiin this unpublished rudy, wFoarstuhseepdu3r5po8sLesOoAfEthLisforirstkheasasveisansmsepne,cidesi.eaHroywleevveelrs,odfu1e0tmoet/heksco(n1flmigc/tikngg BrWeilda,y)aoNfOCArEiLn pwriesy - dreergiavreddinfgrtohmetChresspaemcieessuedvayluiantwedh.icAh NthOeALEOLAoEfL0.w1amsgs/eklegctBeWditdoamyaiwnaisaidnearidveedgrferoomftchoensLiOsAteEnLc.y using a conversion facor of 10. (AStsetvuedny cetoanlduc1t97e6d).witFhordotghse ipnudripcoasteesdotfthhai2s.5rimsgk/aksgs/edsamyenotf,CraiLnOgAesEtLedofi0n.t2h5 adinedt caaNuOseAdEdLeatohf 0.025were used orthered ox, raccoon, nd mink. . 47 Copper : `dOonseestofu1d0y0wamsgl'ockategd/twohdaidcahoygdectaeursmeidndeedatthh (efOfeHcMtsDofi1n9g8e7s).tiFoonrotfhCepuutropomsaesmomftailssipesckieass.seAssnmeonrta,l 3maLmOmaAlEsL.of 10 mykg/day was used and a NOAEL of | mg/kg/day were used for the exposure of S(e6v1e3ralmesukdgi/edsawye)recaluosceadtedawshiigncihfidceatnetrdmeicnreedatshe ienffgercotswoefh Caundonfocohdicckoennss.umpAtdioosneo(Sfmi3t5h0 m19g6/9k)g. A19n7c8)t.hrAssusdumyifnoguntdhatrehsapdaiorastteooryfp3r2o5blmegm/skgar(e2a3.5amcyut/ekge/ffdeacyt), caaLusOeAdErLeospfir2a.to3r3ypmryokbgle/mdsay(Haantdcha NOAEL of 0.255 mg/kg/day were used o determine risk t avian species. 48 tron Nleorastuurdei,es pertaining 0 the dicary toxicof ron to mammalian or avian recepios were found in the 49 Lad "inThe sgiansgliecomroatlildiotsyeofwaasduelvtamlaulaeteadntdhrfoeumgahletheed-ucseiolfedsuhragwikcasllfyedim0p.l8a2natnedd r1a.6n4sdmugerPshifkog BaWpierdiaoyd ofgehsteieonowfeeuknsdifgoelsltoewdinmgattehreiadlospee.lleNtesit(hLearwclonecrenetal.ra1t9i9o1n)h.ad any effect on gasic contractions or APbspuoidsocnoinngdu(Rcetioseendr raendd-aTielmedplheaw1k98f1o).undAthsaitmi3lmary'sktgu/ddyayfooufndPbthcaatus3edmgt/hkegc/ldianiycaflesdytmopstaormisngosf causeda reducion in muscle condiion and altered thei feeding activity (Osbome etal. 1983). For as 00034 11QEW naan ShpeecpiuerspnosdesaoNfOhAisErLisok af0s.s3eswsamsenuts.ed.LOAELof 3 my/kg/day was ustodeetermdine risk to avin CSeovnedruaelesdudoniemsicweeriendlioccaattededhwahi1c.h5 mdeytge/mdianyeodfthPeoecfafeucstesdoafrPebduicnigoenstiinosnutcocmeasmomfalism.pliAedsuodvya p{rCelgankan1c9y79w).henAntohtendeoesestwuadsy afdomuinndisttheare2d.23 m(0g5/ddaaysyfoclaluosweidnga meadtuicntgio(nClianrkhe197f9r)e.queFnocrytohef sPuerdpo0sesdeoterfimsinieskriasks(0smeamsmsalmasNe.OnAtEL.of 0.15 myg/day and aLOAEL of 1S merkeiday were 410 Manganese mTahnegaenffeescetseeledve.lsRfaotrs emxapnogsaendes0e1t3oxmicikty vBaWriydwaiydoelfym,anmgoastnelsiekelays Maarw3o0uSabiinethtiortdheiffoorrm22o4f Bvasye,xiatlseodofrecMus3ed0tefton0orodnareysleeveslls(iLeadsiknedyeectraela.se1d98a2c).iviIyn m(iGcrea,y adndeLaarskleeyve1l9o8f0).140Ammguc'h - dhiogphaemrienxepolseuvrelesc(oGnicaennturiastoisoannfd M2,u3r0r0amyg1'9k8g2)B.WIday ofmang1aMAnCEeressuleed in reduced a1nctoengraesspilratoerya,vciaegrhdolv5a9ss5es0lmrg,/gkagsBwWoiindeasyionfaml,haemantloggaisacMla,nSmOueHscfusol1oes0k3eiwaele,kshehpaadtinc,o refefneaclt, dermal, snd ocular sysiemsofmice (Hejamancik etal. 1987), : Foesrimhaitseirisskk aofsmasnegasnsesmaedeionettthaer,syeelxepcoesdurmeamlemvaellioafn1r3ecmegpt/okr.g BAWNiOdaAyEwLilolfb1e.3usmedg153BWL/OdAaEyLva1s5 Gerived from this LOAELusing a accepied conversion facior of 10 Nloiastnudeies pring to the dietary toxicicy ofmanganese fo 3 avian receptor were found in the a1 Nickel fSeeveidralssulufdcieesinwdeirceataevdaailNabOleAEwhLicohf1d8e7t.e8rmminged/hkegef/tfoedcmtoassoyftNsiysitnegmessteixocnetpt mfoarmbmoadlys.weiWgihsit.arTrhaitss SleivmeillaorfsNuidswuiltfha cbaeuasgleed,a2N7OA1E2L9 opfe6r2c.en5t mdegckrge/adsaedybwoadsywneotiegdh(tA(mAbmrborsoesteaelt.al1.9761)9.76).ForItnhae hpuirspovseuseoftwaisscskoansvs1ee3rsLtsaOeAmNEOedLAnEoLtf 6o2f562..05mmykgg/a/y bkywamlsgiupsel/dyitondgdehtaeerNmiyOnAeELrisbkytoamafmamctaolrso.f 10 sNpeocisesefsrowmeriengaevsatieldaNbie wtihlalt dneatebmeidneetderhmeidnedoofNsi 0 avian species. Therefore, the risk to avian 412 Vanadium dGoasveagweassncdioes nin mvi0ce.e3hnaLvOeeAfEdLouonf3d1 3L.1 CmSgO/kofg 341ndmagNVGAVAKEgLdioef(S0c.3h1 ruoseidnegraanndacBcaespsead f1a9c6t1)o.r oTfhi1s0 Ccoonnvceernsmiaotni.onTbhyisanfoiondgedstoisoenwaatse ccoonmvmeorntledytoobsaderavieldyidnomsiecbey(0m.u0l0p3lkygionfgfohoed LdaOyA)EanLod rtheNnObAyEthLe inverseofth body weight (0.025 KEKRTECS 1985). This calculation sesulied na LOAEL of 0.372 a 005.55 USFW 063 tmigskVtoimgaBmWmiadlaiyananrdecaepNtOorAsEinLhoifs0r.i0s5k7a2ssmegssVmienktg.BWiday. These values wil be used o estimate Rorseoplmiecsat(e1s9o6f01)3excphoiscekdencshivcakreynisngtocvaorynincgecnotnrcofaevtnantiaroodiafnuvtmsaniafodoinarums.perTihodeodf 2y1 dianyvso.lveTdhefesedmindg effofuincdietncyohafdfaioeoadtrytllezvaetlioonf.40Amt lkevelisnotfh2e0d0ietmgr/eksugl,iemdaritna3limcaywraksedndoetperdesisniaolnl tineswecihgichktengsa,inTahned "aTuhtishodrisetraerpyolretveedl wthaastacodnivaerneydl1ev0ealdoaf2il0y dmogse/k2g5 acboouvled bbey mtoulletriaptleydinwgitthhendoierteasruyacnotncoexntircateicontbsy (a0.re8p0r0eksegnXtaRtTiEveCcShi1c9k8e5)n.inTgiessticoanlcrualtaeti(o0n.r1e4s0ulktye/ddiany)LOanAdEtLheonfbymtgheViinkveerBsWeoidfayreanbdoadyNOweAiEgLh of 3.5 mg Vikg BWI day. These valueswill beused o estimaterisk t avian recepiors. a3 zine . oSefve1r2a4l.5sdmig/eksgw/edraeyacvaauisaebdleawdheiccrheadseeteinrmgirnoewdtthheanefdfeacntesmofiisngiensctheidckZeansto(bSiarhdls.eAa.co1n9c8e9n).gaiInona wseimiiglhatrDsteuadynctoaln.duc19t9e1d).onIcnhaicskteundsy,caoncdonuccetnetdroatniJoanopafne3s6e1qmuagl/3dcaonycecnatursateidon roefd1u3c9timoyn/ikgb/oddayy pcuarupsoesde7s poefrtcheinstrmisokraalsisetsysminencth,icaksLaOnAdEreLduocfe1d39fomogd/kign/tadkaey(wHailsl unsdedCtaomdaertdeersmeine19t8h6e).feFcoersthteo aSvfiaacntosrpeocfie10..This value was converted to a NOAEL of 13.9 mg/day by dividing the LOAEL by yAesatru(dyNAcSond19u7c9t)e.d Fonordtohges,puirndpiocsaetsedoftthhaits1r,i0s0k0amsgs/eksgsm(e2n5tm8,g/LkOgA/dEaLy)ocfa2u5s0edanndo aefNfeOctAsEaLfoerfo2n6e mweirkeeusdeady tcoaduseerdeamdiencerreisaks0inthfeoofdoxiannadkethaenmdowuesieg.htlIonsas.stBuedcyacuosnedtuhceteedraen ifsevseirmsil,aar tdoosheeomfi3n7k0, 2 LOAELof370 mg/kg/day was used and a NOAELof37 was used to determine isk to the mink. 50 RISK CHARACTERIZATION tThheeDfroyllRouwninCgrmeeetkhsoidte,waimspluisceadtiooncsaolfcutlhaeteerxispko.suTroeecsotnicmeantterathteiornissknteoewditoldbeedienttehrmimnoedde.l TsyhseteHmQs umieltzhiondg r(eUpSr.oduEcPtAive19f8i9,leBaomrirendouucesdegretoa.wt1h986T)hceocmpoarmespexaporsruiereesxcpoornecnesnstserdatsisornast0ioseocfoplootgeinctailaelnidnpaokiensvasulcsh a1s6 population effect levels, or: Hazard Quorent (HQ) = _No _ Observ_ eEdxApdoM vseurrseeCe oEnfcfeetoa rLaetvieoln n(NOAEL) hAeHoQrgagnriesatme.r tAhaHn Qonelesisndtihcaanteosntehadtoeexspnosourined0icattheeacoanctkamoifnraisnkt. hTshethHQpostehnotuiladlbteo icnatuesrepraedtveedrbsaeseefdfeocntsthien severiy ofthe effect reported. The resuls of th risk characterization ae presented next, SI Benthic Inverebrate Community Sruerure and Function c"aTsohcmeombmuepnnatihryiecdsiutnrovvteehrytesbRhreoaftweeerdecnoacmedmerucnerieaatmsye.iinnSDicrnocymeRmuuannnidtauypspteeaaaxrnosdntoaomvibacieldaatibvlieesrshkiatbfyoiracantdwaorsebruetanhsedoasnnsac.meeaTilhnoeDnrbgeybnotRhtuihnc @ 009.55 - osrternenainmsomi,nnthsaeperddeeiscmeremnentatissienliinTneDidroiyvueeaarersniy.styAIacnnasdannddabbdeiuinpndAr,arondehcuseeceIaildn.mpDihnrTiyhtpehoReduobnbxsemeinravyeiedbceeossmaetmrgurlinsubiruetltyye,gd rdtsaoopmwecocsoninasmflamletiyne:asatnwhidaaoestnr miSeiauntsscoapcpFgeeurir.vie1el,ydcronerdniweedrewcizhooonnieeesg,a,isvhesmihanosumiu,aicnelsrueb,lateiConesahigpGseewe,grreiookwte,cSaEdppRooIissEstSu1md6 hed10 vwiehrmSeilnc,ehthee osebdsiemrevnetdsXcaiss tmeayarnedprlesesnltongsihgeniwhfoilcea rDre.Run eschsppes abe $2 Soil lnvensbrae Community Sears aad Funcion Rhne.siTlheianvneonrcoommkuniity doecsninftiepdenoparobbeeaskwibassurevoidnvacluoreoswol.condiions a Dry 53 Fi Communides rbTheeectfyehsvcecsoosnoicmiornmesad iwuDni rUnypRspyneeTmorf bcaoeonyAtuiymkid.nuacRteesmnulathrofltayhmepthhilepasoddltmfihn.bnusotTwhsois,unmvocrwbaaoslsecsgoaaulidsvhenolowyt CCSomoelis0e.dc10woietvhenp,oeaTsfiheuermewcdaosnvcaaetsssriaisiafominpcslae,nstB.opwLoesovtwievrsepieccoirersceoldraitvdeilroasndibcoyenrnwwdeaesaabsfuoantdshaenacdaesuorabvsievravslegdnadfduirreiaonsng ne eecohocking effortmaybe reflected by he resus ofhe aniciy test. ' 54 Womeaing Beds RAfaocraogCenr.essoleatrenivdawesatdas,esiThnesemomdteoehdltespwl boasseerdmtohdnnatwesebtiaiwnesmisigsahy,tbcceornaeaFitsmki,odnucseatpopfiecronneadgm,ioveafancnssandcfiiiuommhi,roezZiDnner,dy nCoeamkpBouonardnds.eeaoFrrofsoukachrfaaocntmoierssikbhacaslencdlwoarniacionsnsksescrnvdoatrsievseduulieannputthsc.azkaBroydfdqteuoofitaicuea,nltbsoeisreelsipubrmee,scehrnrtoenmd,rkimnsaTnfgolarnehess4e2e, 55 Camivorous Bits AfRocraaogCenr,seseeoknlsaaineihdrviwsekadaerssrsTmihienmem:dodhmeoaldepclraembdiisvieocdcaooutnswmiesuwmmga,hybcceohtrnoicmstikuimod,unecso0popfioenrngealsstrdiio,nrioanfon,snnfdorraeidnDrey LeheneasFdciioamenptoneurdnsdesaihsFiodoordoocfnhlaucioannrisosemkrevcaaniaveelscicnupiusltksaafdtBcriyerosdunedllustloh,alzbarcekdorufiro,xniorslno,greimpaarlnegbsaeennncsehsdm,aiarikTksoelo,er FS 56 Camivorous Mammals (Terestially feeding) CRAoucmonnasmCeirrnvsaetteidvseefiosraakgsea,ssdseeosesmremsnitnnsdemwdoadlheesla.baTcshaeemdimavnordwoeeultsrwemeiagcmhmtsaclhosantcmelnauaytmiibonenasao,tficoshnkrtodmauiemuim1,n0 acnogpoepesrei,o2nDr.oyf " 006-87 B USFW 0635 rmainhglaonreosfel,uovraonmaedtihuamn,eaanrde rfilsukorfiadcetoarrsedruisektfacltaocrksobfaosxeidcoonlocgoincsaelrvbaetnicvhemianrpuktss,foBrythdeesfeauclot,mproounnadnsd Food chain risk calculations andresultanthazard quotients are presented in Table 42. 57 Piscivorous Mammals A conservative riskassessmentmodelbasedonwet-weight concentrationsofconaminantsfo tie Dry cRounntaCmrineaetkedsiftoerahgaes, sdoeit,earnmdinweadtert.hatThpeismcoidveorlopursedmicatmsmtahaltschmraomyiubme,amtanrgisaknedsuee, taondinfgleusotriidoenaoref rbeickaufsaetoirtswbaassendotodnetceocntseedrviantiivceeisnpeudtism.entTsr.ichFlooordofclhuaoirnomreitshkancaelcisulnatoiocnosnsaindderreesdulatarnistkhfaazcatrodr quotients are presented in Table 42. 58 Omaivorous Mammals RAucnoCnresekesrieivshkaaasstsdeeistsevmremenitnmedodtehlatbaosmeadivoonwroeutswmeiagmhmtacolnscenmtaryatiboensaofrcioskntdaumeinatontsinfgoerstthieoDnroyf. cvoanntaadmiiunma,teadndfofrlaugoer,idseoial,raenidswkaftaect.orsThbeamsoedoendlpcroendseircvsatthiavteairnspeuntisc., cThrriochmliourmo,flcuopopreorm,etmhaanngeaniessneo,t creosnuslitdaenrtehdaazarrisdkqfuaocttiorebnetcsaaruesepirtewsaensnteodtidneTatbeleci4tn2.seed sediments. Food chain riskcalculationsand 59 Insectvorous Mammals Aconserivskaastseissvmeent modelbasedonwetweightconcenzations ofcontaminants or the Dry Run Creek site has determined that insectivorous mammals may be at risk due to ingestion of c`moanntgaamniensaet,evdafnoardaigue,msaonild,falnudoriwdaetear.e iTshkefmacotdoerslbparseeddiocntctohnatsearlvuamtiivneumin,pucths.roBmyiudme,fauclotp,perro.n,leaandd,. criocmhploournadfsi.corFoomeotdhacnheaianeisckoncsaildceurleadtiroinssk faancdtorressduuleanttohlaazcakrodfqtuooxtiiceanltosgiacraelpbreesnecnhtmeadriknsTfaboltehe<2s.e 5.10 Herbivorous Mammals RAucnonCserreveaktisveierishkasasdseestsemremnitnemdodtehlatbahseerdbiovnowreotu-swemiagmhmtaclonscemnagaytiboensatofcroisnktadmueinfaontinfgoetsthieonDroy.f contaminated forage, soil, and water. The model predicts hat aluminum, chromium, lead. manganese, arincdhlfolruoofrildueoraormeetrhiasnkeafracetocrosnsbiadseerdedonrisckofnascetrovrastdivuee 1i0npluatcs.kofBtyoxidceoflaouglitc,alirboen,ncvhamnaardkisumf,o athnids compound. Food chain risk calculationsandresulant hazard quotients are preserved in Table 42. 60 UNCERTAINTY ANALYSIS cTohnesriedearreedfawchteorns iinntheerrpernettining trheesulrtiss.k aMsasjeosrsmseonutrcpersocoefssunwcheircahinctoyntirnicbluutdee(naruunrc2elrvianritaybilaintdy,neererdor.toabned. insufficient knowledge. Error can be invoduced by useofinvalid assumptions intheconceprual model. Conservative assumprions were. mpoasdsiebiilnitlyioghftocofntchleuudnicnegrtathianttynoasrsiosckiastepdrewsietnhttwheherinskaatshsreesastmaecnttuaplrloycedsose.s Texhiisstw(a5s.doenleimtionamtiinoinmoifzealtshee negatives). Whenever possible, isk calculations were based on conservative values. For example, NOAELS " 000-155 usedtocaleulate HQs were the lowest values found in the lieraur, regardlessof toxic mechanism. Aasnseismspmoernatnstbcaseod. nRimsktbcoauulnccaetlrraooinntsryaeibtahsedinocnommpalxetiemnuemssoCfOtCheledvaeltsaionfsiendfiomremnatt,iwoanteurp,oanndwhoiichsatmhpeliess.k ; LdietneirfayrrseruvaileusesusfoingthcelotsoelsycrieyloatfedCOspCesciewser10emnaotkeavraiislkbelsetifmrateaslforertcehpetosreslpeececds.rceApnrorasn.emSpptecwiaess mreasdpeontdo iwfhfircehntthleytooxiecxitpyosduacraeatroetroexipnrse;dr.espMoentsheosdotoloCgOicCaslbpyrotbhleeimnsdiwcearoearlsspoecpipesasmeanytbien sdeivfefrraelnotftfhreomsusdpeiceisesSofomr Wfhoiucnhd NfoOrAsEoLmeSowfertheeosbealiencetded. rUescefpotrocrn,ately, swudies which were mre suiable for tis assessment were not AValluiteesrautsuerde steoacraclhcuwlaastecHanQdsucwieerde0theidleonwiefsytavpaplruoepsrifaotuenNdOiAn EthLeSliaenrdauLrOe.AEILnSmaforntyoisftrhisksamsusieesssmreenvti.ewTehde, - aapdpvreorpsreisetfefNctOsAEweLrse foobrsserovmeedraetcetphteorlso.weIsnttehxspeoscuasrees,coanfcaecnocradoofn1.0 wTahsisusmeaddetoictoinmvpeors:stihbeleLOtoAiEdLen1i0ty3 NOAEL, which adds uncerainty to the NOAEL-based calculations. cDoosnetsamiinntaonxtiscolboogdicyalwesitguhduideasy.canAlble droespeosrreedpoirnieudnaitssmofgmg icnodniettamweirneanctosnvedireste,dotr iunniutsniosf omfemgg t'hBiWsidcaoyn.verbsioodn.y wOetihgehrtwsiswee,rethreepboortdeydfwoeitghhettaenstdaninigmeasltsioinnagraievefon strhce,sptehceiseesvraelpuaesriweedreinsoethderforlmcaekraiunrge sources were used. Aonomthseirnsgoluer-cseopfeucnicse,rsaiinngltey-acroisnemsirnaonmltahbeoruasteorofytosxtiudciietsy. vParleudeiscrteipoonrotfeedciostyhestleemraefufreectwshfircohmslraebdoreartiovreyd. s34u4isto isthdeifiecfufletc.tsLoafbocroatnoarmyinsradnitesswceasnsn.ot aNkOeAiEnLtoasccwoeurnettgheneeeraflfleytsofeelencvteidrofrnommesnrdfiacetsorusswihnigchsimngalye Ccoonnttaammiinnaannts.exposure scenarios. Species wilizing the Dry Run Creek sit are exposed to a variety of Tfohrewsieldslivfeeryspelcviels.infIonrtmhaitsiiosnkavaasiseasbslmeeinntt,hmeoesrtaotfutrhesreegvaarlduiensgwtehreerabcaessoedfionnciedsetnitmaaltessolrespedoinneedntforinsgpeesctiieosn similar to the indicator species. dEextpeocstuerdeincosintceemneadriiao,ndsalwyerfeoocdalciunlgaetsetdiofnorrateeasc,hitnacrigdeetnarlecseopitlorsesdpiemceinets ibnagseesdtioonn rlaetveesl,saonfdcboondtaymwieniagnhtts repored inth literature. "rTihsikseevcaolluoagtiicoanltisskcaosnscelsusdmeedntthwaatsa"cponeduncateldewciotlhotghiecailnrtiesnkt"ofexcisotifmthpe laHQbeascteallciiunlenaitsegkd farsosmestshmeenmt.axIintmhuims caarleeaulcaornicoennstrwaetrieonmaadnde tuhseinNgOLAOEALELeqtuoaxlisciotry ebxecnecehdmsaroknse.. Within the calculasion spreadsheets, altemate 70 CONCLUSIONS 70 Bembic Inverbraie Community Structure and Function Dmaatya bferoamsbigontihfitchaentbepnrtohbilcesmurivneDyraynRdutnh.e tNouxmceiryotuesstsfiisnhkdiiclatle htihsattofrilcvarlildyeraepnodrmteetdalincDorntyamRiunnatailosno 0 0090:89 USFW 0637 provide evidence for potential effectson the beathic communi. 72 Soil Invertebrate Community Soructureand Function TcuhreensttrccornudrietiaonnsdffouunncdtaitonhoeftDhrey sRouiln iCnrveeerktesbitrea.teHocwoemvuemru,nisciyncdeoeeasrntohtwoarpmpseacromfporibseeata rsiisgkniufincdaenrt `pmrooublnetomsftmhaefyorraesgueltbafsroomfscoonmteamoirngaanntissbmesi(ne.gg.tiAedmeurpicinanthreobeianr,thshwoorr-maitilsssuher.ewBs,ascecd.o)nfoooudrcfhoaoidn. Chain models, it appears that this may be the case. 73 Fish Communities IcownatasmisnhaotwinonthcurroruegnhtltyheprreesseunltsonefatrhetefaltahnedfaidllmionuncaolwabtiDoarsysaRyu,n.thaTthliasrvfailndfiinsgh wisefruertshuesrcseupptipbolretetdo bloycatthieonr.esuNletgsaotfivteheebfefnetchsicofincvoenrtaembirnataenttsoxiocnitythteesbtse,ntwhhiecrceotmomxiucniitytywamsayobsdierrevcetdlyataftfheectsafimseh cbeomrmeumniotvieeds,frionmthtahteasypsotretmi.on RoeftphoretsfoisfhhifsotoodribcaaslefiinshDkriylsRuarne (ailes.o baenntihmipcoritnavenrttepbtrcateeso)f mevaiydeanlcseo tphraetsesautggpersotbslaenmsetcoolougpipcealrrliesvke.l Icnoansdudmieorns, hdiugehtoledveilesaorfymteotxiaclistyw.ere notedi the fish, which may 74 Worm-eating Birds . Rriesskultdsueoftthoemfeotoadlsc,hafilnumoroiddee,l faonrdwoircmh-leoartoifnlguobrirodmsetshuacnhea.stheThAimserriicskanisroabsisnoicnidaitceadtew2itpohtetnhteisael cecoonltoagmicianlanrtisikn0theavsioainl arencde/poirorisn.earthworm tissue. Reportsofhistorical wildlife ills also suggest 7.5 Camivorous Birds Rdueesutlosmoefatlhse,ffolouodricdhea,inanmdodTeilchfloorrcofalmuiovroormoeuthsabnier.ds sTuhcihs arsistkheisraesds-toacliahtaewdkwiitnhditchaetsee3cpootnernatmiailniasnks in the soilandorin small mamma tissue. Reporsof historical wildlife kills also suggest ecological risk t0 avian receplor. 76 Camisorous Mammals Rinedsiuclattse oafptohteenftoiaold icshkaidnumeotodemedfaolrst,efrleusorriidael,lyanfedewdiicnghlcoarmofilvuoorrooumsetmhaanmem.alsAissucihskasitahsesroecdiaftoexd with these contaminantsi th soil and/or in small mammal issue. Reportsofhistorical wildlife kills also suggest ecological isk to mammalian receptors. 77 Piscivorous Mammals Rdueesutlosmoefatlhse. ffoluoodricdhea,iannmdoidceh!lfoorpoifslcuiovroomreotuhsanme.ammTahilssissukchisaassstohceimatiendkwiinthditchaetsaee cpootnetnatmiialnarnistks. in the soil andor in fish issue. Reportsofhistorical wildlife kill also suggest ecological isk to mammalian receptors. 78 Omnivorous Mammals ~ st 005-30 leew NR38 z- tReesnulettosmseooftttalhas,nfohouroadricinhcaeainhanmdtoidmseseulh.lfoorrRooefmpuaoiorvrsoormooefuthshinsmteao.rmimcaTalhliwssilsiduslckihfei1ksihlselssorcaslisssosedosngwgiienhsdittchaeetcseoe3lcopgooitnceaanlmtiiFanlkainstsk5 mammalin receptors. 75 Insecivorous Mammals pReosurlntssorf lthedfootdo mcheaailns.mofduoerlidfeo,r ainnsdewciicvholrooruosflmuaamrommaelthsanseu,ch Tshsitsheiskhasraasislocsihatreedwwiintdhictahteesea SFoomanmienaontsfheinsthhreeswositaaknednoroninsieea,ruwrohrrmstuigssguees.tPehcyoslioogliocgailciaslks.soIonrmdadliivsieosn,tsopetchiefidciarlelcyt ptoeteontaitahl sFukesfor Tthhesschoruelwds,prseosemnet pofrotbhleesemsantoimoarlgsanhiasdmsighhacofneceednotnrastihorneswsofanmdeaolesransdmafllomraimdmainlrsiosn mhaesmstmealdiune rteocedpiteotrasr,y toxiiy. Reporesof historical wilde Kil also suggest ecological risk 710 Herbivorous Mammals pResoulvs orfistkhdeufsotodmcehalasn,mfoudoreildef,orahderrbiicvholrooruasflmaaomrommaeltshanuec,hThai5strhieskmieaadsosowcivaotleed wiindtihcatthees3e ESeommveaamfitnhaetsse ianhiemalsasilhaadndhoigrhicopnacnetntirsatsiuo.nsIonfmaeddailtison1tnodthfeludoirriedcet ipnottehnetiiatlisrsiuseks.forTthhies lceousl,d . frosieen,prRoeblpeamnss0ofhairorgicsa hwtidfeeedkoimllsvoallsso ssnudggteshtrecsomlaolglicmaalmrmiaskltsoomnatmhmeasliiteandureec0eptdoirest.ary 80 SUMMARY HSDeuivrneidrnnegesstbshnoipnmsantleiswjebevoesrrainln ahyinesdarhsae,drudal.tfTuchmaeensese,wnehorroramtgaialczibeteisheahsviishoaarv,leseiinflfcaelnsusgdaeotfdhgnracetcehisnosafdduDilrntycciRdaeuennlc,eCorafebesnko,irmhlaaslorpecopasavurerisee,,d mTmhionnftaesrmrdeerita,nnadgndarthohrmisgDhhramyvoerRaaall.istoyTrhaeepeorraetcserduossnsuolfmlethraiogsuersciasisahessskeioslfslismeinthDesrrudyp.pRoIurntn,aisainsdoewriilodpretohbakltieelmfsf(lwueei.ntt dfheirseo)hmertfdho,er EeDelrhayitdReuduontuosCrefneorrsiesctah,endmdellaevdemolaws,yofsbeemeahdamavl,isn,agnfaldduovfreiiprdasere,ieaafnnfeadcbtmsiiocehsltohtrehaaeftlcauocelroapgmrieectshecanontemontmhuattnhsessipc.hpatTohiehbsaeebirecfefhseuecltsaoinmdoaffyetdbh,ee co{oanknsidsslstaednsntmiweniantgthe.,hneuAmcteoanrcomluiusnsiioomvnuesmorf,cttohhmeepssoyukmnpdaissoewmsessrmmeeannptir.feesseItnnbaiyndtDdhreiyhnRerafdno whsepeeSccihfaoirmcaacplileoyauttinheodoshefastfidwueenrtriifdsieuoddxi3seidTcIi,Cn snhiodsr oTeynmaileytryesdeenitf3ierdeaCto0mpounydssieinnh,eanBcNeArssnclay)mtaetrcfourltdhenrovtebsetaicgcautiroant.elyThideenDtiufPieodn.t lTahnedsfiellcohmtpoduranidnss - rte Dry Run i he only apparent source ofichiorofuoromethane in sil adjacent o he eam. = 080.37 LISFW 0836 LITERATURE CITED bAygeSncciyefnocresToIxnitcemSautbisotnaanlceIsnca.nUdnDdieseaUs.Se. ReDgeipsaeryc(mAeTnSoDfR)H.eal1t9h90a.ndTHuomaxniSecrviPacreolsfiCloeofngorraAicltucmNoia.nu2lm0,5-9P3re-p0a6r0e6d Research Triangle Pak, NC. ALygeSncciyefnocresToIxnitcemSatuiobnalsItnea.andUnDncdieserassUeSR.egDiespaayre(mAeTnStDoRf).Hea1l9t9h0.aTnodxiHcuomloagnicSaelrvPircoefsleCoonraaMcatngNaon.es2e0.5-9P5re.p0a6r0e6d Research Triangle Park, NC. AbygeSncciyefnocresToIxnitcemSautbisontaalncIense.anUdndDiesreaUs.Se. ReDgeipsatrrym(eAnTtSoDfR)H.eal1t9h91a.ndTaHsuimcoalnogiScearlviPcersoCfonlomeracVtanNaod.iu2m0,5-9P5r-e0p6a0r6e.d Research Triangle Park, NC. bAygeSncciyefnocresToIxnitcemSauibosntaalncIensc.anUdndDeirseUa.sSe.ReDgeisptarrytm(enAtTSoDfRH)e.alt1h993a.ndTHuamaxniSecrviaPcreolsfiColoenfgtoraicBtecrNyola.ia2lm0.5-9P3re-p0a6r0e6d Research Triangle Park, NC. AScgieenncceysfIonrteTmoaxtiiconSaulbsrac.ncUensdaenrdU.DS.iseDaseeRpeagirsaomyfHe(eAnaTSltDtR)n.d H19u9m6.anTSearvisceis CconatPrrlaocftoiNloge,fio2r0c5N-ia9c3kl.e0l6,06P.reRpeasreeadrbchy Triangle Park, NC. dAmobgrso"seJ, FAoMo,d Sci5. TLeacrhsonno.la1n3d18L1F-.18B1o7.rzaieca. 1976. "Longterm txicalogial assessment ofnickel i rats and Barbour, RW. and WH. Davis. 1974. Mammalsof Kentucky. Lexington, KY: UniversiofKentucky Press, 3225. B19a8m6i.hUosuesre',sLMWa.nGe.fWo.rEScuotleorgiScaMl.RBsakrAeslslessm1.enBte.auPcuhbalmicpa,rRonHN.uGmabredrne2r6,79E., LOiRnNdLe-r,63R5.1V.. OENneviilrlonamnedntAalE.SeRrovsiecens Division, Osk Ridge National Laboratey, Oak Ridge, TN. sBe3ye2r,)3W7N5.38EE. Conner, and 5. Gerould. 1994. "Estimates of Soil Ingestion by WildlifeJ". Wid. Marae. hBerpoaotkost,oxiL.cicy19b8y8.cap"pIenrh.i"biPthi.onD. oDfisNseArDaPtHio-nc,yRtuotcgherrsomUeniverresdiu,cuNseewaBnrduansnweincuka,tNo.nJof acute diethylnivosamine BYourlk,JN.YA:nAdJl.fFreaAdm.aKnndoIp.rf,,1I9n7c7., The AudubonSociey Feld Guide to North American Birds, Eastern Region New BurtonP,. 1989. Birdsof reyofthe World. New York, NY: WH. Sith Publishers Byemum, RU, RE, Eckaret, LL. Hopkins. 1974. Vanadium, Washington,D.C. National AcademyofSciences. 5 005.02 CParlydsieorl,ogWy,A.244a:nRdEOE.IJ-.RBErDaSu.n, 1983. "Scaling of osmotic regulation in mammals and bids." American Journal of - CSiasscarnoopnvaag,esV.a,ndL.AlBvoewolmaarnT,yapnedILJCRelWtrsigJh. tTox1i9c8o4l.. E"nTvoixrionc,ieyHeoafltMhea13l:i8c45-o8n5s6.in the Lung: Effects 0a Alveolar CSleiarkT,ecDk.r.13:3139789-.341"Lead Concenaions: Bats vi. TeresialMammals Collected neaar Major Highway." Emiron DCheiacnks,"C..T.oBxMic,olHaLregtiss.nd$T3PS0.3H-a3rg1i8s.. 1991. "EffoefcZitne ToxioncTihytroyid Funcion andHistologiyn Broiler "DTehGeraUanti,veRrsMi.tyaonfdMDa.sD.saRcuhduisses198P3r.essN.ewEnglandWildife: Habit, Natural History. and Distribution. Ambers, MA. + DDeemMeasyuoia,lAP.anMt.sC.anTdayAlqourataincdLKifWe.." TCaRvClrC.rit1i9c8a2l. Re"vEifefwecstsion fEnCvoiprpoenmreonntaHluCmoannisrd,l,Lab1o2r(aGt)o1r8y5-a2n5d5.Farm Animals, EDnivxiorno.nRmeLn.taRlJ.HeaSlhtehriPness,peacnidveLsP.. 3Le0e5.3-61397.9. "Assessment of Environmental Factors AfTecing Male Feral." Edwards, CA. 2nd IR. Lofy. 1977. The BiologyofEarthworm. JohnWileyand Sons, NewYork,NY. ! Ewh.rlich, P.R., D.S. Dobkin, and D. Wheye. 1988. The Birders Handbook. SimonandSchuster, Fireside. New York. 785 - ESiesrlevri,eR.Bi1o9l86o,gi"aC!hRreopomritu,m8H1a.z8ar6d.s t0opF.ish, Wildlife, and Inverebraes: a Synoptic Review." US.Fishand Wildlife SEeisrlveirc,eR.Bio1l9o8g8i5c,a"lARrespeonritc8H5a(z1.a1r2d)s, o Fish, Wildlife, and Inveriebeats: A Synoptic Review." US. Fish and Wilde = EWiisllerd,lRB.io1l9o8g80i,cal"LReepaodrtH.az$a5r01d.s14t)o.Fish, Wis, and nveribrates: A Synopic Review. United SatesFishand - EI1v3ma7n6e,. sA"EP3,f.0f.e72c0nt4sdo:W7f1.3CGh.IrnD.oaiSmlt.ieuv1em9n,i7n41tDh".eThCLeaJnE.afDedacivtaisneosEfSn,voEidXrio.numSmetnaCtnh.le"ryoN.amtRt..eAR.oesnA.btbhCootusPn,rco.Mx.iCmaIannl.k,aT,NubRLu.ClBeCsiNodof.tsh,1e50Ra1a7nt.dKi1Ld6F.n3epJ.ya.w"arLasbi.. : FCloenmcienngi.atWiJo.nsainndJepC.Aa.nSecsheulQeura.il1.9"88E.nv"iIrnfolnumeenncteoalfTtohseiMcloegytoanfdhFClhuooermididseeAd7m(i1n0)i8s3i1a-i8o4n6.on Toxiciy and Fluoride - FEluermoipnega,n SWuJrf,inCg.sE.." AGrrcahe.,ECmA.. CoSncth.uleTors,icaonld. C1M66.):B4u8n3ck-.90.1987, "Effcsof Oral Doses of Fluoride an Nesting L GMiasnnguatnsoess,eGA.dmaindniMs.aT,iiMonu"ayNe.wro1r9o8s2i.co"lA.li3e7r5s-i8o1n.s in Brain Dopamine and GABA Following Inorganic or Organic Goldman, E.A. 1950. Raccoons ofNorth andMiddle America. Washingion, DC: U.S. Fish and Wild. Service. 54 L 000..0% 2 USFW 0641 fects on Aquatic Biota: 1994 Revision. ESTER/TM-961R,Martin Mariera Energy Sysiems, Inc. Sure, .W. 1977. "Effoif Fluoride on Livestock." JournalofOccupational Medicine. 19(1):40-45. Tyson, E.L. 1950. "Summer Food Habitsofthe Raccoon in Southwest Washington." J. Mammal. 31144844. UWaSt.erEnRveigruolantmieonntsalanPdroStteacntdiaorndsA,geCncry i(U.atSn.deESPtrAa)n.diara1d9s81D.iviAsnioenx,pWoassuhrienagntdorni,skD.Ca.sseEsPsAm=e4n0t/f4o.r8a5r.s0en0i5c.. Office of UReSg.alEantviiornosnamnedntSatlanPdraotredcst,ioCnriAtgeerinacayn(dU.SSa.ndEaPrAd).s Di19v8i5s.ionA,mbWaisehninwgattoenr,qDu.alCi.ty criteriaforarsenic. OfficeofWater UF.rSe.siEwnavtierronamnednMtaarlinPreotOerctgiaonnisAmgse.ncUyni(tUe.dS.StEaPtAe)s.En1v9i8r5o.nmMenettalhoPrdootsrecMteioansuArgienngcyt.heEAPcAi/eSOTAs-i8cSi/t0o1f3E.fluents to + UWass.hiEnngviiorno,nDm.eCn.talEPPAr/o5t0e/c1i-o8n9A1g00e2n.cy (US. EPA). 1989. Risk Assessment Guidance for Superfund. Volume I. LUi.Sf.e EFnevdierroanlmReengtiastlePr.rotVeocltiuomneAg57e.ncNoy.(U2.4S6..EDPeAc).em1b9e9r2.22Ambien: Water Quality Criteriafor the ProtectionofAquatic USStSs.esEnEvnivriornomnemnetnatlalPrPortoetcetcitoinonAgAegennccyy(,U.OSf.fiEcePAo)f.R19e93.sWialendidfDaeeEvxerploospcumreenhtF,acWtaosrhsiHnagntdobno,oDk..C.VoElPuAm/eGIOoOfRI9l.31Un8i7tae.d oUf.SS.edEinmveinrto-nAmsesnotcailatPerdotCeocnttiaonmiAngaentnscywi(tUh.FSr. eEsPhAw)a.te1r9I94m.veMrteetbhraoedss. fUonriMteedasSutartiensgEtnhveiTrsoincmiesnyta]ndProBtieocatcicounmAugleatnicoyn EPAGQOR 94/026, UReSg.ioEnnv[IilroBnTmAeGn.taTlecPhrontieccatlioSnupApgoerntcSyec(tUio.nS.. EPPhAil)a.de1lp9h9i5a.,RPeAv.ised Region lll BTAG Benchmark Values. US. EPA NVaatnioZnianldeRreesneaBrackhkeCrouanncdilJ.ofJCaawnoardskai,.As1s9o8c0i.ateEfCeocmtsmionfeVeanSacideinutmifiicntChrietCerainaafdoiraEnnvEinrvoinrmoennmtenatl,QuOalriatwy.a, Canad: VPelneunguompaPlr,esBs., aNenwdYTo.D.rkL,ucNkYe.y. 1978. Metal Toxicity in Mommas: 2. Chemical Tasiciy ofMetals andfesaloids. WMiiecsreol,som1e.s f1r.Co.m LRaetuTtizss,ueLs:.DiDamiofnfdceannidalHVI.nhiGbeiltiboonina.nd19S7i1m.ula"tAiroynl bHyydBreonczaorfbloanvo(nBeesniznod(aO)rpgyarneince)SoHlyvednrtosx."ylAarschin Biochem. Biophys. 184:78.86 Wixson, B.G. and BE. Davi. 1993. "Lead inSoil" Lead in Soil Task Force, Science Reviews, Northwood. 132 pp. Woolson, E.A. 1975. Arsenical pesticides. ACS Ser T:1 - 176 (a cd in Eisler, 1999) El 009.84 USFW nha? ~ Ap Fs CY he 5 SOT = AE3 --~ Ada ARN ER LPR aGU ESAs CO o 0" usew 0643 \ 7% 000.106 INTEROFPFICE wENCRANDUN DFartems wE14s-gmtroovn-1A.997ves0e2:Ritpm mom TDeopel:e aSanoemsveesaRIsNG RounERs TTTooo,ui sRRoowswoeiRoD:pWL.x.HamLirorooewuEsy ({{ mRseeroceazmoes) )) TToour iD.avDiAaVIc.D RRaakrSraiYs.enTR. {{ aEaavnEzyee) ) Subjects C-8 DATA ROR DOVESTIC WATER WELLS or, FCi8RiDL'EV(ElLbS LDUNBTSHCEK WBEALSLTFTFEILLDE)D WDOEMLELST#1ICAWRAETESRAMHSAERRIVZIECDE BWERLOLSNAND WEST VEST WELLPIELD (01D LODRCK WELLPIELD) WELL#1 sm ose So111saommm (amen e$oo07-3178514+ sSSuuummRmamoooacanawtrres rRReaecccooovvveeerRryr a im 120 - 126 + SURROGATE RECOVERY ssn ware HE#L33L6 on 3 oRairsAs mY 55352-8C7e6s0+v sSnunmsmmooaannirrss rsmeacccooovvueernryr WE8L33L1 oJ3ns soolsemamme s"Ps0EI-N 7o8n+s ssmnnmoouunnrTes RRieeacctooivvieenrrdy wns 6/93 3.3 PER 69 - 87 % SURROGATE RECOVERY g SSRIUEMRCIROLOVAGERARTYECbORFEORCTGOHAVENEIRACYNASLPTIERTRUITCACIIAVNLRSENTE2OT0HTOTHDHEEUPSSREAADMCPTTLIOECEDTEoOTFEGRAAMGDIEDNIETNHGTEHCEOPMECPaROCURNNETDSSULTWIT(H12, ggg Tomei) "AN INDICATION OF HOW MUCH OF THE C-8 PRESENT IN THE SAMPLE WAS = EID091600 006..% 7 000.165 Fr I| T. x12e0w08e7d9e7L03:41 AM cSTuootiect: CcZ-o8PoFMEkOLiNcKKEOYENSNTMUCD,Y CHAPMAGA KOEFTFIWCIITAHL AIPTKEENSAPBFUOT GHREORUEPILSASATQVUEIECKK-NPIRNEUVTIEEWS:WILL COKE WITH 21))D6.F1A/R2RASRHARWEISLL(W6O5R0K,00700)GECTOMCMOINTTTREADCT0S OHNONKPELYACEANDBYRYAETARWSORKEXD V3O)RPKINABLY C3O-SXT(TEOSTBE50,I0N00T)HATANDREGBIIOONC,HEN2IDCEATLAIDLESTERIMNICNLAUTDIEONASNABLYYTICAL HLEAISDKEERL-L-P(EARRHOAUPNSD T2H0E,00D0O)L.LATRHIASMOUWNITLSL DESIRE OF THE TOX WORKING GROUP 10 BCEAN DBEETAAIDLJEUDSTTEH.ROUIGTH ISBYTHPAEUL. NOT GO ASK FOR KORE MONEY. wa4y)T,I1N9I98N.GGNKEY PILOT TO START IN TTB, 1998, RESULTS AVAILABLE 1999. WE DEHCOINDKEEDY TKHAAITN-TTHOERSETAWRATS JLUINTETL1E99C8H,ANRCEESUTLHTAST ATVHAEILSATBULDEY KAY W3OUHLODNTHGSE~N=E5R0ATEITEN15OUAGH6SNOOLNITDHINSTFUODRYM.ATION TO ALLOW CONCLUSION AFTER E$X)PCEODMIMTUENOI-CAALTLIOON XINNTEERBFEARCSE WWIALDLE TNIENEIDNGBECKOARTKNITTAKIENNETDS TAONDKEET THE ADBUORVIENGSACNHDEDUALFET-E-R TCHOIMSPLWEITLILONIONFCLTUHDEE I2NULSIAFNEDPH2ASEEUSR.OPEAN MEETINGS DFAUTRET-HELROODKESAZLLSIKETOEVCEORKYEO-N-EWORISKINIGN GLRIONUEPTWOASGETTHEAFTKEORSTTHCEOOPIESSRUAET.IVECO70 ANMODTETTOHAATLETHSESERRISEXKTAESNSTESTSHKEENRTAT,WISLTLUDRIEELSY HAENADVIHLEYNCEONWTIHLILSNNOOTNKBEEY, conpreTed 1 1998. 006-37 EIDO81907 7e8r 009-76 . INTEROFFICE MEMORANDUM Date: 17-Feb-1998 11:20am EDT From: R|IRTCOHBEERRLT L. RITCHEY DeTepftNo: E8P6-3E-n4v27.1 TO: See Below `Subject: EPA Visit to Dry Run Landfill 11,t1osDrhyosRtuend tLoadnadyf.ila, pre-scheduled visit by Mike Taino, EPA Region is aMFiuknedwiOgns-aSscseingeneCdootordEiPnAa'tosrD,rRAysusnuche,ffhoertsgseetvseirnavlowlveeedkusnadgeor. He Sexupplearifneudndth/aCtEhRiCsLrAolwehies ndetahleirneg iwsiathpsoitteunattiiaoln"srtehmaotvraelq"uiprroeject. He ghieamfnmidenldeeiswahtraeetmaetrdteeisnaptloionrnsees(ptihosunrsseerqseumiworhevidaclth)oaaarsgeiolvpoepnnogesiremdmteetdromitahitneeinrangteruerodeu..p MtHhieaktawosuald Givi Enagris.neer with an Environmental Masters and has been with EPA What drew Mike into this Dry Run effort is thegercepionby EPA tfohratthoiusrislaonbdfviilolumsalyyibnfeluehncaedving bayn cilmapiamcstoofnhiDsrtyoricRaulncCartteleek,.fish, The basis aasnsdeostshmeernwtildrieipfoertimopnacDtrsywRhuinc.h aMriekereifnldeicctaedteidntthhaet EhePAhardiskread the c{oGnc4luisnifoonrsma(tairolny)woefsiubsmiterdeportoanndDraylsFgunh.asWaivtahiltahbaltebfaochkigmrotuhned, he wasPrperseednitsaptoisoends taondbeQli&eAvestehsastiiohnesrewiatrhoprWooboldyemIsrealtanDdraynd DRunaCnrWeekbeer `crweedriebisluictycoefsstfhuel EinPcAarsiisnkgasssereisosumsendto.ubtMioknetahteosnceiepnocientasntdated sTiokmeetrheialnlgy ickane'*tsroel|y oanmthdiesceidsingo!whWteacdiidonasckanroewnleeeddgeed,thiattsionunds tg1hi9as9ta5sitswohceaisathnaeoddtarinefoercpocimusrforldeuedorosifiden"scb,el.aecxkplwWaaeitanesre"do,odbuiurstcceuoxsrprsleecadtiitnvheeedancutthmie oecnarsuosauens,d {duheicshignwiilmpbreovinecmoernptosraatnedd ianddoiuironnaelwmpoenrimtiotringwhaenndi pfsefrimniatllryequirements issu\ebde.liWeeve Miindkiecaistoefd ohuerodpeisniiroentothbaetgwihnawtowrekinhgavoen atlhroesaedy AdSoAnPe. Hgedrwehsaertvwedeplthe arifngohtdtooudnedcedrethoethneerwwipseer,miintclwiuldlinrges2aldveecitshieonisfsoued.o emolrsWowesettuocdooyuk.lMdHidokoweetavonedtrh,wehhLaeatnwdeaflissledawenoaudrldlhyehbgaeovtiunasgtgterooudobld,e toutrh.inHkoingdoofgwshnaott thaalvkienga abnadckhgerohuanddfienwdeqauleisnfigownist.h lEavnedrfyiltsh,ing lwoeokdeiddgmooosdt.ofDrytheRun AGsreDeakndisdunmomlarhiazveedthaeftaeprpwearadrsa,nMciekoefcbaeimnegtaodvseereseugllyy eacndteheddaitdna'ilt.. 1 beMliiekveewhilel cbaenathealuprsmteabeitliinzegEwPitAh'sEPunAatnteaxcthMedoenmdotafiyonnaPlhirleaadcetlipohniat.o 000.72. g g 8 EID067733 +""+ soaoqnmuatehtiiscofiantnthederamacsatsimeomrnattilooidnaasnyatntodhxacitiotsnswciullelussbiaeonnidsmwpoohfrettnhaenwtsettuovdihysi.itt|hEaPbreAdl.ioenvethbeased BEET ERE Distribution: TO: WILLIAM H. HOPKINS a] TO: H. DAVID RAMSEY. JR. {RAMSEY) CCCC:: JLOYHNNWOROMDAKT.HIEREWLSAND (M(AITREHLEAWNSD . CE CC: RBARLPIHGN,DSTAAHGL GJRO. N R [E(arSeESsEE2R1Aa)1 AT CSOC ) CCCC:: AKENIDTRHEB.WPSI.EHRASROTNTEN CC: Charfes T. Alt (an)(,P(IHEARRSTOTREBAASTAATLAAT1 EATSVCSAOCX) ) GCCC:: CC: JJOOHHNN MJ MMIEGNLTIIONRKE DANIEL A.WEBER ((MMeInGi) (WEBERDA CC: GEORGE WOYTOWICH (WOYTOWIG ) 009.75 EID067734 | May 14, 1998 RETURCNERTRIEFCIEEIDPTMARIELQUE-STED HUs..S. SaErnavhiroLn.meCnatsaplarPr(o3tHeW3c2t)ion Agency 8P4h1ilaCdheelspthniuat, BuPAildi1n9g107 RE: EPA Draft Report, Ory Run Creek, November 1997 Dear Ms. Caspar: rreepgoarrtdTihnaagnndktyhfeoourvamfleoierdtiiptnrygoviwodfiitnhtgheDuDPuroPenoptnotrton'WsasFhceiobnnrgcutlauorsnyioW2n3os,r.ks199a8,coptyo ohfeartheoursucbojneccetrns time pTrheohipbuirtpeodsereovfietwhiinsgleinttoeurrimseettoindgo.cumAentsumtmhaorsye provided, followed by a more detailed discussion. ocfonckeerynscomamnedntostheirss which dreipsocrutsWseitoornecroeongmnoviFezeebsroutmaheraytof2t3hethreariespieomdrptlitchwaeetirpoernvosisepwetechadtt oiftsheamakc"ioDn-rgaaufttc"hhoarncsgoepsyi.ndtiocWahtthieildse doruarft they dtoidacncotompilnitsehnd,thiusp.on Wreevdioewnowte bbeelliieevvee tthhaatt apromsapjeocrtrweawsritoeffewroeudl.d beThenreecfeosrsea,ry we have elected instead to limit our coments to this letter. beingWeadvsehrarseelyanafifnetcetreeds,t ainnddeitfersmo,inidnegterwmhientihnegr Dthrey our opinion that the conclusions of the draft report RcuanuseC.reekHowheavserb,eenit oris is with respect to' these 2q3uesmteietoinnsg,areitnoits osuurppoirntteendtbytoawvoariklawbiltehdyaotau.toAsdesiingdnicaatneddcoantsioduerrFaebruary cbeohlilnadborthaetivreisknexats-ssestsempentto. advance a scientific understanding of the issues | Sincerely yours, SRro.berEtnviL.ronRmietncthaely Control Consultant Washington Works Attachment how: 196751 09.7 USEPA 062 | | BE Roger Zola <ZPFELOWMWPS.ATEMALOUPONT.COM> on 091419 Tor Roger J BfeAERupone Sie (6:8 ENVIROMENTAL SAMPUNGI24- u1r998FC-143 Results Avaas ------------------------ SFDraucobeuj::ectWV:eEdR,PA1L2164W3IJGuRAneLs1u<9l9t8Ws1IA3v:Ga3i8Nl:u0Lb0lVemrLTo-eEpmaawtiel.p.d(usMpeo-tnotaw.i1ccoh.n)> T ERToI:TBCHNREUY"RRE<NOR5.IAHTGAaRCmTpaTHiELN.aE-duR-CpHoLaanAnt&iRLcwlTo.u.pTdsuE,apAo-nS-tLaEcENoClRuGSOs.D0,X0,"-DDAIUANRPLIEOLENEALTNN.DAC"A.ONLWSEL,BER"~ROBERT L. SSIRRELEIANRDIOSpaCPaaiHL.FRaenmAaeaLmliRa.lidlwGduupappouonppnatotcn-co.emocasuo,sn1,s,"R"GIRECoOHgReAGrREDJ.HAOYKTTIiORpSNfCeEHiCNtHER, TR* DCAHoeDnlEtiOevvneetrTa-yit-ydoTpanet::e:OI1aWL:1eN0T.dI,PeTmA2aR4iSC/JNudInuRXpEo1Dn9p)t98cBoe1Om3Us:N4D4A:R0Y0=-BSOoTundary_(ID_2NbORBOXIUENFSQRO/NTA)NFTioospttoyirpntaga:ndcaeHt:AeI:LnoWremda, 24 Sun 1998 13142100 EF ---------------------------- RSDauitbzej:evcetWs:eedi,Foon-2:1643g1u.n0Dac1a9.98fro1m1:L0a7n:d0f0il2l0s7 ACTooenpytoparnteae:n-cteyB:poe:ncoartmesaxlt/plain June 24, 1998 Details of FGri43 Sample Data Prom CHEN HILL Available To-date: tocation sitbea'cseaspled lossesteiaonn Result [SE EID082057 Dry - Run Landfill - 5/19/98 .- - :: - - Stsreeraaamm:11 411.s0 L0e0a1choauteelet s167 Een 0 Le. tart Landfill . -. .- -. -- -- -- - - 5/28/38 ULpopweerr pPoonndd WWRKLLTTLLGOZSA HWLLTI. TWrWiKpLTLBHlWaSnk razxoz 1418000 99300 26024000 2.7100 0 0.1 Lo-cal Landen) --- --- 6/2/S9t8reamou2tlet15101 sa oouuttcfaallll 0000s4 3192 raLx0s 0.1 Plant site - West wellria 16 16058 (viw) 009.0% EID082058 | INTEROFFICE MEMORANDUM TTOO:: JLOYHNNWOOR.D MK.ATHIERWESLAND CCCC:: GRaIrCyHAWR.D AKleKsIeRlSCHNER, JR Subject: Dry Run Landfill DFartoem:: TDeelpt:No: T08h-oAmuags-1R9.98Wal1d1r:o3n3am WAPELDD-RPOOTWRER/SERVICE 304-863-2485 (( MIARTEHLEARNSD)) (( KKILRESSCEHLRGAH )) sLlaonwdfirlalt.eI. caTTmhheeepiolnenvdtehliissofbmeoirtnhngeinpdgroanaidtnehadbaoduttdorot0ph8ep30edsttraoebaolmuo,tokaatatfoaoDtvreyorryR.usno. chOahndecmkoyipnewgnaeydonouttht,ehevIparlrovagenreaisnstl.iottolHneee, aoeflasorRliicseharairddt'hhseiswhamasonrdistnogla,dndtaonhedtuwsraansidijhtuest pcorofomfppaebrreitfsyoornel)idnaear.tk.#0R(0i71)c,haroIdnetCooaotnksttsrohumeect2i,wo0a0nt0ehrafscsamilpenlvseetlsalla(enjddustaonecfoouraptlveitshuoeafl ntcohhteeckaolultdfaamtlshleatsitosl0ei0l1dfs.awnedrTehaelssowtaatyieinrnsgtwaalbselheidrnudns.niiltngThfetenhcrseotsurgehaanmdtwhahesamybtobutarhlbeisdbutin Lcdilonewean,r.to`anTadhbeWouritelbuairs tEshatoriullslanhdaas flooitontsotfaolrlaescdotiabvuitmteytbeadyloowngnda.theethaaratt,tthheweasprloifpnaeeirrtlyy hpfiresnocpeee,nrdtymqywuihgteueensshaewloostuo.lddesbIiefretIso.gegtivSeomaehocinhmeanecaiess,ireurI nmancaicnyegscshteheocnkiotlnol otuhfrirnogms down there tomorrow. Tom 000.7% 55 EID030998 - | INTEROFFICE MEMORANDUM DFartoem:: DTeeplt:No: T0h9o-mAaugs-1R.998Wal0d3r:o5n7pm WPAPLDD-RPOOTWRE|R/SERVICE 304-863-2489 TTOO:: JLOYHNNWORO.D MK.ATHIERWESLAND (( MIARTEHLEAWNSD )) cCcC:: GRaIsCyHAWR.D AKleKsIeRlSCHNER, JR (( KKLIERSSECLHGRHA )) Subject: DRY RUN LANDFILL has now dIracianmeedidnowtnodaabyouatt 3140t0o t4ofceehte.ck oInaDgraiynRutno.ok Tshaemplpeosnd d(ifdoryevsitseuradlayi,nsaptectaiboountontlhye),2,0j0u0s!t bleelveolw athned a#0g0a1inOuattfatlhle, as I aptrotpheerty2,l0i0n0e. levTehle oiustfaallslo sisligsthitllly tpurrebtitdy. tuTrhbeidsaamnpdletheatsatmheple ptrheopsetrrteyamlinjeustisbesytiolnld tchleearf.enceWaitlbtuhre'sprcoaptetlretywelrinee.wallIogwoitng in osdeoverraflrompicttheuressampbloethatyesttheeroduatyfaalnld btuotdayi.t doYeosu cnoatn nsomteillcelaikne yloeuachaaltle.haveTI awilllookb.ringItthaelmkeddowntointhethSeemcuirnittyheGmuoarrndinagt tahned lfeitll aanndd hweentsabiadcktheupsatmhee cooludplreosadasjusltastbewyeoenkd cthaemeodlodwn1,0o0n0'4-wshaemeplleers psooimnet.wackIy,awmegeodipnegrhtaopschbeecikngthgatrowountupsootnheraen.d sePerobiflemI icsa,n Ifind wdoint'htmekln!ow whIatheatrhethsetuyffgrolwookasloltikeo.f thIatmaysthuaffveovteortaikneMReoiggser Ciotunstuyr.e loAosksIawrliottelitkheisrmaeisnsaogne,thelowoakyi!ng oJuutstmywhaotffiwceenweienddoawt, the landfill... More solids in the stream... Tom 00.34 EIDO17500 | | AGENDA 8/11/98 DRY RUN LANDFILL Commitment to work together Purpose of Collaborative Effort Materials Potentially Landfilled DuPont Inputs on what to look for * Mammalian effects * Organofluorides + TICs 7/22/98 split Sample Results Collaborative Program Proposal 009285 USEPA 0821 scope devAelcooplmleanbto,radtaitvae ecoflfloercttiboent,weeannd EiPnAtearnpdreDuPont, including undertaken to characterize environmental tation, will conditions in order be to: 1) investigate potential causes of environmental effects 2) dcoentsetrimtiuneentisf caanudseesxpoarseurecpoanntehcwtaeyds to landfill , 8/11/98 - 5 035..8% EID017942 8S  - dG2fio3rsl3opl4uoo2pws4ia11nl1:g.hiiMnaTtsheiirgsinaillfsiicsatknintnogwqnrueaopnrrteisstueisneptsescattaedgsootomodehaftviaemiethbeieenfnfhoisrsettnotrCyotosiDvnreciyivudoRecuenthe story for materials meeting this criteria. bdfoiiirylts/esrrhubb(bocltoetaolfm-rfoaimsrhepdl(abcnooitallee-rxfsci)arveadtiaonndsalternate fuels boilers) baiboscoarkbeed biosludge bsiupoe-rwnaasttee ptornedatmdeinrtt settlings (equalization tank) paoyllyoancerteaslinsresins peollaysetsotmeerricrepsoilnysmers paoclryyvliincylpolbyumteyrrasl pfolluyoertohpyolleynmeers wcoaorddboard gslcarsasp metal asbestos 8/11/98 I 009-25 EID000244 -- qe-- eye - Group 1 Appendix: Major monomers and constituents of Group 1 resins. RESIN polyacetal resins aylon resins polyester resins : elastomeric polymers acrylic polymers polyvinyl butyral fluoropolymers polyethylene MMAOJNOORMERS/CONSTITUENTS formaldehyde hadeixpaimcethaycliedne diamine dcoadpercoalnaecdtiaomic acid ettehryalpehntehaglilcycaoclide butylene glycol* eetthhyylleennee/-mpertohpayclreynlei-chexaacdiidenceopoellyamsetrosm*er+ butylene/poly (alkylene ether)phthalatet meetthhyyllamcertylhaatcerylate ne-tbhuytlylmemtehtahcarcyrlaytleate miestohbauctrylylimcethaaccirdylate pbuotlyyrvailndyelhyadlecohol tetra ethylene glycol diheptancate hteextarfalfulouroorporeotphyylleennee ethylene ethylene * = mot handled at manufacturing site as monomers (already polymers) 9/1/98 009.8% EID000245  : 7 OcGhSreoSmwiicla2y:lsheuLsoSewrceasinesdatstorigavtceenttivseo,lOurptyleaRscuthinecmii"zcaeanrlcssr,ilolrfefi{rinnitcgeleruredasentttswh,heicsfuhorlfclaoocuwtliadnngts. mgataics.nk.ettesnw.dhnicciehnscuchloeaumtliidconab.les.rpargessT.ehnetabTsiisontrbde1e5ntmsin.noitmecitcso.m.palneooutrnetassdslotnaoboFcrirlateteaortrsey.osruch a ohTofiwsegtvreweroa,utlesdatgboieondtaenrfeaesixtthhaguiesvftfeionvrettheexhaesricnbtieesenentamotafdaethetaocEiPliAnictlyruedqaeusestdthi.ovseersceheamsicoaulrss; faocretmiicc aacciidd maectehtaonnoel ccahrlboornoftoertmra chloride hheeppttaannoels mmiixxeedd iissoomneerrss Ns-tbeuatryiTc baecnizdenaendsuslafltosnamide dbiipfhleunoyrlochalnodrobniepthehnaynle o(xFi-2d2e) trmeitchhylloernoetrcihfllouroirdoeethane (F-113) ttreitcrhalcohrlooertoheytlheynlesne methyl chloroform mp-hcerneoslol hbeyndzryolxyeatlhcyolholcellulose Tmeotlhuyelneethyl ketone pshiyoldlirycoeoctnahryboloienlnseoigllsycol ethers asumcmcoinniiucm ethylene paglecyricfdollyorooctanoate dgia-s2oleitnheylhexoate numerous hindered pohfenpoollyceotmhpyoluenndesglycol B alkaIlaitniEec baantShtnyecdrriiecse AdlietseerlnatfueelFuels Bofler flyash (one time event) 8/12/98 009..5 EID000246 " SE SE SR Se Ge es i ns oy . 2 DRAFT oT ~ (50 a a ay Ganarat HumaPnroHpoosuatl ktodCoEnmdeucatmeantal Effects a Riok Analysiosn C8 TM Ww ie 3 Pe ps C pumosa: S22Te0nhmdui-rdBuoiuansrnmpDotaOsinSaatlAtoriOffvoeCtmh3oies.sxiparmTotahjtuoeecrtasenioaslfoltrso6ii.sesckvsawliisuloabatneeatctmhoaeenxndrptuioecaskicsuoturdorehsiemu.mm`aaamnssmphaeeannl.tahpsaencdrtosheia ) ul aSGaoaevmneayibtoiopivsndeadasl.n.wtiiAiTsalhkdaoscapinfradootjmereacfmcuawtoniumluroimLaceuconicmdoupanradtsuricasotnonnesnssdpioronferchserakdenissdngSppeaarrtoiieyssm.soaurcTnerosegrsoemirrawepsiE oreeLesosmon pBeogd in ) scGctoohrnnialdttreuaigccbiutletoasadratzinoendcphaaiTlrghohaaerasa.itntaIrvnlieswpskhsaicr3ca0hnwihhblauedmedarvoenevicahooaespmaSemtodhon.enahaTunthciiesoorpensaajioemoicassenpigooaonshssreiesparoneaohntd N Smeolnotwhswitlo presented 1ac6osmscpuOlmeletaeaDfOFreorbm.att1h,oenityimekof iaUnpaiptprioaptprirooinav.taeTlphdaeanttEex.p)peorssuornenaenaHleymsees crake listed 12 EScomp AanatHaearndRomimstication 7 Trmeealdgse Es0C0o0.ms TPP( -- _ Rowe B pcHroaittzeianctarildalsli odtxoaisihiyummaetae nendroshi0atshbeofwuitsleelhdeavfaaornvciienet(we0arshdpueamcniadenssehuxmermaaarproirlziasektdowniiloifissersecctiohon.s aThe sz PISN AA MN TchoereSroeses-mroansepsanasspcehasraectagisicorsoofsC-p4awict bse eevxatlaoupaetoleadr)pTahisrmtahysiatnasmki.e 7 aJ{bCpoenoevnorredrauleacoavtscnuiaohncdeogea.bzbaseacInreycpd.hoosmsAnaiprbtpklhredeo,opkrsraiueladytiuemnmedaonlotdysavisremysoeftotensorycsisGoieoncn,ritolegTylrhcsneaopl-Se.o-hcbbaiasresemseradoecpdshiaaxcarvraerrmeeneyocririesSeuiisnhye2ca0ve5rs%, ose elaionswihliebes dwaolvableoGpeevdel10opleadctinatheiarpisapcaecias axabolasn cs cos. Sisk ve, . fbRElexoraparsoioseeunn,raeebdloAfeknaeielxxnyppsgooisstwuuarrterws,icldanebarermiadoles,veaolnrodpGea-di8:hawHiralrslkbaeeldnlegwveelslsiowporoenradk.p0we7Tiahnriasna.rae ksItse1eyi6l.n0e0e0trudoee 22 xTHifapahrsnoeksmsepelehlrsctew.lliaranowctidallutlabceeoutneaecbh,ouanlacpanatdnceth.wraaarMataictaotonendrsolioazCfpeaoCtrslha8oelsitaenophecorhxaaiotaiuauluneorsssa:imopTadahytmobheewbdaeysissem(feeoamshtisowwmoeaedmerwence o!sn) aiae.ciTehdeucpopsetracsosnofciidaetnecdawmiihltshifsortatshkoisncelxupdoessuornelsy,Hdaaspkeerleipoegrisnosnsneetninsat.ess of . dDReiissrkkmsaClwhaitrhabceotrasnouzama)mtaifroonirzeeudchacCco8rdaipnpgli1caitihoenm(amjaonrurloauctis1re2e1o,f8/S9xp7osure (a1,6s.o0r0e0, z< 20 : 1oi0ps.cp8ao5n2atiaMa:atirToihnnseotrfoiEshkxsopowdisolusrbeeo-.rcehTsahrpaaocnctsheearrirazecleadttoibnoysnsachtoiompn,pawTrihiinpsgrMsoeovwlaacoieinipsoarpnneCeeaorrssseyetnrtoekloro,eadd @ 2d) Lowe ANT 51s EID087228 $3700 137 A? 009.35 : DRAFT [LS pr Joets bed 1 Ecooga grec e informatk iPonotehalynys .ehea lopidentiy fy tyhe Oepemraetilrosnes BE ang, xp0surg Pathways tng,Presan; A ny C Haszeaero f dalnGoanRiOtrYcirayeiognSnSamecaetnotsTharatanegsaoSa205TWiTl bo rovewaqenc2 oy T] &F sA PPSaersoenemeSaonn,Et AReFVeaNvleTtreoprromcchaum,ntaigCyannoLcnCrtt4ealisaponrxfoeeoalcEsSihanatidnsemaSacpomccuimamas5s0lwaiGintopxvoecoagnenoo:g CTA - ot 21)) THeasztairnR dgA(sFiceahS sEgmLanarnoawp)aanpg sSmhonreYa8nS1us5m8m,arj y sb iobogrbd,o and ) SE scare 8. CCExrepnossaucerelneAnaaXlpSyosissuvre scanario or c.g v-i50 >, oXfx SwiioloBerae demaegvnaaelasorppoeeeds,naMloHsasseeksaglpgaalnrwdigla waCorc.yi0e2rma ulC0ar0ca0ts1u0no0n0eg5 s(Acorrt4,tnGgnriagutheoern TanWith an a orfopi re 5 7 SN "nCaaOcneitCniedI,onHi osrioef GCa3snnoacesipeSaDfLtpciSiRernraCgmnaiadnndoaad maSoanrcsodase1iosPgrC.noacvlPicSiuedoireiasi)tHoon,a(oTskh)raxafarynwoaimgpeotrhare,: oPDaloadtnlt seite0to * pFpr 253))) With this tas E0Enx0pmoo5srusree AAssssaassasmmaenn,; .. Ol Haskelpl apa0rsSoHnrraoaddbiy bWaeshninggton Works gy oof dsaoaul!Tho coy "J tRishk Ceh*a)ramcEixapnoiszuargeonAAsscsaassiammaanns;| oComrdiedt a 11i0ss7i,)5 285p.3N "3loco (paymOf A ECnESvenaimoreroraantma,oanniToahlomCor1oncmkenats worinsgsce croormiinc cg3tioomne{ToSa ycoumtaBcatuiS rne,gvhaenSiatpayonB5.a01a21 e5xons Ch1a0acSptaoraitzioinosnanwdileraxopaavGtneia.Sornoeescl.tap(PCEa)Cl)st0o the'10Pr2e5diHcaotzeadrrNdoQmEufofgecaatCno,ncprecnattcreatsions 9 Q PaorSa6catebryizCa8tioannsg.wmilml aalegso enablefuture hat rosant thg Comparisons pipers, rik. The donity gg Recommendation on pi Manama Statogios and to pg made way of 00 potantiasrisks 2 I rWpehciecahmoalpsetraelatreiccowotnipsil.ivooeCsovm.uaaldtnCnabeeseerctdaootcaruOnarseSno Aes1eT2rl01ri5ae8ao7mg6npr a 24a00s 00 5 Some arson rFgoaeiteeq8 100aennssuhreerPiepg9espaalrnoeoI(.cerootPmraOtxphorericailgseayly(nmroaarnnaaugseagqninSthe, " } 1. 33 TI. 204 r42r 5 EID07230 009.34 85 -- 000.21 a "RRogoer gerJ. Tota"Zotar" <ZPFELOWWPS.AT.EMAILD_UDPUOPNOTN.TC.OCMO>M>oon 03114199 To: Roger J ZplelAEDuPont Siblect: (C8 REVIEWS/10-55-19981C.8 Review Date SDPuarbtoeaj::ectT":hRuO,cB-E8R1T0RLeS.veipReIw1T9C9DH8aEtYe1"1:<28R:I0T0CHEORTL&wps-al.emsil.dupont.com> <TZGoAArNRIZKBOAeSOr,Tn@awrPpd.aEJ-.aR1<e-ZieAlmNlaIyiKlO<.LRdJEuEIpCLoSLnO2tCB.-JcAEoLNn.A>EN,MOATIE"LSR.LoD.gUEePNrOAKLJT.L..CDTOUiNPp>Of,NeTls.TCROINN>I,GA*RIZSAIDOROS J. <<HAITTPSORTREEuvpLs-Oalew.meamipla.ialdu.pd-ounpatonct1o.mc.>on,>,"RO"BDEARNTIERL. A.MATWTESBOENR-<<HEIBEAROCAGKuwSpaO-aDl.DemaEaniawll.p.ddueuppoo-nntt.acco1onn>,,s DAWN D JACKSON <CeHr I"GH.LDIAOVITDERwANpSEeY-, aJlRd..u"pso<onRtAucNLSoEmlY>@.,uwpAsn-dazle.semVaiMla.ldiunpoownstk.icos>, JOHN K NIGLIORE <<SMRAALGIGNZZLA11,C.GEEMEXANAINLLAL..ADNUDRUNOPONOOTNT.TT.CEOCEMOS>NS,S,LMCaruariigceSAksatgogrsga <ASTORGNEISCOCVS>, RIoKbEa-cvtez7aiPoinn:cho1t.0<PINCHIRPENANOTESI.EHALL.DUPONT.CON> CDoenltievnetr-yt-ydpaet:e: tTehxut,/pl10aiSnep 1998 11:56:00 207 PIonsptoirntga-ndcea:ternoTrhmua,l 10 Sep 1998 11:43:00 EDT A-type: MAIL TuphsetaCi-r8srsemvailelw hcaosnfebreeenncesatrocfao.r 12T:e3n0-t4a1t3i0veOcAtgoebnedra 5appineartshebeBl2o1w. Vciescietpotriso:nietI wciallll early enough. bmee. arrWaengciannggyooutro pcaasfseetserainadfyoorulusnhcohuldifplyoaun taorrihvaeve Craig and Andrea: Please feel free to attend. Let me know. AGENDA: 10/5/98 C-8 Review . - Funcctioo:n awnhdatusein te 7 =- VMeonldeocrulaanrdsctoraupcattuirteorandinbfiocrpmeartsiioentence - Toxicology . 60w9n5s [EID082020 . - GlobaFlLEtReaMasnasgtermuecntturesystem -- RGPoeradoludsuc,cttioPnSrotgaarnaadrmdreeShpuilmpamcaervmyieewn;t emafsfsortbaiparnocgeress + -- DPrlyuohcuonpoLlyamnearrsindisposal Sampling daca history . - 1040Government Communications - rPeerrmits = Drinking Water . Risk Assessment Program - Crista Kanagesent Plans (069.35 ED082021 | +r ou. . .: nen oWeaare es PPot mwe r11 September 11, 1998 RETURNCERRTEICFEIIEPDT HRAEIQLUES-TED MIrn.dusJtorhinalG. WaBsrtietveSce,ctiGoenologist GOfofoisceeRuonf WRoaatder Resources, WV-DEP Fairmont, WV 26554 Dear John, LandfiDlulr,inygououraskSeedptmeenbteor s1e0,nd1y9o9u8 to EPA's question about changes we cthoenfesreevnecne ictaelmls had made in the wI itshummEaPArizreedgaarsdinogurDarynswReurn 1993-1994 timeframe. changeAss iinndtihceatendatuwrheenof1 tchoeverweadstethoisr attempting to correlate these changes mthaeterpihayls,icawles aorfe to any effects. sthiempllyandrfeiplolr,tiwnigthout It would be our ceJcouond-fgeemfrefenentcctet.hacatlTlhmiosstthwatooufltdhtehebaesellfecughraattnhigeoersnsswuoopfuploedrftfehedacvtbeydTaoEtPweA'pstroobraaetbveilllaiettaisytonofthdeuanring the atnniiydm-e1fq9ru8ae0ms'etsi.opnredaEabPotAuetdalcstohhaencigroemsuennddtueerrdisntgathnadttihantgthooerfqouttehhasettriohnitsitmaeobfroryuatmoeftshaelils1e9gp9ar3to-ib1oa9nb9,l4yanndot that baeplporwo.priate. However, since you had asked for the sumary, I am including it 1) Si1o9mm9pe2rovtgeorapdaersoddiufocffterpeponeltryafcoserttmaaablnicleriezasetirn.sp.r.owceerpseosliytnargcarnystlieatmmpiieodrneaetdusrtbeaesbg.iilninzOiennrlg.y.a.rotuond ipfionnltiyhsaehcerdyTlesarimenis.diensTphrhieassveenwtotuhleidn stptrhaoebbimalibizlseyr.,n5wotta%n,dprwemhsaiexcnihtmuwamnoucloidsnscuebeentrsiaintncicooernproeorsfaitned is stable. 2) mApatrtoedtruhiceatlss,amiwseeatlcishnoaengiaesndcotrhteopaorsattbaeebdtitleiinrzeatrhnetcih-asontxgaiebdlaeanntdp,olfyoimrregrta.hnooxseT2h4es5a.ammeouTnhtisin the finished product is less than .lwtk. 3) Aifsinncditinhneegrartneiesouwnltoufotorlfetarsegclofovoberarlysalpoefrogohefraatomfvftao-lsupreee,cdusmcaietgenprioiflaiylcmaenartndtrotehldrauonudcgftihilloinbnsy TthaendfqiulalnetditaytoDfrypolRyuanceotcaclu,rrendyloena,chpyoelyaerstferro,m a1n99d3eltahsrotuogmhers199b5e.ing Srv vn 009.35 EID000228 : @ enim N John G. Britvec -2- Septenber 11, 1998 4) AisnstianldliicantgedtheprenveiwoubsiloysoltiodsOWRfialntderEpPrA,essinat199t4h,e pilnanptrepsairtea,tiotnhefor aSmiogunnitficoafntsloyrbeidncsroelaisdesd bienintghesSepnrtintgo Dorfy1R9u94n.landfill was 5) Ablisoosolaisdsindiincaftieldterprecvaikoeusfloyr,m,iwnhiAcuhgusitncr1e99a4s,edvebiobneagatnterdisposing of ncoenwcefnitlrtaetriopnresasndwapsutmmoorreeeftoftiaclienbtiomianssremtoovitnhge lsoalniddfsi.ll because the 6) BseecdaiumseentsofwesroelidrsemaocvecdumuilnatAiuognu,st,the199l3owteor mpaoinndtawians pdornadinecdapaancdity Wre-qOuMiRr,emenSttse.ps Awseryeoutakkennow,fothpirsevweanst dtohneereinleacsoemmuonficsaetdiiomnentwittho the receiving strean. 7) WSeeptbeemgbaenr,lan1d99f4i,llihnagvinagt cthoemplleotweedr stheectifoinrstofpatshse olnandtfhiellupipner section. not ha1vealsionfionmdaitciaotnedonduwrhiantg tchheangSeesptetmhebernei10g,hbo1r9i9n8gcofnafremreerncmeaycahlalvethat we do iinnvtersotdiugcaetdinign tthhiiss saraemae.tine period and that we would hope that EPA is Sincerely, SRro.berEtnviL.ronRmietncthaely Control Consultant Washington Works 2070-2 009.25 EID000229 | N INTEROFFICE NEINORANDUN . PDartoem: D3A0N-ISEeLp-A1.998wEs0E9R:26am OT TDeeplt:Nor WENEGBIENREOEARING PoLvERS 0-863-441s Tor DANIEL A. WEBER wemsRo)n Subject: C-6 INFO SLIDES FOR RLR MESTING: 10/5/98 gg EID091595 009.25 DRYRUN LAVDEILL: FC-143HISTORYStawRy SUPERNATE POND SOIL DISPOSAL: - O7F100NETAORNSTHOEFBSOOTITLOMCOONFTATHIENINLGAND-FI65LLPPIMN F11C/-8184.3 DISROSED - ATNHDISBSUORIILEDWAISN LAATCELRAYM-OLVIENDEDTOSETPHAREATTEOPCOEFLLTHIEN L1A0N/9D1F.ILL FC-143 GROUNDHATER AND SURFACE WATER MONITORING: - BEGAN MONITORING ANNUALLY FOR FC-143 IN 1991. - GROUNDWATER CONCENTRATIONS RANGE <1 - 15 PPB. - LEACHATE CONC. AT O.F. 001 RANGES 30 - 200 PPR. + PRARNOGPEESRTY2 B-OU2N5DAPRPBY.STREAM CONCENTRATION - DTAHTEA1R5E91PORATNENDUAALNNREUPAOLRLTY. TOSTTHIELLWVMDOENPITOBREIGNIGNNIANNGD WITH REPORTING ANVUALLY. + 1398 RESULTS: oLuETALCKEATTE001 == 5167 PePmB sSTtReERmM ##12 =- 14.6 ePeEsR PROP. BD. = 0.88 PB 0-7 POWND/YR FC-143 DISPOSED OF WITH BIOCAKE (530 PPB). 61/0906M; PODOUENSDS/NYORT OCFONTFALIUNOROFCP-O1L4Y3M.ER WASTE DISPOSAL BEGRN gg z EID091596 8 009.29 ; 88 : 000556 INTEROFFICE MEMORANDUM Date: 13-Oct-1998 05:11pm ii From: DANIEL A. WEBER WEBERDA Dept: Tel No: ENGINEERING POLYMERS 8-863-4415 Subject: POTENTIAL FOAMING MATERIALS AT DRY RUN LANDFILL FYI, BASED ON A REVIEW OF GROUP 1 & 2 LISTED MATERIALS, BELOW IS A LIST OF MATERIALS WHICH MAY HAVE GONE TO DRY RUN LANDFILL THAT ARE KNOWN TO CAUSE FOAM. - N-butyl benzene sulfonamide - this compound was identified in a sample of foam taken from a Dry Run Landfill leachate discharge. stearic acid and salts polyethylene glycol ethers ammonium perfluorooctanoate Triton X-100 (tm) - not specifically listed but contained in supernate dirt and possibly empty containers ucon ofl - not on group 1 & 2 list - biological foams - from biocake and bacteria growth in ponds : c09ses Ei016841 o INTEROFFICE MEMORANDUM DFartoem:: DTeeplt N:o: D2A9N-IOEctL-1A.998WEB1E0R:29am WEENBGEIRNDEAERING POLYMERS 8-863-4415 TO: See Below Subject: FOAM AT DRY RUN LANDFILL Jom, I WENT DOWN TO DRY RUN LANDFILL TODAY WITH TOM WALDRON. I NOTICED DISCHARGE FOAM FORMING PIPE. THERE DIOSWNCURIRNETNHTELYLNOWOERPONPDONDDIBSECLHAORWGETHETOLDERAYCHARTUEN CREEK. BLEAARCBHAARTAEDDEIESMCHWAIRLGLE.BE TAKING A SAMPLE TODAY OF THE FOAM AND THE DPELTEEARSMEINTEAKEISACALUOSOIKNGATTHTEHESFEOAMSAM-PLSEASMEANMDATELREITALMSE AKSNOWLAWSTHATTIMYEOU?CANCAN THE LEVELS BE QUANTIFIED ? TPOLEADSOEADRDEIFTRIIOGNEARLATEANTAHLYESEUSNUSLAETDERP.ORTION OF THE SAMPLES IN CASE WE WANT THANKS FOR YOUR HELP, oan Distribution: CTCO:: JROOHBNERTF. L.DORUIGTHTCYHEY CCCC:: LRYINCWHOAORDD AK. KIIRRSECLHANNEDR, JR CCCC:: TGhaormyasW. R.KleWsaelldron {( RDIOTUCGHHETRJLF )) (( KIRIERLSACNHDR)A ) (( WKALLEDSREOLTGRH )) 1 000:- 2 EID030763 R 1 90 009508 | nrEorrics wom DPraotme:: G0E2m-aovu-K1e9w9E8dY02:36pm bet: KAcewenoL Tolmer des-sass 2T0o:i Wosactatrhew GaKrozsanings 2T0o:r WRoEgLeiraw3.3zBaRptOeClK {Ccvaonmzirzaaonen axxx ccoociuwsn)) ({ 2sxroorcemnisAx AL AT Wes) Subece: cee vowkey sTUDY 1S1R7O0G7RESDSOSEREP3O0RMGT/KTGHRNOOUTGHTOFLIRESRTATE30D BDYAYS2 OOFF MOHNOKNEKYEYSST,UDYD:OSIG RIAESSTADRITSECDONATTINU20EDMGA/FKTGE.R A1F1TEDROSETSHISOFLO30WEROIRNG,111DAOFYSTHHEEN A(ANSPPECTED AC7LI3N0I)CAVLASPARSAAMCERTIEFRISCEWDERIE ADLITSETRREESDSIANFTTHEERS7AN0TSWEASL.ALAONNUGWSWEIRTHOFMARKED HINYPEOCPHAOTLIECSTESROOYLYEENST.A, TWHIELMDOHSTYSAEPRPBAIRLEINSTUBEIXNPELIAAN,ATAINODN MFAORRKEThDaTNCRESE TRHEPSAPIORNESDE LINIVTEHRISFUANCNTIINOANL, ISPOSLSIIVBERLDEEGSLEONOEDRALTOISOS.N/ANNECDROISNTFSLWAITTHION uINrsE.ITHER THE LIVER OR GI TRACE. PATHOLOGY WILL ADD DSTATL 10 2))3REAHNADINI10NGMG/MKOGNKOENYKSEYAST T20O WDAGT/EKGLODOOKINGFINFEI.VE; CLINICALS DO NOF HSOETEEN)N7O6 EIFNFDEICCTASTESEAENNY IPNROB4LEWMESEKINPCILLOUTDIANTG 2T0HEWOL/IKVGE.R IT Is OBVIOUS TEGHX/ATKTEGN,ADTS3 LFRREOADMST110S7OH0WOE/KOGFMOCNTTOHHUESL.DPORPPEURVLOEADNTUBCIEEORNBCTEAHFNEECTNCSOOTNAVSTLOALTTIEHVREEATTEPHOET30EO/NF2T0IDAOLSING HNEERXET R15EPWORATTWWIELLARBEF LAOO2KMIONNGTHAST/RUONRL.ESS STRIKING FINDING INTERVENE. a2g EID 088762 g3 009.07 91 000505 ` : TO: See Below INTEROFFICE. MEMORANDUM FDraotne:: DeTeel tsfo: J0O4H-NNoFv.-19D9O8UGH0T8Y:10am DOUGHTJF (P3P0D4) 863-2801 Subject: SAMPLES FROM DRY RUN LANDFILL tPhauel FTR-oIwRa.n tahnde MIashsavSepescpenatnd stehveeraxl-rmaaynondatysheoneletchterotnwomiscarmopslceospeu.sing wTahse afnoaalnyzseadmptloe ciodlelnetcitfyedthferacnautshee oLofwtehrePofonadm.on 10-29-98 at 11:39AM Because the foam was very concentrated and stable, we were able to wiassohl.ateTmhaetemraijaolr mbaytedrriyailnginatthreoomfoatmempiserathteuresodainudma saslitmploef maenthaacnroyllic polymer with 3 become a major high acid content. As You know these resins have product in recent years. We have never identified this mTaatbeorriaatlorybefuosrieng501vtaocictoenf2i6r2m7thaned isdoendtiiutmy,hydIromxaiddee.someTheinsctahnes were a match. enough Later we did our total material to normal extraction procedure and isolated be very roughly 3500 mg/L in concentration. ba1ercesapnmeaecduelsoaltauerbeltehb.eeinWhgeighkcnoonawvciedrttheeadrcertyloisicthseordeissuiomndsiuinwmhitschaheltfalrieyn tihnesolluabnldfeil3ls tanhdey ash and the fly an orIrsesibfanrsoimic.tascerlyf1licacomuplnodoltyomraeiwrgasirneatthoeafteainatychceourtmhuelfrartomenajtiohnrethfseoiulrbtceierossclauokdfegesoidaninudAmC.FtyhleicsThe bottom of the equalization tank oMarstshoSpaencd wpaorrak tdoolnueenoen sthuelfoenxatmriadcetsanadlsDouitdyenbteinfzieendesnsaulllfeornamaimdoeu,nts of mniyxltounreolitghoamterwse, bealifelvueoro1scarbbioonlogtihcaatlweinboerliigeivne. isLoCt8s anodf a compiex microbiological organisms were evident under themicroscope. cpXoo-turalasdysibwuoemr,kfraoaml]usmdoiinrdutemt,oerctSteihldeicsoofndl,iyumas,suhlfcubhrul,toritinhoeed,inimeoadgiannneedsiifunrmo,np.arcatliMccoiusutlma,rOfisthneoste 3ue1xs5pee0dctsaesede.msstatbToihleiiznsedoriuscracteienmauZnsytteilobdeipnrtoehdecucoptnostt.aaisnsOiinnuegm coiofomdpoioudurendMa.ansdscuSppercousscainosdide The other sample was taken fram the discharge of the 4 inch pipe at the Lower Pond at the same time. We did sample. our We nworemiaglhedexttrhaectrieocnoveprreodcemdautreeritaol itsooldaetteertmhieneorgtahneics in the bEceoomlneicaeenvnieternatistwiuobsnisolwnohygilicochnalwoalslignarnooerurigsgh.ilny| Aa3ls5swomegl/plLr.sasenWtoerwtfahosoundasnodntehpemamasatjetororijauentehat we 000.6 BIDU0TT . suTfonanice and buty) benzene sulfonamide distribution: 0: DANIEL A. WEBER TJOO:: GREOOBREGRET WL.OYTROIMTICCHHEY ( HEBERDA ) C( WROIYTTCOHNEIRGL )) 00005 EID030774 SECC:: PCAHUALRLESRJOWARNEFSHAUGE CCCC:: CPYANUTLAHIGA CHRAKWILRESYCHNER CC: RICHARD A KIRSCHNER. JR (( RROEHFASNHPAEC]) ) (( CKRIARNSLCEHPCSH )) C KIRSCHRA ) 009. 01, EID030775 92 0005: INTEROFFICE MEMORANDUM : DFartoem:: VT1hA3oL-mD3aRasOnT-R1&.999wal1d0i.o2n6am eDelpto.: 3P0PaD--aPeosNE3R4/ssERVICE To: Jon F. wooRE ooResr ) cCe1: uRIaCwHoAoRpD A&. KIIRRSEGLRANNEDR, JR ({ mKRmseCLHaRA ) Subject: Dry Run Landfill bSitcepsof tosWohcliioldnestaitinnouartsihengmusctcrhheeaamsf.awceilI ciottuyalldyk.eesdteTtrhodiasMye,lwvouiIlndwiBtobonesestseaenddadduqueiftcreoeoskha BBSohaanlpedes"waosf hruanyn/isntgrauoutinthteheousttfraelalm aanndd tshpepesdrietdchtolinbee iinteveeirfy s`eTnde om 000.3% gz EID030784 KOENIMCRCDELAOS V8DURONTCoM an 01269 033200 At TISro ora PI ancT T HaO vR GCOMUoDOTNCETOcSooNSmmoIsaTY?S|toc, ve, rron,e1 1442 yu riage Sor Tia ppvermSEA nE. th Su YAh FuSY2D S Ly bhn in TE TrS rTh a ee e tosco5un Bre Son ure tes ay Slee shvorsssine Riese saves Wo ects chemo TEI CR a oe Le ee m RE hL vI n eainis s 1 Es E I d Te aa eTeses Eenery oleat, Dokseione ro eI A De i Aer T eeT rpernsr erLLReemheee y reoar tl tre ihe a. ik where ea ereesfoortio:n Taare ey a ene FEI or tToteGs 2 #iomnat|IS:ofoSdEs 23I s A Sor wp eer sAurueurs aR/AguuaAmenEtT,m "wogEue 3.yTu igwtese"i SPE cc: Maurice ITH, Astorga/AE/DuPont@DuPont ein eI e LortoTnn Too rFiretoammeairiehnesShteroSmeeoeeineIpoei s en LvSeieCioeE n.w"aopicmue iiyn: toeeSerteeiis a -------- : that I'm proposing and giving me feedback on how to upgrade the process. 3 Comments are welcome and needed...Here goes. L EID087029 009. 1% AssuOmupttpiuotnso:f the Risk assessment will ba a series of results that will be eixnpotshueref.o"rm of "for toxic endpoint X, the risk is Y cases/1000ys at 1 Weexpowsieldl hpaovpeuleatxipoonsurien dthaetaftohramtofwillY' allcaoswesc/a1l0c0u0latyri.on the risk of the AennydpoCi-n8tsrepaslaCc-e8m.ents will have at least 10X less risk for toxic Proposed Approach: Select a base case and 4 alternative cases as options for our C-8 strategy. wCiotmhpartehethreiskficnaanlcciuallastioofn tfhoer ftihveesecacasseess.( using NPV as the best indicator) UtilizAebstohleutfeolclhoawnigneg idnattahemearissukresforashutmhaenchoemaplatrhiseofnfepcotisnts: Relativi.ee.chasntgreateignytAhererdiusckesforrishkumabny Xheaclatshes/e1f0f0e0cytrs ve. strategy B Relativi.ee.chsatnrgaeteigny tAhe rerdiusckesforrishkunbayn Xt va. health strategy B effects on a financially weighted basii.se. utilize the metric of X cases reduced/1000yr/SHM NPV change ve. the base case Cstornastiedgeirest.he WDouuPolndtthiemagsetrvast.egitehse choolmdpetuiptotro'spubilmiacgesbcarsuetidnyo?n the various iCnodnussitdreiralthoeccrueplaattiiovne arnidskevoferythedayvarliifoeu.s C(-J8uststrfaotregyioeusr wiintfhoromatthieorn,risskosmeof ernilsikghntuemnbienrgs)are listed at the end of this note. I thought that these are Consider the premise that the goal for exposures and emissions is ZERO. Croendsuicdteironthaectirveiltaiteisveinriosukrrbeuduscitnieosns.of the C-8 strategies ve. other risk Options to Consider Base CaRseep:lace c-8 where technically feasible and market conditions allow. and cuAsgtgormeesrsilvoeclaytimoinnsinize exposure/enissions at our manufacturing plants AlternDaotenoctasreep1l:ace C-8 in any application. and cuAsgtgormeesrsilvoeclaytimoinnsimize exposuce/emissions at our manufacturing plants = AlternRaetpelaCcaeseal2l: C-8 use 8 2g Aggressively mininize replacement emissions/exposure & 00031 EID087030 Commune gcaden Reguented Number fs of endpoints/1000| Endpoint considered | [em | 0.001 | cancer | | 0.02 | Death | ! wanvoras vaiee sor norm] EID087031 : 009 15 [rabicte accident gush | | 1 I Cancer i CritesreitaocucseudpatbiyonoaslA to exposcuarrecinLoigneintss for | i i sean i ee ag AvMeeraasgueredoccvuaplauteiofnoarl sia | 20 i Death i Mewaosrukreerd vdaealtuhe dfuosr mtoine occupational accident | 2 1 Death i Meafsiugrhetdervdaelautehfoinr tfhiere Line of duty [IE EID087032 Bye Efe Vr fon FN d ppp Fan and (Fh oo wari faiF CSE lio ba orlity lon esasfloniss copoly bene LA Ob arationtrials EPA Lo peTn uy bonsens fussed she b rts Plunsls on cattle aeth = df commactoTirnl,t Pek BuniaGolnps cod ns - elton, arp J A ek ) let wn, gop Tole te Conti Orang Placer ) lees weet HELB oe. our I Terbewiad ponidiin on loafl. dopomey co 3) JEL TET en &y Sh Coon enSud Ce i - his do al cats E-BTLLeLeaECs.\L es ec. ldson oa EID090029 Ioo A pe. T elt rie. Prare- Po. =pollen, 22 re Moran ~ Wows J Fey Wegha - 3 actos 253% - elefacto -y%32 Eu A ob AM v1 v J EID090030 g 94 000335 5oEr5R2I. i x02a12w41e93s12:43 PM TaSeibrject: BROCKZWJ, KOENIZMC, C8 MONKEY STUDY ZIPFEL, GARZAOT C$S)AUCRRRIINEFNITTCLHEYED.LINOWNO21DSOOTSUETWSEI(DE3EKHGO/CKFAGU)S2E6SWHFEOOEWRKEDTSHTERUADPDYIE.DATLDHAESWTTAESRWIEODEREKTAETCIATOENMDO;NAENYD W(A1SOF TFCROAELNALITOMHWAEELNDSTCLRIOENSLEATLTHYIIOSNWSIGHTRIHOPUPTHIAESREACONSPTTIRRNOAENCGTASORPOASR(SECIOBAVILRLLNICTE6Y-.MMOANTDIKHSEIOYSNS)I.SRETBCEHEIEINVGOITNHGER PJ5Ho%ENNIoONNSKETGNR.OUNCTTHGIEOVRIEE-NPGRSEEONLE.MISNIANNTAAORLYYBSEIFASINNODFIANFGFESEFCFTESSCHTOSW1 AVLNSIITHTBALLLEO,ODDKIOFCFT-E8RAENLNOECTVEHESELRSIWNILL TBFHLOAoLToKbSHOLWREITVLAELLLISBTEIBEEGSTAWTEHHEAENVREIMNOGONCKCIEUNYRSRMEARDDEICASETOINVTIHANETGD30O3,/S2I0N10G,MGE/OBKRDG2TG0ORGORUE/PVK-IG-E.TWHERDEACTTAAOL-KL TS(EO3RO6IK6O-UA5S2T59RF)EI,CNODVI1ENMRGYSCOPINANCREA1MRENOTEFEDR4SA.BLOOUPWLTEDATOSHSEEE LCAALCLK WOIFTHDOSANEYRQESUPEOSNTSIEONSAND ANIMALS. 060-129% Z 8 EID087006 95 000220 | Cattle TMeaarmchKi3c,k1o9f9f9Mesting Summary aTNnnyde paBrotolvttidoeinnTCgaenttahaemrc.omneMftaerfnoeyrntctnehearnfoikrossmt.ttoimNeeownBMoaltrocnhC9enattetrhefoUrnniavstoifnPganrnesymiveanaias's Attendees Q{SREaorRlaRih)n.sCLaasbPpoerararrtyo(rHEya)P,bAeLciRksoeagriHeo(lnUleIrolf)(.pPrMai)vi.akteeBpoHrboacmtPieocep)p(,eUGSnrFgeWagS)(S.UykoMefasrP(kaD),uSPpoPrenettnegsPehrMasa(eEc)Pe,A RFaadllphRSotsahsl ((DDuuPPoonntt CHoarspk.elRlemLeadb)i.atRioundyGrVoaulps)n.tina (DuPont Haskell Lab). sad Expectations aaIndhvyeisaCesasEtoclPieAatTaeendademxDpuioPssouenrxtepsaacsotretdopatrthoaembeeextiesratsnintgohbacjtoencmdtiiigvtehi,otniiomnfpdaeMcrpt.entTdheeennotavnebtroa'ldslyhheterhaadltthawnidl Lpioehseascihhbelraed.fcuotnuTsrheaenismTupeascatomsn tisoteethxepheehcretdr'des'ds cthooenadblietthi.toenchnaincdallryecsoomumnedndian tiitsonaspptrooamcihllgaantoyef Tom Structure and Logistics > cToafhlelveeC.tateTtmlhaeerTiTaeenasammainswidallscsucobinesdneutticstotfsdtehwteiaitDlhreydexRepvueanrltuTiasatecihoninniscaolflarMTgree. aTamneinamnnaadlnsti,'sscehosepmerpcdoiasalnelydy w1ri8elPpOorrbttetbhaapctrkedpe1at0raeitldhs.e tTheaTchhfnienidciTanlegsaTmoefatmmheeimnbTeaaprapsmroaxarinemd:atreaHlacyboem2cm-ke3enrmd,oanttHiheolsnl.esr,fAorMwoarscisttaiennn fVaolpepnetningea,wilalnsdupSpyokretst.heWTheearme. needed, Caspar, Hom, Sprenger, Stans and > PhDraa.ndrGirneHggablSeoygckikseetsircswaacatsnidnegloetachsteertdhcetoooSrbcdeiientnahtteioicrcodoLuretdaiidensea,rt.wohriGolrfeetPgheerwrCiyaltwtbiiele rbTeaesarpmeo,snpwioiinteshiDfvroe.r othrelfeianddiinnggsiahendherredcoevmamleunadtaiotni,onisnt.erpretation of the resus, and the drafing of > TsOrhe.eamLwi'islsal aHbcoteilvlireterisewpsio.llnsIaincbtaldead,sititwohhnee,rloebceancleaveuedsteeadm,oifafrhoierarnepxaraonmxdiimnwiiiltnlygbteoaniMyrn.vooTlfevntehndeawnihtte'hrsdaiflatrthmha,et 2 might exhibit untoward signs or that is found dead or moribund. Mr. Tennant 2 eas EID042172 . EE IPINT EWIRNETVEL saxsce-ssz-ee sz 3 fwiolunbde responsible for notifying Or. Heller when such animals are noted or rSaenasdrpaohalnldCacstoopmamarunnywiicllqautaeicstotnaisso.ntsheNforiontmmeerMfmra.bceeTrweintohnfaMntr.the ToCerantnoltalhenetrTsoenaretmghaeirsidniientxgapl afsciinttdeeidvnigssti,ot fcioenlcdlinugsiaonnsy oqruersetcioomnsmenfrdoamtitohnes moendithae ahnerdd.resSpaornadhinwgillobne breehsaplofnsoifblEePfAo.r JRaaclkphsoSntaahtlDwuiPllonbet Wraessphoinnsgitbolen fWoorrrkesferwrhinogwtilhlerseasmpeondquoanstbieohnaslftoofMsD.uPDonatw,n > EPA will be responsivle Poppenga; DuPont will be for supporting responsible for the work supporting Oorfs.DrHse.lleHraabencdkMeorisaann.d aAndamliyntiisctarlatiwvoerskupcpoorntdu(cctoepydingo,n matihleingh,eertdc.)inwcilludbiengbilbleldoo5d0%antaloysEiPsA,, 5at0c.% f1o0rDcuaPttolnet.subTjehceteTdetaomsaacgrirfeiecde stihnacteMrh.e Tweansnagnatinwinogulsdubnsottanbtiealcobmenpeefnistaftreodm this effort at tie or no cost. > While noted ctohanttahcetecdurornenMtlayrchhas9 by 40 hSeaardahofCacsatptaler, and 36 Mike Home, of which are Mr. Tennant expected to rceaqluvierethiesxsapmriinnga.tioTnwobycoOrw.s Haerlelecrurirnentthley enxehairbittiernmg.sigHnes ohfadsisatrecsisndaenrd-bmloacyk bbearusfeoduntdoahtoilodnctahtattlecdaunribneg uexsaemdinaastiaonc,orral, and a steel head-gate that can > wEhPitAe-tdaaitleerdmdieneerd itnhWatoothdeyCowuonutlydafnudndothaenrdaruenadsertthaiksesparinsgt.udyEPtAo emxaaymiunsee itnhteerCpartettiaetiToneoafmthfeorrecsounlstusl.tation on this study, including its design and the Action items 1. Tofhethivsisidtattoe Mbry. STaernanhanta'nsd fMairkme.is TAphreilT8e,a1m999wi.ll Mcro.ndTuecntnaanntewvialllubaetiionnfoornmealdl V4i0sithethaedgorfazcianttglea,reoabstaiinnclauddientgaitlheodseheorndohrisnteoarry DfrryomRuMnr.LaTnednfinlaln.t, and may 2. Dr. Hellerwill are safe and avpispirtoMprr.iaTteenfaonr tu'sse finaemxatomiennisnugrethtehahtetrhde. corral and head She will report gate back 10 Greg Sykes and Perry Habecker on this point in the next few weeks. 3. dTihffeerTenetaiaml wdiilalghnoolsdtiac ciondnifcearteonrsceprcaoldlutcoerdedvuireiwntgheth1e3Mpaortcehnti9almeptrionbgle.msGarnedg 2Q and Perry are responsible for setting this up. g 009.5, EIDO0S2173 4. `MmiakemmHaolrnseamwpillilnpgroevfifodret the Team with a copy of the Woodward Clyde small S. dReaplopshitSetdahiln wDirlly pRruonviLdaendtihiel.Team with the lists of substances and materials 6. T9T6ehtaemam.najoermiatiylofactchoeuTnetasmo'sthcaotrrsehsepocnadnenccoemmwiullnioccacutre beyleecmtarioln.icOarl.lyHawliltehr twhiel 7. dHiostmreibutpehdosnoe evneurmyboenrescouofld tbhee naTiefiaemd ianntdhe morpidity or mortality prior to or after the April seuvpapnotrtoifngan site visit ianndiimvailduaelxshibiwteirneg 8. `aTwfhtheeernnteahxneatlAymptreiiecltali8nsgvuisloitftsttohaerMerT.oebTatemanianaennddtfssruofpmaprobmlr.oionTdghseianmdepixlvaiecdstu,aldesatct.weilalwinlbdledweshopetmehenetdriomoner SnoatratnhewilTlecahmichkaswitchraGfrteedg when this maaing may fake iatsndfinPdeirnrgys place. aaftnedr trheecoAmprmielnd8atviisoitnsa.nd Rdaeltpehrmainngd Phone, fax, email information Sarah Caspar WFaox:: Home: Email: PerryWHoab:ecker HFaoxm:e: Email Mike HWoon:e FaHoxm:e: Email: 122110558.878113441..32322858703 Cllplne PEGE 2221055--337i05--94,5720f caspar.sarah@epeapmaagiolv 610 610 444444-.50680902, ext. 2385 h6a1b0e3c8k4e-r0@4v5e2tupenn.edu 773322 332211..66772147 h61o0m9e2m3i-c6h7a0e1l @epamailepa.qov Peter MWooi:san 919 733-3986 Fax: a EHmoamile:: 919 363-3523 2 g3g 009.2% EID042174 Greg WSyok:es FaHoxm:e: Email: 330022 336666.-66006750 610869.8469 areq.p.sykes @dupontpharma.com Bob Poppenga FaWox:: HEommea: Mark Sprengar Wo: FaHoxm:e: Email Lisa Heller FWaox:: HEommaei:l 666111000244644448-.454186101027, ext. 2217 poppenga@vet.upann edu 732 906-6826 732 321-6724 sprengermark@epamail.epa.qov 304 684-9495 l2a0d-k615@Yj-u7o%,0 com RalphWSota:h! 302 892-1369 : Fax: 302 892-7641 HoEmmaiel:: 3ra0l2ph478s-t9a2h5l3ir@usa.dupont com Rudy Valentine Wo: Fax: HEmoamiel:: 302 366-5315 302 rudolph valentine@usa.dupont.com 009.0524 39 EID042175 L INTEROFFICE MEMORANDUK Draotme:r D1A0N-IMEaLy-A1.999WEB0E8R:08am EDT Dept: WENEGBIzNREoEARING FOLVMERS Tel Nor 8-863-4415 TToo.. JRoosmERTM LW.iGLRIIoTRCsHEY (( rwzaccuumzRosm )) cer auzsow A crave (camera) Subject: Ca IN EAST FIELD WELLS sono, eur, GPCECRASPEISO,NALOLUYR DUSREIDNKIFNOGR WDARTIENRKISNUGPPWALTYERW.ELLS ARE 331 AND 33. 332 IS ALSO Co CONCENTRATIONS MEASURED IN THESE WELLS BY CHMHILL ARE AS FOLLOWS: ELL ue 1593 ABRIL 1996 ray2997 a 2.5 ug/L 0.52 ug/t 0.55 ug/L 26 0.5 ug/n 0.48 ug/L 0.75 ug/L 2 3.3 warn oa 000.0 g 2 EID0S1591 ? INTEROFFICE MEMORANDUM DFartoem:: DTeeplt:No: A2N1T-HMOayN-Y19J.99 [1TO0N:Y1]1amPLAYTIS PLAYTIS 3P0O4L-Y8M6E3R-S22S2H8EGEA : TO: ROBERT L. RITCHEY : ( RITCHERL ) : CcCc:: DRoAgWeNrDJ.JACZKiSpOfNel (( JZIAPCFKESLODD) ) Subject: C-8 In Drinking Water Communications Bob, on C-8I cihnedcrkiendkimnygfwialteesr.forTahenyocnolmympuenritcianteinotnsdotchautmenwtesmiIghctoulhdavefinidssaureed atthteacshuebdj.ect.I don't believe we ever actually released any communication on ThursdIa'1y1mesettoipngbyiynouWirlmoifnfgitcoen.on TRougeesrdamyamyoronrimngayatnot8:0b0e atboledistcousmsaketheit. Tony 000,24 EID089418 Flom: Dawn D Jackson an 06/23/99 07:55 AM To: RZoibpelretULAAEiDtucPhoeny@/CDLuIPDounPtont@0uPont, Anthony J Playtis/CLIDUPont@OuPont,Roger J Subject: Outine of communications with GE Plastics regarding C-8 Gentlemen, t1 hhearveeaarettoamcihsesdioandsraofrteorfroarns,ouptlleianseeolfetpmoientksntoow.be |mwaidlleaitntecmopmtmutnoisceantdioynosuwaitrhevGisEioPnlabsetfiocrs.e |If leave today at 4:30. | will be out of town until Monday. Dawn `GE Communication 006.54 EID082078 6/22/99 Bob Ritchey, Tony Playtis, Roger Zipfel, Dawn Planning for Communications with GE Plastics Jackson regarding C-8 Scenari1o: Resultsofearly June testingofGE drinking well show <3 ppb Ranedcospmemaeknfdreodmctoamlkmiunngicpoaitnitosns:ucJhohasntLhitotsleecbaellloswD;alJloahsn SaillsvoeorftfheorrsnteotosernedpoMrtStDesSt roensults C8 and Community Exposure Guideline (CEG) information. Outlineoftalking points (in brief form; to be developed further). cWrhosyse?s-siWtehbyouwnedadriyd;tmheodsealmpslaiynsgn(oR;FWT;WC-w8ainntgerdotuondswaamtpelre;tnoebeed stuorek.n)owifit What? Whatis C-87 (Explain what itis: detergent-like material; surfactant; used in manufacture of Teflon fluoropolymer resins) `Wphoenrdse?con-stWrhuecrteediisnitmcido-m1i9n5g0'fsro(mo?ne)(oalnddsumpiedr-n1a9t7e0p's (otwo--)na;ndadeercoobsmimcisdsiigoesnteidonin 1988) Re: concentration -- represents TLV; below the CEG. dose lower than TLV would allow; it's __%of the Tacouxtiecihteyalptiheceef:feRctesfeervetrooMbSseDrSv;edo;ffheorwetoveprr,oviitddeoecsoppyeorsfisMtSinDtSh;e batlotohdessterleeavme;lsi,nno `animal testing at high doses, iver is the target organ. Path forward: concentration Emphasize that in WW drinking concentration in water, WWwill GE well continue is comparable to to monitor;ifthere is an increase at WW, we will contact GE; Site Qs/As, in the eventofmedia inquiries. EA will prepare standby statement and Scenari2o: Test results -3-25 ppb R(1e2c-odmamy?e)ndwietdhcSoimlmvuenrithcoartnieona:nd JhioshnPlLaiytttilse,cRailtlschDeayllcaosunStielrvpearrttsh;omtoe attotreenqdufesrtoma WmeWeti--ng Little, Ritchey, Playtis, Zipfel Outlineoftalking points (to be more detailed than for first scenario): WRFhIy?ab~oSvaemEePAinsfcoraesenaibnogvel,ev+elss;oamsesudretaanicleatbhoauttWitWs bewiilnlgwtoherkonwliythchEemPiAcatlo idneftihnee levels acceptabtloe EPA and methods/controls to reach those levels. What? -- Same info applications outside as above DuPont + a reviewof the C-8 molecule itself; possible other Where?-- Same groundwater info as above + hydrogeology, including river recharge, plume in 03900 EID082079  Rmea:jorcoenxcpenotsruarteiorno:utePsro(viinhdaelaMtSioDnS, ;skdiinsacbussosrtpotxiiocno)lvosg.icinignefsotrimoan;tidoinsciunsdsetCaiEl,Gsauncdh as intent to reduce or eliminate human health exposure route. * Toxicity piece: Talk through elements of MSDS, vs. just providing a copy; provide ioncfcourpmaattiioonna,l Uh.eaolfthMibnanceksgortoaunpdap--eran(ifmlaalwesdtusdtiuedsy)d;etraielvsi,ehwuwmhaanthweea'ltvhe-rdeolnaetewdith our own employees since 1981, including employee communications; share Pace Team strategies? Path forward: DuPont will take necessary action to protect human health and meet regulatory requirements; Site EA will prepare standby statement and Qs/As, in the eventof media inquiries. Anticipated Qs from GE: 1. What kindofengineering controls are effective to handle elevated levels of C-87 2. What exposure routesarethere besides drinking water? 4 3. Do the levels in GE drinking water indicate a probabilityof measurable levels in employees' blood? eas EID082080 PSremma awe RETURNCREERCTEIIFIPETDRMEAQIULE-STED Mr. Martin Kotsch Project Manager U.S. EPA, Region Ill 1650 Arch Street Philadelphia, PA 19103-2029 June 24, 1999 RE: Permit WVD045875291 Dear Mr. Kotsch: for yourPlreeavsieewfiannddenccolmomseendtt.he RCRA Facility Investigation (RFI) Reportof Findings [Fou have any questions or comments, please contact me at (304) 863-4271. Very truly yours, Anachment R.L. Ritchey Sr. Environmental Control Consultant Washington Works . CC: OMfrf.icMeaorfkPWraisdtdeyManagement `WV-DEP 1356 Hansford Street Charleston, WV 25301 MOfsf.icBeaorfbaWraatTearylRoers,oCuhriceefs* `WV-DEP 1201GreenbrierStreet Charleston, WV 25311 Ms. B. F. Smith, Chief Officeof Waste Management C1h3a5r6leHsatnosnf,oWrdVStr2e5e3t01 * cover letter only - z : < et peanotenng Devas -- EID0735,, Gwe Come HEALTH.TBAABSLEED S68CREENING . FOR PRODUCTION WELL WATER Fone | oii | tats [semmampions sie|sr2sr| cle oor = ose ] =fx] go || nmocn osn | aoromm cen mn | woos reas wt is Totscnooanyine | wn | Noes Trenrsanyere wi | wows cms meu No PPraotcotniseYeNso3) s wer | we s MeL|Procpeosussvieens-o4 -2 | ==] so. o -nec fPCSLLr=Praomsiinma CScorennegtLoLvaoerv:mesfooierdTnkaieang6nw6aatntedrScio84.n2 "R=CNet=atmakbaassse concantation fo 3pwater USEPA gion 1, 1985) H0)ase:n 336 wor. s@ePwroecresswatervies KCiirsomwaort LViorsowwoorr VLoosaepwworr Lowman )6) FT14o3e enx eooxeceperrdt eadniaoryHCtSLLihrpocyrucioolndwweeeutsVcKOn1Si6--PFosWHOOnT1, VOSPWO1. 304 Lob-PWO1. = 8 0F0E0T2E5 EIDI09784 000535 -- Wiliam-- R Bert-------- oar1/93 02:11 PM cTeoir GRougaetrliJonZiCpfKerleAaEmDeUrP/aAME@DOuuPPaomn@t0uPont Subict: Estimated C-8 in ver Hi Roger, concentrAatttiaocnhsetdhaits twhee tEaxlckeeldfialbeotuhtaet|arlpiuetr.together on Ohio River flows and estimated C-8 Estimated C-8 concentrations in Ohi Best regards, Bill DVouiPcoen:t(3C0e2n)tr3a6l6R-e6s7e6a2rch & Development PFaagxe:r(.30(23)883)6564-86-6902264 Intemet e-mail: Wiliam R Berti@usa.dupont.com 080: EID082037 `Ohio River monthly average flows at Pittsburgh, PA ARsisveurmef:low1 dfatta/fsro=em:c<A0p.:0/2A8w3wmw3/.sIercd;-w1e.mu3sac=e.1a1r0my%. mciml3M;o1ncthml3y_=hi1m/m>L. Long- Estimated Measured flow. termof nomnal, nomal flow, Mor Mlsec % fidsec Jun98 28480 120 23733 JUSS 17192 124 13865 AugS8 9111 76 11988 Sep98 7312 72 10156 Oct98 7066 66 12070 Nov98 6144 28 21843 Dec 0440 25 37760 Jan99 53865 124 43440 Feboo 46314 94 49270 Mar99 52898 77 68639 Apr99 60741 105 57840 May-99 23053 61 37702 Estimated nomalflow, mlsec 672E402 3.92E402 3.39402 287E+02 3.42E402 621E402 1.07E+03 1235403 1.39E+03 194E+03 164E403 1.07E+03 Estimated nommal flow, mmo 1.74E+09 1.05E409 9.09E+08 TASEH0B 9.15E+08 161E+09 286E+09 3296409 3.37E+09 521E+09 424E400 2.86E409 Estimated nomnal flow,Umo 1.74E+12 1.05E+12 9.09E+11 TASE11 9.15E811 1.61E+12 2.86E+12 3.20E+12 3ITEHI2 5.21E+12 4.24E+12 286E+12 Total flow Jun-98 to May-99, L 2888413 C8discharge to Ohio River in 1996, bs 40800 080535 EID082038 11-Aug-99 Ca discharge cEosntciemnattreadtiCo8n cEosntcmeanttreaaticoan SoOuTImCaENtteradtiCo8n 10inO1hi9o96R,ikvger in OhikooRiver, in Ohio River, mol in Ohio River, ugiL 18416 69E10 6.30E04 0.639 f coo: ag EID082039 Ohio River monthly average flows at Bellevile Dam, WV. River flow data from <hitp:/alerdata.usgs govinwis-wIWN/data.componentsist cgi?statnum=03159530> Based on USGS mean dally flows from 10/1/1974 to 9/30/1985 Esticmsated Estimated Estimated Estimated cs Ca concentrat discharge discharge onin Meaflsouwr,ed nfolmowa,l fnloomwa,l nfolmonwa,l Estniommaatled RtiovOehriion RlitvoOehriion ROihveiro, Mo fdsec Musec mdsec mymo flow. Umo 1996,Ibs 1996.kg ko Jan 6400079 64001 181E+03 4.69E+09 469EH12 Fen 8800868 88909 2.52403 6.74E409 6.T4EH12 Mar 1112358 111236 3.156403 BAIEH00 BAIEH12 Apr 401667 94017 266E+03 6.906409 6.90E412 May 6710733 67107 1.90403 509E409 S.09E12 Jun 4737891 47379 134E403 34GE409 34BEH12 dul 3098947 30389 8.77E+02 235E409 235E412 Aug 3050191 30502 863402 231E409 231E412 sep 253393 25339 7.47E802 1.73E409 1.73E412 oct 3302062 33030 9.35E+02 2.506409 250E+12 Nov 423207 42330 1.205403 3.1E409 3A1EH12 Dec 7898592 78986 224E+03 5.99E+09 599E+12 Tolal 744E405 7.14E+05 2026404 53IE10 SIE 40500 18416 3456-10 [IEEE EID082040 Esticmsated cancentral Estimated C8 ohio concentration River, in Ohio River, mon. uglL 34sE.04 0.345 00aB4l EDos2061 `Ohio River monthly average flows at Huntington, WV' River flow data from <p:/iwww.Ird-we.usacearmy. millMonthly_htm/> Assume: 1 fd=/0.0s283me3/scec; 1 m3 = 1106 cm3; 1 cm3 = 1 mL. MoYr Jungs Jul98 Aug-98 Sep98 Oct98 Nov-98 Dec98 Jan99 Feb99 Mar99 Apr99 May99 Measured flow, fdsec 97300 68742 28484 17.733 19710 18233 26710 141810 108500 142350 112200 57484 Long. termof noma, % 172 190 94 78 80 41 36 126 84 86 82 62 Estimated normal flow, Msec 56570 36180 30302 22735 24638 44471 79750 112548 129167 16552 136820 92716 Estimated nomalflow, mdsec 1.60E+03 1.02E+03 B.SBES02 643Ee02 6.97E402 1.26E+03 2265403 3.19E+03 366E+03 4.68E+03 I87E403 262E+03 Estimated normal Estimated flow, _nomal mimo flow, Umo 4.1SE+09 4.15E+12 274E+09 274E+12 230E+09 230E412 167E+09 167E+12 1.87E+09 1.87E+12 326E+09 326E+12 G.O4E+09 6.04E+12 B.SIEH00 B.SIEH2 B.84E+09 BB4ENIZ 1256410 1.25E413 1.00E+10 1.00E+13 T.03E+09 7.038412 Total flow Jun-98 to May-99, L 6.908413 C8 discharge to Ohio River in 1996, bs 40800 009511 EID082042 Estimated C8 Cdischarge Estimated C8 Estimated cs Concentration 10inO1h9i9o6,Rikvger OchoincoeRnitvreart,iokngiiLn OchoinocReintvreart,imongiinL in Ohio River, uglL 18416 267610 2676.04 0.267 089013 EID082043 `Ohio River monthly average flows at Cincinnati, OH River flow data from <ftp:/iwww.Ird-we.usace.army. mi/Monthly_htm/> Assume: 1 fid/sec = 0.0283m3/sec; 1 m3 = 110 cm3; 1 cm3 = 1 mL. Estimated Estimated Estimated Measured Longemn nomnal nomnal nommal Estimated flow, ofnomal, flow, flow, flow, nomal Mor fsec % Msec mysec mymo flow Umo Jungs 131,400 175 75086 2.126403 S.51E409 SS1EH12 JukS8 94452 211 44764 127E403 3.39E+09 3I0E12 Aug98 28,387 80 35484 1.00E+03 2.69E409 269E+12 Sep 21,200 74 20649 8.11E402 2.10E+09 2.10E412 oct9s 21.085 77 27357 7.74E402 207E+09 207E412 Nov-s8 21.400 40 53500 1.51403 3.92E400 3.926412 Dec9s 34,548 35 98700 279E403 TAGE09 7.48E412 Jan-99 178,190 131 136023 3.85E403 1.03E+10 1.038413 Feb99 134,860 81 166404 471E403 1.14E+10 1.14E413 Mar99 180.260 85 212071 6.00E+03 161E+10 161E3 Apr99 118000 65 178788 5.06E+03 1.31E+10 131E13 May-9s 60226 49 122010 348E+03 9.326409 9.32612 Total 1.028408 1185406 3.34E+04 BT4EH10 BT4EHI3 CBdischarge 10 Ohio River in 1996, Ibs 40600 00001 EID02044 Estimated Co Estimated Cop C8 discharge concentration ~ concentration to Ohio River in Ohio River, in Ohio River, in 1996, kg. ko mg Estimated C8 concentration in Ohio River, ug/L 18416 2.11E-10 2.11E-04 0.211 00a: EID0s2045 ROihvieorRliovewrdmatoanirhoyma<vpe:rage flowIsrda-tweP.tussabcuer.ghar,myP.Am,iHluMnotnitnhgltyon,hmWsY>, and Cincinnal, OH No. 14am Mo 23 FMeabr 45 AMpary 673Judn 895Aeupg 10110Ncovt 12 Dec PitsPbAurgn, 332M0EEH122 S422EEev1Z2 2T8T6EEcN1Z2 QTOOBSEEVM12 TOA1SSEEMMl1 2T6S6I8E4M1Z2 DBaelmlvWilVe HuntWinVgton, CinciOnHnati, AGSTIAEEMM2Z BBSSIAEEMS22 111L4OEEHN1D3 GBR4IEEMe1Z2 1120504E1H33 1{SMIEEVDI 3SMOEDEEWWiZ2 T4O43SEEeeMi22 SSS2IEEIMZ2 2283(4Ee2f2 22T340EEWe22 233609E4M1122 215T0Ee1r22 11S8T7E4M122 221007E6W411Z2 SSSAEEHWZ2 3B2M6EEeW1Z2 3T9A2IEEwN1Z2 1.8E+13 3ogre 16E+13 1.4E413 eee SEOEOIR sT 1e.0El+13 A 5 dl gl dl 8s6.0eE+12e :| LIA RAS i 4.0E+12 A |BE| iNH i ME HR HN 0.0e+00 HEHE] H ! a Jan Feb Mar Apr May Jun HEPitts Sell iii a : Jul Aug 0a EID082046 burgh, PA olobemw | tington, WV CL innati, OH I ] Hi | |] oI Sep Oct Nov Dec sev EID082047 101 RTTACH MENT s01 /sTScA CaTx. Den 6 3010000014 No San: tized Version was pro vided. 039515 | 102 0005.19 : . OuWffroormee tos wan August 31, 1999 M`GrE. PDlaalsltaicssSilverthorne, PlanMt anager P.0. Box 68 Washington, WV 26181 Dear Dallas: . As we discussed by telephone on August 30, T have enclosed the lab report on the `water sample taken perfluorooctancate. at your Ihave facility on June 3, 1999, for analysis oflevels ofammonium also enclosed the. DuPont Material Safety Data She documents refer to the material as FC-143, but itiscommonlyknownasC-8. et. Both ThreuLpmrVaesnaennhTdte'sadilsaltiihdnkoeetsfhtfeeoerlcestoiaswtmeehrreaarttveahenatgnbhteeaaethnsetohTwbeLhs0aeV.rt5wv5weo2deuluasgdte/lecaoiclnnolcnoeocwnue.rntsIrintaetf'aiscotdn,rdiiten'tkseiacnptgpewdraoixtnieymroawuterelllssyi,t1e'N%soosfatmhplee trations many times this level, you can}hreoapcehtmhaettahti8s63i-n4f3o0r5m.ation s useful to you. IFyou have any (Further) questions, Sincerely, Enclosures ft H Lite Plant Manager irre e495. COPY EID089407 _-- - i Analysis Repa <P Where quality is a science. pip ia LL sample No. WW E3i167122 rusts 616s EcicdRo:viaoxcmato7d0s3r2oss-recoyarl 5.0. tat0.c221 Sm aR SE ater Sue Ao cashot 1999 aBT wusswe fesJarss ezmiovnrennonpar TS Zoe TSfeEcSMsIoEateTr ye advisRory nSly etaldoS]isfeictns acohupsies wn 220 BwrFeeg) to uisateere an oom aun aBok6oe `QUALITYCONTROL REPORT Bows sBsREeE o } Pa A 0m Ji \ rr BA SgHnOUymT Sara ROzSE &s5nore LMTTo8t 224 Fea nace en JEiye :5 83 a& aBBrFeawHrAsRis we foseiniJ "UGRATORY CHRONICLmEo n i aBuset3A8/0w8S/o59r,0e730 GaB pvarrasnn H. Zimmarnan 22 ENN Mime ater tee FEL HAT EID089408 TB SE en nm sme ee se co 1C0PY TO Woodward Clyde Diasonds ATTN: Ms. Sara Seastron JUN 18 1999 ceptoad ate. ToT Check| Date_ 2 EHE5TERshy4 ron i a QrueesytiBoonrsr?nolCoantact your ClientatSer(v7i17c)es6R56e-p2r3e0s0entatib ve i`Hon ldingsTimeChe>ck DOste. A a tics RSeesapevcetrtul,ly hesSsu.mi0t.e5es Group Leader Pesticides/pss MM en rn Tn ee. 009i Material SDaufpeotnyt.Data Sheet Page 1 . voo03045 FC-143 FLUORAD BRRAeNDvisFeLdUOR1O5C-HJAENM-I1C9A5L7SURFACTPArNiTnt(e3dM) S-AUG-1995 CHEMICAL PRODUCT/COMPANY IDENTIFICATION : TT Tradenames and Synonyms - FLUORAD FC-143 Company Identification HANUPACTURER,/DISTRIBUTOR R33eHvCGieesnneetdrear2l3-AOUfGf-i1c9e9s:6 ~ FsYt. Paul 5u5s1a44-1000 PHONE NUMBERS TPrraondsupcotrtInEfmoerrmgaetnicoyn :: 860102--472343--31310100 COMPOSITION,INFORMATION ON INGREDIENTS Components MaAmtmeorniiaulm Perfluorooctancate Ammonium perfluoroheptanocate AAmmmmoonniiuumm ppeerrfflluuocrroohpeexnatnacnactaete CA3S82N5u-2m6b-e1r 6130-43-4 6281265195--1417--04 933-37 1-3 01-.311 EXPOSURE CONTROLS/PERSONAL PROTECTION Exposure Guidelines ApAplmimcoanbiluem PExeprofsluurcerocLicmtiatnscate ATPLEEVLL + (((OADSCuHGpAIo)Hn)t) ::: 0N0.1o00n11e mmEggs//tmma33b,,lis88heHHrrd.. TTWWAA,, SSkkiinn, A3 i* mpAoELsedisocDcuuPpoantt'isonaAlcceepxtpoasbulree ElxipmoistusrewhLiimciht.areWhleorweergotvheanrnmtehentAaElLly are in effect, such limits shall take precedence. EID089409 009: 0003045 Material DSuapfoentty Data Sheet Page OTHER INFORMATION TT Additional Information TT #*EEaInnRdfoErsmhR RaotuAilRodnbeinustehdeRAaaRsbEotvEehRe SRpeRrAcitmiaoArnAys AsaAroAeurcRpeArRoAvfRiodrReAdthRebsyEe bRupEoAnAte. +AAcaRtegorRiAeAsA. REARR AERARARESAAR RRAR AREAL L885A . Vendor MSDS Text 3M MATERIAL SAFETY DATA SHEET 33M4 CGeennetrearl offices 6St1.2-7Pa3u3l-,111M0N 55144-1000 1pAC)LouLpryptrhoreisigeghihttno,sfforpr1mre9aos9te6p,rievorenlMdyi.nisnuetCcsiooloppityizaiienndMggininai3nnMdgfp/ulroalorndduwdciMottawshnnlunofiosaadcacitlhnulagroniwgoneefgdstCphorimsopvainidnyefdormthastti.on for the 2) wNaiegtirhteheemtrehentthienitsecnootpbiytoannionroefdthefearronomirni3gHg,inparalonfdiits rtheesroelodn.or tniess otherwise price distributed Abbreviations: NN//AD -- NNoott ADpeptleircmaibnleed DIVISION: SPECIALTY CHEMICALS DIVISION TRADE NAME: FC-143 FLUORAD Brand Fluorochemical Surfactant 3M ID NUMBER/U.P.C.: ZF-0002-0378-4 98-0211-0008-0 00-51135-09138-8 0908--501211315--00829914-19-100-51135-09365-8 98-0211-5489-7 0908--501211315--6518017-602-1 00-51135-10405-7 1. INGREDIENT c.A.s. No. AAMMMMOONNIIUUMM AMMONIUM PPEERRFFLLUUOORROOHOECPTTAANNOOAATTEE PERFLUOROPENTANOATE 38812350--2463--14 8289-11-0 AMMONIUM PERFLUOROHEXANOATE 21615-47-4 2. PHYSICAL DATA 98-0211-7394~7 PERCENT 931-- 397 011--13 sv7oaaippolorirnDgPernePssoisitunyrt:e:: NN//AA N/A 009:5B% Hac89h4 e v0003045 Material SDaufpeotnyt.Data Sheet Page 3 : (Continued) ESvoalpuobrialtiitoyn iRnatWea:ter: wA/paprec. PSpe.rceGnrtaviVtoyl:atile: 0N./4A - 0.5 Water=1 (Bulk) 3 VpHi:scosity: cna/.p 5 (0.5% Aqueous) AMpepletairnagncPeoinatn:d Odor: N/A Light colored powder: slight odor 3. FIRE AND EXPLOSION HAZARD DATA FFllaamsmhabPloeintL:imits - LEL: NN/oAn-flanmable AFultaomimganbilteioLnimTietmspe-raUtEuLr:e:N/A Extinguishing Media: WNa/tAer, carbon dioxide, dry chemical, foam Special Fire Fighting Procedures: asHrreoeausrnsdufruelalrmospr,roptrweeacsitsstiuvreeanddcleomltaehgnisdn,gb,fraecaietnhcmilanusgdki,nagpapanhrdealtmpuersto,,tecbsutenilkvfee-rcocncotovaaeitrnienadng,dfppoaornstiestx,ipvoebsaendds areas of the head. Unusual Fire and Explosion Hazards: See Hazardous Decomposition section for products of combustion. i. REACTIVITY DATA stability: stable Incompatibility - Materials to Avoid: Not applicable azardous Polymerization: Will not occur fazardous Decomposition Products: iZnamrobnoina.monoxide and carbon dioxide, oxides of nitrogen, hydrogen fluoride, 5. ENVIRONMENTAL INFORMAaTION spill Response: EID089411 UOPblssaeecrewveetinpsrwaeececapluiotsniegodncscoomnpftorauoinmndeorto.rherwatseecrtitoonsa.voidCodlulsetcitngs.pilClleedanmatuepriraels.idue. Recommended Disposal: aInccoimnbeursattieblien maanteirnidauls.triaClomborustcioomnmeprircoadluctfsacwiilliltyiinnclutdhee HpFr.esenDciespoosfal 2 0005 v0003045 Material SDaufpeotnyt:Data Sheet Page 4 t (Continued) aclhteemrincaatlivwea:ste.Dispose of waste product in a facility permitted to accept Environmental Data: . MDCiehnmenamoniwdcal((BPOOiDxm2ye0pg)heanl=eDsNeimlap;rnodmTeh(leCaoOsDr))eti=9c6a-Nlhilr(O.xL0yC0gS00e7n0=Dg7e/4mg0a)n;dmg/2(L0T;h-OdDWa)ayt=eBrio0c.f3hl2eeamgiyc(qaB:lapoyhaxabiyesgeenna mc1aa4gp-nrdaia)cyor4EnC8u5-t0hurm()cEeClS1lO4-=ddrayy46w0EeCi5mg0gh/tL();cel=Glre73ecnoumngAt/l)Lg;ae=Gr4(3eSeenmlge/AnLlagsaterum(Scealporniaccotrrniantim) B(iPoFOcon=ce1.n8t)ration factor (BCF) for ammonium perfluorcoctancate Regulatory Information: VVoOlCatLielses OH2r0gan&icExeCommpptouSnodlsv:entsN:/A N/A bSienfcoererdeigsuploastailo.ns Hazardous.) vU.aSr.y, EPcAonHsauzlatrdaopupslicWaabsltee rNeugmublearti=onNsoneor (aNuotthoUr.Si.tieSsoA TrheegisctormaptoinoenntsreqoufirtehmiesntpsroodfucTtSCaAr,e EiInNEcCoSm,plCiDaSnLc,e AwIiCtSh, tMhIeTTcheamnidcaKlIccL. EPCRA Hazard Class: FChirroeniHca:zardY:es No Pressure: No Reactivity: No Acute: Yes 6. SUGGESTED FIRST AID Eye Contact: iImmmmeeddiiaatteelmyedfilcuaslh aetyteesntwiiotnh. large amounts of water for at least 15 minutes. Ge skin Contact: Faltutsenhtisokni.n with large amounts of water. If irritation persists, get medical Inhalation: EID!089412 IZfontsiingunes,/scyamlpltoausphoyccsuirc,ianr.emove person to fresh air. If signs/symptoms If swallowed: 0 not induce vomiting. Drink two glasses of water. Call a physician. 7. PRECAUTIONARY INFORMATION 006555 v0003045 Material SDaufpeotnytData Sheet Page 5 (Continued) Eye Protection: Avoid eye contact. Wear vented goggles. Skin Protection: ABavioridofskignlovceosntamcatd.e rubber. "Use one or fWreoamrthaepprfooplrloiwaitneggmlaotveersiawlh(esn) haarnedlirencgomtmheinsdemda:teriBault.yl a more of the followig personal protection items as necessary ttohanpreglvoevnets)skisnhocuolndtabcet:madeheaofd ceoivtehreirngo,f Ctohveerfaollllso.wingPrmoatteecrtiiavles:garments (othe: Polyethylene/polyvinylidene chloride (Saranex). Ventilation Protection: Utosemawiinthtaianppermoipsrsiiaotneslboecallowerxehacuosmtmenvednetdileaxtpioosnu.re Plriomivtisd.e is not adequate, use appropriate respiratory protection. suIfffeixchiaeunsttvevnetnitlialtaitoino Respiratory Protection: - AaacvpcopoirrdodvabendrceeartewhsiiptinhrgatoOofSrHsAaibrreabgsouerlndaetoimnoanatsei:rribaolrf.nuell-Scfoeanlcceeecntthorinagethi-oeonfffitofhceiecnofcnoytlalmofiwinilantngetrsNrIeOasnSpdHiriantor, full-face supplied air respirator. Prevention of Accidental Ingestion: Dtohornooutghealty, widtrhinksoaopr sanmdokewatwehre.n uWsaisnhg thhainsdsparofdtuecrt.handWlaisnhgeaxnpdosbeedfoarreeaseating. Recommended Storage: Dcoontnaotinesrtordrey.contKaeienpercsontoanintehreirclosisdeeds.whenStonroet aint rusoeo.m temperature. Keep +*PREVENT MOISTURE CONTAMINATION TO KEEP POWDER FREE FLOWING*.* EID09413 FKiereep acnodntaEixnpelrositoinghAtvloyidcalnocsee:d. No smoking while handling this material. ther Precautionary Information: EMIS HAZARD RATINGS: HEALTH: PERSONAL P3ROTEFCLTAIMOMNA:BILIXTY(:See0preRcEauAtCiToInVsI,TY:section 7.) EXPOSURE LIMITS Ingredients AAmmmmoonniiuumm PPeerrfflluuoorroohoecpttaannooaattee Ammonium Perfluoropentanoate Value Unit Type 00..011 nmgg//mm33 TTWWAA 0.1 ng/m3 THA Auth Skint A3CHGIH 3H C0535 v0003045 DuPont Page Material safety Data Sheet : (Continued) Ammonium Perfluorohexanoate 0.1 ng/m3 TWA EL Y paIuoctSoekunistniaNmloetmabctroianontner:ibauntdLiioesyntee,dtoesituthbhesetroavnecberysalaliirnbedoxirpcnoaestuerdore,wibtmyohtrhe"eY"pcaruuttniadcneuerouSsKINrourteeferinctloudtihmee contact with the substance. larly, by direct Vehicles can alter skin absorption. S=oAuCrGcIeH:ofAmEexrpioscuarneCLoinfmeirtenDcaeta:of Governmental Industrial Hygienists =~ AIHA: American Industrial Hygiene Assoc. Workplace Environmental Exposure Level = 3M: 3M Medical Department Guideline 3. HEALTH HAZARD DATA EYE CONTACT: Yoderate eye irritation: signs/symptoms can include redness, swelling, pain, searing, and hazy vision. Airborne product may cause eye injury consisting of corneal opacity. SKIN coNTACT: Product is not expected to be irritating to the skin. ifnicldludsekinredinrersist,atisownell(ianfgt,eranpdrolitocnhgiendg.or repeated contact): signs/symptoms can INHALATION: fay be absorbed through the skin and persist in the body for an extended time. Illness requiring medical attention may result from a single exposure by inhalation to moderate quantities of this material. May be absorbed by inhalation and persist in the body for an extended time. eRincepoeenlametevenaddteeiddnhgoaurligadatenilooifnnleuoscf,riamdiaerybolcreanvueeslesp:roidnucttheabbolovoed.theSeixnpgolseuroevergeuxipdoesluirnee, caanbovreesult Ianrdritthartoiaotn, (cuopupgehrinrgespainrdatsonreye)z:ings.igns/symptoms can include soreness of the nose 2rolonged or repeated overexposure, above recommended guidelines, may cause: i>fveurppeErffeacbtdso:mens.igns/symptoms can include yellow skin (jaundice) and tenderness IF SWALLOWED: Boots 14 ingestion is not a likely route of exposure to this product. oon V0003045 Material SaDfuertanytData Sheet Page 7 (Continued) mIaltlenreisasl.may result from a single swallowing of a moderate quantity of this AcC2MoAnMmNmCOpoENonRIui:UnuMdmApPiemnEridRfxuFlctLueUuodOrrReoOcpOaoeCrfnTctAiaaNnmnoOmogAoaeTntnEieiucm(ia3tpn8yde2r5wfa-a2lms6um-oo1rnf)oioouuwcnmatdsapneionrfafetldteuh,detroosahtameulmdxboyain.nnioouamtTrehap,etersrefthlfawuoteorrrewo2ahsyeepator3asn,cwaotneg. ssbeetncaiotgnindstittcuwmoao-lrylseyarsinigsntthiuefdiyclaitvnheterr,ecowpmeaprnoecurnedsatsra,etaialsnttdeidctaeblseltnyiisgnswihgtenenisfticicocamunpltaarrecdotmupmtooorusna.dd reIlnaated 1ibitus a DhpueaPaiolrnt-thf)e.dimcpolnitcraotliso.ns. Bas(e1d983onantdhe19c9u3rrsetntudikenoswlceodngdeu,ctetdhesjeoinftilnydinbgys3hHavaendno mum. s MtUrTaAnGsEfNoIrCmIaTtYi:on Niont mautmaagmmeanliicaninceilnlvittrroanmsuftodrgmeantiicointyassaasys.ays. Did not cause cell RSEoPtROtDeUrCaTtIoVgEe,n/iDcEViEnLOrPaMbEbNiTtAsL TbyOXIoNrSa:l 3avage or inhalation exposures. administration. Not teratogenic to rats by AOT3HMERPHrEoAdLuTcHt HToAxZiAcRiDtyINSFuORmMmAaTrIyONS:heet is available. SECTION CHANGE DATES 4EADING SFeLcUtOiRoAnD cBrhaanndgedFlsuionrcceheMmiacyal20,Sur1f99a6ctainsstue MSDS: FC-143 August 23, 1996 sITNohCerLrUeiDcnItfNoGar,smatoBifUTontNhOeiTndaLttIheMiIsTiEMsDasuteeTdOr.,ialAN3YSMaMfIAeMKtPEyLSIEDDaNtOaWAWRASRRhAReANeNTtTYI(EOMSFS,DSM)EERXCPiHsRAENSbSTeEAlDBiIeLOvIeRTdYIMtOPoLRIbEeD, JFsIeTrNESisS FreOsRpoAnsPiAbRlTeICUfLorARdePtUeRrPmOiSEniOnRg particular purpose and suitable for CwOhUeRtShEerOtFhePER3FMORpMrAoNdCucEtORisUSfAiGtEfoOFr TaRADE. user's method of use or application. Given hs2osemseenvotafirailwehtiytchhoaftartfehaecutunoisrqesuretlehyvaatlwuicatanhtienatfthfeheectIHustephrre'osduusekcntoawtnlodedadgepetpelriamcnidanteicoownnthreootflh,eari3titpirsiosdufcitt, Zor a particular purpose and suitable for user's method of use or application. 3zoo4misptshreioovnirsdeemsootreianlpftooesrrsmaiatbtiiioloninstyiintnheatltheicestlreoicnnitfcroornmfaiotcrimotnra,sanas3fMesmrearkmveaisycehnaotvoereiptrsreessucelunsttteoadmteiironsn.serraosDruset,o i3tasy ncootmpbleeteansescsurroerntaccausratchye. infInormaadtdiitoinoni,n tihnefoMrSmDaStioanvaiolbatbalieneddirfercotmlya dfartomaba3Ms Tschopemebciidnfaaittcaiominantewtrihitiahsl aMndayteesoritigahnlearteSdmaafteheteryrieaiDlnataaonrdShidenoeetasnyrnepoltraotcreeessl.sao.tnelyttoo ustehein 20d of NSDS EID089415 009055 103 099030  Fl-c2 i ::i : KErPismHmansoenauinhei Te 23809 [EBM NEEnvy ironme ental p CabTM Spiemm res vs September, 1999 : PaIMulToLxiidceolrogyServices maa DearPaul Lieder: HAeosnrleysafoirdheplripemylioymuionmraiargkyinerabelesetmueasriflodermcePissOsiaAognAes,aIblvoeeustsstihdeossenraotsamdokflscivuterheeossxarTneOdsXfuOts2piu6rb(lirPceO.jeAcWAteMsporarovneidydeeSryhne)sd,, ou ed1 se hedota 0scartain ead, bt less ont UBL ofrel sec alo rAy eAdelsfilsnaisttieohdnia,tinnatnereiabmrerleisesarutlctoosummmgauhnyicecahstainrogenev,biteeifwosbrdeyathaheheyasasraielelenbteneerSneQdiiCfn,f8inbahulertEenpootrmtQsA'irfE.eroeTrs aLhraeabdre.iesiBcnsyotveereriemd SUL ig 7/1 aOsAtDh.edittmoyvoutuonuegrhstahnrteevipetwepraoclesrs,ikscilvilngvpdewniithnmg ivinewdabtya.i EnviromeLnatb V Tiys WSCa eYtA IMEnronmenLaalb Dicton29E09 oimBueniol 2202802 ZQ EID088631 8 L EE E rWn aa lnt oEEEa sEeeneee ESR TR EE 000 in HSiidsk s4les ii8z5l3e5 JH fot : 3 5 $fi bE nEg, Fbiofitie sig Allin' Hi t pHgai i ge H iid EID088632 eons .Eg : g : & 5B3ird5 n38 E8 of Zgaz ex H LEE H HEE H H pipe Tile pag pegs i lo doe N 1 0d 5 g: Hil3d2 82). sfHah' Hhou Sa[2E55)228|2285)53888F) 4 8 HN kekez bo1 d badil2h4a8s h[1a3r% EiE ATT EfiGEi: EID088633 009:35 g2 s st 8 | Tr | fl ofo] f 31 25 IT$1; i ! ib, | fifth tris IElhlyo J Se il ian i i BRHNAHE . i Eo i Ii | iI EID088634 000-75 :; J pe A i HE 1 ii i : Hert Ehdslesleal gas EEE i Ho HH limi, | ii h id: = hl bree pp Jl] adil sff il 3 a ED0ggs35 2 000F47 imino, | E! 3TIEEEE hI ddi eid 14 14]i | * HlEARiteper e ed|sat Ll Pil Ht Aid 3 ll]DONE ii i 3 EID088636 z: 00935 |a [144A1o]o : i 88 dH) 3 z f i i a i 1 Ty id RRI1I40N0R0 LE J gq uwbg ; gl :: i i i: i | 3 | ifii 000535 EID088637 - gi ; i3 Pog pI Ad A P51ly Bi edied 4 4 do lii Pini, i i L oEEdIEEE, to szzsslEazs 3 Hho nT % 3 pls 1h dafilibdin i: i] ii EID088638 000. . : g: i Hi AA ] of Ppa i 3 1% sii qd qd {ipeg : ; 58 seats bfg I Sd li iPi ug ail i a < Inidg= oTE p : i {=Gl HL 1 iid EID088639 8 005% i . ' Hiofoeo]A hp i31f. EA ddd * HATH pspoan Jo, al i oepf i H iHEf aittlhdit 2 TH + iil EID088640 8 009019 ly taint db i d!o ld EE] |i 44 1A o1oa, al,ih I} all boJ i id ii HER : EID088641 ee } deal, | ET ii 8 pid GE 4d 1 gE SEE JlPa hd tipo" e]i EID088642 g 009.1 $ rE A ERE1 1I gE y hd HEE dd 1 oRgitaiiiess. * ii ppd 4 lo] 5 iE ranean f bL= i1lay Jll J i pled, tll] i g SHEINHE i: 5 000575 EID088643 $i 8 Eh;E| i ElliTy BIELLtHEDondEe: nd 5 So Hominy Ii hoi ny 4 Ii i adial 53 ih 80.75 EIDogggqq 2. gi bio 1 i | Ho E RE E lily bpd bdo Li a z in ph 8 EID088645 2 009 i . fbb, | Ji B5E AeA THoTat o id 1nn4r lal Ml id y E fmreatEte biep]Efk yi g g EID088646 hs [DERE i TiAIiiP A P o m ifr obse m tA] o hol4 i fil l il dui hy El, i i iilit ii o EgR EID088647 = 6075 FT ir i gd iI gl111,5 Hl, Adib ii EID088648 g. ! i 1 HTH id 11 pd; gE s 4 & Whi bry| : il hi i] . 0005 EID088649 : i Hmm PL| A de j| Wl tt] HEHE mn : iE i i lll Edel] i 1 Ah 3 BE 3i gE ii EID08sss0 g eeonvy abii H|!g m[1l11e1 | CM pe | pl i, mtd i i 11 HE 089535 ElDogggs, i, | i 1 ETH . PH billing pest 1 : HEE i halt i EID088652 3 [DREN lll eed i |I JERE Fc ud CU Le, I I |i CL 1i EH Fn WE il ped ! i yii: yftil ow FP . C Days E r E| = Days oT38EE3EEAEE | wes BSEREL E oe E Week 4 E Tisa 1 p veiredr e ell D2 welel c EhE].2 P| ed : el g asf E |sl 1Evelei ee : eElEEse TrEe)|| va eo paE= wvee1s wn EE eliOEHSEEEE SEi E c 72E||veWveeenks18 ia ee M JE E 3 hweairsgl E J:Ie MSe eIEte e =BH tie o Week 26 - T T ERIH Eo E eo een EARRERICIRNEY WTe r 7 :2 FT il e i [is fifs iii EF gE HH E31 53 = g EID088655 = 009:-&% 104 000-25 " LTT 9 Ansrows Haran 090399 02.48 To RoRRbaoenlrentnowRFsiPkcIIhnDcePhyUoCOUUUDDPEU@VPOAoEUrOPU@.POSOUaNPm@aaDrnUdtPaJnRte,isNdOaPrLoDsUJPZGaOnUKPe.s/AMiEcThOaUe:POJ@LOkuaPaSnAtE,IOAUnPdraema@OWPon. ADRlaatumonsne3AyiCJA/aEacnDkeUi/PoAanErCILD@IuOOPUaUPrPioa@nm0@,uDJPuooPmno:.nM.MMiAicgrhlanoeroAalnAJTEWFIcaOOyuAiPEsOIiNOCGWLuPIEDpNU@,POau@RPOooungPteorn)H,pDGalevoaiArdgEeIDUPoN@DUPon. HWJaooryitisoownAaluhCgLCeILrDDAWUPEPeDonUn@PGOOuONPUo@PnDatUn.PtnT.itLm,aYJtoyNnSWFBOMiOonoKgDrmea/InCRALEEILDOAUuNPPDao"rn<@(DI@uROPEuoLPnAotNn.Dt@Gwaavpis-a1 smell dupant com, Susiect Re: Plant Manager communication to GE 2) Bab. pGrreeaptarteodhteaardtdhraetsasdEiPonAaqluecsotmimounnsiccoantcieornihnagstoicsciusrseude dwuirthinGgEt.herReSelpatt.ed23toittheisvsiusb,jeecst,pewceianlyeeidfobs vTiasrtuinngKGoEtsdcuhri(nEgPhAisPMh)ptiosPsartkeerGsbEursgieasfrhsteaynadreaavlesosc"uerneingthltyeniemd"m.e.rseAds iynotuheknRoFwI. phreocweislaslsobe Hheopwealnutlsymwee(caannd dTeifme)r1mooGsitvequteositsiopnrsojoectthteefaomrm(aile".WtaosxiholWoogriks.s hRyFdIroR)esiunlmtisd-SOucmtmobaerry." resentation Andrew : - [LEE EID072367 J oo CER Se 1 IT 12S CIENT OF TU aw SLE a Salt F isLp R LA 7pHNre 4r lJYiad - iy J a pe - fe -- DFUAPCOSNITMIFLLEUCOORVOEPRROSDHUECETTS / J TO: Spree Sl snA FAX: 46324/397 DATE: PHONE: FROM: A FA atin dirt J Ad A rere dep LOCATION: ~~ CRP-7LU PHONE: Fax: (302) 999-5123 No.of Pages including cover sheet: Message: 000525 EID087238 7 FIE Mh, 610 8 CH 120E IWR GF TLL 02 9 Gz fog nt C-8 Monkey Study + Goal: A) (0 determine toxicologic effects of C-8 in the primate following an extended exposure period B) to determine potency lor producing change (NOEL-LOEL-EL) Surprises: - Potency at lower dose (3 mg/kg) - Failure of all animals in group to respond similarly - Quick plateau of C-8 in blood A) Quick clearance from blood B) Lack of proportional response (exposure of x, 3x, 6x did not lead to blood concentrations of x, 3x, 6x) = Subtle vs major toxicity end points = Hormones unchanged + Pathology unremarkable, especially in severely affected monkeys 3 EIDos7230 B 000089 Et 0 tr nz het C-8 Monkey Study Sponsor: APME Ad-Hoc APFO Toxicology Working Group Testing Facility: Covance Laboratories Madison, WIT Study ID: 6329-231 Study Study Study Director: Peter Thomford Monitor: Paul Lieder- 3M Representatives: David Farrar - [CL Reinhart Jung - Clariant Gerry Kennedy - DuPont [Giovanni Costa'- Mitani] [George Lin - Daikin]| In Life 9/23/98 - 7/2/99 9g EID087240 2 009539 FILE the, S32 1027 "0 12305 (0HEONT GF TLL 02 6 S12 fig C-8 Monkey Study Experimental Details + Oral dosing - gelatin capsules 3 + Diet - primate diet, 1 or 2 x/day - supplemented fruit/vegetables + Young adult/adult - 3 >5 kg S g g 000528 EID08724; FILE Bo. 85 10.27 el 1205, I0ENT OF 711 we wi 12 ho Design Cy-8 Monkey Study . ky A oH TMA Group | Control - 64 cynomolgus males 4 6 months 2 6 months & 3 months recovery +5 Sh ar Group 2 Group 3 3 mg/kg - 4 males - 6 months (1 monkey - died day 137) 10 mg/kg - 64 m6almeosnths 2 6 months & 2 months recovery "L1hd Group 4 20/30 mg/kg - 6 males 30-day I-11 0-day 12-21 20 - day 22 -6 months 3 monkeys - dosing discontinued (1 monkey - died day29 All sacrificed at 6 months we Days 43 +81 ~ [de shpJloTMaSie ny EID0g724; 009:27 FILE Me Sia 0 ET 123 IDENT oF Tr 0 61 " C-8 Monkey Study Parameters L In Vivo . Observed 2x/day Body weight - weekly Food consumption - estimate daily Ocular exams - pre-test/weeks 27 & 40 II. Clinical Pathology Timing - Pre-test, days 30, 60, 90, 180 Recovery days 30, 60, 90 Hematology - RBC, Hb, PcV, platelets WBC & dict, reticulocytes, cell-indices Coagulation - APTT, pro time, fibrinogen Clin Chem - glucose, UN, creatinine, prot. bilirubin, cholesterol, triglycerides, ALT, AP, AST, GGT, SDH, ions (Ca, etc), amylase, lipase Urine - standard & urobilinogen, bilirubin 00935 EID087243 FILEN:. S84 10 27 1m HOE GF 711 sic we Gz i C-8 Monkey Study IT. Blood Hormones - Timing - 3x pre-dosing, day 30, 60, 90. 180 Recovery day 30, 60, 90 - Estradiol Estrone Estriol Thyroid stimulate hormone Total & free iodothyronine (T3) Total & [ree thyroxin (T4) c Testosterone Cholecystokinin S IV. Exposure Indices - Serum APFO - 7 days & every 2 weeks thereafter - Urine APFO - as serum - Feces APFO - as serum - Liver APKQ - at sacrifice 000085 EID087244 FA te 2 La NRA T oi ten E125 " C-8 Monkey Study V. Pathology Complete nescropsy Organ weights adrenal, brain, epididymis, kidney, Vz liver, pancreas, testes, thyroid (parathyroid) Histopathology (36 tissues) Additional parameters - Palmitoyl CoA oxidase - Cell proliferation - Bile acid determination (receptor level determinations) (bone marrow smear) 9 J-- 8g eed FILE N, S501 27 10T ITERT OF TI 30 i 1 fo C-8 Monkey Study - Results I. Clinical Observations Control - none a de ake 3 mg/kg - 1 monkey - week 18 - ataxic, hypouctive no food consumption, limited use of hind limbs _ end vewtyoy week 20 - sacrificed, lost 9.5% bwt 3 monkeys - none 10 mg/kg - 6 monkeys - none 30 mg/kg - week 1 - low [ood consumption | lost 3-7.5% bwt 20 mg/kg - week 3 - 3 monkeys - same as above withou marked wt loss, treatment discontinued week 7, 10, 12 1 monkey died week 4 2 monkeys - no clinical signs after week 2 000225 EID087246 BIEL S10 ET CEE EET GE TIL 02 se 123 ng C-8 Monkey Study - Results SE 11. Ophthalmology - no findings (ots lL Body Weight - cL TF z pire 0/3/10 mg/kg - no differences a Ioss. 4a" 22[030mmgg//kkgg- -lloowweerrFWwwkk7,1]9, 24.( 14.3% wit gain of controls) wha ie TV. Food Consumption 0/3/10 mg/kg - no differences 20/30 mg/kg - lower (some no foad consumption) V. Blood Hormone No significant effects (0-30 mg/kg) Unexplained total thyroxin lower 20 mg/kg tree triiodothyronine lower 20 mg/kg 9 3 VL. Clinical Pathology 0/3/10 mg/kg - no differences 30/20 mg/kg - mild * wiglycerides mild neutrophil, protein, albumin - 2 distressed -4 marked ALT, AST, SDH, (creatine Kinase) 4 mild bile acids - recovery in oft-treatment monkeys 000:37 EID087247 FILE ti Sd 16 27 CH LT ISNT UF TL 02 a 12 Fu C-8 Monkey Study - Results VIL. Palmitoyl CoA oxidase - expect <4 wks Cell proliferation - expect <2 wks Bile acid - no differences VIIT. . Pathology go Iost Gross path-o unrlemo arkgaby le ~ 5a Organ weight - liver weights elevated oo" Lopror 3 GO/82/83/90 gems Mean (all test) 1.5/1.8/1.9/2.4 Organ/bwt (all testTM) Histopathology - unremarkable Cause of death - --u_n--clear in both moribund animals 2 g 000525 EID087248 C-8 Monkey Study Urinary C-8 Levels (ppm) . oe pEeeT2 TT E wlEww[1Teal1 os E tL mT -. f ineSu:n animals T I T EID087249 ; 000: 2% FUE the, S54 1 27 1 IER OF TH 0 i E12 - C-8 Monkey Study Liver C-8 Levels (ppm) Group (mg/kg; 0 3 10 20/30 Recovery Liver 0.04 (0-0.04) 5.9 (4.1-6.8) } 593.6-8.7) 17.2 (8-28) 0.8 (0.03-1.2) ESde 2 5 065.09 EID087250 IE, Sd TT Te Len TEMEOTF TH ne i SR C-8 Monkey Study - Conclusions Monkeys do not tolerate 20 mg/kg or higher - Non-specific response involves liver - Recovery complete in oft-dosing monkeys - Effects include body weight, liver weight - No specitic histopathological changes hormonal changes Effects at 10 mg/kg only liver weights Effects at 3 mg/kg - 1 death (relationship to treatment?) liver weights C-8clearedquickly from urine (proportional to exposure + C-8 clears quickly from7 blood (not proportional) Se dt - Reaches plateau quickly ley - Leaves system quickly i" p + C-8 in liver proportional to exposure, recovery quick and complete * C-8 in feces - will get "matrix information" g EIDog7,s, 3 0600.05 Fie a bse AE GAT iF TIL 02 en 8123 or C-8 Monkey Study - Conclusion card = ee mel 7 Capt Thr S we + No observed effect level not attained (<3 mg/kg) w, Thee + Potential serious effect in [/4 monkeys at low dose 3 (liver effect unexplained currently; best explanation could be enzyme induction) ~~ unichidyiy odor At AEL/TLV of 0.01 mg/m?, daily exposure to man is 0.001 mg/kg or bodryd ~Ji MGEi Wagl rt tt* ve Te fort pe . 3g 3 0306.05 EID087252 FOENe S34 10 27 6 105 IHof 711 0 ea e12 fy C-8 Monkey Study - Issues . + Livereffect (will answer) mt er ors I foo : wt + Death of low dose monkey + Lack of slow elimination as seen in man (does human data reflect multi-phase clearance) + Evaluation of monkey-by-monkey data (in progress) 000803 3 g EID087253 Thanks for Hanging in there..... Trewmah {pet Cluight RN oder po Una! posure Tris am Aaphier Psgerst ( A) Senate pg fexic Risfinrit , fo Ky Talk dz farm K. p Fm To Sh wet Soars =F Py Te Ly wt Ga 1teser Nos Lbs [ls = yp8 22 (Ge wi cS ds PE [5p fm pig RE 003% 107 009507 s FFI e roger azote i 1117799 11:27 Am Tor Robert F PnchouDEVIAEDuPam@OuPont cSeutbject: ORes:caCr8TMGoanrkzea/yASEt/uDduyPoanntd@ADlulPoownatble Exposure Limit 2 Rdoube,to| dCon8'texfpulolsyusruep.pTohrtusthIebflrisetvebutrgsehroduoltd arseaidt issimsitlaatredt.o |thdeons'etctohnidnkbuthragterwdeotc.an rule out death Roger. Robert F Pinchat 11/15/89 03:06 PM RobFPeinrchtot 11/15/99 03:06PM Br RR RERs To: Robbin Saneree/AEDUPoR@OuPort, Oscar T Garra/AEDuPorr@OuPort, Anthony J PMTlaaantyattkhiaes/w/PCCOLI/KDDouuePPnooinnntg@@sDDEuuUPPoRon/ntDt,u,PSNotonertfp@uhrOmeuJinPoOGnhittss,suyAk/arA/EPeJDOu/VPDeourPnmoten@utD@luDePunoPn/otEn,UtRR,DoUBgaPerorbnaJ@rZOaiuJpPtoenlt/,AESDeuiPcohnt@DuPont, C`aGvaayndaau/gAhE//ADEuPDounPto@DnutP@oDnut,PoBnar,baRroamJaGnayVdaan/AAKEeDnuEPUoRnItD@UDPuoPnotn@tO,uTPhaonmta,sBJarbara J DADaanvwGisidouMnl/oRA/uEA/rEDaUulPPAooEnnDt@u@DPDUouPnPoo(nn@ttD,,uPMSoaunutsri,acSnMeiAcMhsiatleoelrtigEDaMulcPACoEonDtru@dPO/ouAnPtEo@DnDutuP,PooRnnitct@h,DaruMdPaorJ.inatn,neRoMbaerrtsiDupon@0uPont, CMaavcaFnaaduagnheDu/PDoPnLtD@UDPu@POoUnPt,, Laas/AEDUPo@OuPont ACnldarreeancVe MPaMlhinaoUwAsEkiI/DALEPIDOu@POoUntP@oDnu,PoEnta@W.DUP, Sharron ce DKieannneeRdyS/hAoEmDpuePro/rAtE@IOUuPPoonntc@DuPon, Gary W JepsDuaPornt@/DuAponEt, Gerald L Suect: C-8 Monkey Study and Allowable Exposure Limit Most of the results of the 6 month monkey study are available. Due to some of the findings of the snottuidfyi,catthieonswtiuldlybies shorty thereattar. mSraeipndoceretbaeybmlpFelrtiodoyaetyeh,seNpUooSvteeEnmtPbiAaelrluyn1de9extrphoTasSnedCdAtthoSeeCcl-ta8itoehnrawv8i(elel)3 bbreiycghotthmeteo3akMnpuocbwolamicbpoadunoytc.tuhmTeehnits ffoirndyiongustoofutshee fsotrudyyo,urDicaonmemuSnhiocmaptieornsa.nd |Thairsecdoemvmeulnoipcinagtiaonnepmapclkoaygeesschoomumludnbiecaatviaoianbflreafmoerwyooruk 10 use by Monday November 22. To give you a preview of what we will be in the communication, here are the key points: OOnnee mmoonkneky iinn tthhee lhiogwhedsotsedogsreougproduipeddifeodr rfeoarsroenasstohnasttahraetuanrceleuanrc.lear but may be related eAtlonlzCmy-om8neekxiepnyocssruesrahseeo.sweindtshoemheiglhivdeorseeffgerctosup(vmaornkweeyigshtthaitncwreearsaesinidniasltlrdesoss.agTehegrroeucposv,erlyi.ver * aNnoimtahlsedricdlninoictasl horowpatthheolsoegeifcfaleccthsasnuggegseswteinrgtohbasetrhveedfovtehreerfftehcatnswthaerederaetvhesrsainblde.the liver * Tafhfoecstts,udy resuits are not complete. We won't have a full analysis of the data until January. * TGuhiedelAiEnLe. (0(3.m0i1cmrgo/gmr3am8s/adnady)12wihr, TfoWrAnowwi,thsatasykitnhenostaamteio.n)TahnedCCoommmmiuttneietywiElxproevsiusritethis 000%e35% HOY81959 afar the full asus are in and analyzed. hPliesasneotwealist1f0orgitvhee yfooruma3lhceoamdmsuunipctahtaiotnhipsaccokmamguentiocactoimomnunisiccaomtiength.is broadly. The purpose of RReogbards, . 00062060 i EID081960 3i | C-8 Monkey Study Communication Plan Communication to Employees . DuPont Legal opinion is that communication is required to US employees. No specific time frame is given in the OSHA Hazard Communication Standard. To be conducted on Thursday, December 9 to all DuPont and employees potentially . * exposed to C-8 (Sites include WW, Parlin, Spruance, CW, DW, Mechelen, Shenzhen, Madurai, and Shimizu). Summaryofstudy made public on November 22 through TSCA 8() filing by 3M. Messages to be conveyed atal sites : 1. Current AEL is protectiveof human health 2. Liver effects seen at al doses, effects were reversible after ceasing exposure 3. Two deaths occurred in the test groups. One at low dose and one at high dose. The causeofthe deaths is unknown. 4. More data will be communicated when analysis is complete (early 2000) `Some sites adding site specific information on exposure levels at thei site (allofwhich are less than the AEL) WW communicating that C-8 s in drinking water a the site, at levels less than the Community Exposure Guideline. WW is communicating the results to GE Plastics management. CommunitcoaCutstiomoerns No MSDS changes have been made at this time. No need to communicate to all dispersion customers. May have to change the MSDS once the final results are analyzed and will need to communicateto customers Chem Fab and Gore have been told about the monkey study. We will share the results with these two customers in the near future. (Gore meeting set up in January). 0006 = EID083021 S = Terman: Fam Herd Health nvesugaion Cate Team Report Tennant Farm Herd Health Investigation Cattle Team Report EP/DuPont Cattle Team DDrr.. LPiesrrayAL. DHaavbise-cHkeelrler DDrr..PReotebreGr.Jt.MMouinssanon DDrr.. GRroebgePr.HtS.ykPeosppenga Decembe23r. 1999 QUIIn ' DUP 242 Tena Fam er Hest ncsigaion TABLE OF CONTENTS Carle Team Repon [Er Signatures 0 SETHoDs 2.0. | INTRODUCTION rr -- 3.1 1 Cattle Team 3.01 T members 523 dissnosi paology epors 32 1 Animal Daia 321. | videotapes 3.23 1 April 1999sitevisit data 324 | miscellaneous data s 1 6 4 16 6 17 s | 7 18 T1 3 CITTCodueans [ONSE1 S151 Aon 1999 se vie dais is 1 a._herd history (4/8/99 interview) 115 7 ._physical examination of cattle (3/7/99) 116 T e cimee shus e ime punoloss --I ]ie _--_ 1d hay and grain analysis 118 o32se= Miscellaneous Data ] 1 19 [Esl Tvocouges 5} E-- 5E0 | DISCUSSI-- ON ----1 FT endophveroiey 000s : DUP 243 - `Tennant Farm Herd Health Investigauon Cattle Team Report TABLE OF CONTENTS (continued) 1 50. | DISCcUopSpSeIrOdNef(iccoinentciynued) toxicology sues F 60. r | RECOMMENDATIONS - --7 2 7.0 CONCLUSION 8.0 | REFERENCES -- on 1 Graph I: Individual Prolactin Values 26 26 5] 30 -- Fa re -- i Figure 3: Delayed shedding -- | __ Figures 5and 6: Coronitis | Figures 7and Cale standing in water -- 1.3 134 35 11.0 || TTAaBbLElSeI Table Review of Individual Tennant Animal Farm Data: Videotapes ClimcalSig ns 5 136 T= | Table 3rd Animal Da: Hematology (ervvon places 35 | Tabl4e: Table TIrnddinviCiddhuueaalmliAAsnntiimmaall Data: Data: Hematology (leukon). andSpecial Clmeal Chemise | 48 i% |TaTbabllee7 TInedninviadnuFalarAmniGmarl Daoatna:diHaSneyr:oloNguyriavnodnaFelcaAlnaElxysaims [I5S 12.0 1APPAEAppNppDee9I7nnC:ddEMiSBAc. hiDAgibaabngrneAovnsitiaimicaedlPaCHtuehraolrltiohcguyDliRuamegpnVooisrttasieco(OfLhaCiboatD#eep1t7T.9e25Aag7mr1i;Mc.eUnm4i3bs9e77r.s|| 33365 35 P#e9n9n0.14L3ab7., of Large Animal Pathol. and Toxicol. UP9902702. | AAppppeennddiinx C: D: DFirgyurReusn1S2af:ery Plan Photographs of he 43 30a calle Figures 43.66 Miscellaneous photographs ofthe 71 `Append E: Ferd Health History ("ATpernina8nt 1F9a9r9miannedrvciaewey. 106 Appendix F: Diet Analysis: Computer Software Simulation 1109 coats 3 DUP 244 | Teanans Farm Herd Health Investigation Cate Team Report 10 SUMMARY Introduction: Earl Tenant's cTahtteleobhjeercdtiavnedodfettheirsmiinnveesptoisgsaitbiloen cwaaussteosoefvaalnuyatperotbhleehmesa.lthThsteatus of Mr. wainhnvidecsehtviaogluauttalitioinnoensinsoctfluunddeyewdfidanandtaie.nxgasTmahinnedaitnmivaoenksoetfisgraretleiecovonamtnmeternmhdiiasnttaotireoidcnasilntdotahtieampparsroodwveuelclthieaorsndtohhfeeatclhotilshlercetpoirotn, vMeettehroidnsar:ianTshweitThencnoallnetctfiovremexhpeerrdiheenaclethininbvoevsitniegadtiisoenasweass, choerndduhcetaeldthbmyaanatgeeammeonft,six dtiosxciucsoslioognys.. ptahtehoclaouglye.taenadmwviilsdiltiefdetdhiesTeaesnensa.ntInFaadrdmitoinonAtporinlum7-e8r,ou19s9m9eientionrgdseratnod collect relevant data. diagnostic laboratory rTephoertcs)ataendtceoanmtreemvpioerwaerdy historical data (e.. data (e.g. clinical videotapes, examinations. blood tests). Diagnoses and recommendations were based upon the data collected. Results: The herd revealed multifaceted disease health problems that winevreestrieglaattieodnotofetnhdeoapdhuylttecattotxlieciitny,thienfTeecatinoaunst beef hKiesrtaotroiccoanljduantcat.ivwiittihs p(rpoilnakcetyien).vamlaulensutorfitsioomn.eaanndimcaolpsp,ewredreeficcoinesnicsy.tenCtliwniitchalenadnodphyte pcPlrIiSonCiiOocIanOlgNeieCdxOassmieisvn.eateAieonnnzseoxooatfmiipcnrsaeotvfiioofunascloeyfflavyfifd(eeMcouttesadcpaeasdauumlrtaudamenniadmluairlsis)ngdiuntrfheiesntgsauttimhoemnehaernrddmocvnoistnichtosimnaidntidacnatted pinkese. and grain rHaasyioannsalfyesdisw.erceatcloensbiosdteyntcownidtihtipornotsceoirni-negn.eragnydmaanlneuvtarliutaitoinonanodf the mineral mactomineralfiruce serum texting ut the nutrient deficiencies. time of the herd visit Earlier laboratory were indicative of sdaetvae,reclcionpicpaelrsdiegfnisc,iaenncdy in the cattle. Conclusion: continues fo There was conclusive be. suffering from four evidence that major disease the Tennant cate herd entities. some of which was. and were fmpioantldeninunttgirsai.ltliyoann.idntaheinrsrdieolcraoitpecdap:lerdaetdnae.dfoitcphiheeynstceye.ftoouxAriscciostnuydbi(sttfiaeonsntcsiuaertemeadydcibolytyotaxhiceccoocsluiinnsti)c.faolpraitnnhkdeeyclaehb.roornaitcorhyerd health problems on the Tennant farm. inTnuhtieeirthniaoelnr.dpahirenaasalidttehequcianotvneetsrtvoielgtaeptrriioongnarrrayemcvsaeradeli.eddanndodetfliaacpcipekenaocrfieftsloyihncaohvnteerroadl.smuabTnshtaagenetlmiaaeclnktio,mfpiavncacctlcuiodnnianttghiiopsnooarnd relatively isolated herd. eDveisdpietneceoanfteoxxhiacuisttyivaessroecviiaetwedofwihtishtocrhiecmailcaanldccoonnttaemimnpaotriaornyohfertdhedaetnav,irtohnemreenwta.s no 039cin : DUP 245 Tennant Fam Herd Heat Invesigaion 11 Signatures Cate Team Report pa Hobecho Perry L_Habecker, VMD, Dipl. ACVP (223/45 Date Lx & Ae LAU, isa B. Davis-Heller, DVM 12/50/65 Dad' SM een Peter G. Moisan, DVM, Dipl. ACVP, ABVP CAN ve Robert J. Murison, VMD DA E -- RobertH. Poppenga, DVM. PhD, Dipl. ABVT CSrTm lSeS Greg P. Sykes. VMD, Dipl. ACVP, ABT ues Date 13 joc Date . el Date 3.33 Date 06a. DUP 246 s Teanan Farm Herd Health nsestigation Cate Team Report 2.0 INTRODUCTION `cTahueleobnjeercdtiavnedofdettheisrmiinnveesptoisgsaitbiloen cwaaussteos eovfaalnuaytpertohbelehmesal.thTshteatiunsvoesftMirg.atiEoanrlinTcelnuadnedt'asn edaxtaa.minTahteioinnvoefstrieglaetviaonnt theirstmoirniactaelddaitnathaes pwreoldluacstitohne coofltlheicstiroenpoarn,dwehviacluhaotuitolninoefsnsetwudy findings and makes recommendations to improve herd health 3.0 METHODS 31 Cattle Team LL Members `("TehaetiTleennteaanmt")F.arTmheHetredamHewaalsthcoInnsvteisttuitgaetdi1o0n iwnacsluadesseixgpneerdtitsoeaitnebaomvoifnesidxisveeatseersi.nhareiradns hDeuaPlothntmaCnoamgpeamneynt(.DtuoPxoincto)losgeyl.ecptaetdhotlhorgeye.maenmdbewirlsdl(iDfres.diSsyeakseess,. DaRveipsr-eHseelnlteart.ivMeosiosfatnh)e: trherpereesmeentmabteivresso(fDrst.heHUanbietcekderS.taPtoepspEennvgai,ronMmuennstoanl).ProAtbebcrteivoinaAtgedenCcuyrr(iEcPuAl)umseVlietcateeodf the cattie team members are included in this report (Appendix A) Cautle Team Perry Habeier, VNID Dip ACVP | ChiefT.oLuaircgoeloAgym.mUanlis.PafooflPoegnyn.. LSchaoob! oofrVoeatfetrFiantoahraryiogys snd Ts Dov Hetier BUNT | PravaMwteeycp_riancet,ionNeerw.Bio.ltMoanryC'esntVeert,erKienanrnyerClSiqnu.areS.t PMA.ares PeterANBiVorEan, OVA. Dit Robert Muon VAD ACVP. Dipl | VeterLiinbaorrystPaotrhsol(osgaitee.IRsobolrlamtsorAv)n,iRmoalelygBhr,scsNsCe. Diagnosis Field Inesigator. Centerfor Animal Health 3nd Producti | Unsivq.uowfePpesnn ScohfVoeteorinlary Medicine. Kennett RaberA:BeTppens DVL PRD Dift. | Chit.UnTio.xiocofloPgeyn.n.SLcahoboloofVreotafePrthinooatrryogyMedaicnidneT,oxNiecwol GregAS5yTkes. VNID. Dipl. ACV. Dipl | PatholBoogliisto.n CSearfneetry. AKsesensnsemtentS,quaDrue,PoPnAt. PRarmacearcaly Company. SineResearch Center. Newark.DE. DDDiiVppMll.AAVCBVAVPD === DDDioipcpltlooomrmaotaefs.:VAAemmeerrriycaannMCBeodlioeoenfaoVfetVreerirndearnyaPrPiacbelo(Fgososd Animal and Beet tleSpcisiss DDiIpl AABCTVT == DDiipplloommsaitee., AAmmeerriiccaasCBololsegeofofToVentceoriinoatryy Touclogis ASctietnhteiffiicrstLemaedeetri(n2go.ftchheaicramttalne)taenadm G(rMeagrcShyk9.es19w9a9s),elPeecrtreydHCaoboerdcikneartowra,s Tehlee.cted 0006S 6 DUP 247 Tennant Farm Herd Health Instigation Cate Team Report clehaadierrsm,anDras.ndScaoroarhdiCnaastpoarrw(eErPeAi,nsRierguictoend I(I0I)caonmdmuRnailcphatSetawhilth(DtuhPe o"nStteCeorripngorcaotmemitee" RMeimkeediHaotrinoen(GUrSoFuWpS))a,.s MnaeredkedS.preThnigser"s(tEePerAi-nOgEcRoRm)mi,ttaened"RiuncdlyudVealdenDtrsi.neC(aDspuaPro,ntSt-ahl, Specialities Chemicals toxicologis). 3.1.2. Cattle Team Meetings The cane team met formally on four occasions, including the Tennant Farm site visit Cattle Team Meetings March 5.795 New Bolion Center. Kenner Square. PA TireIsting premeen Fare svn LFORESY Inn. Pakersburg. WY In addition. among Drs. sHeavbeercakleirn.-pMeurnssonond.isPcoupspsieonngsa.toaonkdpSlayckeesatbNetewweeBnolMtaorncChen1t9e9r9baentdwetehne and issuanceofthis report. and US postal systems foArllpcaiartlaendtegarmoumpemdibsecrusssuitoinlsizaenddthienftoerlmeapthioonne,shianrtienrgn.et email 32. Animal Data 32.1. Videotapes Ttawpoesvwiadseoatacpoelslewcetiroensoufppvliideedottaoptehsemcaadttel,e atnedamnabryrattneed.stbeyerMirn.g cEoarmlmiTtetnene.antEaocnhhoifs ftaherm and the adjacent different seasons. landfill area. it appeared thAalttthhoeusgehttahpeestawpeersewaellrepreodidtuecdedanbdetiwnceleunde19m9at5erainadl from 1997 Tennant Toe | Farm Videotapes Te FT [| TennianoteFarm: New England. Wood County. WV - January snd Febras FE] 0%wRevn Fs PC. Wood Co OF Nort Fork of as Ceak New Engand. ANnuimmbaelrsCoxe | 1-15 | 1060 Bothofthese tapes were viewed. in their entirety. by the cattle team members iHsniedcliklvecirdouwnaoslt.lyp.wreesrTeenhtee)v.yalwuAearteteodt.aallslooifre6em0vsiaoennwiemtdhaelattcaaapsceeassu.tlhreaattnegwaienmrgemfneroeottmiannagidmoeanaldJrucelrlyaayt2ef8di"s(he(.Dtgro..,gwrDaoatuveiprss-of theraelatthmednatt)awdeerreivneodtefdrobmutthneosteetvaaplesu.ateTdh.isTatabbllee d|iosesa ncootmpiinlcaltuidoenmoafntyheasrseelretviaonntsaannidmal : ' 0ODnLT DUP 248 Tennant Farm Herd Health Investigation Cate Team Repo interpretations. be incomplete made by the or erroneous narrator in the tapes, which the team members considered to 3.2.2. Diagnostic Pathology Reports Tcowmomiptaeteh.oloBgoytrhepwoerrtes i(sAspupeednbdyixstBa)tewaenriemaslupdpilaigendosttoitchelacbaotrtalteortieeasmibnyretshpeosntseeertiongthe submission feviewed by of dead animals the catle team. or tissues from the Tennant Farm. These reports were oAf tohnierdapnaitmhaollo(g+y37r)eoponrtJ(uAnpepe10n,di1x999B.) wTahsecpartotdluecceodmsmuibtsteeqeuednectitdoedt,heatelaemceteivteisnagcroinfice oMnaeyor25.tw1o9o9l9d,etrhactowist.woMurl.d Tbeeninnafnotrmwaatsivaes(k0edhatvoesealtecotxiocnoeloogrytswcoreoeftnhoen ctaitstslueesthfatrohme ccoonwsitdheatrehdadtofbreesihnetnheedwaorfsetwmcoonndtihtsione.arliHeer.chTohsiestaonsiamcarlifwicaesceouwth#an3i7z.ead Tb-yvegaurnsohlodtrbedy prMre.seTnecnenoafntoDrn. Dtahveisf-aHremlloenr.JTuinsesu1e0.s 1w9e99r.ecoMlrle.ctTeednna(Dnrt. pDearvfiosr-mHeedlltehre) dissection for in the histopathology and analytical toxicology. IPnadiiisoigdsuaRlepoArtni|mal Pathology Reports Nameof Diagnoste Liboratory I Case Mawral Die | Stores 10. 1997 | Animal Disease Diagnostic Laboratory, OMG (ase numbers G63 mont3 hold bull si Nar 12.1997 || AmaDleoHuenamltehnDtioafgnAossrtciucluLraebo.raRtoervyn.olCoslbluergee, oOfH_||*Wocsruie7s-7s:e9a7rold Hoffer soo To ET] || Canerss. Lansing MI Caborsons of Large Amal Paelogs and su(e1s7992s5e7a1r)-oldHolsiin con sues 7-vear-old con ||_ TPoeunincsoyllovsasn.ia,NeKwenBnoelttoSnouCsermeer.PaUniversitoyf| (+UP9S02702: L#99014371 3.2.3. April 1999 Site Visit Data Tahnde 8c. at19e99teianmorvdiseirtetdo ctohlelTecetnndaatnataFnadrmbioalnodgiacdajlacseanmtplDersyrReulenvalnatndtfoiltlhesiheeordn hAeparlitlh7 aitnvtehsetiPgaatrikoenr.sbuBregfoHroeliprdoacyeIendnindgutrointghewhsiitcehontheApDrrily TRtuh,naSabfreietfysPalfaenty(mAepepteinndgixwaCs) hwealsd Hreovrienweeda.ndT2heU6SFcaWuSleetmepalmoymeeemsbewresr,e 2 of the present. steering committee members (Caspar. il 7.1999 Tgrhaezincga.tleantdeainmtehravdiepwlaMnrn.edTetnoniannstpeocnt tthhee faafrtmemaonodnaodfjaWceedntnelasnddfaiyll,Apvriielw7.theHhoewredver, 00 25093 5 DUP 249 Tennans Farm Herd Health Investigation Cate Team Repan dmuoreni10n3g.miWsuhnednertshteancdatitnlge.tMera.m TaenndnEanPtAh/aUdScForWrSallpeedrshoinsneenltiarrerihveerddaotnapWperdonxeismdataeyly s5e:v1e5raPlMh.outrhse.heTrhdehtaedabmeethnerceofnotraeineeledctinedatsomcaollndeuncctlotshuerei,ndwiivtihdouault afnoiomdaolrewxaatmeirn,aftoirons ainnsdtaslpleedcinmeextn tcooltlheecteinocnlsosiumrmeedtoiatfaecliyl.itatAe anneiwmahleahda-ndhloilndg.resMtrrk.inEtardlevTiecnenhaandt baenednhis brother device were very helpful in handling the cattle and moving them into the restraint The 41 halter, aandduletxacamtitnleedw.ereEaicnhdiavdiudlutal(l3y8 run into cows, 2 the chute, bulls, and secured 1 steer) with was the head hold and given a general a cpohnydsiitciaoln.exaanmdineasttiimoantiinocnloufdianggeobbasseerdvaotniotnheofingcriossosrsa.bnBolromaolditwiaess,coglrlaedcitnegd obfybjoudguylar svaemnpipluensctwuerree (r2ecrteadll(y0pc.ol|legcrteeedn top. from and | each lavender top adult. Cows twbes) from were rectally each cow palpated and to fecal dwiettheramniniedetnthiefiicparteigonnannucmybsetratausn.d All one ewxiatmhiannedimapdrueltgnaantiemdalisnsercetcieciivdeed. two ear tags. one One Hereford Gpaolwpa(tiico.n..tbhleo3od9coclolwecti4o2n. aandudlte)arestacgagpiendg.the chute prior to examination. aging. uierine pEhaocthogadrualpthsbo1v-i3n2e) was individually photographed and identified (Appendix D. Only est. wI acsoiwnc(iasneidmaalnd#2dr2a1irneecde(ivAepdpetnrdeaitxmeDn.t p-ho2tmoagsrsa.phmso4s9t-5c1o)n.sistent with a dermoid Aadndiimtailon"alelspiohnostogorbaspehrsveodf the on farm April 7(.Ap1p9e9n9d(iAxppD.enpdhioxtoDg.,rapphhotso4g3:. 54-58), individual .phs 44-48. 52, 53. p2hpohtootgorgarpahpshsoufppclatiteldettoetahme atnedamsbteyeMrirn.g cToemnmniatnttee(Ampepmebnedirns D(.ApppheontdoigxraDp,hsph60o-t6o5g)r.apahnd 66) are also included in this report = Adult Cattlee vPraocnedures Teel ample cllecion seamen rcechtalmperaesgunraenmceyntexamination. T [ee araapssseedd:iansnemctailciedenim shotographed | Twelve calves tags: the larger were five examined as a received no ear group. tags as The Mr. smaller seven received Tennant indicated that insecticidal they were (o ear be sold in the very near foture. cAaltteh.outghhe ttheeacmatdtelceitdeeadmthwaatsthperreepawraesd n1o0 daoniamaplosstuf-fmiocritenetmlyexilalmtionjautsitiofnyoenutohnaenaosriamoarned necropsy at the time of the visi. 009521 DUP 250 5 Temas Fem Herd Healt Iesigarion Cote Team Repors bAlylDarn.iHmaablebcikoelro.gicBallosoadmpslaemspl(ebslowoedreansdubfjeeccetse)dwteorheetmaakteonlobgayc,k steorNuemwchBeomilsttorny.Ceanntedr serology. Randomly selected fecal samples were subjected to fecal flotation. The following clinical pathology parameters were evaluated: Hematology [obcleiom eidncceil ddiissrbibuwiioonn wwiadtnh C Thess pm arameterse ers sm ued sp g hen mesear1 edd do-- e A giy me Serum Chemistry CcrosmisncSinanem ansieoss Slo ures nein TcaHcorudme masnesm oun lseepnunionzer ] <T= oBbRaS 5neSarIed froombToEnmdpelaesmra dUeemd fro8moElDTpArWoensvdeandetpr) [ovSnersolTogey rem vm er |conooneemoron Gusmeofdeer and TET Son[ehevrosnsGarbao anres mor cla 5-11 = rom nen EE Jlepaiimoieons Gar (TS rope ss: (379) S S50 ET Immenoditun te April 8, 1999 (Appendix E. Three membersof the cattle team (Drs. Moisan, Munson, and Davis-Heller) met with Mr. Earl Tennant and recorded his recollection of the 1998-1999 herd health history Drs. Caspar and Horne gave allof the cattle team members a driving tour of the property DbuertiwnegenthtohseeT(en0narnitps.barthneatnedatmhemeDmrbyeRrusnwlearnedfialbll,eionclsueeditnhgeacodrninveectwiintghipnastthuerelasndfill. 009525 "0 DUP 251 Tennan Fain Herd Health Inestigation Carle Team Reporc abdejiancgenutticlriezeekds.at tnheeigthibmoeorifntghceastietegvriaszii.ng. and wildlife. The landfill was open and iWnhcilluedionng stihtee,ftlohrea.caftaluena.teaanmdmmaadne-gmeandeeralstroubcsteurrevsa.tioCnosreresgaamrpdilnegs tohfetehnrveierloanrmgeenrto,und hthaeytbeaalmesswoemreerceocleliepcttsed(a(t3essamrpalnegse/dbaflreo)mf2r/o9m8 btaole1s2/i9n8)thferboamrncoymaprdl.eteM,r.miTxeendnafneted,gaavned mineral supplement he had purchased. tAollnuptlrainttiobniaolloagniaclaylsissambypltehse (Fboarialegde hTaeystcionrgeLsaabmoprlaetsoraynodfgtrhaeinNosratmhplCea)rowleirneasubjected pDreopgarrammen(tCoNfCAPgSrivcu3l.t1u)rfero(mTaCbolren7e)l.l TUhnievseersdiattya twoereveaulusaetdeitnhaendiEextcseilnstpwroeacdoshweemtodels under two feeding situations (Appendix F. models 1-4). Toe following nutritional parameters were evaluated: HaySnanmdeGrrain Analysis Tmoencsum uennidloblreopron Tpoususlsphiurom acdiudsdieetdercsreantte ievveran T croopnoer oulwdseesinble nirozen pnmanganese | E esttum ySn| umer Thien ee ------_| 324. Miscellancous Dawa DDru.riSnagrathheCasistpeavrisiifttihnerAeprwile.reMra.nyTefnutnuarnetswiganssoafskdeidsetaosneotpirfoybDlre.msLiisnahDisavhiesr-d.HelTlheer otream owfisthheedTeionncaolnltechterwdhatever data might be relevant (0 their assessment of the health status Between April and December Heller. Subsequent to notifying 23. Dr. 1C9a9s9p.arMro.f TaennenwabnotrcnoncsaullftwehditcwhicweaswibtohrnDr.wiDtahvais- "Drc.loDuadvyise-yHee"l.lMerr.exTaenmniannetdbtrhoeucgahltf athned cmaalfdetoaDrd.iaDganvoissi-s.HelMlre.r'Tsenclniannict(lAepftriwlit2h1.th1e99ca9l,f. On May 26. mandible. 1999. Dr. Davis-Heller examined cow #30 for a lump under the right 009525 n DUP 252 Tennant Farm Herd Healt Inesigation Caile Team Report 325. Wildlife EPA small and DuPont each mammals in the sponsored environmental studies that grazing fields of Mr. Tenant's cattle. included the trapping of These reports were supplied 0reltahteesca(t0tlsematlelammabmymtahle sptaetehroilngogcyo,mmwietrteeeev.alTuhaeteddatbay itnhcelcuadetdeitnetahme.se reports. as it Small Mammal Studies Nonvatetmyber. 1997| Dry RViuensCivrae,ekUSWaEsPhiAnEgntvoinr.onWmoeontdaClouRnetsyp,onWseest | F3H5i1st39o:paRtoelogsy aoffor the December 3. Team | Smal Mammal Trapping Effor. Dry Kun Landfil.| TaMbeiaId: oDwaVoSleummary Smal 1998 fevers | WCaistheiagsiuosne,) WY (URS Greiner Woodard Stamml Tnvergon TDrh.eCcratutmle atnedamaswsoacsiaatlesso omfadthee aWweasrteVoifrgpienriiaodDiecpdaeretrmerenptroodfuNcattiuornalsuRrevseoyusrccoensd(ucWtVe.d by DNRyin the Dry Run arez. however no reports were available. 4.0 RESULTS 41 Cale 411 Videotapes (Tudiz i) wTiwldolivfiedesocteanpeesswoefresevpersess!eaiheodu.rsdedpuircattiinogn nwuemreerroeuvsielweesdi.ons.ForTthyeciantdeivsidcueanlesscaenneds 2t0i. cases). along with the catiie team's order in which they were =-esented diniatghneovsiidse/octaopmemse.nt.ThaerehperredsehneatletdhipnrToabblleems1 in the identified in these videos ere summarized as follows: 1. Kerautis: observed in Cornea! ulcers, scars and opacitieass, many care. These were all considered wellasblepharospasm. to be manifestations of were "bopviinsk.eyTeh".e afnaceifnlfyec(tiMouussckaeraauttocuonnajluincst)ivpirtoibslceamusoebdsebryvebdacitnertihaesseucvhidaesosMoarnedxetlhlea ainctkhoefseefcfaetclet.iveAfflfyecctoendtryolouwnegreancdonasdiuslttenctatwtilethwethree doibasgenrovseidsotfo sheavveere2-"3pitn0k2ey5e-'50 osercrmeotrioensf.aceFfiligeusrefsee|dianngda2t atrhee pmreidnitaslfcraonmtvhiudsoeoftaepaech#2e,yeillaunsdtroatnintghethleacfraicmefally cphrroobnliecmkoernataoccoanljfuannctdivhietrisd.am,Firgeusrpeec3ti(vveildye.otBaopteh#2o)f tdheemsoensatnriamtaelss awnereearbllyicnedntfrraolm corneal ulcer on the left eyeof acalf: aceflies are seen by the lower eyelid. 00:24 [i DUP 253 Tennar Farm Herd Hesih Inestigation Cate Team Report 2p.robHlaeimr.losTs,heneaclkopaencida otail:bserTvheedcoenrvitchaeltaaillosopefcisaomweascamtotslet(ce.ogn.silsotsesntofwi"tshwaitlciche) may also have been due to lice. or may have been related to fescue mycotoxicity. 3a. ndPsouormmseherdsdienggmoefnhtsaiorf ctohaetsv:ide`Tohtiaspecsli.nii caclonssigins,temnotswtitphrommuilnteipnlteinnutthietiloantealspring cvaifdiecoiteanpceie#s2atshwatelwlaassdfeessccruiebemdycboytoMxri.coTseinsn.anFtigausrhea4vidnegmodnesltaryaetdesshaedcdoiwngforfomthe winter coat. +o.fteHnaiarssdoecpiiaetmeedntwaittihona:nutTrhiteiodniaslcodleofriactiieonncoy.fatnhed cisaetstlpeechiaairllcyoactosmimsoanchianncgaesemsosotf copper deficiency. 5f.esCcoureonmiytcios:toviAcloospiesc.iameacnhdaneircyatlhetmraauamba.oveortahse coronary band 2 non-specific may be seen with dermatitis. Figures 5 abyndMr6.(vTiednenoatnatpein#2m)aanryeorfephriessecnattaet.iveFoifgtuhreee7sryatnhe8dma(tvoiudseoftoaoptele#s2i)on) sdoembosnesrtvreadte tFheesccuaetlme'yscoptroexfiecroesnicse (f"orfesstcaunedifnogoti"n) twhaeswcaotnesriwdehreend tthheesemolsetsiloinkselwyerdeiapgrneosseinst.of this condition 6a.od"oHmuinnaclheodf ufopo opraipn.ainbfuutlhsatsanbcee:enTshpiescifisicaalcllyindiecaslcrsiibgendofastean maasnsiofceisattaetdiownitohf the fescue endophye toxicity complex c~.aseTshipnrebsoenctecdomndoisttiolni:kelPyoorrepbreosdeyntceodnddiiffifoenrenist aetnioonl-ogsipeesc.ifiTchfeinedmiancgiaatnedd tdheead cdailafrrwhietah osrermoausstiactartoipohnypraopbpleeamrss.toChoanvseidsetrairnvgedthwehiolteheorthfeirnsdianpgpseainr tthoishahveredh(aed.q. lfiekeedlyancaolnytsirsi)b.utniuntgriftaicotnoarl tionspuofofricbioedncsyc(onpdriottieoinn.-energy malnutrition) was also a Sproombaeslfyindwienrges rdeeaslc.riFboerdeixnatmhpelsee.ttahpeesdewsecrreibdeidff"icluultmptso"evianlauactoewbuyddveidre(ocaalseth#ou5g4h)twhaeys dwiefrfiecudletsctorisbeeedbaust"whouunlcdhebde-ucopn"siodre"rheudmapnedin-cuipde"nt(aclasfeisn#din1.g5i,n 1a7n)y-catshee.seAmafeywhcavaete been related to mycotoxicosis. lameness, hardware or other condition. disease (traumatic An individual cow reticulopericarditis), that was slobbering, fescue losing cud. and was urinating not clear. (Acnaoseth#er13i)ndmiaviyduaallsochoawve(chaased #ha4r5d)wwarheicdhisweaasse,paanlttihnogugwhatshecodnisaigsntoenstiswith wfeasscuGeenmayicnoltyoxnoinc-osspiesci(fi.icc... "summer fescue hyperthermia), although this presentation 069621 DUP 254 ts Tennars Farm Herd Health Investigation Cate Team Report 4.1.2. Diagnostic Pathology Reports (Appendix B) Oofnlsyomfeourtyopef. MrT.heTemnonsatnts'isgnciaftitclaentwefriendsiunbgmiwtatsedmofdoerrpaotset-tomomratrekmeddicaognpopsetricdeefviacliueantciyonin the three cows analyzed was formally necropsied. forThhiesav6y-mmoenttalhs.oldKebrualtlictailsfwaapspaorbesnetrlvyeddieind tfhreoomnlwyinatneirmal that sutnatrrveaattieodni(nit.e.s.tinneaglactoicvceideinoesirsg.y bTahleasnecereoproprrtsotaerien-ienncelrugdyedmailnnAutprpietnidoin)xcBo:mpsluimcmaatreidebsy are presented below: a. Dead 6-month old bull Laboratory. Ohio Department calf submitted of Agriculture, to the Animal Disease Reynoldsburg. OH on Diagnostic 2/27/97: Laboratory report dated 3-10-97 (Appendix B) History Gross diagnosis: Histopathologic diagnosis: 6-momnotnhtho:ldrebcuellivceadlfn;ounmeddeircwaetiigohnt:; cdoiranrerahleaopfaocriotinees: died Emaciation with serous atrophy of fat Intestinal parasitism (trichuriasis) Entericcoccidiosis Kezatiis, moderate, chronic. focally extensive bD.iagnostTiicssLuaebsorfartoomrya.4C-oyleiaersoeldofHoVlestteeriinnacroywMesduibcmiintet.edMtiochtihegaAnniSmtaatle HUenailvterhsity. Lansing MI on 374/97; Laboratory report dated 3-12.97 (Appendix By History 4-yeoawrnoelrd:Htoilssstueeisnsucobwm;itdeidedby2-E18P-9A7: dissected by Heavy meta! screen Copper deficiency in liver (1.9 ppm vs. 25-150 reference range) and kidney (2.37 ppm vs. 4 = 6 opm reference range). Mangwaasnessleighwtalsy imnacrrgeiansaeldlyinltohwe iknidlniveeyr: cadmium No heavy metals found in urine (urine fluoride was 6.6 ug/mi){reference range: toxic if 2 14 pg/mL] DiagnosTtiiscsLuaebsorfartoomrya.9C-oylealregoeldofHoVlestteeriinnacroywMesduibcmiintet.edMtiochtihegaAnniSmtaatle HUenailvterhsity. Lansing MI on 3/4/97: Laboratory report dated 3-12-97 (Appendix B) History 9-year old owner; Holstein cow; died 3-2:97, tissues submitted by EPA dissected by 085: DUP 255 Tennsns Form Herd Health Insigaion Care Team Repor Histopathologic diagnosis: Heavy metal screen: Clinical pathology (only hear, liver, and kidneys submitted: autolysis and freeze/thaw artifact) Myocardial sarcocysts Coppreefrerdeenfciecireanncgye)inalnidvekri(d2n.e0y3 (p2p.3m3vps.pm25v-s.1540- 6 Manpgapnmesreefewraesncmearrganignea)l.ly low in liver; iron was, elevated in the liver: cadmium was slightly increased inthe kidney. Urine heavy metals were normal (urine fluoride was. 5.55 uglmi){reference range: toxic if = 14 ug/mL] No significant findings d. `Tissues from a Tennant) submitied to t7h-eyeLaarboorladtroerdycoofwLa(reguethAanniizmeadloPnat6h/1o0l/o9g9y and and dTiosxsieccotleodgbyy Mr. School of Veterinary Medicine. University of Pennsylvania. Kennett Square. PA on 6/27/99: Laboratory report dated 7-35-99 (Appendix B) History Histopathologic disgnosis: Heavy metal screen: 7-year old owner: red cow: euthanized 6-10-99; dissected tissues submitted by Dr. Davis-Heller. by Enteric lesions of minimal significance {forestomach, asbasrcceoscsyessi:s)intestinal coccidiosis: myocardial Coppreefredreefnicceiernacnyge).inliver (7.71 ppm vs. 25-150 4.1.3. April 1999 Site Visit Data a Herd History (Appendix E) The herd history (Appendix E) was based on Mr. Tennant' recollections during the interview on April 8, 1999. A written record of herd health was conspicuously absent Muchofthis can be auributed (0 the lack of outside intervention. There is no record of veterinary care or consultation with an animal nutritionist. Minimal medications have been used Excepefor on these the few animals. animals and the noted in re has been no this document use (se of vaccines e Diagnostic or modern Pathology dewormers Reports. above), no diagnostic herd management has laboratory tests were done on dead animals. The not changed since the installation of the landfill levelofcaule 0095s DUP 256 BE Tennant Farm Herd Health Insesigation b. Physical Examination (Table 2) Cate Team Repon ObunllsA.prainld7.| a1d9u9l9t,sttheeerca(uTlaebltee2a)m. eExsatmiimnaetded4a1geasnifmoarlst,heinadcullutdicnogw3s8raadnugletdcofwrso,m 23 atdoult gbreeaotledrerthtahnar99yyeeaarrss., TThwiesntiys-asheevrednof(27a/g3e8d)ccaotlwes; w3e2roefptrheegn3a8ntc.ows were estimated to Body Condition Scores aBvoedryagceonsdciotrieownassco3r.e5s((3B=CthSi)n,w4e=rbeorbdaesreldinoen,a5-17-9issccaolnes.iSdceorreedsorptainmguemd)f.rom 2 o 7; the Clinical Signs iHnacilrucsoiaotnscbynso:rmthaaltitwiaess lwaenrceedevainddenetmpitnie9do.f tMeam41macaruyleg.laOnndeluamnpism,alcohnasdisatnenetpiwdietrhmal c(hsrcoanricussmuaest.itiRs.ectwaelreexianmtienraprteitoendoafsaobnsececsoswessourggaestcedcthue pmresuoenfclfeooarfotuinstciroan-onaebcndtoimsvineal fat necrosis Clinical Pathology (Tables 36; Graph 1) Hemstologs Eanriymtahivsonw(eTraeblceon3s:ideRreedd abnleomoidc,cell indices were generally in the low-normal range. No LDiefofkeroesnt(iTaalbcleell21c:ounTthsewteortaelcwohnistiedebrleododincvealllicdoduunetstowetrhee 3w6ithhoiunrthdeelnaoyrmbaeltwreaennge. collection and tesing. Clinica! chemistre (Table $1 Mwiotshtmeilledctdreohlyydteravtailonu.es wSeirnceeinthtehecahtilgeh-wneorremapleatnoesdlidguhrtilnygeltehveadtaeydlirgahntgeh,ocuornssiosfteAnptril 7. wunheixcphecwtaeds.unDseehaysdornaabtliyonwaisraml.soatnhdehmaodstnoliakcecleysesxtpolawnaatteiro,nclfionrictahle deleehvyadtreadticorneawtiansinneotin 40/31 cate. dMioasgtno(s2i7s/o4f1d)eohfydthreatcaitotnle(thoatdaleplreovtaetiend =togtallobpurloitneifn,rawcthiiocnh+alaslobucmorirnelfartacetsiohni)g.hlyInwailltha ctahtetlreef(e41r/e4n1c)etrhanegeg.lobulin fraction was elevated while the albumin fraction was within [LEE 0 DUP 257 Tennant Farm Herd Heal Inesugsuon Caule Team Report Gamma glutamylransferase (GGT). a sensitive indicatorofactive liver disease, was cmounsscilsetennetclryoswiist.hiwnasthealnsoornmoarlmarelfeinreanlcleofratnhgee.catCtlree.atHinoewekvienars,ea(sCpKar)t.ataen indicator of mamiinniomtarlalnysfeelreavsaete(dAiSnT)3,3/a41lecsasusleen.siTthiivse miingdihctatboerforfolmivleeruaknodcymtuesdcilsesodleugteinone,ratthieonr,eswulatsof the 36 hour interval between blood collection and testing. Specialchemistry. Prolactin: `According Plasma prolactin levels to the testing laboratory (Table 4 and Graph 1) were significantly depressed. (Dr. Neal Schrick, UniversityofTennessee). an average prolactin level for cattle on fescue-free pasture (for April) was 171.6 micrograms/liter Tennant samples (ng/mL) (ie.. reference mean = was 110.1 ng/mL and 36/41 of 171.6 ng/mL). The average of the the Tennant cattle were below the 41 reenfdeorpehnyctee-mienafenct(e1d71f.e6sncuge/m(Ls)i.mulIantceodntbryasetr.gaontaamvienreagteartprraotleacatdimninliesvterlaftoironc)atwtlaeson105.8 ng/mL (data from Dr. Schrick). This average was similar to the Tennant herd average (110.1 ng/mL) and 24/31 of the cattle were below this reference level (105.8 ng/mL). According to Dr. the Tennant herd. Schrick. these findings were highly supportive of endophyte toxicity in Copper: Blood copper copper assay was below levels were in the deficient the limit of detection. range for 26of41 animals: one Selenium: Blood seleniurs levels were normal fo4r1 of41 cattle. Pepsinogen: Pepsinogen. 3 blood enzyme indicator of parasite damage to the anboormmaasurme.ferweanscemreaansgeu.redThiense10dcaotwas.supopnoertsetederthaencdonocnleusbuilol.n All that values were within the sbomasal ostertagiasi was not 2 problem in adult cae in this herd. Serologs (Table 6) BLV(Bovine Leukemia Virus) Johne's (Mucobacierium paratuberculosis antigen) Brucella BBVVDD (MBiocrvoipnleatVeirAusssDaiyar(rvhireeamainatidgeetne)ction) Bluetongue LEeHptDostpyiprea2in(tEeprirzoogoatnisc (H5esmuobrvrahriaegtiicesD)isease of deer) 1/31 positive [1/214 positive 2/41 positive a1 ol 3/41 positive 2/12 positive NLeopnteoosfptirhaemsiegrholoregfylevcatlureessidsuuaglgevsatcecdinaathieornd-tiwtiedrse problem. Positive titers in purchased animals or for BVD natural and exposure (0 this disease these diseases. has been in the The local discovery of two deer population positive EHD titers was evidence that 008530 DUP 258 1 Tennant Fasm Herd Health Investigation Cate Team Report Parasitology Routine samples. fecal The flotation (Table 4) magnitude of ova revealed shedding parasite ova in 11 of could be categorized 14 as randomly selected rare to moderate fecal pPaarsaassiitteisgmrowuapss niontclcuodnesdidceorcecdidtioa,betaapmeawjoorrmsh,eradndprsotbrloengmyline-tthyepeadnueltmactaottdlees..ThIen.testinal sheddingof small numbers of oocysts and helminth ova is expected of mature cattle, d. Hayand Grain Analysis (Table 7) rDeugrairndgintghehecartdtlfeeetdeianmg'sprvaicstiitcteos.thTehTreenenalanrtgefarromun(d4/b8a/l9e9s),oMfrh.ayTeinnntahnetbwaamsyairndt,erviewed (i3d/ebnatlief)iewdearserceoplrleescetnetdatfiovreaonfaltyhseish.erTdh'sisfofroargaeg,ew(eire.e, vhiasyu,alglryasisn/sfpeescctueed) awnadscfoerdeasdamples libitum, During the hay tahpepesiatreevdis1i0t,bfeohraiggeh quality was and forage asnuabljyescitsiv(eTlaybleeva7l)ualatteedr as poor. The substantiated fiber that level of observation. feed can be Fiber levels of consumed. Dry forage matter play an intake (iDmMpIor)taisntinrvoelreseinlyderetleartmeidntiongfihbeorwlemveulcs.h oaf pAocucnorddsipnegrthoeMard.peTrendnaaynto,fmaagtruarien amniixmaclosm,poonsethde oTfendrnyanetarfacromrn,,wseoryebealasno mfeeadl,fivaend omifntehriaslfsee(datweascotualkdennoatnbdeavnaalliydzaetde.d, despite the existence of grain receipts). A sample eAvnalEuxacteelthseprdeiaetdss.heUestinpgrotghreafmor(aCgeNCaPndSgvra3i.n1)nuftrroitmioCnoarlnealnlalUynsiisvecrosnidtuycwtaesd buysetdheto tFowroamgoedTeelsstifnogr mLaabtourraetcoroywsof(etahrelyNolratchtaCtiaornolainndadDreypparretgmneanntto)fweArgerisceulletcutreed(tToaeblxeam7i),ne the current feeding program (Appendix F). According to 1999 fed five tphoeucnodmspouftethrismogdraeilns,anadcforweeicnheoaircley lactation hay was (model #1) in the in severe negative spring energy of rbeaqluainrceeme(n7t2)..5%Thoef rleiqmuiitredemneunttr)ieanntsd alveasislsaebvleerweopurlodtehinavdeefaicnieegnactyiv(e90im.p9a%ctofon milk wprooudludctrieoqnu,irpeer2s.i4stteinmceysotfheprcoodrunctciuornr,enatnlyd bceailfnggrfoewdtht.o bAe icsoocwaluonrdiecr(mthoidsefle#e2d)i.ng system nSiemgialtairvley.enaedrrgyy pbraelgannacnet(c7o5w.2(%moofderleq#u3i)reimnetnhte)sbaumtenofteeddeifnigcisenytstienmprwootueilnd(a1l2s5o%b)e. inThe nseagmaetidvreyepnreerggnyanbtalcaonwcem(a8x7i.m7i%z)i.ng dry matter intake (model #4) would still be in 008500 DUP 259 1' Tennan Farm Herd Health Inestigaton Cate Team Repose `tThheedbieotsd.y cTohnediitmipoancstcoofrtehse(BpCoSosrq)uaolfittyhe hfoerradgeweornetchoinssifsatremntanwditshubtsheeqeuneenrtgyendeerfigcyit of deficits pasture. were considered to have chronic effects well after the cows ret to adequate 42. Miscellaneous Data Following suspected the sick site visit. animal. Mr. Mr. Tennant Tennant consulted with Dr. broaucaglfhwitth Davis-Heller regarding 2 2 "cloudy eye" to Dr. Davis- tHheelrleerw'assclnionitchi(nAgprwirlo2n1g, w1i99t9h).theDre.veD,aevxicse-pHtelfloerraesxlaigmhitnmeudctohiedcaelxfudaantdedoentetrhmeinceodmethaat which was easily wiped away. On May 26. 1999. Dr. mandible. The lesion Davis-Heller was aspirated examined (pus) and cow #30 for a lump subsequently lanced. under the right 43. Wildlife 43.1. Videotapes (Table 1) T(chaese2#0 4w9i)l.dloiffencoadsieasgpnroessteinctveadluien. thTehevisdeeowtearpeesalwlecroensailldedreeaddtaonbde. ienxcciedpetntfaolrdoenaethcsase sdeiantches.theIrne fdaicdt.ntohtesaeppdeeaarthtso abpepaenayrecdontsoibsetemnocsytincotnhseisstpeecnitesw.itlhoctahteiorna.nodromtiwmiinlgdoef the c#a4r9c)aswshesicwhhipcrheswenotuelddwbiethfohuenmdorirnhaagheealftrhoym ecosystem. the nostrils The may individual have died dead from deer (case epizootic ohfemtohirsrhdaisgeiacsediisnealsoceal(EdHeDeIr.(pTerhsiosnadliacgonmomsuinsiwcoautlidonc:orDrre. spCornudmwitothDrt.heSkykneosw)naenxdisttheence finding of some EHD seropositive catle in the Tennant herd. 4.3.2. Small Mammal Data Tshwroewpsa.thaonldogmiisctes)rceavpiteuwreedd tohne tlhieveTreannndanKtidpnreoypehritsytoilnog1y99f7ro(mUS45EPsmAalElnvriordeonntmsen(tvoalles, RTaebslpeon3s9)e. TeNaomledsriaofntsrecphoarrta:cteDrriystRicunofCrheepeakt,otWoaxsihciintygtoofn.neWphorootdoxCiocuintytyw,eWreesetviVdierngt.inia; Although several teratogenesis. anomalies were identified. none were considered suggestiveof toxic The 1998 small 1998) observed mammal no gross atbrnaoprpmianlgit(iUeRsSinGrtheeincearptWuoroeddwanairmdalCsly(vdoelesst,udsyh,reDwesc,eamnbdemric3e,). 43.3. Deer Studies TthheeWceastttleVitregaimniwaasDempaadremeanwtaroefoNfattwhreaplerRieosdoiucrdceeesr(rWepVroDduNcRt)ioninstuhreveDyrsycRoundnuacrteead. by Although available. tOhenetetaemamremveiemwbeedrs(oSmyekeosf) thhaeddaattaeslheepehtosnefrcoomnvtehressaetistoundiweist.hnDor.reCprorutms were of the 00a 19 DUP 260 Tennant Farm Herd Healt Ins stigaion Cate Team Repor WV DNR additional regarding dees herd information. From health in the Dry this conversation. Run area it was the in order to acquire some catle team's understanding that evidence of low fertility overpopulation: rates in young does was probably attributable to deer epizootic hemorrhagic disease (EHD) has been diagnosed clinically and serologically in dead and captured deer, respectively: - bovine virus diarrhea from Dry Run: (BVD) has been diagnosed serologically in deer not far Tn addition. the team has learned that outbreaks of EHD in West Virginia deer were rpuebploirctaetdiobn.eeFieenld 1M9a8n0uaalndof1W9i8l9dl(iSfoeutDhiesaesatseersn iCnootpheerSaotuitvheeaWsitledrlnifUe.DSi.se2ansdeeSd.t]u. dy Since there population was was no not evidence of considered an EHD or BVD outbreak to be a contributing factor in in the Tennant herd. the the cate herd health deer problems. for any of Also. there was no the disease entities evidence identified that the deer herd was in the Tennant herd. a useful sentinel species. 5.0 DISCUSSION The six veterinarians comprising the caule team agreed that there was conclusive evidence toxicity. that the pinkeye. Tennant herd malnutrition. was and suffering from four copper deficiency. major disease entities: endophyte The clinical. leboratory. and historical daa substantiate that these herd health problems on the Tennant ffaorumr.conditions can readily account for the chronic Endophvte toxicity According fescue hay to in the the history winter acquired on and pasture April 8. 1999. the herd has been fed a die that approaches 100% KY31 fescue during of KY31 the summer. There has The clinical signs in been no supplemental the Tennant herd that pasture or other forage fed to these animals highly suggest endophyte toxicity (fescue mycotoxicosis) include: + swelling the creek and pain at during hot the coronary band (coronitis) weather (Figures 5-8); and above. with cattle that stand in + + ppaotocrhsyhteadildianlgoopefciwainwtietrhclooastssof(tFaiiglursew4i)t;ch: + birthof undersizedcalves: + + poor conception numerous vague adnidsecasaelsvisnuggrgaetsetsi:ve of immune dysfunction; 060525 DUP 261 0 Tennant Farm Herd Heslh Insestigaion Cate Team Report Other clinical signs that are consistent with endophyte toxicity include: + + cfaotncneocmriotsains,t ppresrumpteiovfesc.oapspedeiradngenfoiscceidenebcyy:rectal palpation in cow #15; + + gpeannetrianlg fianilcuorwe o4f5t,hescuagtgleesttiovethroifveh.yperthermia; eVnadsoopchyotnestrifcutnigounsisassseoecniaatseda rweistuhltfoefsciunegemsytciootnooifcaosniusmbiserAocrfeemrognoit-uinkecoaelnkaolpohidisa.luTmhe ewthail.c.h 1p9r8o5d)u.ceTshepsereloalliknael,oipdesrlaoclicduimnuel,aNt-eacienttyhlelfoelsinceu,eagnrdasNs-sfeoerdmyd!urlionlgingero(wStthu.edemann. acquiring the the alkaloids highest may be fcoounncednitnrasttioornesd a the hay. greatest maturityof the grass. Additionally. Tprhoedcuocreodnibtyisepnrdoobplheymteobtsoxeircvietyd iinn tthhee "vfiedsecouteapfeosot("Fisgyunrdersom5ea.ndS6i)gnwsasoftfypeisccauleoffootthat agnendersaolrleynessisartinwointhe roerdbuoctehdrweeairglhitmbgs.ain.Hyoprelroessmoifaowfetihgeh,corrooungahrhyaibrancdoaot,ccaurrcshebdetbwaecekn, the al. d1e98w4c1,lawAsracnhdinhgooofvetsheabnadciks gweanserraelployrtaecdcboymptahneioewdnebyr sinomtheesvwiedleloitnagpe(sHeamsken. et "hunched and "humped" posture in some cattle, Pdiesrsiipphaetrealhevaatsodcuornisntgrihcottioenatfhreorm. thTehsiesvpahsoeancotmiveenoalnkaislokindsowrensualsts"isnudmemcerreassleudmspbility to s(uOgsgbesotrinveee.otfalt.h.e1s99u2m1.merThselupmapntsiynngdarnodmed.rooling by ared cow (#45) in videotape 2 was The has ablisrethbeofenunddoecrusmiezendtecdal(vBeosk.to dams et al.. i1n98g6e)s.tinTghiasdimeat yhibgeh in by eanmdoepchhyatnei-isnmfessitmeildarfetsocue tbhleoovdasvoecsosnesltsrimcatyionrecsualutseinddbeycrtehaeseerdgocti-rlciukleatailoknaltooidtsh.e gVraoswocionngstfertiucs.tioTnhoefetfhfeecuttehraisne been pups dforocmumfeenmtaeledsinfemditchee that were material deuxrpionsgegdesttoatthieonewnedorpehaytleigdhtuerrinbgirgtehstwaetiigohnt., Mouse were delayed 19911 in post-partum development. and grew slower than control mice (Varney. et al. oEfvitdheenaciel tshwaittecnhdiosplhayrtgeelytoaxinceictdyotianl,fefsrcuoem gvreatzeirnignacraytplreacmtaityiobneerrsetshpaotnshiabvlee efxopretrhieelnocses with similarly affected vasoconstriction result cattle. in dry gTahnegrmeonseotfstehveeretaifloarnmds odifgeitnsdo(pRahdyotset-itisn,duetceald. 1994: Hemken. etal. 1984). Rinecprreomdeuncttailvley edfefpercetsssferdocmotnhceepitnigoenstriaotnesofinencdatotplheygtrea-ziinnfgesitnefdecfteesdcupeasitnucrleud(ePaterson, et al. 1995). potentially In the play a Tmeajnonranrtolheeridn.tthheeugnraaczcienpgtaobflpeacsotunrceesptwiiotnh 100% KY31 rate. A poor fescue could conception rate 009527 2 DUP 262 Tena Farm Herd Heal Inesugarion Cate Team Report could where also be secondary 10 a breeding occurs year lackof round. intensive breeding management at The advanced age of most animals the Tennant farm, in the breeding herd could also be interval. Likely. 2 expected to be a cause for depressed combination of all three factors have fertility and contributed an to extended calving suboptimal ferility . Tofhethpeocoorwgsroowrt2holifmittheednguernseitnigc cpaoltevnetsiaclouilndtbhee hmeurldticfaocutlodrilaeladastoweplolo.rTmhielkapdrvoadnuccetdioange aanmdonpgootrchealbfrgoroodwtcho.wsSciomuilldardlye,prleascskocfalpfrgorpoewrthn.utrTihteioinnogresatiloancokfoefn2dobpahlyatnec-eidndfieestted fescue could lead to depressed milk production due to prolactin inhibition (Hurley. et a.. 1950; Paterson. etal. 19951. The mechanism is considered to be due to the dopaminergic effectsofthe endophyte pituitary gland (Schultze. etal. 1999). ergopeptides on prolactin production in the bovine Endophye intoxication is also considered to have an immunosuppresive effect by an ainptpoaxriecnattliyoninidsirreecstpornosuitbel.e Afolrthdoeupgrhesasneedcdiomtmaluneevifduennccteioenx,istthserteo aspupgegaersst ttohabtefensocue apparent lack etal. 1997). of immune response Indirectly. however. to vaccinations of cattle fed diets high in fescue there is a relationship between immune function. (Rice. e1n99d8o:phSyatkeer.intetoaxl.i.cat1i9o9n5:a.ndSctoeperpsergrsatzaitnusg oefndcoatpthlyetoe-nianfheisgthedfetsalcluefedsiceute(Dheanvneisl.oweetral sinerduepmrceosptpeedrmcoonnocceynttrea-tmiaocnzsotphhaangtehofsuencntiootnos.n a high-endophyte tall This is apparently an fescue diet. resulting effectof the decreased uptakeof copper by the infected tall fescue plants. Another source has recorded 1999) depressed globulin levels in animals grazing infected pastures (Schultze. et al FTahtenneeccrroostiiscifsat3 ahcecrudmpurloatbiloenmosfarceamtoestglryazwiinthgitnaltlhfeeosmcueentwailthanhdigehtceonpdeorpihtyotneeallevfealts. depots. masses and consistofhard masses of partly mineralized within the sbdomine! cavity that were identified fat. Cow during the #15 had palpable herd exam on April 7. r1e9a9c9.tionThceasuesimnagsstheesfwaterneecmroossitssiusgugnecslteiavr,e ohfowmeavsesre,s ionfanfefcercotteidcafnati.maTlhsethbaitocarheemoincaaldiet ohifgchhoilnesNt-efroorlm(ySltuaenddemNa-nanc.esye]tall.olin1e9.85t)h.ereAinsiamaclonssiwsittehntinrcerdeuacsteidondioeftacriyrcluelvaetlisngoflevels endophyte-infected fescue had decreased body condition and increased fat necrosis. Pinkeve FTaecnenfalnitesfwaerrme(Faisgeurrieosus| parnodb2l)e. m Aidndtihteiocnaatltlley,inthtehye hvaivdeeoatlaspoedbereencoardpirnogbslteamkeinn ootnhetrhe years. according (0 the history interview. Faceflies were seen provided in small by Mr. Tennant during numbers at the eyes of the the Apri caule 8. 1999 during the April 7au.t1u9m9n9alhiesr.disvisaitv.ecrteoprrefsoernMtionrgaxaenlelaarlbyovsipsr.inthgeientfeisotlaotgiyono.f Tmhosetfabcoevfilny,e Mpiunskceyae. Control eannii DUP 263 Tennar Farm Herd Helin Investigation Cate Team Repon of these insects is based on the care. Insecticides and preventing insecticidal the ear ftlaigess,farsomapfpeleideidndguornintghethleacvirsiimta,larseecerfefteicotnisveof csounstcreopltsi.bleSeccaotntdleardiulryi.ngthoeuitnbsreecatkiscoifdepsintkenedyet.o limit the spreadof M. bovis between Safefveecrteedfacactetflle.y iSnfoemsteatoifontshecapnoorreswuletigihntpogoarinfdeeedsccroinbsedumipnttihoenhiasntdorcyoonfvtehrseiohneradmaonndgthe videos may be due to "fly worry" The manic in oneof the videotapes. was likely due to the sltaargmependiungmofobftfheleicersatle, that was described Malnutrition Mhaaldnuiidernittiifoinedwpaosocrognrsiodwetrhedratteosbaenad siingfneritfiilciatnytapsrsopbelceifmicinptrhoeblTeemnsnaanmtohnegrd.hisTchatetloe.wner Tthheislowwasbocdoynsciodnedrietdioanmascnoirfeess.taDtiieotnaorfy prreoqtueiirne-meennetrsgyofibneseuffficcaitelnecychaanndgweadsrarmeaftliecctaeldlyin during the life environmental cycle of the animals and during the year. and physiological stressors as fluctusting particularly with respect to ambient temperatures and such miomipsrteusrseiocnoonfditmiaolnnsu.trliatcitoantitohna.tgfroolwtlho.weadntdhebrveiseidtisnogf(ARpicrei.l 1991). 7 and 8 The clinical were confirmed by the results of the feed analysis of the hay and grain mix rations taken during the visits Copper deficiency As indicated by the heavy metal three animals. copper deficiency analysis performed is a problem in the by two laboratories. on tissues from Tennant herd (Appendix BY. In H1o9l9s7teicnopcpoewr dbeyfitchieenAcnyimwaals HdeiaalgtnhosDeidaginnosat4i-cyeLaarboorladtoHorlysotfeMiincchoiwgaanndStaa9te-yUenairvoerlsdity isnacEraisfticeLdan7s-inyge.arMoilcdhiregdanc.owInby19t9h9e. LcaobpopreratdoerfyicoifeLnacrygewaAsnirmevaelalPeadthinotliosgsyueasnfdrom a Toxicology of the University Furthermore. serum samples of Pennsylvania. Kennett Square. taken from 41 adult animals at the Pennsylvania. farm on April 7. 1999 rexealed that 26 a the reference of the 41 laboratory (63%) had (Table 4). serum copper levels below that considered deficient cColuinsi.caplosoirgqnusaolfitcyohpapierrodneftihceiceonwcys,seaenndoonvetrhegrToewnnnahnotovfeasr.m Twheirse wlaigshtreenpionrgteodfbtyheMhra.ir Tennant and shown in videotapes made of the herd. `efTfheecctlsoinficaslucehffdecetfsiocfienccoyppaerre wdeeflilcdioenccuymearnetemdult(iNpRlCe.,a1n9d96t)h.e cTlihneiceaflfeacntds iphnycsliuodleogical iinmemxutnreemdeefciacsieesn.cieDsu.ripnogordiqsueaalsiet,y choaiprpecroadtse,fiicnicernecaysecdanfrraegsiullittyionfdbeopnreessaendd lseuvdeldsenofdeath tumor necrosis infections and dfeapcrteosrs(eadcfyeteodkiinnet)akweit(hGernegseulltbiancgh,abentoarlm..al19t9e7m).perature responses to gant DUP 264 5 Tennant Fam Herd Hest Instizaion Conte Team Report aIcmumteunpehadseefipcrioetneciinesrerseploantsede taoncdolpypmerphdoecfyitceiernecsypaornesimvuelnteispsletoanmditiongcelnudsetdimeuplraetsisoend (Arthington, et ai.. 1996: Gengelbach. et al., 1997). efciency i expected fo be present at his ime and to continue. The relationship As there has been no documentation of any copper supplementation of the herd. the between high endophyte fescue grazing and copper status in the feed has been described (Dennis. et al., 1998). Copper deficiency is widespread throughout the United States (Dargatz. et al.. 1999). Toxicology issues Based upon the Response Team draft report entitled Dry Run of the US EPA, carnivorous. Creek. 1997 piscivorous, from the Environmental omnivorous, insectivorous and `herbivorous mammals in the Dry Run Creek study area are at increased health risk due to exposure to metals. fluoride and wrichlorofluoromethane. At least with regard to metals. of concern. diagnostic evaluationoftissue and fluids collected from three animals from the Ten Bolton nant farm (two Centedro) nots submitted to Michigan State Universit uggest elevated concentratoifoannsy y and o metal. ne In submitte addition. d to N urine ew (two samples submitted 10 Michigan State University Michigan State University) and from the cow evaluated ac New bone (one sample submitted Bolion Center) samples for to fluoride analysis did The urinary fluoride not measure values were concentrations above expected or "background" values. 6.60 ppm and 5.55 ppm and one bone fluoride value was 1090 ppm (expressed on a fat free. dry weight basis). Urine and bone fluoride concentrations in adult cate consistent 3000 ppm or greater (expressed on a fat with free. fluorosis are 15 10 dry weight basis). 20 ppm or greater and. respectively (Osweiler et al. 1985). In addition. there was no clinical evidenceofchronic fluorosis in theTeanant herd. Exposure 10 trichlorofluoromethane a lackof toxicologic benchmarks fo was r this considered compound. 10 be a default risk factor However. available toxic basedupon ity data cdehrliovreodflfuroormocianrhbaalnastisounchstsusditersiucshilnogrocfolumomroomnetlhaabnoerahtaovrey laoniwmaaclusteinadnicdatcehrtohnatic toxicits (ndMeearvgvedolauo.spmse1yn9st9t9a)el.mtsoSuxiicgchnansatsass.lsedotochianaritgteydaafwnfidetcthinarcceoupotrreodditunoacxttiiicoivntey.paeCrrhefloorerrvomefarlnsucioebrleoacnedafrfabercoetnssnaoatnret4hnenotOcUeOntXrCai 6.0 RECOMMENDATIONS hTehred mvoissitt simnpdorretvainetwgeonfehrael irnevceostmimgeantdoraytidoatna,frwoomultdhebceatftolre ttheeaom.wnaeftreorfcohmeplTeetninoanontfthe phreordgrtaome.ngage veterinary and nutritional consultants in the designof a herd health 080 ih DUP 265 Tennant Farm Herd Health Investigation Cane Team Report `Endophvietoxicity: With dietary forage that contains nearly 100% KY31 fescue, fed Guring all seasons, the immediate goal would be for the dilution of the endophyte in the Gdiieftfebryentmifxoirnaggethseouhracye.anAd sphaosrttu-rteewrimtghoeailthweorulnodnb-een1d0orpehdyutceeitnhfeesctoendtefnetscoufeeonrdaonpohtyhteerinfested hay and pasture to 50% or less of the diet. primarily by supplementing the diet with higher quality forage. An acceptable long-term plan would be to replace the fescue pasture and hay fields with a non-endophyte-infested forage crop or crops over time. again with the goal of diluting the dietary endophyte consumption. Crop management should be auempted under the supervision of specialists in forage and grazing management. Pinkeve: Prevention of pinkeye (keratoconjunctivits) in the immediate future should be attempred by an approach that limits the spreadofthe infectious organism. Moraxella bovis, from carrier caule to susceptible caule. Effective fly control, through the use of insecticide-impregnated eartags or some other proven method. is perhaps the most effective control method that should be practiced during the warm months. The insecticide-laden eantags should be rotated every year in order to circumvent the development of insecticide resistance by the local facefly population. An additional long-term approach that may be employed is the breeding for cattle that have dark faces, By selecting for dark-faced cate. the comeal damage that is caused by the ultraviolet light of the sun is minimized. However, while minimizing the damage to the corneas of the cattle may prevent overt lesions of keratoconjunctivitis. the loss of condition from severe fly infestations will not be avoided by selecting for face color in cate. Thus regardlessof the type of cattle in the herd. insecticide fl repellants should be used every year Malnutrition: Rations and pasture nutrition should be planned with the assistance ofa Specialist inbeef caule nutrition. In the Tennant herd. there was evidence of gross protein-energy malnutrition. 2s well as concerns about macromineral (calcium. phosphorus. and magnesium) nutrition. Trace mineral and vitamin deficiencies are common 0 many beef herds and should also be addressed. In the development of a cation for this herd. particular attention should be paid by the nutritionist to the local trace mineral and macromineral deficiencies. Copper deficiency: Copper is a trace mineral that is crucial to the healthof cattle vet is missing from the diet of caule in many areasofthe North America. As copper deficiency was suspected clinically and confirmed biochemically in the Tennant herd. the provision of a high copper trace mineral supplement. again under the supervision of abeefcattle nutritionist, should be a priority year round. This is especially eritical considering the. prevalence of endophyte-infested fescue on the Tennant farm. 00052 DUP 266 Tenn Farm Herd Health Investigation Cate Team Report 7.0 CONCLUSION `sTuhfefreeriwnagsfrcoonmcflouusrivmeajeovriddeinsceeastehaetnttihteieTse,nsnoamnet coafttwlheihcehrdwewraes.poatnedntcioanlltyiniunetesrrteolbaet,ed: eAnsdospuhybtsetanttioaxtiecditbyy(tfheescculeinmiycaclotaonxdicloasbiosr)a.topriynkfeinydei,nmgsa,lnauntrdihtiisotno.riacnald dcaotpap,etrhedesfeicfioeunrcy. conditions readily account for the chronic herd health problems on the Tennant farm, `nTuhteithieornd, hienaaldtehquinavteestviegtaetriionnarryevcaerael,edanddefliaccikenocfiefslyincohnterrodl.maTnhageelmaecnkotf,viancccliundaitngiopnooarnd internal parasite control relatively isolated herd programs did not appear to have a substantial impact on this eDveisdpietneceanofextohxaiucsittyivaesrsoecviiaetweodfwhiitshtocrhiecamlicaanldccoonnttaemimnpaotriaorny herd data. there was of the environmen. no 8.0 REFERENCES Endophite Tovicity References 1. Boks DI. BonJd: Effects en calfbirth weight.milk iynieplrd.egannadntcablefgerfohwetifhe.rsJA grazin Sngcifi 6u3n(gsuusm p-piln)f:e2c9t7e.d tal! fescue 1956 2. DNeeaonnissphSoBd.iuAnllcenocrViGo.phSiaalkienri_KoEn. cFoopnpteernotcoJnPc.enAtryaatdioJnYMin. tBalrl ofwenscuCeP.: Influsnce of J Anim Sci 76:2657-2695. 1995. 3. Hembken RW. Jackson S3:1011-1016. 1984. J. Boling JA: Toxic factors in tall fescJuAnei.m Sci + Hurley WL. Convey EM. soncenteations as affecied Leung K. Hemken RW: by tall fescue summer tBooxvicionseispraonladcttine,mpeTrSaHt.ureT. and T3 Anim Sci S1:374.379. 1980. 3. Ofsunbgoursn-einTfGec.teSdchamniddftunSgPu.s-MfarrepelefeDsNcu.e Rahe CH.Steenstra JR: and ergotamine tartrate Efoffcoenscumitng on selected 7ph0y:s2i5o0l1o-g2i5c0al9.va1r9i9a2b.les of cattle in environmentally controlled conditions. J Anim Sci 6. Paterson toxicosis J. Forcherio onbeef cattle C. Larson B, productivity. J Samford M. Kerley M: The Anim Sci 73:889-898, 1995. effects of fescue 7. cRyaadnoosbtaicttserOiaM.. cBllavoiobdactDeCri.a,GainysecCtCs:, aDnidseaasneismaclas.usedIn:byVettoxeirnisnariyn plants. fungi. Medicine: A 009-25 DUP 267 Tennann Farm Herd Health Inestigauon Cate Team Report textbook of the OM. Blood DC. diseases Gay CC. eodfitcoartst.le,Baislhleiepr,e Tpiingdsa.llg,oaPthsi,laadnedlphhoirase1s5,328-"16e1d.1,, R1a9d9os4tits. 8. ERxiacleuRatLi.onBloodfgehtutmoDJr.alScihmurmiugneGG,reSswpeocnskeesriWnSc,aFtoentegrnaoztinJPg, eAnldloepnhyVtGe,-iAnkfeecrtsedRMor endophyte-free fescue. Vet Immun Immunopathol 59:285-291, 1997. 9. Saker KE. Monocyte iAmllmeunneVGc.ellKalrneistpsoknyseJ. aTnhdatccohperperCD,staStwuseckiner,beJerf. WS, Fontenot, JP: steers that grazed endophyte-infected tal fescue. J Anim Sci 76:2694-2700, 1995. 10. Schultze AE. bovine serum Rohrbach BW, biochemistry pFrrofiibloeusrgasHsAoc,iaWtaedllewritIhC,prOolliovenrgeJdW:conAsltuemrpattiioonns in of endophyte-infected tall fescue. Vet Human Toxicol 41:133-139, 1999. 11. Stuedemann JA. AB: Association Rumsey of blood TS. Bond J. Wilkinson SR. cholesterol with occurrence Bush of fat LP, Williams DJ. necrosis in cows Caudle and tell fescue summer toxicosis in steers. Am J Vet Res 46:1990-1995. 1985. 12 Vamey DR. Vamey endophyte: effect on cLoAng.enZiatvalosdePvMe.lopWmiegnltesawnodrtphupMDg.rowStihegienl MR: mice. Tall fescue J Dairy Sci 74:260-366. 1991 Malnutrition References 13. CRliicne NLoE:rtThhAemeerf~fFooeofdncuAtnrtiitmisoPnraocntre7p:r1-o2d6u.ct1i99v1e.performance inbeef cate. Vet Copper Deficiency References 14. dAenfhiicniegnicoyn oJnD. acCuotrez-hphaLsRe. Bplroetcehian cF:oncTehnetraetfifoencst, ofsupmeorloyxbiddeenudmi-simnudtuasceedacctoivpipteyr bloevukionceyhteerpnesutmibceurs-s1.. aJndAnliymmpSheioc7y4t:e211pr-o2l1i7f,era1t9i9o6n, in beef heifers inoculated with 13. Dheairfegrast.z DJAA.VGMaArry2F1B5.18Cl2a8r1k83G2B.: Serum copper concentrations 1999. inbeef cows and 16. NDeeoatnhissphSiBo.diAulnlencoVeGn.opShaikaelrumK_Eo.n FcoonptpeenrotcoJnPc.enAtyraadtiJonYMi.n Brown CP: tall fescue. Influence of J Anim Sci 76:2687-2693. 1998. 009i DUP 268 = Tennars Farm Herd Health Investigation Carle Team Report 17 Gengelbach GP. Ward ID, Spears JW. Brown TT: Effects of copper deficiency and copper deficiency coupled function and response of with high calves [0 dietary iron or a respiratory molybdenum on phagocstic disease challenge. J Anim cell Sci TELS 1997. 18. National National Research Academy PCroeusnsc.ilW:ashMiinngetroalns,.D.in:C.N5u4t-r7i4e,nt19R9e6q.uirements of Beef. th ed. Toxicology Issues References 19. MagdaS: Fluorocarbons. McClellan R and Welsch FIn.: edTiocoxrisc.o.lAocgay.deImSi!ecd.P,reMsas.rqSuaanrdDtiHeg,oS,c6h5a9f-e6r6S2G..1999. 20. Osweiler GD. Carson TL. Buck WB, Van Gelder GA, editors: Fluoride. Clinical and Diagnostic Toxicology. Kendall/Hunt Publishing, Dubuque. IA, 183-188. 1985 21 USEPA Environmental Response Team: Dry Run Creek. 1997 (drafo. = aan DUP 269 EY Tennant Fam Herd Health Insestgation Cate Team Report 9.0 GRAPHS Graph 1: InHdeivpiadruianlizCeadlbeloPoldassammaPprloelsatcatkienn (April from 7, 41 1999). adult cate during the catle treesapmo'nssivivseith1o0rmthoeneT,enpnraolnatctfina.rm Gwrearpehainlalluystzreadtefsotrhtehelaebnordaotpohryy'es- rineffeesrteendce(1m0e5a.n8sngfo/rmeLn)doApprhiyltep-afsrtueree.(17T1h.e6 anvge/rmaLg)e apnldasemnadopprholyarcet-in evnadloupefhoytre-tihenfTeesntneadnrtefheerrednc(e1.10T.h1ensge/rmeLs)ultwsaswesriemihliagrhltyo tshuepportive of (tTheesdtiianggnolsaibosoraftoerny:doDprh.yNteeilmySccohtroixcikc,oUsniisveirnstihteyoTfenTneannnteshesrede) 09: DUP 270 " e " : l|Lag ` o : zi L oTdE Ez i " i " :8:gzzsggzszee- (lw/u) unoejord C0dn1 30 DUP 271 Tennan: Fam Herd Health Insesugation Caute Team Report 10.0 FIGURES Figure 1: Faceflies on the head ofa calf. Fparcoebflleym(oMnustcheaTaeuntuamnntalfiasr)m.infIenstaadtidoint,iownastoctohnesicdoensrteadnttohbaeraasmsamjeonrt dbiysease cflliiensi,catlhilsy cballifndhaodn stehveerveidbeioltataepreal(pkheortaotowcoansjutnackteinviftriosmanTdenanpapnetarveiddetootbapee 2) Figure 2: Faceflies on the head oaf cow, b"Tihliastecraolwkewraastotchoenjduancmtiovfittsh.e c(aplhfoitnofwigausreta1k.enLifkreomheTrecnanlfa.ntshveihdaeodtsaepveer#2e). FigurFeac3:eflLieefst aeryeeaofveactcoalrffwoirtthhefabcaecftleireisalanadgecnetnstroafl pcionrkneeayle opacity (`mkaeycatporcoognrjeusnscrtiovdiitfisf)usseuccohmaesalMourlacxeerlatliaonboavinsd. clCiennitcarlalblcionrdnneeasls.op(acpihtoiteos.was taken from Tennant videotape #2) Figure 4: The Delayed sheddingof videotapes presented the winter coat on a multiple catle with beef cow. delayed shedding of winter caosatnsu.tciTihoinsailsdaecfliicniienccailess.ig(npohfotteon waasssotcaikateendfwriotmh Teenndnopahnyttevidteooxticaiptey =a2s) well FigurTehi5:s Allesoipoenciwaasanpdreesreyntthienmsaevaebroavlecatthtelecoinrotnhaervyidbeaontdap(ecso.ronIittiiss)a.common sign ofendophyte toxicity and is generally referred 10 as "fescue foot (photo + 35 taken from Tennant videotape 52) Figure 6: This eAxlaompepclieaoafnd"efersyctuehefmoaota"biosvseimtihlearcotrootnhaartyprbeasnednt(ecdoroinnitfiisg)u.re 5. (photo was taken from Tennant videotape #2), Figure 7: Three cate standing in the creek. cAautneusiunatlheprseudimleecrt.ionThfoirssbteahnadviinogriinswkantoerwnwatso bdeesacsrsiobceidatfeodr wtihethTenant efonodto"p)hayntde htyopxiecritthyearsmiitap(r"ovsiudmemsesrofmeescrueel"i)e.ff(oprhobtoothwacsorotnaikteins f(r"ofemscTueennant videotape #2). FigurAesS:deTsewroibceadtfeorsftiagnudrieng7.instaanpduidndgle.in water provides some clinical relief to cisatatslseowciitahtecdorwointithis".fesAclutehfoouogth".n(opn-hsopteociwfaisc.taakpernedfirloecmtiToennnfaonrtthviisdbeeohtaavpieor 2) 0054.17 31 DUP 272 rer ese Re Ge PRS alr" Sor iT SEs 4 == syHoa PES ESS d CA J EN RY raed voy 0 AN SEN 7a Re = Es Figur1e EL TEA od GE Lo Te NE Se Fgus2 ean! DUP 273 2 pry pi) y | FE i ~. SM = pm BeS.Cll0 Crone en. Ee E22 so . F =e i (PECTS 2 LEE CR oT Te DUP 274 ei 000515 3 Ee m= TE. EEE = a Bay SS d= aT = = - FE 0 IE Rt = - CE = FZ | mooo < ans FF See Figure 5 Ea = pE e =s Ee = ee aE = #7 : Ti Ea _ -- Zi Toes . 009: DUP 275 2 Ex 3 EE - E SS lr t BEE SE Le NY R eeA e -- a een) =rE a dl - 2co = = = = AP 2 EE a =2x =a e oN T Te a T E e e8 EE rEE nT eae a RTA nee LD See C09 5 DUP 276 ? Tennant Farm Herd Heslh Investigation Cale Team Report 11.0 TABLES Table I: Reviewof Tennant Farm Videotapes Table 2: Individual Animal Data: Clinical Signs Table 3: Individual Animal Data: Hematology (erythron, platelets) Table3: Individual Animal Data: Hematology (leukon),and Special Chemistry Table 5: Individual Animal Data: Clinical Chemistry Tabl6e: Individual Animal Data: Serologyand Fecal Exam Tabl7e: Tennant FarmGrain and Hay: Nutritional Analysis 000. DUP 277 36 Tenant Farm Herd Heath Investigation Cute Team Report Table I: Review of Tennant Farm Videotapes Tape #1 (cases 1-18): Tennant Farm: New England, Wood Co., Wa January &February, 1997 Animals) T||Cow, Hereford | ++ dnecek:salcopaersci"iah,ubsmcapeleiddng-,| |+. probable Tee, "humpdifeficudltt-oapuprepcia"te +_(swnpo,wing) ontape. Z| Cow, Hereford | + + c_o(Grsnneoawliongp)aciy, + cpionmkeeayel.scar, probablysecondary 10 3|| 2black bulls |+ possible discoloration ofhair (notclear), | not clFeromatrape 7] Con.Hereford | + + | [1 t(hsinnowing) + very thin,probadbule1y0 itraipvooressd, decforodeconasumsptieonadnd | | + (snowing) `mnaosttisceaetnioonnpvriodbeol,em.althoughteeth | [Con Hereford | + + possible hunched back | + atgeeethuprnoblkemcn uanuksnoeoownw f.ponssi;ble notclear from tape. |! (notclear). + snowing) 6] Cowltani i| | alopewicl siwiath., || tsnowing) |= wtoaiullhdaiinTcolsusdeGimfeecrheanndiiclald,ialigcen.os fescue toxicosis, and selenium 7| Cow | + I (asnlowoinpg)eiclsiwiatc.h, | ttaoixlichoasirsl.oss Gifierenial diagnosis would includemechanical, lice, | | tfoexsiccuoesist,oxicosis. and selenium [CA black |. sdneaodw,(dmed29/97) in | + hoboutvneost uanulsueall,onger thannormal. | + overgrown hooves, bilaletnseoparciatiels, |. "cold cataracts" (post mortem), + teeth normal, + + blmacuklcooroonwfnuetceesest,h, |. ffecaelimnucrceoecutsusmn,ormalforstagnant + lneescironosp,sy:noother |. naetcrroopphsyy:oflafactk: eomfafcaitatsieorno,us + sted: haddiarthea probably duetostarvation. 00001 Tabl1e: Revie.of TemFanrmVaidenouptes DUP 278 37 Tennant Farm Herd Heath Inesigaion Cale Team Report Table | (continued): Review of Tennant Farm Videotapes Tape #1 (cases | - 18): Tennant Farm: New England, Wood Co., WVa - F] sibia January &February, 1997 Presentation Diagnosis/Comment STcar,Animal(s) neck: alopecia, probable Tice, fbalcaeck/white +| dleinasmohreac,omeal + + pcraoubsaebolfedicaormrehaelascuanrkn(ohwarnd,to ell). T0| | Cow, Hereford | + opacities thin, + comealopacityprobably secondary + + acboomveealhooopvaecist:y,alopecia| + diffpeirneknteiyael,diagnosis of hoof + 2dnidahnyeperemia, dleesrimoanrsitisn,clfuedsecumeecthoaxniciocsails. and ! + cmaouissetodferdmiaatrirthiesadaunedttohuinnnkinnogwn i i unknown. C+| 13 Cond | || | | {| + | i| T4|Cov.red |+ i| {| + | ve sores slobbernglosing eud (uroinnagtrionugn,d). il switch alopecia neck: alopecia, wil swich: short hair [robes | + sobberingurnadng Geren] diagnosis includes hardware and clihkoelliynedsuteertaoisnediinvhiidbiutailonco(lwess + alafofpeectceida)d,ifferential diagnosis ifnecslcuudeeosrmseeclheanniiucmalt,oxliicceo.siasnd neck: probable lice, | + tianlclhuadiersdimfefcehreanntiicaall,dilaigcen,osainsd fescue or selenium toxicosis. 17 Cow. Hereford| + possible hunchedback | + dmioatgcnloesairsfirnocmlutdaepse;hadridffwearreential deitsiecausleop(ewrriacuamradtiitcs). 089.00 Tabl1e: Review of Tennant Farm Videotapes DUP 279 36 [I ---- Catt Team Repon Table I (continued): Review of Tennant FarmVideotapes Tape #1 (cases 1 - 18): Tennant Farm: New England, Wood Co., WVa - January & February, 1997 # | Subject | Presentation | | Animals) Diagnosis/Comment 18| Cow, red + dead in bam, (same as #13) | + corneal opacity, + necropsy: no other lesions. | | | | | | I | | | | | + (is this the 9-year-old cow submitted to Michigan?), + comeal opacity may be postmortem artifact, + necropsy: serous atrophy of fat, + noted: normalpostmortem changes include moderate to severe autolysis, pseudomelanosis of intestines, interlobular emphysema (agonal), + also noted: normal front teeth + large gallbladder suggests period of + acnaourseexioaf,death unknown | Table 1: Reviewof Tennant FormFarm VidVeidoetoauppess 06a DUP 280 37 Tennant Farm Herd Heslh Investigation Cate Team Repon Table | (continued): Reviewof Tennant Farm Videotapes | [Lins Tape #2 (cases 19-60): Dry Run Harris PC. Wood Co. - Off North Fork of Lee Creek, New England, WVA . FSi T Animal(s) Presentation Diagnosis/Comments 15 [ Calves, muliple ~ comeal opacities of | + fly problem with secondary varying severity; some| pinkeye, with exudate and/or blepharospasm, | + hair coat shedding and coloring probably due to a nutritional + fly problem (summen).| problem. | | shedded andor light- | | colored coats 1 Tr |S raccoon?) 77 | Cow | = | car i possible skeleton ~ incidental possible. death: no diagnosis |= comeal opacity i [comes searsscandary 0 piney J+ cpoosmseiablleaphaecadiitsli.(not * |+ cheoamdeatlilsncoatrcsleecaornodnartyapte.o pinkere, | clean Tar | i I. fies | T+ dead (<1 month-old) {+ comeal opacity. |+ | causeof death unknown. comestscaseconduy to pines i+ (burning carcass) [GE BERETS) l ! T|+. cfloymeparlobolpeamcities. [+ dead ! possible. I `Ny problem pinkeye. withsecondary I incidental death: no diagnosis possible. 1 TableI. Review:of TennantFarmVideotapes DUP 281 eda #0 Table 1 (continued): Review of Tennant Farm Videotapes Tape #2 (cases 19-60): Dry Run Harris PC. Wood Co. - Off North Fork of Lee Creek, New England, WVA 7 Subject I Presentation Diagnosis/Comments Animal(s) 31 | ad + dead, + cause of diarrhea, emaciation and | | ! 32 | Crow 34 |! Calves, multiple 3 [Cow | (dehydrated?), serous | + lung emphysema was agonal and ||+ agonal lung | emphysema + dead ianocivdeinetal death: no diagnosis T+ | comeal opacity T+ comeal opacity. | + thin : possible. + comeal scar secondary 10 pinkeye. + comeal scar secondary 10 pinkeye. + diagnosis of the causeofthin condition not possible. 38 !| Salamander 39 Toad |l . dead dead 40 | Newborn calf | [+ contracted tendons, + big hocks T| + ipnocsisidbelnet.al death: no diagnosis + incidental death: no diagnosis + difficult to evaluate from tape; may be congenital contracted tendons. possible. Table 1: ReviewofTennant Farm Videotapes 00:00 DUP 282 4 Tema Farm Herd Healt nsesigaion Carte Team Report Table 1 (continued): Reviewof Tennant Farm Videotapes Tape #2 (cases 19-60):LeeDrCyreReku,nNHearwriEsnPglCa.nWd,ooWdVCAo. - Off North Fork of #1] Subject T | Animals) Presentation Diagnosis/Comments =| Cow praensptiirnagt:ioinncreased ~ dhifyfpeernehnetarlmidaiadgunoestios siuncmlmuedersfescue || + ditaoxgincoossiiss,uncerain. 37 | Raccoon | | 39 f|Deer | 50 | Revit ST Tuner 1 | Hak ! I Shall {T+T debaldood(yfrensohs)e. | | + dead ad iTae + incidental death: no diagnosis possible. possible + hdeeamtohrprhaogicsdidssueaesiteooebfpidzleoeortyic (EHD) + incpoisdseibnltea.ldeath: nodiagnosis incidedathennoGtaganoln [iponssibdle. en possible vo dso possible. 55 | Cows. multiple I above hooves: alopecia,| + differential diagnosis includes || | i+ ovpeosrsgirbloywneryhtohoevmeas, | mtechoanixcaalinddemrcomaitsoittidsse.rmfaietsciutseisd,ue unknown, F [Bullcows. || comedopaciies. hcoomoefallensgctahrnsotesicgniofinctaondptiakresy. | multiple + aabolveohoaponvdeeesrcytiheama | + hmoeocfhdainfifcearelntdiearlmadtiiatigsn,osfiessicnuceludes | toxicosis, and to unknown. moist dermatitis due Table 1: Reviewof Tennan arm Vidseosrpese cadiin pup2ss Teanan: Fam Herd Healt Inesigation Carle Team Report `Table 1 (continued): ReviewofTennant Farm Videotapes Tape #2 (cases 19-60): Dry Run Harris PC. Wood Co. - Off North Fork of Lee Creek, New England, WVA FT Subp | Animal(s) | Presentation Diagnosis/Comments 38 |Cows. multiple| + | above hooves: alopecia,| - hoofdifferential diagnosts inclodes possibly erythema. mechanical dermatitis, fescue i + poor shedding of coat in some animals toxicosis, and to unknown, moist dermatitis due |i | + pnuotorrithiaoinralcopartosbhleedmdoirngfessucgugeests | mycotoxicosis. 60 Cmuolwtsi.plheeifers. [+ + thin. delayed shedding i + deffrionmittiavpeed-iapgrnoobsaibslyno2tnpuotsristiibolneal deficiency. sNVgoiiredeeeTishh"s tEhnelarenraaxrtrsaotlrourb'dsuetswsesrmseoneycronnofsittdhherereSbdlIabcyEkethnegedcmatsuelte3h7t8oerapmaphatotclbhoeygimacecaclluacrnaootnsesd.owmeFrsoeraseorxnaomwrpemlraele.,ptrhoAepleeseoeandicmbmiyerBonEvoxs scpleusieidatine tchosmmteabnites regarcing normal organs. durin the dissections Shown in he deotspes. wert nox Tabl1e: Reviewof TeFnarmaVidnosptes 000" DUP 284 #3 ! 3 int "a RORR iIIHg : EH fre eo J Flee =e s = P PO ETPe [TITHE ~ bupass " : EH fix prep | IH oo DUP 286 or * | : Ma I 7 gEL :A E- E EE 4 lFz eEls eRl:lRsislEal R EizlRelsN[elEsl [F2]AHRaRAR es sla: 2elelz zd RRR Pree FH 23382: eal ali EE diese ee zi i:Lecces3ERRL REAz I 2a TT RET eaioesT T HlB: : FsERxEe EEtS aJte IaLl m LaLa t ENaEn l TTeETl R]E : : r Haase i bd FEE EE EE EEE = EiE (E Cl e ee en ten a izl=l z EO oo] 1 7 ON LR Jee LR bo ll] [LE TTT : coors DUP 287 i HL : 5 Py 15iel=lel slslalolol =| 2[o|o ol 2] lol :A Exes : Hfl J C aeR s EeAeR e i: H]M 2 Ande a E ssis: :: = -3 FERRE Re REARSieRdE de { F- l= ls = el aelz lelclclslalelalalale]} 5 3 : EEEEEREEEEEER B 25d 2 E-- INS PATI C00: DUP 288 z2 ww Re : HE: SEERA EERE i[JH Poll [TTT DUP a0 o * SIi mB TTT] (REI 2 fc | =| le [ls] da. Do : R REAR f ! HEEES 25225220 zgsge z]s5 T } F}EEE5 :gi2ol m slefei lelet lelee lela] nalalenleas ]2d :g FI | i[I fl :ZHH R2S22E2oEoEleEelE sleg lde elallRele5s 1 i 1 SEZ gid 3 8% 3 23 2 HEM. ssdslslslslslselleleg EEE ET Elle FI s ERE Ee R ARa R sR gE i i t:l: sFRzRsI RRnRaERnzARENAsaLLdatE dl]lnE Cli E1 : 2z ploe EH la CEERfeI ygt desl 14 1d 2cieiealEER RITNZSI EA IE RCIRNS 53 ] : SiPM 2 sc essanal asasRaaEra EHEEasi ii 1: F-EC e slsfslelzsle selollole n deRiiriiaizci z SEE lid lds FE88a530 3 1 Li: EB Pa AHIs EE | [EF RERRRRE LHLI : El | ITU & CGH 2 DUP 290 ka | WE OR Ce H eee eee i N > Tens alzlsls Hele slalsls ay Ee elle i 1 Bp ER S RRRH RRAM R < M sBliec ssxixailEalRzlEsgszaslzzziiagenleelsg lsiai eisaz i sole $cB TIaEzEzEEdEeedSEeE ls seldalaa dele s See eed eee : ME slslelezlelsl-e 2lslelsle i 3 CE soe Hk EEE es I [JE : WC 2 SEE 52 SEREE g ofl] TTT H SER | & e09ais PS DUP 291 ; ee] 3 ll zd Hegel leis sdaleelalollells Fe i EE olesazesaan 1] I BH fama rele HAE ii E Breede 9 : fact S333 ne gl BH SI s iEl:fEsRazszeliszlgeelsoidsslEocalgeefleleozllaelsen2 is23y2 CR i| WE RRR . ie 5 : ) DUP 292 : [TTT cE EN 1 fe a Ie REE Po TTT, orm " : . M [T mTmI I ULE i i Ki | Bae EE i : me LITT Si cs LT Ee 5B I i i | LTT TTT] 8 fil ies TTTTEAA Ag q9e iiLlH cE AT HE 1 RE POT hie 09s p DUP294 % TT HH ! 3: = 5 EE 2[I | lslali alelalls | lal Fl slate gi! HE B= FREE AT slg i TOC PTE ig 3 2 FE:.< Haolsinig/elalalolel EEE alTleTlT[ls = i RCT : IP TadO T TT TT T I T2TE 2 EHER F = 5EvEslEna izEisetsiasltlsnefAl B RSisIT|iE :2 : i Pe OER. SERRRRRREERERRRRRES' i, lelelslelslals| [i533 7 BR rcsnanns 7 | HET i 2 1 - BHEKSESEIEE]EESGE| NE EPEsAE RiiEl : EF HEE |2 | 2 i J 14 BSi2 Zyc i 3 EEEEERERERERERRE REE 3 : SEEMS EYRE g EEE ggR)8lE seme 2 oor DUP 295 Tennant Farm Herd Health Incstigation Cate Team Repors 12.0 APPENDICES Appendix A: Abbreviated Curriculum Vitaeof Cattle Team Members Appendix B: Diagnostic Pathology Reports Ohio Department of Agriculture: #4977-97 Michigan Animal Health Diagnostic Laboratory: #1792571 University and oTfoxPiecnonlsoyglyv:an#iUaPL9a9b0o2r7a0to2r,y#o9f9L0a1r4g3e7Animal Pathology Appendix C: Dry Run Safety Plan Appendix D: Figures 1-42: Photographsofthe 42 adult cattle; Figures 43-66: Miscellaneous and caule photographs of the Teanant Farm Appendix E: Herd Health History (April 8, 1999 interview) Appendix F: Dies Analysis: Computer Software Modelling ede 55 DUP 296 Tennant Farm Herd Health Investigation Cate Team Reporc Appendix A: Abbreviated Curriculum Vitae of the Cattle Team Members : TT CeifhiceaNraiemon-- esn:: DrV.M-- DP.eDrirpyloLm-- atHeabAeCcVkP-- er -------- ---- Employment Chioeff, PLeuang.eSAcnhiomoallofPatVheotleorgiyn.aryLMaedibcioner,ofaNPeatwthoBoolrloigyoyn CnednteTro.xiKcoelnongess. SUqnuia.re Eaucarion: JunsPtA College (BS. 1972-1976) GUnniisveerrsstiyt ooffPPeennnnssyyllvvaanniiaa.. SScchhoooollooffVVeetteeriinnaarryy MMeeddiicciinnee ((rVesMidDent1,96199-5199.7139)92) Adiliaions: PAemnenrsiyclavnaCnoilalVeegteeorifnaVreyteMreidniacryalPAatshsloocgiiastiosn ---------- AAmmeerriicanAAsssoocsiinaiioonnofVVeetterinaryLLaabboorratoryDDiissggnnostiicians TT beNaemes: Dr. Lisa Davis-Heller CEemrpnlfcoaynmoennst: DPriVvatePracuioner. St. Mary's Veterinary Clini. St. Mary's, WY. Educaiion. Atiliancas: OOhnioo Sisttee UUnniivneerssiityy. College of Veterinary American Veterinary Medical Assocation Medicine (DVM, 1979-19551 OWheisot VVeitregriinniaarVyeMteedriicnaals AMsesdoicciaaltiAosnsociation -- HolsIHi onlrinsatircis oVneatlerViV entaerryinSae orcyirAycue punctun re Socim ety n00S0 een TT Name: CenfiDceasuroeness. DDUr.N.PeDtieprloGm.atMeoAisCaVnP.DiplomateABVE (ood anal specialist speci bese Employment. Education: VCelteevrLeailbnaoanrrdaytSoPtraayit.heoCNlooogrmitmshtunCaainrtoylFieCnloaldDlIeengpveaers(ttAimSgea.tnot1ro9.7f4RA)oglrlicnusluArnei.maRlalDeiiseeha,seXCD.iagnostic EEUaanssittveTTreesinntnnyeessossfeeTeeeSSnttnaaetiseeseUUenn.iivCeeorrlssliiteyyge(o(M5fS.,VeMMtiieccrrrioonbbaiirooylloMoggeyyd..ic1i19n97e758)()DVM, 1981) Aflistions: AMKmaiencrshaiisgcaaSnntaSBtoetaeUrndiUvnoeifrvseViretstyietr(yiRne(asRreeyasriPcdrhes.nctiV,eiVtoeentreeirrnsianrayrPyaPthaotlhooglyo.gy.1919959-51)998 ``AAmmeerriiccaann CAoslsloceigaetoifonVeotfeBrionvairnyePPartahcoilotgoinsetrss ``AAmceardiecmayn oAfssVoetceiraiinoanryofCoSnwsiunleiaPnriasctitioners AmAAemmreeirriicccaaannnAVAsesstoerciinaaattrioynMoefdViecteaerriAinsnasaroycLiLaaatbbiooornatorryyDDisgnnoossiiciaannss AppendiAx: Abbreviated Curriculum ViotfCaalee Team Members DUP 297 esses se | | bee: Andrew Hartten Rob Pinchot Sharron Laas JHLitde : HD Ramsey D.D Jackson 1M Migliore RBanerjee RIZipfel AJPlaytis 11%, 200 : 089-70 EID089382 { SAeNniDoRr ECoAunsV.elMALINOWSKI, ESQ. DoaoPouatLegral,Rboom D078 FPVhiaolxcnei(:ag0i()o30n7,T)D7aE74s619484938 : January 12, 2000 VVIIAA OFVAEXR(NcoIveGrHlTettMeAr oInLly()wi[t4h13a-t4t4a3c-h6m5e5n3t]s) LDeoguagllas Johns, Esquire OGenneerPlaalstEilcesctArivcePnluaestics Pittsfield, MA 01201 Dear Mr. Johns: D5uP7ontto[tcThoeinmscselert1nt-ie3nrogifsfFMuCrt-.h1e4Dr3atl(oealoVsuoarnrecDfoenervreVeredslatdotei'aossnoJCaf-n8ulaoasrrtyaw5me,em2ko0n0ain0udemmmpoaerireflltsupoerBcoioofbicRalilcychieny of ctanoate). pSroemsceenrcmeRienoggfatFrhCde-ip1nrg4e3siteiennmcee1no,vfDirFuoCPn-om1ne4tn3tdaiildn mneenodvtiisrauobwnmamisetnrtaeaTvliSmeCewdeAida.w(iet)ThhnioentiD8f(uiePc)ao-trnietopnoartntoabEiPliAtyofthe to not be reportable. The reasons for that decision are as follows: d deformed * TTTheSeeCrAtoox8uisc)oTlsoSugCbymAoisf8sF(icCo)-n,s1u4db3amtihesadssiNobonesve.enmIrbefeparoxret1de9,dtto1oy9E9o9uPaAlansdbtywbeoetkhaDcuoPpoynotfatnhde3aMteisnt Psruobgmriassmi.ons were made both before and during the TSCmAad8e(eb)yC3o4mp.liOatnhceer Audit * Johudenetd,hiescW1h9ea8sr1tgelVoeifrtgeFiCn(i-aa1t4aDc3ihveiidnsooDntohoecfOWuhaimtoee1Rri)nRvteteosrohtuahrescWebsVee(nWrVeDpoWrRt)ed.toFEoPrAexRaengpiloen iIna citoniscesnttarteadtitohnatofFaCb-o1u4t3 0s.1prmegs/eLn.t iOnuutallll000S0Sd(ipsecrhamriDgteWWsVRi0nt0(oc0ot1ph2yet7Oo9h)iEoBiAnRa.i.vReer.gioNnotIe)i,t EID089383 - Et bem cons 000:2 roCsaeraeresrctrin " General Electric Plastics -2- January 12, 2000 was later were not determinedthatthe caused by FC-143. defects observed in the study referenced in this letter : Thbeeenprreepsoerntceedotfo FECP-A14R3egiinotnheIaTqauinfderthuendWeVrlDyWinRg.thFeoWraesxhaimnpglteo,naWtotarckhsedsite has SuDrovceumyesnutbm2iisssainonexmcaedrpetifar1o9m8W5atsohEinPgAtoRnegWioornksII"T S(ocloipdyWtaostthee WMaVnDaWgRem)e.ntIUnnit bseecetniodnetBe-c4t,edpairnatghreapahqueinfteirtlaetdp"pRbelleeavseless., Spill, etc. it is stated that FC-143 has rTheepoprretsteeodncEePoAf FRCe-g1i4on3 IiInItahnedLtuhbeeWceksptubVliircgisnuipapDleypwaerltlsmeinntpopfbNlaetvuerlaslhRaessboeuernces (WoWrVkDsN'RV)er.ifFicoartieoxnamIpnlvees,taitgattaicohnedWDoorckuPlmaenn(3tVTi)s raenpoerxtcesrupbtmiftrtoemdWiazs1h9i9n0gttoonEPA RpaeggeionnumIbIe(rceodpy18toofWthVeDVNIR, iat nisdstthaeteWdetshtatVtihregiLnuibaePcokllpuutbiloincCsounptprloylwDeilvlissihoan)v.eOn detectable levels (ppt)ofammonium perfluorooctanoate (also called C-8). AdminisBtraasteodruhpaodnktnhoewalbeodvgeeocfortrheesppornedseenncceeso,iftFwCa-s14d3etienrvmairnieodustheantvtihreonEmPenAtal media, both at the plant site and outside the boundaryofthe plant site. 8() repIonrtaidndgitiisovna,gause,youunckerntoawi,n,EaPnAd cguurirdeanntclye(ofnothtehecrpiatsetrisaevfeorraclayveiarrosn)mebnetianlg TSCA r3e7w7r3i5t;teJn.ulyIa13it,s1l9a9st3)N,otEiPcAe osftaCtleadritfhiactation on TSCA 8() reporting criteria (58 FedReg "With regard to interprets section non-emergency 8(c) to require reenpvoirrtoinnmgenotfailnfcoornmtaatmiionnattihoatn pirnofvoirdmeastieovn,idEenPcAe ofwhwiicdhesbperceauasde environmental of the extent, distribution patter, and oamafoucnhetmiocfatlhesucbosnttaanmcienaortimoinxtsuerrei,ouasnldy threatens mutation, odreamthayorsesreiroiuosulsy threaten: (1) or prolonged Humans with incapacitation .c.a.ncoerr,(2)birntohn-dehfuemctasn, organisms `Thus, the with mere large-scale presence of or a cehceomliocgaiclalsluybsstiagnncieficianntanpoepnuvliartoinomnendteasltrumcetdiioan,. raebpsoernttinsgoumnederotsheecrtiornel8e(vca)n.t" information as noted above, would not trigger AdotetshneoltevpeolssetFhCe-1th4r3eaistporrepsoetnetnitniaelntvhirreoantmdeenstcarlibmeeddiaab,ovDeu.Pont concludes that FC-143 oben r(ev)IienewnmevadirkaoignnamigenntothnaelcdereeEcpiPosrAitoininsgosnuwea8s(stch)ienrefnpleourwxtaaebnnivdliiirttyow,namDseunPdteoacnlitdgreueditcdhoaangtcnteih.ziesdtdheactitshieongwuoiudalndce EID089384 coon so General Electric Plastics -3- January 12, 2000 Items 2 and 3: Correspondences to the Town and Test Data on Town Wells (LubeckW)eanhdavteestlodcaattaeodnthtehefotiolwonwiwnegllcso:rrespondences about FC-143 to the town + (LJLuPnPSeSDD1)3w,ait1ne9wr8h9tiaclpehsttiietnrsc(oansttctaeatncethdreaodtnDioponacsgueram2noegfin4tnt)gheftrocootmvhe1rL.0luebttoteec2r.kt2hPpautpbblF.iCc-WS1ee4r3vaiwrceaesnDodtievatiemscaitroenedoifn pwaeualrylcswh,rassiaetmdepntlhreeessseopfowuewslhelisctoahnthdhaitsvheeattaeltshroefbLrePoemSnDtthenesotLewPdSbdDyr.aDwusNPoiottsnttdhra(itsnekeDiunngePxowtnattbuelsrluefbtr)s.oeqmudeinftfleyrent * rMaananarlgcyeshde2fs3rp,oem1r9f09o.2r0m9le]edtXeoprnpabstattmaopc0lh.ee4sdptDpabok.ceunNmofetrneotmth5ta)htrJteoXeothfmeetaLhnePsSnDeeswtpirLmoaPvtiSed.DinwWgeelrleassr,ueltRnseosotuflatwsare ofany writen response to this letter fom the LPSD, Follow-up ahpespirteactieaIttfeoycrooeunctenaiecvetidnmgaena.ycIoafdpdGyioEtfiositnh.aolulidnfdoercmiadteiotno sorubfmuirtthaenr c8l(acr)ifnioctaitfiiocna,tpiolne,asweedwoonuoltd Very truly yours, Attachments Andrea V. alll ce: SGtEevPelaAsutsitcsin [Fax: 413-448-6590] OPinttesfPilealsdt,iMcsasAsve0n1u2e01 MDaanlaegVearn, EDneviVreolndmeen[tFaalx:Pr30o4g-r8a6m3s-7128] 2G.e0n.erBaolxEl6e8ctric Company, Plastics Mfg. Div. Washington, WV 26181 RBoebmearrtdRiRteiclhleyy,,DDuuPPoonnttLWeagsalh,inWgitlomninWgotrokn,s DE EID089385 cag n 11 000: 5 | . EKraetchuriinneeDEisRceod. PAD. ki 4 03d ESnurveitryonSmeernvtailsTechnology 9PB0uOi0lBdBoiunxsgh34A32v33e8n3e6 i Spal. MiY 3533330 3M . .: : November 19, 1999 CERTIFIEDMAIL 220450 ATER ed ed 8 ech 1% = E 3 38 (DoAcumeSnetctPiroonce8s(s9i)ngCooCrendtienrat(o7r407) UOfSfiEcePoAfToxic Substances 4W0a1shMingSttroene,t,DSCW20460 =Z as = Re: ATmSmCoAn8i(cu)mSPUeBrfSlTuoArNooTcItaAnLoaRteISCKASNHOT3I82C5E-2O6N-:1 Dear Sir S3tMudbyapserrefcoerntmleydcwoimtphlaemtemdoanireuvmiepweorfftluhoerodorcatfatnroeaptoert(PoFnOaA6)-bmyonCtohvparnicmeatLeabfoereadtionrgies, Madison, Wisconsia. M capsule deposition of0 ale cynomologus (2=6), 3 (n=4), 10 monkeys wer (1=6) and 30 e give daily (n=6) mg/kg doses ammo by intragastric nium S`peevrefrlaulcrwoeoecktsa.noaDteo.sinSiggwniafsicsatnotpipleldnewshsiolcecutrhereadniinmatlhse r3e0comv/erkegd.doDsoesignrgouwpawsitrheisnumed at a2n0dmhgi/ghgd.osAet tghreouepnsdwoefrteheaslilxomwoenttodhrdeocsoivnegr pfeorr9io0ddatywso. Oanniemhailsghidtohseecaonnirmoall, wmaisd asraecrfeilftitcoiebndemcoomrpiobuunndd-rceolnaditteido.n Ootnhdearyhi29g.h dTohsiesaanniimmaallssaulfsfoereexdhihbeiptaetdiclilveesritoonxsicwihtyi.ch The following findings are being reportedby 3M under TSCA 8(c): - &TSihgemnriyefkiwcgaainsitnaioynccr1oe0rarmseegsdhpgolin/vddeiarny-gt)oa-dtbveoedrrymsiweenpiaaglthhtsolraoatngiyeosi.wnetrhLeeiovtbewrsoewrleoviwegedhsttipndraoleslsedsgoerssoeuwgpersorueps. reversedafter a90dayrecoveryperiod. 35S =: 7& =2: - SdPooreeslceirgmvriconduarpinys 3aanrlaesliylmtiiclmaalrarterosurltthsoosien3fdMfiocuaCtnoedrtaahmgeoesngeGrruotmvheelehcvihegelhsmeisoctfaPPlFFprOOoAAdusfcoetrriutohmneeslmeevptellwosyoeleos.wer =e -- & W19o7r0k5p.lacEempmleodiyceaels'sufrlvueoirlolcahnecmeiaccatlivlietveeslsh,awvheebtheeernmceoansduucrteeddaastt3otMalsoirngcaenitch:e = fluorine or as PFOA, have not been associated with clinical bepatic toxicity. I : EID102775 > z ------ --B-- EHQ-- -93-14e53e6----88-- 00e8e0008-- 36-- ---- -- -- COI a : (DAomc:umeSnetctPiroonce8s(s)inCgooCrednitnearto(r7)407) UOfSfiEcePoAfToxic Substances PNaogveemNboe.r2 19, 1999 - TcIenovnaeddaidltiitaoisnopneo,cniofsnitecudlcyoawudsadeyoosf1e3m5(o.3rbmAigdn/iktigyn/.ddTeapyhe)entdeeefsnftteacnptiasmboaobllsowegarysversdeiavcnirtiehfwiicosefdaitnhniismmaoclarsiweebrduieaddnnoott CCoonmspiosutnedn-trweiltahtetdh.e sTihgenirfeicwaenrtehenpoateofxfiecctist,yootbhseerrtvheadnaitntchreeahsiegdhldiovesrewaenidgmhtaiy ntohtebe remaining three animals testeadt the low dose. 3ThMishcahseamnidcawlililspcroondtuincueedbtoyco3nMduacntdmeisduisceadlbmyoniintdoursitnrigalofciutsstcohmeemriscaasl apprrooduccetsisoanid. `workers and to reduce potential for worker exposure. Acopy ofthefinalstudyreportwillbeseattotheEPA whenreceived: . Please contact Dr. William Weppner, 651-733-6374, for further information. Sincerely, >z: EID102776 g 00aeT 112 or [Er | Dear Gerry, AECseepTodEriotsuscyuisaascndeeddanaoyhndAoptsrhuiell:fonr1ae3tleebdvyanpptheocnfieln,ufoorrEomPcAahtenineoiencdasilnst,oyouwrrietvpihoewsisneicstosimaiplloentfeoorcucscoopniotenrsoPlFofOoAnfinal ESTrpveairrfsointmoernnsetTaoluctgafinanotgiecpSahucaiirtdme)as:cokaiInnhdeetiinrcfesoq)ru,meastetineovdni,cionnafnnoedmnathtauilmoanneffiaenncdctlsuednevsstiurdohineemasel,ntthaleffeexcptossuce iSEVteaugidaliraedbslteoa,npdwreoijnerfcoerqtmueaedtsitcoonmt,phalteitniycoolnuuddicalntagermiofanynidttophrerionvsgit.daetusuIsfoWffiitnahanly troheengpooliranttgsestsarteuadndnioetsmoswtith ee Elen SE i preriminary reports in your possession of controls W2e000r:eq"ueRstethgatayotrhued'upirlovfniodnegatu"esdwiptahcfltuhoezoacbhoevmeicianlfso,rmoautrioniniotniaPlFOAintbyeceMsaty 2i6s, Ehoecuhseodveon{phefrofcimuaotriooonetoynlPRsOuSlfboynicAPFaiclid28(,PF2S0)00and we request Sat you provide pE1eecfyloCuuhoermhoiaccvhaeelnsaincyfaolosaf,lltvhoeew aufsbeoqvuteeosticnofnthofaritmr,amtiboouynrApoirnnitleorteh2s8et,r, 2c0aa0nr0db,oxtyhlyeoanutperdionvioirtdieaslulltyhfeoindaetnetdify pFoerqtuleusocreodchienafiocramlastiobny Mianyyo19u,r 5p0o0s0seasnsdiononofothceorntrcoaltboonxyloattheedr pseurlfflouncartoecdhemicals mBays"t euseekfulllatyerb,e apryovi26d,ed20i0n0.chTehmeicailnfsopremcaitfiiocn oinncrtheemseentsadd43ititohneaylaccehemciocmapllestecda,n Sth completion of the full submissions by the dates requested. A feu points of clarification regarding his request: >TdSuCpAon58t(en)e,edan3otFilrse,subumnidtercoFpIEiReAs) ofaltshtouduigehswealdroeadryeqpureosvtidtehdattoyoEuPpAro(vei.dge., aunder cSogmapirneshtenosuirvehobldiibnlgiso.graphy of the studies already submitted so ue can check this c35oipdiieess o2fs daecsucteeibsaydsteimnicchetoDxaitcaityAdsetquudaiceysacnadnrboebusltimistuemdmartyo tghueidaknecyeodrevceriltoipceadl aZo'rBitbhleiogHrPaVphCihcallleinsgteingProagletshso.ughUfnudlelr cthoipsiesappcraonabceh lalilmitsetduditeosswtiuldliesbewhciictehd (i1)n ZSoeuvteescoor'id(e2)ntirfeyporltowecsbtser(vie.d..efBfoescttstworhiicc)h dlieftfhearl dforsoem vtahlouseessbeyendiifnfesrteundties {using che same route) submitted under (1). S>u3tkliinneadndfoeryeaciurtreitastyisotnemisctudTioexsicictayn b(ei.he.a,ndlSeudbmLiCn caompaiensnerofcotnhesisKteeyntofwictrhititchaalt SSSttuhubedniriecscierwdrhiistcachtuidosineersvs.)etudfioessetWhiocuht tshheowirerfifetcattsiownhipcohtednitfiafleroffrtohnetchhoseemicraelpoarntded in >1at5lh7l6e.situndiFitoerisalsatruneddqieufseosrtcofnuildslugcetcneoepdirepasrliloyorfltsitomuidt1i9ee7d6s,toivnesttuahdesikefsoflorcloonawdiubncigtbeledinodgdpruoaripinhntygaroleriassta:ifntger gSeonxeictiitcy;toxiimcmiutnyg:toxsiucbicthyr;oniucptatkoex/imcietcya;bolriespnr;oduCchtriovneicSoCxoixciictiyl;y/dceavrceilnoopgmeennitcailtys neuzotoxicity. >anrde'gdaarcdai'ngofextpheosutryepesinffoorumnadtiionn,theweUsaereamnodstExpionstuerreestIendforinmatrieocneivPirnogfilienfo(rVmEaIPt/ion tshueelslulUtcEsoIp?ioefhsasexopbfoeessnutruedUiseeosdr hmtooenrisetuoprpaoivrnatgilSasIbtDluSedieaasnsdse(sihsnumcmelannutdsianndginednetvthiaeriolUnSs)meonnatnadplr)oi,cnefdiounrrcmelasutdiioannngdon mFeetlhaotdisngusGeodthfeorulstaimmpaltinegenavnidroannmaelnytsiasl. faWtee aacned dalissoeriibnutteiroesnteodf tinhessetudciheesmicals. ; - Coven EIDOS012:7  I In order otno TmanOiCniyotuapasii,yvnecnoetmh1cep5ha0einmnysitucuebagnmlridtietraysthTaeoSfCsAieynpo$fu8aorcr(aam)tsaeutbifmo"einFlsoasrtaisionYngossuu,rptpoplIletnmehfeaeonssmteeastcsihtuoeobnmmi'iactnayl(asFpl.YlIr)iorAs oR I or Eaiuieirsrtaieeonnasben"cvsistuhisnireaetdgevadarndcient,oapctlcheoearsdseaunbcmceiosnustiiatochnt apFrpeopeclzeiydcuaOrb7elBseE,yparnoofceydouurewsi.sh `tIof Go3-260-3403) L you hava e any (gSe0n2e5r6a0l-5q7u1e5s)t.ions1 trheagnakrdiynogu itnhisadvraenquceestf,or plyeoausre ccooopnetraacttiomne. by CCSEhhEaeRrmeiieec"salswe.coFnAoutterirou,ltioDDniirveiPcsrtieoovrnention and Toxica/OPPTS/EPA S.eas Eg 2 38 EID0s0128 | | 7 0H8o11m51i20R0a0m1s2e4y2 PM To. JIRoorbhebnliaGnnrdBlaaCnnLqIeuDrLsePUwGArAEISD@/DUDuPUPooPrrE,i@@JDOoUhuPnPooNn,A,uRDgoasbwTenrAtEODLJWaRPciOkcNihoGenDy/CUCLPLIo/DnDUUtPP,GonnJioh@DnOuUMPMPoin,tg,oArLtyAhnLownDoGyoKPdoni@DuPon, PlayisCUDUPoN@OUPont Roger J S96AEuPom DuPont Ostar TCarre uPon@DuPant Sibiect EPASideofPFOSStory NY Times oe FoardbyHOn RaaAEDUPor anOSA 1241PU ere From: Bemard JReilyon 05/19/2000 05:32 AM To: ARRGaombseUerytAAEPIiIDnDcUUhPPooO/nDN@E@OVDuIUPAPaEroDtnU,,POJPnaotu@nlDJSuPBSooinesgts,EeUrMiRAc/EhDIaAeDlPuoPMnoIn@@CDOuuAPPoonSnt,:DHuPDoindt@DuPont, RicharJd =Sibioct PASideof PFOS Sony -NY Times May 19, 2000 ELPA. Says It Pressed 3MforAction on Scatchgard Chemical By DAVID 8ARBOZA CHICAGO. May 18 -- The Environmental Protection Agency said today that it had pressed Minnesota MhceihanelimtnihgcaaalnndcdotMhmaepneounfuvanicdrtouunrsmieendngtit.noSccoamfcehguaprwditahnad saonluataioyn aofftehrotuhseehcoolmdpapnryod'uscotswncotueisdtsphoasde sahsokwntothhatumaan {TmeahsketsiEns.ghP.otAhw.eedactchhceaomtuitnctahlediucfsheeerdmsificnraoSlmctcohlocamhtpgooafurn3ddMas,nfdwahimilacedhntysoaoidtdehcoernompMrpooondsudecatIysnbtthyhaettehtneehvianrddoonvomfleutnnhtte.aryOieflfayirdciebacelicsdaoeufds3etMotshsteaoyp hey have no evidence tha the chemicals pose a long-term thea to human healt Wmfafhroikmleett,htehaemgaer.nPkc.eAyt..ofTsfahicedilotsffisicdaiiadnlsotthiastdeIefta3hMneyihgmarmdeewdniocatotanecctseeadmfeettdhyeaiybkwoouuftolrpdocthoeanntvsieuamltealrkosennugsstieenrpgsphtreooadrlutechmtsosvknesotwthoeohnpurtmohdaeuncst aantderaaniSmMalsttiusdsyueshaonwdetdhatthhatigthhedocsheemsiwcealr,o pkenrofwlunortoooKcitlanlya!bosrualtfoornyatrea,s.ingered or years in human blood lp"eToshntegircriledeesrsucasonnrdsaietsoqexudiecnascnueubssm.tbaBeunrtcweosfeactdonotchneetmhs.a.Pv".eAs.aeiv"diWdShetnaecpe1hesnu1gsJgouehnsnstsasofnteo,nwuohswoi.swhoartksthienrethaereofpfoitceenotifaplrlyevention, aOrfeflnaolsloonfg-3tMe,rmhocwoenvseerq,uesnacyetshtyo ahruemaabnsohleuattehl.y confident that thelr products are safe, and tht here a"TMh.iswshinchaishebaalstedssinueSt.noPwau,la.nd t won't be a health Issue," said Lamy Zobel, the medical director at Tthootuhsaenqduseosftyieoanrosf,w0hebteheartthriesabtudhse suapdi.n humans, it would havteo be a long time, ike hundredosf Many scientists have praised 3M' decison to stop production of periuorooctanyl and elated chemicals. oo eededt EID0S0088 "`OaTmbhvoeuetrrteshaialytibosfseucKeaauinsssteaisfsMcseotduufilfcdaablcecCutemrnuotulebalrtee,is"n,SKaaainnddsJaiosfhCniatyDc.ocuul"mlN,uolaacthreeetsmiiricendatlphreiosefoectsoassloylrystoiefnmnc,ioicynuioocuaulsh,taoavxneicdtooltobsgeyeweaotmrstrhieed nce able that anything that accumulates would nt eventually become toxic." o11iadsd.itioSnartpootSseoatncdhgiasartdheprr,odauncdtsi,ntphaepecrhepmaicckailngi,s usnsaecdka-1s0s0tdabnagresp,elpleatn-toaondd bpargotse,cftiirveeficgohattinigngfoonam and pesticides. eTSnahvmeiprElo.enPsmeAt.natks:eaniftdfariptospmedeaacrrisosuiinnodnwittdhoieipfrweeosrasdn;d3Mahnurdme,satbneadsteiosdnsuofenouatrrhoceuosnntdcuedtmhyseo:wfotlrhalebdo;croattmaoprpoypuernaatrdss,isiitnpheharussmistathneenbptolitoneontdthieal to harm humans. T{CnohanettiEindPuyedA,.tmosaagliedet iart newgdauslfaefrmradstloesaelaestrostfewdaetbrooeutthgei3v.se2tnumddiyollsoifegslraaobmfosrtaphteeorcrkhyierlmaoisgcrasalhmoaornfldybtoahdteyenrwmefiat gtwheatds,.cmWoohnsdetuncoftaetdpherienogf1nf9as8np8rti.fnagItn died within four days. "YWoiuthgoailngthtaotdion?f"orsmaaitdioMnr,.wJeohfinnsaollny attaltkheedEt.oP.3AM. and said tharaises a number of concerns. What are Texhterreemeislsytihligah,dibfufterE.ePnAce.ofofifnitceiraplrsetsaatiidont,hhaofweewveort.heOrffcihceiamliscoafls3wMosualiddhtahveedoassessegvievreenatnoetfhfeecrta.ts were "This i fay toxic stuf in rats," one E.P.A. offical said. "Theres clear evidence it presents a problem in ats `tBhuetc3hMemsiaciadlist hsaodthnaott yeatppdeetaerremdiinnetditsshueecoarubsleooofddseaamtphleins.the ats nor how humans or animals ingested "Thats a very interesting question; Mr. Zobel said. "We can't say how t gets ino anybody's blood." AGso aawraesyulwtitohftthhaetcuhnecmeritsariyntbyy, tahnedetnhed poefrtshiestyeenacre. Tofhtehecocmopmapnoyunsadidinitthneegeontviiartoendmweintth,t3heMEs.aPi.dAi.tbwuotultds Gecision was voluntary and there was never a discussion of recall of the products. 3diniMs,rceowcnhetniitcnhwueeiseuktsshie,ngoanfttlheyer ccthoheemmpia.snPtrAyy.kbnaeoshwkinenddtom3omMsattkooefcpotemsrefSlcuuooptrwociohtcghiaarandyslop,lruhotdaiusocntb,se,tehnwehsciecoahmrpcahacincnyogdufenotcrifdaolretdaebmtaootuitve$s3.00But milion n sales,o less than 2 percentofthe company's $16 bilion in annual revenue. inc ne anuncamenton Monday, he campanys hares Nave gained 31.125, as asta7.0825 today. 3cMo,mpwahniicehsatlhsaotpursoedutcfeosr Pthoesirtp:rondoutcetss.and Scotch tape, will sop supplying the chemical to other St : eeasss EID080089 14 009:47 : 7 H0oSmaTRam1s3e4y8 To DHZHaiMNlaInoADrCADJaCUaPDrcaaKriiCnGLi@OOu@uUPPDPo:unSotnNPi@JcAoOaorUniPEGnaA anJRroB abebArEou Lur sApioeBcenhnbea e ent/aCeaLpIonc DmUyPCon@SOluePronr Jom tn Subst PA and Canada on PFOS and Related Pducoalys - 8ANews Ci LT -------- From Te: BBoaobmsaaernrePAJiEnRDceLihoonuoiDn@E0DVuA5PE1oIDn8U.P7O10n25D@0e4Ou8U0tAPa0Rnta, Jomn sSDUeeSGEyURIADUEPaniS@DouPoynt, Pauls 2SMM0IgSoaUUIDAlDUAPTnSoDnAoL@OPOoAwUuNp@osCo@DNnOLGkuDFORPoUooAunPNb.a@EMePnDar.uratP4BhamNnu.&,RPEeecureaesnlkAA@oMbEuauthaPDensuStoMABmEE ErmoeENSProL Gerth, i R ZKPJaae3mrmkeInsuAaEdKIyAHO/EUADPDUiouPnRaGoAgDnnEUiEP@DOgoOuUmuPP,POiooDNnna@,rHnOeuMugaFsh&arnJWotCHn1aEDsmrAaD EsMaaDttaTora AAOmCSUUePe PPoOsnRGmE BeoenreeuTiarree)n Siejct SPA and Canada on PFOS and Rlted Peruosiys - BNANews Ci : INFrSoiSd.Na8y15M2a1y/91490.22000 Page A-14 News CE3hMPeAmHiaHcsaaslMaNSjoaofreRteRygeusleaatorrcyhPTleanssionng UPnRdOeSr:Way il5iesd10reoamritheomkanrokwetwhbeyt3hMe,r arengE:unlvaitroornamcetnotnalisPrnoeteedcetidononAgaobgrcoyuSpeofccahewmeicanlsAbesaneg) Aue{ns8ive5nidteo0innsmcabeeenmrttteta,eitrneiumvsneeid,naeitrtnhsreoteucasginosdhmtpahinahotenwSycpcaheomarlpsfcuahvagnoraywcread$cd3pt6rtaoonhdcyeuocSnctdoh,unecpmatiatcfreuairltt(shPeaprnFohdsOeea)mdlothnhveeeahnamdeauaent,vsirrwanohsncemtnenwtaal {TS20rnhodEedPubSAcoLtxoePifasnuieolnf.nfMofaiamtlanlutnoiswoeb-nsuapasPbeiFondOfuSotcr-mohbamteaipsoaaned.ndvyeTcrahhsneeenmTioeocuexancilcctsesSdaufopbeflsrnatndsasuensnMctdeanisaynlgC1noE6anPtrtAoripaehAsancesstbesr(reo5qau6untiiEaraelNsprssoaAafkobarroberlroeeret Shron, o PA Searchesfor Cousins z g2 [LURE EID072413 CmEhaPeyAmiricselataliteCndognt"0crooudlseiDtnievcrihmseiimonniecihanlotswh"emaOarfenfiybceediinosgfcrPmeoatldeleuP,tiFoCOnhSParrcelhveeesnmtAiuiceoarnl,sadnaiarreeTcbateoxirinsog,fmEtaPiAdd'eSSaNnAd Mhaoyw wr1ie7.lphorT3thieSnigamigalneadnrcctyhreaimcsikspiatnrrgtyi.mceuhclaehralsnyaiiidsn,mtsear.tehstoeudghin miodesnttipfoyilnygmtehres paorleynmoetrsmetahastuarreed bienintgemTaGdaA noBetecrateuoqspuei3rPMedFoOfmfaSicniuiasflaascnatiduo.lrdetrphserotcdooucmcoptn-adtnusyctphreaonsdvucicortonindomnuecbnteteagdlavnoirrmtuhoaerlalelyttehhvtaeenrsyt5s0tooxyniec.airtysHtoaewsgetovk~enrEo.PwAanshoans. PFOS, and some studies have been done mare than once. EfoPrApoessxipbelcetsretgouildaetnotriyfyco"ntternoslso,f Asuuebrstsaaindces in commerce that may need to be reviewed cAtohuleelreocnstlaeyidcdpotemhrapitoadwnihcyiallmelay3kbiMynwgEaPosAr thohanendcpihrieenmdgiotcmhaielnsasnumtbasmdtaaennuocfreaicimntputorhreetreUodnfintPteFodOtSShtaetmeUasnt,ietrHieadolsSa,tiaidttewcsaatsa,not EmianCtdeiFrciiaatsles.uthsaTethdtenhetroeetchhaenrroelcoootguhyneturrsiceeosd,mpthoaenmisaaeiksde.thtahte astublesatsatnchea--veelethcetrcoacphaebmilitcyalofflmuaokriinnagtohneor uBUpSecScoamuofisfneicgitawhloesrwtkieilcnhlgneogalrdooaguypdfimoserceumtsaiskniigonnogfabPcoFhueOtmSi-wcheaelltahtreeergduwlcoahrteoimrdiswcifadrleosmceotxnhitesrtOsorlignaanoritezhnaeetriscodonuendftorraitesa,n . Economic Cooperation and Development, Auer said : crPehFpeoOmriStcpaarlroedcunocomttpiaronenpivoerostlutdhmatetohatanhndedoaltnehnmeuraolrienTfotoxrhimacantRi1eo0ln,e0ta0os0EepPIoAnuvenendvtesoorryyf,ftohhueermsyaaeitade.rrsiHaiolnwtaehrveee"rr,eTqSuCirAed to Inventory Update"ofchemicals in commerce, Auer sai. acHhneeymoafilctsoahlessaifadendPderFpaelOlsSytifccuihndeedmseidcinaelhxspuoamsraeunrneobtlsotaoumddoiaennsgdtthtahitessscuehe.eekmitcoamlesacsuurrreentalnydbeiidnegntloiolkeevdelsf.or in SScormeeen,a"gAeunecry ssatiadf.f have described PFOS as "sailing under the agency regulatory radar "cenIocsmop0uar0naigeeiasrnlgtyoatcroteipkoonnrotowonrwthcheoentitrhreporalrat,hersierugcuplhraotadisuocn3tMii'sonsn,oeveorldwuehndet"atruhynewdrietlrhetTdtrSearCwsaAtlotfchraootmmwpoatuhnelidemsarrekqeuti,re would adress tis issue, Aver said Company's Responsibilty ptTerosoptdiu3ncgMftosiornftftiehceraalccshtwieinmttiechravtliheebweeecdnavbuiysreBonNtmhAeensc,aoiemdvpteahnneayfcothmarspaaanpryreoswdpauocsntsiusbnicdleotrymtamtkoeiunrngcdreiierafssleetaarhncadhshaeonnwddeidt.s brBieelalesnCoonsynhweoe,wnasretenoipbohreavssiiacnfegepiornuetdsoitdzhieesnntpsfrooorfdrtuoecxstiecsaitrtychtahetsattnsi.dsTdnheoevtesfluaosctptamtiehnanattbmlaeit,n"3uMet,evetqnouladtnhtBoiNulgAehs"itothfeh.tahsis emantoeurgiahl1h0aavcetbheeensaiidd.entfied in the environment and persist in the environment i reason 0aEsn EID072414 sWa3uaMvbssenntaiassgnhltioolanrmie,dTanin3en5Es30ePvTAeormroaalytfoeburcorixaeislsoadrro.efmadTdatnteoean"loinoepmdiaas3ri3scoHhneOnm.isg0c4ano-lfo,0iu0casa3enl7dd33mm1oilrnheeeTbTeToSxSCpeCrsAiAmauaSrrbeyreeibxepeasemcmi.toerd to cFreermcircoalochtaatnheassuBleoennatieh(CsAubSjeNcot. o2f7m9o5s.:3o5f)S. Fan eEsotninSg aendla3n0al4yse poctsncn No Sussitues Yet CRfforoerosydFensaeOcriscSsahiewdiirnlsrmraaoettsm3tbayifnhihieasnveceSnocsdmoamlodcfehr2tg0cah0ery0d.baeprpcreraootdudruuscceetttei,honCyowvayierneebyfse8aahdrrams.liiaieHawdetaeaytd bfeeoosrnmehSfnisMntim3nagonuwfsauScbetsouttrtoiumntagaerd stes-one n Alabama, ne cern te Netharands. nTexahpteencdtaeecddi"sconnnectseoanadbeaandtoansaho$w3e0d0 imniellpornepsreondcuectofinPeFwOiSthnoutpaacseusbwshietree rewaodsy wnaess "not al sTinchimeeinicnsuottm.epoauxnapyaniibnteeesg.saninsbfooosd tfo rmedaucbeooresleSaasnekswofotyheeasrusbs3t30a.ncKeawnheernntewRaesedd.iscoovpered ae3seMsocsctciiaehtneteidsctwhsiehmhai,vceawldielsvbhelosSpuaebddmiaTtnhededrmeoeftinhPeoUddStcKohCgOyaI,bOonwrshtco3hr3yhma5es6tghoiooddosAttbhrartaawtseoorreoynursaaecdictsoeasd :. Canada Welcomes 3M Decsion OemnTadTtoAefWs2A,0-0E0TnhtveihrCouansnmeaeodnfitapMneirgtsuotcvereroroacmvieainndty|AwcnehleacromsmsoetnsystianihdsdMoemcaiesio1o6f.niby cMomptanpyh'assesputecbyythe oP(PrrPeoFrhttAueu)cmotcraiaaonnnschaAiaalocnftys(s!,CucbEAhsPnetAdma)einrcc3saeolsnsrdewsqeeaunrdieii1eagdmjfounnnthg1se9rta9hie9eavcmnioedemnewmtreawrtcihipteoatCHleanoctnhaiaeanlmaiMnciraneEslatnsnetriotAgeltamnpneaarFrusovocirkconamleknyt A{wT9geheeeenknCcsatynHywaeadaaisllalsnmasgCnoaounfvsaatecudrtyamuieranenngrtdsaiEatennavdcmiaerisodmnpsiomoreftMnecatrhrsCecamohinfca2ta0dle0as,0cohfhfieahctmisilttshcaeatwiUelamsneu,ndstEegnsahvtaieh.reora1nufmoeonhnrtetamelcasoPtmrmioitnoCeogncnEtiPoAn Canadian sage and toxicological momaton. 536, 8 Pete Menyasz Copy: 2000 by The Bureauof National Ata, Inc. Washingon D.C. eonye EID072415 2M Ph1303 Out Someofts Spaciay Mates 3S6T01A0YsccMuacnnecsatraa fMaeyt1e6s,20n0d0 Srasmyranoatcuences 1 han out of secon cram SS{pT3ane3TnesyinciaSnicrSeEaugroosSnStrasaSntnota"aaBcttGyuoaSrchuekastasegrnecEp.trhesfsere3natdTidg3cn0iiiuaotongbnaydmep.ewrecinaerdnnatooefsfpooIawecyeaayerrcaoaonromdupw$oc1is8ewairossokoinwfniisnhhsaecrsroeyamcomnaseeetse. These mcs eeees HASLmPiIOS GnUEI14a3nTb5eaBn4u15se0codaheOcforeuictniCrvreilaeyclsoosrRnmeooefrceer3necpaeonskns4sn0elgevsaantrsceet4eSarrnersoiaueet0nmp,t8 mmcSoeesucmmaamreeessvrrs ag asne enea e rs, + cSluasettaecmerre3 ,stCoocmemiunngi0 etiseesuracnedsvt oesscctisr.sh tRoocnhovvaetciaon intmroerssssoaf 3tautnScoopaorunrieters snaotocha notogen Th eSCSoTssmoeiprosuvmcneardany,ttokew1ee0lsivtniilnansgrpGcmcoaoteoeslrainaAttllsscenxc-sseisn4ogahmrSevcnradearvinefmhleeoenpxteahdocoaiwnniardnbeseyveSaerlrslerccaaaensedtslfreeahwakaydetyaWrosoe-esrsxshtseoenewrcnenaaptxehinseprsstant at SCaamkaas essammaieens oir 8yoer5tL2000 Th exces 3 naemscharge on ie ses Spam ETag3acrActeeucsSramstoioSnnoessmflgeaaiawystsedasgLWrsOeroewDemeoSxrisemecooqnhwmsaecpsrohsoifhavnaeannmvraanarmdas4GnncEtdoOnuwoemMytcasrucoyunTfohifaadonauncsttalrienoecuwrtoomaonsnsw nyaesncam omrntneeta caeorveseescrS?ondsonwn : ove Caner nays sinates GeSimane 4 f Sa 5G0ar1rPo8aoi8bn3 ouareiaiocnvnaegPprrmblraoamerncankseeinmtotse,nnawtcaaouyfhsS"copnfdreoaoivvsainaosinntmmieanarmnoaoidrauAscCtthusasnn,nf6o045dnCddoou(1sn9tneec,swaceoanstskumieeosrrc,iSaTohnnte sgcoaenpnasen,esansntce,enohmeaayth Gren. {{SfFaookplrnasemvacaa4trsin0so-npPuLcnuaocttoreunranagatnsgoStntoeeastsneImAo4encnaetursattCcMoauokfaricenngo4psso3ra.4tlsionanamrcodf.nei.sTnhsre(s1s)wmawoyaannSesoewssrcmt9s0ahskttcocenolasmyoistcthwooaimsnMebsfno as)teomertehafranncairlye IAC Shortages Inid cseessaetses:n)hhCeottomfveayndowectapeaanlce.oaf sne5wperonecrisure ange Seater is 3 vadamarocf company. IIFMrMoCPmeunstiecr.RSeautionngs225.15.15 . EPSUronaPea:uw(6i5o1)7mS3531c0o60m100830 3MHormel(News and Profi] Pres Bor) LCeogamlyGunsatn19e5s7 3. Argh ese essere 039: EID072415 | ar a DuPont Haskell Laboratory Ene il .. o[ceolueaormtaraemyeter . . Caf 2) Ar asd Soha RECEIVED w May 25, 2000 JUL 08 70 LEGAL Mr. Charles M. Auer, Director U. S. Environmental ProtectioAn gency Officeof Pollution Prevention & Toxics Chemical Control Division 401 M Street, N.W. -- Room 403 Washington, D.C. 20460 Dear Mr. Auer: LAasborreqauteosrtyedw,itehncAlmomseodnairue mthPeesrufmlumoarroioecstaonfosattuediaensd conducted at DuPont Perfluorononanoate. Haskell If you have questions, please contact me at (302) 366-5259. GLK:jhh Enclosures 3 a Si ly, Gerald L. Kennedy Director ~ Applied Toxicology and Health . 4Po 2 NemoursandCompr Co0can EID091521 roadon treatin. SUMMARY OF A STUDYSUCLOFNODNUACTTEE(DPFWOIST) HATPODTUAPSOSNITUM PERFLUOROALKYL Type: Species/Strain: Sex/Number: Exposure: Period: Frequency of Treameat: Exposure: Levels: Method: Biopersistence Screening Study ~~ RMaatlse//SC/rgrlo:uCpD.SD(IGS)BR 5 or 10 days; 94 daysofrecovery Ad libitum for5 or 10days APomtmaossniiuummpeprefrlfulourooraoloycltasnuolaftoen:at2e0(mPgF/OkSg): 10 mg/kg Speirxflgurooruoposctoafnroaattse,we1regraodumpinriescteeirveedd ammonium the test substance for s5ucbosntsaenccuetfiovre 1d0aydsayasn.d Atpheprootxhimea$rteglryou2pshoruercseiavfetdertthheetfeisrtst dose, bdolsoeosd. wTahsescoellseacmteedraftrsowmeeraechsarcartiffircoemd othnetgesrtoudapyde$saipgpnartoexdimfaotre5ly 2rehmoauirnsinpgosgtr-odouspisngr,ecaenidvebdltohoedtaesntdsluibvsetrsanwceerfeorco1l0ledcatyeds.. The Five rats (w2erheousrascrpiofsitc-eddosaen)d,h1a3d, 2b4l,oo5d2,aonrd9l3i/v9er4s.cTolhleecttoetdalofnlutoesrtindeaycsont1e0nt of the blood combustion mweatshodde,tefromlilnoewdedbybyusainnaglyasiWsiwciktbhoaldfltuoorrcihde ion stehlreocutgihvoeuetletchterotedset.. Body Liver weights weights and clinical signs were were recorded, but not recorded reported. sSuilxfgonraotuepsasodfersactrsiwbeerdeabaodvmei.nisFtoeordedapnodtwaastseirumweprereflauvoaroiallakyballde laimbmitounmituhmropuegrhfoluutorthoeoctteastn.oaCteotmesotiglrwoaupss.used as the vehicle for the are: `Test Substance: Potassium perfluoroalkyl suspending it in com oil. sTuhlefornaattieoowfaascedtisosnoelvteodcionmacoeiltownaesbefore 20:80. tested Negative controls of as described above. corn oil and corn oil/acetone were also No Ammonium perfluorooctanoate, purity 93-97% Results: P#2o1t9a5s-s3i9u-m3,pe3rf-l8u%orCoaAlkSyl#3s8u7l1fo-n9a9t-e6,,pu3r-i7ty%8C2A-S86#%29C4A2S049-3, R1a-t3s%dCosAeSd #wi6t0h27a2m.m25o-n1ium perfluorooctanoate exhibited wet perineum and diarrhea during the dosing period. Alopecia was eoqbusievravleedatdsur(ibnlgootdheorrgeacnoovfelruyorpiedreiolde.veTlhs)einnorramtablliozoeddpueMaked after EID091522 00050 Reference: T5hdeayCsomafxdowsaisng51a8n.d12the4n4d.e8c9repapsread wtihtrhougtheorumtinthael htaelsft-ilnigfepeorfiod. (8.B3iodaacycs.umuTlhaetiAoIn)(Awcacsum64u9l7a.t5i.onAInndaerxe)a wuansde1r2t.h5eacnudrvtehe(eBsItimated fluionrfiinneitcyo)nt(eAnUt.CITNhFe/DA)UCwIasNFca/lDcuwlaatsedcaalncdulnatoerdmaalsi7z0e,d78f9o.r6. dRiaatrsrhdeoas,esdalwiivtahtipoon,taaslsoipeucmiap,erbfllaucokrooacluklyalrsduilsfcohnaartgee,exahinbditsetda.ining wofasvaorbisoeursvpeadrtdsuorifntghethbeordeycdouverriyngpetrhieoddo.sTihneg pneorrimoadl.izAeldopueMcia equivaleats (blood rise throughout the odrogsainnogflpueorriioddealnedvemlsa)yinnortathbalvoeordecaocnhteidnued to hsatlefa-dlyi-fsetaotfe.40.T5hedaCysm.axThweaAsI98w9a.s8559.01a1n6d.9t0heppBIm wwaitsh5a83t8e2r.m2i.nal `The AUCINF/D was calculated as 566,479.1. DuPont Co. No.2922. (2000). Unpublished Data, Haskell Laboratory Report SUMMARPYEORFFSLTUUODRIOEOSCCTOANNDOUACTTEEADTWDIUTPHOANMTMONIUM Ecotoxicity Type: Value: Breakdown products: Method: GLP: Test Substance: Results: Biodegradation 13%at Day 28 coy wMoadsimfeiaesduSrterduamsTCeOst;(eOvoElCutDio3n0.1 ABc)t.ivIantetdhissltuedstg,ebwioadsegursaeddabaislithtey inoculum. No AAmmmmoinosiiuumm ppeerrfflluuoorrooooccttaannooaattee,(p3u0ri%tysoalsustiuomne)ddi1d0n0o%t demonstrate B"iRoedaedgyraBdiaobdielgirtaydTaebislti"tdyo."esNnootteitmhpaltyfatihlautrethteotpeastsssuab"stRaenacdeywill persist in the environment foran extended periodoftime. r`Tehfeerteonxciecicthyetmeistc,awlh(iscohdiiuncmlbuednezdobaotteh) tihnettheestsasumbestflaanscke,aynideltdheed p<e2rf5l%uobriooodcetgarncaadtaetiwoanswcitohnisnid1e4reddayisn;hitbhietroerfyorteo, ammonium microorganisms in the inoculum. EIDO9I523 2: Coen Reference: Type: Method: DuPont Co. (1997). No. 24-97. Unpublished Data, AEM Laboratory Report AAdmsmoorpntiiuonm-pDeersfolrupotriooocntaSncoraeteenaidnsgoSrpttuidoine/sdesorption.screening scltauydsi,esawwearsehepedrsfaonrdm,epdeaotn msoesvser,alantdesatnmaatgerriicaullst,urianlcslouidlinfgrotmwo aDlesloawpaerref,orUmSeAd.usTinhgetawdososruprtfiaocne/dseosilosrpatnidontwscoreseendiinmgensttsudfireosmwetrhee WOhoiroksRipvlearntconlelaerctPeadrkienrtshbeurvgi,ciWneitsytoVfitrhgeinDiua.Pont Washington `aTdhaeptaeddsofrrpotimoan/mdeetshoropdtdioenveplroopceeddurbey uthseedOfifnitcheisofstPurdeyvewnatsion, PEensvtiircoindemsenatnadlTPorxoitcecStuiobnstAagnecenscy(OfPorPTuSs)e,inUntihetetdesSttiantgeosf p(eUsStiEciPdAes(a1n9d98t)o.xiFcatse,ubsttraannscpeosr,taannddtthreadnesfvoerlmoaptmieonntteosft tgeusitddealitnaes: `isOoPthTeSrm,83U5n.i1t2e2d0SsteadtiemEennvtiraonndmesoniltaaldsPorroptteicotni/odneAsgoerpntciyo,nOffice of Prevention, Pesticides, and Toxic Substances, EPAT12-C.98-048). mEexschep)tfstoaritnhleessclsatyeesl, salilevseaminplpersepwaerrateisoncrfeoerntehdethrough a 2-mm (10 awbassohrepdtiuosni/ndgesDoIrp(tdieoinosncirzeede)niwnagtteerstt.hrFouurgthhe2r-momrme,atnhdeSs0a-nudmwas sutsaeidnlienssthsetesetlusdiye.veTsh. eMsaatnedr,iasloirlse,taainndedsoenditmheentSsO uusmedsiinevtehewas swteurdeiebsasweedreonaior-vderni-eddrpyriwoeritgo htussoe.ftDhaetasacmapllceusla.tiOonvse,n-hdorweyvweeri,ghts were determined after drying a subsample 105C for a minimumof 24 hours. of material in aa oven at `sTuhbesptaHnoceftthoewastaemr)p.lePsewrcaesntdeotregranmiicnemdatitnearrwaatisodoeft1e:r1mi(tneesdt using the loss on ignition method. Screening Test: Adsorption Studies bTlhaenkadcsoonrtpatiinoinngte0st.w0a1sM pCearCflo;rsmoeldutiinodnuwpliitchatteestonmaetaercihalmsatearnidaln.o A `ammonium ammonium perfluocooctanoate perfluorooctanoate and a single control at each concentration but no material were pahlsaoseioncfluadseodl.utEiaocnohfmtahteertieasltwsaubssetqaunicleiabtra5t0e,d 5w0i0t,hatnhde 5aq0u0e0oupgs/L. EID091524 3 concn GLP: Test Substance: Results: prepared in 0.01M CaCl, vSteesrsielles.50OnmeLppaortlyapirr-odpryileednmeacteeartirailf(u4g.e0tgu)bewsaswewreeiugsheeddaasndthe test e5xpcaesptts ttheestcsoonlturtoilontu(b2e.0 mTLh)e cweenrteridfeucgaenttuebdeisnwtoerceenstercifuurgeedtounbeasn, e2n4dh-oouvresr.-Snadmmpilxeesrwaenrdeacgeiattartiefdugatedapfporro2x0immaitneultyes30atc4p0m00foxr g, caenndtrtihfeungefitlutbeer.ed Tthhreouvgohluam0e.2ofuamquneyoluosn ssuypreirnngaetfainltterwainstomeaanseuwred caondmproefurnidgeursaitnegd aatnapLpCr-oMxSim.atTehley b5laCnukntainldatnhaelyczoendtrfoolrttuhbeespawreernte subjected to the same steps as the test systems, including filtering. Screening Test: Desorption Studies sAubfsrteasnhcveowlausmeadodfe2d0tmo Leoacfh so0l.i0d1MphCaasCel;(peslolleutt)i.onThwietshaoumtpltehewtaesst mthiexeadd,socrepnttiroinfusgteuddi,esf.iltTerheids, sdteosroerdp.taionndsatneaplwyzaesdraespewaatseddoanseecinond time, No resulting in two washings that were analyzed separately. FAimvmeoonfiummatepreirafllsuotreosotcetdafnooratteh,e paudrsiotryptniootna/pdpelsiocrapbltei:on cUhpasrtacrteearmissteicdsimoefnta,mEmaosntiWuomopdersfoliul,orGoaorcdteannoAarteea(pseoailt,maonsds,Kaolin cplearyf)lueoxrhoiobcittaendosaitgeniafdidceadnt) aadtsoonreptoironmo(r>e2o5f%tohfeaamdmdeodnium concentrations of ammonium perfluorooctanoate. Montmorillonite clay, Downstream sediment, and Sand, Sassafras soil did natotanaydscoornbceanstirgantiifoinc.ant amount of ammonium perfluorooctanoate Othnrleye cpoenactemnotsrsat,ihoonwseovfeard,daeddsoarmbmeodnasiiugmnipfeircfalnutoraomoocutnantoaattea.ll pKearoflliundrloaoycatadnsooartbeeadt a50s0igannidfic5a0n0t0ampgo/uLn.t oTfheamGmarodneinuAmreasoil ocoflalemcmtoednaituWmaspherifnlgutcornooWcotarnkosataelsato Sa0ds0oprgb/eLd.siUgpnsiftirceaantmamounts ssiegdniimfeiacatnst farmoomunthteoOfhaimomRoivneiruamnpdeErafsltucWroooocdtasnooialtaedasto5rb0eudga/L only. Once adsorbed on peat moss, most of the ammonium apesroflluutoiroonoocfta0n.c0at1eM(C>a7C6l%.)Fdoirdtnhoet dKeasoolribn calfateyr, tmwoostwaosfhtihnegs with a EID091525 eden + Reference: daemsmoorbneiduwmitpherwfalsuhorionogct(a>n6o0at%e).adsAotrabemdmwohneinumadpdeerdflautor0o0oc0tagn/gaLte `afwrdhodimecdhthaaetds5Ko0aro0blepidgn/4cLl,6a%hyoaowffetvetrheert,waomanmwaoasvnheiirnuaggmse.poefrTfh9le8uo%EraodsoitcdtWanonoootaddteessooairdl,bded at t5h0euagm/mL odnesiourmbepderofnlluyoraoboocuttan2c%a.te FdoersotrhbeeGdawrdheenn Aardesaorsboeild $f7ro%mof pteherfSl0u0orpogoc/tLansoolautteiofnr.omNothemeUapssutrraebalme sdeesdoirmpetnitonaoftferatmwmoownaisuhimngs was observed at 50 pg/L. when the ammonium perfluorooctanoate was added DuPont Co. (2000). Unpublished Data, Report No. EMSE-053-00. Acute Toxicity to Fish Type: Species: Value: Method: 96-hour LCs L63e4pommgi/sLma(c9r5o%chfiirduucsia(lbliunetgeirlvlals,un5f6i7s-h7)25 mg/L) cAonrcaenngterfaitnidoinnsgosft0u,dy0.w1,as1,co10n,du1c0t0e,danudsin1g00n0ommign/aLl. test F3o2r8,t4h1e0d,e5fi1n2i,ti6v4e0s,tu8d0y0,, naonmdin1a0l00temstg/cLo.nceGnltarsastiaoqnusarwiear(e200,L2)62, ccohnatmabienrisngin10thLeowfatteesrt bsaotlhutuisoendwteormeaeimnptalionyecdo.nstPaonstittieomnpseroafttuerset wreeprleicaatsesiugsniendg ursainndgormanaduommbenrusmb(e2rrse.pliTceantesfipsehrwceorneceandtdraetdioton;cach t1o.t2a:l2.280cfmishstpaenrdcaorndcelnetnrgatthi(onm)e.anCo2n.t1rcolm)fiasnhdra0n.g0e4d51f-r0o.m524 g wet wcoenicglhutsi(omne.anFi0s.h2w28erge).noCtonfterdoalplporaodxiinmgatwealsy02.423hogu/rL.saptrtieosrtto and dveurrsiunsg 8thheotuersts.dAarkpnheostsopwearsioedmpoflo1y6ehdouwristhli2g5htm(i3n1u2t-e3s4o4fLux) alingshittiinotenravlall.ighOtbs(e<r2v.a1t5iLounxs)foprremcoretdailnigtyanadndfoblelhoawviinogratlheef1f6ec-thsour were inade daily. rDeipslsiocaltveedbeofxoyrgeenad,dpitHi,onanodf tfiesmhpaetrattesutrestwaretr, edamileya,sautrteodtailnfeiashch cmoonrtdaulcittiyv,itaynodf/torheat ctoensttreonld.waTtoetrawlearlekamlienaistyu,reEdDbTeAforhearfdinsehssw,eraend awadtdeerd-actotnetsrtolstraerptl.icAatecownatsinuusoeudsltyo rcehceocrkditnegmptehreatrumroemveartiieartnioans dcounrcienngttrhaeti9o6n-shionurwattesetr. wCehreemnioctalpearnfaolrymseeds.of the te_st substance EID091526 : 00062 GLP: Test Substance: Results: `The Yes LCso value and its 95% fiducial interval were calculated. Ammonium perfluorooctanoate, purity 99% aMnodra8l0it%yaitn0t,h0e.1r,an1g,e1f0i,nd1i0n0g, satnuddy10af0t0ermg96/Lh,ourersspewcatsiv0e,l0y,. 0,0, 0, Total mortality was 328, 410, 512, 640, 0, 5, 800, 10, and 15, 30, 40, 1000 mg/L 65, and 95% in the concentrations, 0, 262, respectively. exception of All deaths occurred within 1 death at 48 hours at 1000 24 hours, mg/L. No with the behavioral . effects were noted at < 640 1000 mg/L were lethargic. mg/L. Surviving fish at 800 and Reference: TAoltlaclhaelmkiaclianlitayn,dEpDhyTsAicahlarpdanreasms,etaenrds cwoenrdeucwtiitvhiitnyoefxtpehceteddilruatniognes. water control were 79 mg/L CaCOs, 76 mg/L CaCO, and 165 umbos/em, respectively. During the test, dissolved oxygen aconndcetnetmrpaetriaotnusrerarnagnegdedfrformom6.271-.84.-52m2.g1/LC,.pH ranged from 6.9-7.4, DuPoa Co. No. 61-94. (1994). Unpublished Data, Haskell Laboratory Report Type: Species: Value: Method: 96-hour LCs O40n0c1ormhgy/nLch(u9s5m%ykciosnsfi(dreanicneboinwtetrrvoault,) 3327-4932 mg/L) cAonstdautcitcerdanugseifnigndaidniglusttiuodnywwaittehr5cofnitsrhoplearncdonncoemnitnraaltion was concentrations of 50, 100, 500, 1000, and 5000 mg/L. Nominal concentrationsof625, 1250, 2500, 5000, and w1a0t,e0r0)0 wmegr/eLc(ho2s0e%n sfoolrutthieondeoffianimtmivoentiesutmbapseerfdlounortohoectraensuolattseoifnthe preliminary rangefinding study. . Test chambers were stainless steel aquaria that held approximately 9 Lof est solution. Two replicate test chambers were used per test concentration with 10 fish in each chamber (total of 20 fish per concentration). Each chamber was covered with a glass plate to prevent fish from escaping. Random numbers were used to assign test concentrations to the test chambers and position of test concentrations in the water bath. Rainbow trout used ia this study were not fed approximately 29 hours prior to and during the test, and were assigned to the test chambers using random oumbers. Addition of fish to the test solutions was initiated approximately 41 minutes after mixing of 5 EID091527 e09:25 the test solutions was completed. Mortality and behavioral Oatbtseesrtvaetndi.onsAwtetreestmcaondceluastitoens,t saltlarsturevvievriyng24fihshouwresrtehesraecraiffiiccre,d.and iAn rtehceitrecsutlacthianmgbweartserdubraitnhgwtahse 9us6e-dhotuormtaeistn.taIinnamdediatniotne,maperature ctoenmtpienruaotuusrleyvraericaotridoinnginth1erremploimceatteerofwathseudsieludtitooncwhaetcekrfcoorntrol. A photoperiod of 16 hours light (approximately 199450 Lux) and. t8rahnosuirtsiodnaarlklniegshts(w1a1s-1e5m7plLouyxe)dp,rwehciedcihnignacnldudfeodll3o0wmiinngutthees1o6f-hour + light interval. Dissolved oxygen, pH, and temperature were micasured in all replicate chambers of the control and test substance concentrations. `These measurements were taken before fish were added at test star, every 24 hours thereafter, and at test end or at total mortality ina concentration. Total alkalinity, EDTA hardness, and conductivityofthe water were measured before fish were added at the beginning of the test. Test solutions were not aerated during the test. Concentrations of ammonium perfluorooctanoate were measured directly by high performance liquid chromatography/tandem mass spectrometry (LC/MS/MS). At test conclusion, fish from the water control ranged from 2.53.2 cm in standard length (mean 2.8 cm) and 0.15-0.30 g in wet weight, blotted dry (mean 0.21 g). Standard lengthofthe longest fish was not more than twice the length of the shortest fish in the: control. Loading in the water control was 0.23 g/L at test conclusion. GLP: Test Substance: Results: `The LCso value was calculated using the moving average-angle method. Yes Ammonium perfluorooctanoate, purity 99.4% Atthe ead of 96 hours in the rangefinding study, the mortality was 0re,s0p,e0ct,i0v,e0ly,.2nTdes6t0s%ubastta0n,c5e0,so1l0u0t,io5n0s0w,e1r0e00c,leaanrdanSd00c0olmorgl/eLs,s with 0 insoluble test substance present during the study. In the definitive study, mean measured concentrations of ammonium perfluorooctanoate were 554, 1090, 2280, 4560, and 9360 forthe 625, 1250, 2500, 5000, and 10,000 mg/L dose levels, respectively. Control solutions showed no detectable 5 EID09152!8 00a: 2 Reference: Mammalian Toxicity Acute Toxicity Type: Species/strain: Value: Method: csounbcsetnatnrcaetisoolnustioofnas mwmeorenicluemarpearnfdlucoorlooorclteasnsowaitet.h All test no insoluble test substance preseat during the test. Awlilthcihneemxipceacltaedndrapnhgyessi.caTloptaarlaamlektaelirnsiftoyr, tEhDeTdeAfihnairtdinveestse,stawnedre c1o2n2dumcgt/ivLiCtyaoCfOt,headnidlu2t4io0nuwmahtoesr/ceomnt,rorleswpeecrteiv4e9lym.gD/uLrCinagCOtshe, pteHst,rdainsgseodlvferdomox7y.g1-e7n.2c,onacnedntmreaatniontsemrpaenrgaetdurferwoams7.151-.181.C2 m(rga/nLg,e 1L6-12.1C). Ncoontmoolrtfailsiht.y Norosmuobrlteatlhiatlyeoffresctusblweethraelseefefenctisn twheerediolubtsieornvweadtaetr c1o1n72c0e,ntr14a1t2i0o,nsan<d25150/020mga/tL2.4,A4t8,57020,0amngd/9L6, mhoourrtsa,lirteyspweacsti8v/e2l0y,. At10,000 mg/L all fish were dead by 24 hours. sSuucrvhiavsinsgwifimsmh ienxgpoastetdhetosu5r0f0ac0e,mgl/abLoerxehdirbeistpeidrastuibolne,tdhaalrkeffects coloration, and erratic slewtihmamrgiyn,gp.artial lossofequilibrium, rapid respiration, DuPont Co. (1999). No. Dupont-3381 Unpublished Data, Haskell Laboratory Report Oral LDss Male rats/Crl:CD 4M7a8lemgra/tksgre(c9e5iv%incgonafmimdeonncieulmimiptesr,fllouowreoro3c6ta1nomagt/ekga,lounep:per S71 mg/kg, slope 7.9) Male rats receiving ammonium perfluorooctanoate and pcornef-iudeedntcmeenltimoitfsp,hleonwoebrar5b1i7tamlgs/okdgi,umu:pp5e4r75m8g2/mkgg/k(g9,5%slope 22.1) Male rats receiving ammonium perfluorooctanoate and pre-treatmentofproadifen hydrochloride: 520 mg/kg (95% cAomnmfiodneincuemlipmeirtfsl,uloorwooecrt4a5no0amtge/wkags, audpmpienris6t1e8remdg/bkyg,instrlaogpaest9r.i8c) intubation as a suspeasionincorn oil in single doses to 1300rraattss,/g1r0o/ugparotupc,onwceernetrtarteaitoendsobfy4s0i0ng,l5e0i0n,troarpe6r5i0tomngea/lkgi.njeAcntiootnhser EID091529 8 00on 2" GLP: ReTseustltSsu:bstance: wfoirth3 adqayuse.ouOsnseoldutaiyoanfsteorftphheenfoibnaalrbtirteaaltmseontd,iuthmearta8ts0wmegr/ekg/day aindtmuibnaitsitoenreudsianmg mthoensiaummepterrefaltumoernotocatsadneosactreibbyediantbroavgea.strAinc aindtdriatpieorniatlongeraolupionjfe3ct0ionraotsf, a1q0u/egoruousps,olwuetrieontsreoaftepdrowaidtihfeann `hyadmrmoocnhilourmidpeeraftl5uo0rmogo/cktga.noaOtenewahsouardamftienristtheirsedtrbeyatimnetnrta,gastric isnutruvbiavtiinogn,rautssifnrgotmhealslatmreeattrmeenattsmewnetraes wdeesicgrhiebdedanadboovbes.erTvheed dvaulruiesnagwe1r4e-cdaalycurleactoevderfyropmertihoedmaonrdtatlhietny sdaactrai.ficed. The LDs `aTthse fprheonmobboartbhipthaalsseosdeirumepchoamsbeionfetdheansdtutdhye wLaDssorevpaelauteedw.asThbeased oNnoall 60 rats. `ATmhemroe nwieruemnpoersfilgunoifriocoacnttandoiaftfee,repnucreistyinatphperoLxiDmatveallyue1s0o0f% `foalmlmoowninigumprpee-rtfrleuaotrmoeoncttawnictahtee,itehietrhpehrewnhobeanrbtietsatledsaoldoinuemoror proadifen hydrochloride. tMroerattaeldiwtyitrhat4i0os0,of5020/,10a,n7d/6105,0amngd/8k/g10amwemroenoibusmerved for the rats paenrdflwueoirgohotctlaonsosawtee,rereosbpseectrivveedlya.t lWletlevaenlds/oterssttead.ineOdthpeerricnleianlicaarlea swiegaaksnoebssse(r5v0e0d ianncdlu6d5e0dmsgt/akign)ed, faancde (cSh0r0omaondda6c5r0yomrg/hkega), (500 mg/kg). All deaths occurred within 6 days after dosing. Mproertarleiatteydowfi0t/h20p,he4n/o2b0a,rbaintdal19s/o2d0iwuamsanodbstehrevnedtrfeoartetdhewirtahts400, 5`W0e0t, aanndd/o6r50stmaign/ekdgpearminmeoanliaruema,psetrafilnueodrofoacctea,ndoiaatrer,herae,spaenctdiwveeliyg.ht loss wiefe observed at all levels tested. Other clinical signs observed included weakness (500 and 650 mg/kg) and lethargy (650 mg/kg). All deaths occurred within 4 days after dosing. Mproerttraelaitteydowfit1h/1p0r,o5a/d1i0f,enanhdyd8r/o1c0hlwoarsidoebsaenrdvtehdefnortrtehaeterdatwsith 400, 500, and 650 mg/kg ammonium perfluorooctanoate, respectively. Swteaaiknneedsfsacwee,rweeotbasnedr/voerdasttaailnledlepveerlisnteeaslteadr.ea,Otwheeirghcltinloiscsa,l asingdns o(b40s0ermvge/dkgi)n,clduidaerdrhteraem(o5r0s0(a4n0d06m5g0/kmgg)/,kgc)h,roamnoddalcacrryiomrarthieona EIDO091530 000435 Reference: D(6u5P0onmtg/Ckog.).(1A9l8l1)d.eaUtnhspuobclciusrhreedd Dwaittah,inHasdkaeylsl Lafatbeorrdaotsoirngy,Report No. 567-81. Type: VSpaelcuiee:s/strain: Oral LDso MMaallee raantds:f4e7m0almegr/aktgs/(C9r5l:%CcDonfidence limits, lower 403 mg/kg, upper 536 mg/kg, slope 8.6) Method: GL: Test Substance: Results: Female rats: 482 mg/kg (95% confidence limits, lower 438 mg/kg, `uTphpeetres5t41submsgt/akngc,e,slaospae 12.3) suspeasion in corn oil, was administered by 6ingtrraoguapsstorficfienmtaublaetiyoonuinngsiandgullet draotsse.sTteon6mgarloeupasndoffmeamlaeleand rats/group were administered 200, 400, 450, 500, 670, or a1n0d00obmsge/rkvgeodfdtuhreintgesat 1su4b-sdtaayncree.covTehreyspuerrviiovdinagndrattshewnesraecrwiefiicgehde.d `The No LDsp values were calculated from the mortality data. MAomrmtaolnitiyurmatpioesroffl2u/or1o0o,ct3a/n1o0a,te4,/1p0u,ri6t/y10a,pp9r/1o0x,imaantdel1y0/1100 0w%ere rfeosupnedctiinvetlhye.20M0o,rt4a0l0i,ty45r0at,io5s00o,f 06/7100,,a0n/d101,050/010m,g7//k1g0,m9a/l1e0,graonudps, 10/10 were found in the 200, 400, 450, 500, 670, and 1000 mg/kg female groups, respectively. Clinical signs observed in male rats included stained and/or wet cpleirniinceaallsairgenas, owbesaekrnveesds,inatnhdewmeailgehtraltossisnactlauldleldevsetlasinteedstfeadc.e Other (450 mg/kg and above), chromodacryorrhea (500 and 1000 mg/kg), hunched posture (S00 mg/kg), morbundity (670 meg), eyes half closed within (670 mg/kg), and 4 daysofdosing. gasping (670 mg/kg). All deaths occurred Reference: Clinical signs observed in female rats included stained and/or wet perinealarca and weight loss at all levels tested. Stained face was observed at all levels except 200 mg/kg. Other clinical signs noted 6in70f,emaanlde1r0at0s0imngc/lkugd)e,d haluonpcehceida p(o4s0t0urmeg/(k4g5)0,awnedak6n7e0smsg(/4k0g0),,450, chromodacryorthea (670 mg/kg), eyeshalfclosed (670 mg/kg), and atDauxPioant(6C7o0.m(g1/9k8g1)).. AUlnlpudbealtihssheodccDuartrae,dHwaistkheilnl3LadbaoyrsaafttoreyrdRoespionrgt. No. 295-81. : EIDO9IS3L Ld 00:20 Type: SVpaelcuiee:s/strain: + Method: GL: Test Substance: Results: Oral LDso Male Male nanedwbfeommalreatsr:at2s4/3Cemlg:/CkDg (95% confidence limits, undefined, slope 55.7) 2F4e4mamlgeknge,wbuoprpnerra2t7s:62m5g8/kmgg,/sklgop(e9519%.9c)onfidence limits, lower M51a4lemgw/ekagn,liunpgperarts6:6547m3g/mkgg/,kgsl(o9pe5%8.c0o)nfidence limits, lower Female weanling 470 mg/kg, upper r2at2s5:858m0g/mkgg/,ksglo(p9e54%.7c)onfidence limits, lower 4M0a3lemgy/okugn,guapdpueltr r5a3t6s:m4g7/0kgm,g/slkogpe(98.56%) confidence limits, lower 4F1e3mamlge/kygo,unugppaedrul5t0r3atms:g/4k5g3, mg/kg slope (95% 15.0) confidence limits, lower Male older rats: 336 mg/kg (95% confidence limits, undefined) Female older rats: 285 mg/kg, upper 343 390 mg/kg mg/kg, (95% slope confidence 8.0) limi, lower `iTnhteratgeassttrsiucbsitnatnucbeat,iaosn ainssuisnpgelaesidoonseisn tcoorgnroouilp,sowfasraatdsm.inTihsetegrreodupbsy (m1a0leraatnsd/gfroeumpa)lewewreeanmlailneg arnatds f(e2m1adlaeynseowlbd)o,rnmarlaetsa(n<d2fdeamyalseold), y(aoguenugndadeuflitnsed()-.8-M1a0lweeenkeswbooldr)n,raantsd wmearlee aadnmdinfiesmtaelreeodld1e3r0r,a2t0s0, 2a4d0m,in2i8s0t,er3e3d0,13o0r,317600,mg2/0k0g,.22F0e,m2a4l0e, n2e80w,boGrrn32ra0tsmgw/ekrge. Male weanling rats were administered 350, 400, 450, 525, 670, or 710 450, mg/kg. 6670 Female mg/kg. Yweoaunnlginagdurlattsrawtesrweeraedmaidnmiisntiesrteedr3e5d03,5400,04,25, D50u0P,o6nrt6R7e0pomrgt/kNgo.. 2Y9o5u-8n1g.adOulldtermamlaelreatrdaatstawearree ardempionritsetdeirned 200, 240, 300, 350, 400, 500, or 720 mg/kg. Older female rats wsuerrveivaidnmginriatsstewreerde2w2e5i,g3h5e0d, a4n00d,o4b5s0e,rvoerd6d7u0rimngg/kag.14-Tdhaey recovery period and then sacrificed. The LDso values were calculatedfromthe No mortality data. MAomrtmaolnitiyurmatpioesrfflouromroaolcetanneowabteo,rnpurraittsywaeprpero0x/i1m0a,t0e/l1y0,100/010%, 10/10, n EIDO091532 009400 References: g1r0o/u1p0s,,arnedsp1e0c/t1iv0efloyr. tNheo1c3l0i,ni2c0a0l,si2g4n0s, w2e8r0,e 3r3ep0o,ratendd. 3D7e0amthgs/kg occurred up to 6 days after dosing. 0M/o1r0t,al5i/t1y0,ra6t/i1o0s,faorndfe1m0a/l1e0fnoerwtbhoern13r0a,ts1w6e0,re2000/,102,200,/1204,00,/1208,0, and 320 mg/kg groups, respectively. No clinical signs were. reported. Deaths occurred up to 4 days after dosing, Mortality 7/10, and ratio 8/10 s fo for r t hmea3l5e0w,e4a0n0l,in45g0r,at5s2w5,er6e700,/1a0n,d27/1100, m2g/1/0k,3g/10, `groups, respectively. Stained and wet perineal area, weakness, and weight loss were observed. Deaths occurred up to 3 days fier dosing. Mortalit 6/10 for y ratios for female the 350, 400, 450, weanling rats w and 670 mg/kg ere grou 1/10, ps, r 3/10, espect 3/10, ively. and Stained and wet perineal area, stained face, weakness, and weight loss were observed. Deaths occurred up to 3 days after dosing. Mortality ratio data for the young adult males are covered in DuPont Report No. 295-81. Mortality ratios for female young adult rats were 1/10, 2/10, 3/10, and 10/10 for the 350, 425, 500, and 670 mg/kg groups, respectively. Stained and wet perineal area, stained face, nasal discharge, diarrhea, and weight loss were observed. Deaths occurred up to 4 days after dosing. Mortality ratios for the older male rats were 0/10, 0/10, 0/10, 9/10, 10/10, 10/10, and 10/10 for the 200, 240, 300, 350, 400, 500, and 720 mg/kg groups, respectively. Stained face, stained and wet perineal area, weakness, tremors, lethargy, chromodacryorrhea, diarrhea, and weight loss were observed. Deaths occurred up to 9 days after dosing: Mortality ratios for the older female rats were 1/10, 5/10, 6/10, 9/10, and 10/10 for the 225, 350, 400, 450, and 670 mg/kg groups, respectively. Stained face, stained and wet perineal area, `weakness, tremors, lethargy, and weigh loss were observed. Deaths occurred up to 5 days after dosing. DuPont Co. (1982). Unpublished Data, Haskell Laboratory Report No. 788-82. DuPont Co. (1981). Unpublished Data, Haskell Laboratory Report No. 295-81. EID091533 " coves Type: Species/strain: Value: Method: GL: Test Substance: Results: Oral LD; Rangefinder and Liver Weight Comparison Test Male and female rats/Crl:CD Male rats: 439 mg/kg 554 mg/kg, slope 6.1) (confidence limits, lower 294 mg/kg, upper Castrated male rats: 491 me/kg (confidence limits, lower 276 mg/kg,upper 619 mg/kg, slope 6.7) Female rats: 459 mg/kg (confidence limits, lower 315 mg/ks, upper 607 mg/kg, slope 5.2) Overiectomized female rats: 400 mg/kg (confidence limits, lower 259 mg/kg, upper 494 mg/kg, slope 7.2) In an LD rangefinder test, the test substance, as a suspeasion in com oil, was administered by intragastric intubation in single doses 0 normal male rats, castrated male rats, normal female rats, and. ovariectomized female rats. Dose levels of 200, 480, and 670 mg/kg were tested in each of the test systems meationed above (10 rats/group). In the liver weight comparison test, rats/group were administered the test substance, as a suspension in com ol, as a single dose. Male groups were defined as male control, male 100 mg/kg, male 200 mg/kg, male castrated control, and male castrated 200 mg/k. Female groups were defined as female control, female 100 mg/kg, female 200 mg/kg, female ovariectomized control, and female ovariectomized 200 mg/kg. All rats were weighed and observed during a 14-day recovery period. The rats were then sacrificed and the livers were weighed. No Ammonium perfluocooctancate, purity approximately 100% In the LD study, mortality in the male rats occurred in 0/10, 7/10, and 8/10 rats in the 200, 480,and 670 mg/kg groups, respectively. Morality in the castrated male rats occurred in 0/10, 5/10, and 8/10 ats in the 200, 430, and 670 mg/kg groups, respectively. Morality of the female rats occurredin0/10, 7/10, and 7/10 ras in the 200, 480, and 670 mg/kg groups, respectively. Mortality in the ovariectomized female rats occurred in 0/10, 8/10, and 9/10 mg/kg at 200, 480, and 670 mg/kg, respectively. In the liver weight comparison study tested at dose levels of 0, 100, and 200 mg/kg, no changes in liver weight or in liver to body weight ratios were seen in the female rats given single doses of up t0 200 mg/kg (ovariectomized or normal).A single oral dose of either 100 or 200 mg/kg produced an increase in liver weight of EIDO091534 " conv Reference: Type: Species/strain: Method: GLP: `Test Substance: Results: Reference: Type: VSapelcuiee:s/strain: Method: imnaclreearsaet,s.buCtasrattrsatciaosntrraetdeducaenddtghievmeang2n0i0tumdge/ofktghheadlihveearvwieeirglhitvers ptehrafnludoirdotohcetacnoonattreol-sw.reaCtleidnircaatlssiingcalsudseedenstianitnheed afamcmeoannidupmerineal area, and sporadic the experiment. weight loss. No deaths occurred in this phase of DuPoat Co. No. 600-81. (1981). Unpublished Data, Haskell Laboratory Report Acute Oral Toxicity Male rats/Cri:CD `aTmhmeotensitusumbsptearnfcleu,oraomocmtoannoiautme (pRerifmlaurorCooo.)c,taansoastuesp(e3nMs)ioannsdia corn oil, were administered young adult male rats. bRyatisnt(r1a0g/asgtrroiucp)inwtuebraetiaodnmiinnissitnegrleeddo20s0e,s to w48e0i,ghoerd67an0dmogb/skegrvoefdtdheurtienstgsaub1s4t-adnacey.reTchoveesruyrpveirviiondg arantds wtheerne sacrificed. No Ammonium perfluorooctanoate (3M), purity approximately 100% MAomrmtaolnitiyurmatpioesrofflu0o/r1o0o,ct6a/n1o0a,taen(dRi1m0a/1r0Cow.e)r,epfuroiutnyd9i5n %thmei2n00i,mum r4e8s0p,ecatnidve6l7y.0 mMogr/tkagliatmymraotnioisoumf0p/e1r0f,lu1o0r/o1o0c,taannodat1e0(/130M)wegrreoufposu,nd (inRitmhear20C0o,.)48g0r,ouapnsd, 670 mg/kg ammonium respectively. perfluorooctanoate. iClnicnliucdaeldssitganisneodbsaenrdv/eodr winetampemroinneiaulmarpeea,rfsltuaoirnoeodcftaacneo,aatend(3wMe)igrhatts `lwosesakanteaslsl l(e4v8e0lsantedst6e7d.0 mOgt/hkegr),clidniiacrarlhesaig(n4s3o0bmsge/rkvge)d,iancnldudaelodpecia (200 mg/kg). All deaths occurred within 4 days after dosing. CCloi.nircaatlssiingcnlsuodbesdesrtvaeidneidn aanmd/moornwieutmpepreirnfelauloraoreoac,tasntoaaitneed(fRaicmea,r ianncdluwdeeidghwtealoksnseastsa(l48le0vaelnsdt6es7t0edm.g/Oktgh)eracnldinliectahlaSriggyn(s6n7o0temdg./kg). ADlulPdoenatthCso.oc(c1u9r8r1e)d. wUinthpiunbl4isdahyesd Dafattear,dHoassinkge.ll Laboratory Report No. 565-81. OMraalle AraLtDs/(CAhpR-pCrDoximate Lethal Dose) 670 mg/kg The test substance, as an aqueous solution (pH ~6), was EID091535 14 009,07 Le: Test Substance: Results: Reference: Type: Species/strain: Value: Method: GLP: Test Substance: Results: administered by intragastric intubation (0 young adult male rats (1 rav/group) in single doses. Concentrations tested were 1, 1.5, 2.3, 23.245,05.m1g,/2k6g,.40S,ur6v0i,v7o7r,s 9w0e,r1e2s0a,cr1i3f0i,ce1d701,42d0a0y,s3l0a0t,er4, 5a0n,d6b7o0,dyand weights and liver weights were recorded. . No . Ammonium perfluorooctanoate, purity not specified Dwietahth6s7d0imdgn/oktgodciceudr a2tddaoyssealfetveerldsoosfin1g-,4a5n0dmgth/ekgr.at Tdohseedrawtidtohsed 2250 mg/kg died 1 day after dosing. S1l-i2ghdatysi.nitiAaltw9e0igmhgt/klogssaensdoacbcouvrer,edthaet 2fe6cemsg/wekrgeasnmdaallboavnedfor irregularly-shaped for 1-6 days after dosing, and the rats were uncomfortable for 1-5%ays after dosing. The compound caused. liver enlargement in rats with single doses as low as 60-90 mg/kg. Based on clinical signs, it also acted as a gastrointestinal irritant. `Additional toxic sigasa the lethal doses (670 and 2250 mg/kg) included chewing motions, polyuria, increased respiration rate, and face-pawing on the dayofdosing. Shovel-nosing was observed at 2250 mg/kg and slight salivation after dosing occurred at 670 mg/kg. DuPont Co. (1968). Unpublished Data, Haskell Laboratory Report No. 128-68. Oral ALD Male rats/ChR-CD 670 mg/kg `The test substance was administered by intragastric intubation to male rats (1 ravgroup) in single doses. Concentrations tested were 1.5, 12,40, 120,200, 300, 450, 670, 1000, 1500, and 2250 mg/kg. Survivors were sacrificed 14-15 days later, and body weights and liver weights were recorded. No Ammonium perfluotooctancate, purity 99% Mortality occurred at 670 mg/kg and above. Clinical signs of toxicity included inactivity (120, 1000, 1500, and 2250 mg/kg), red ddiissccohlaorrgaetiaorno(un3d00thaendno4s5e0(m6g7/0,kg1)5,00ru,faflnedd2f2ur50(3m0g0/kagn)d, perineal 450 mg/kg), irritability (670 mg/kg), and weight loss (40, 200, 300, 450,670, and 1000 mg/kg). Animals sacrificed 14-15 days after having received doses down to and including 200 mg/kg bad enlarged livers when compared to control rats weighing between 500-550 g with liver weights of 22.6, 20.7, 19.1, and 21.7 g and liver weight/body weight percentages of 4.2, 3.8, 3.6, and 3.8, respectively. Liver weightsat 200, 300, and 450 mg/kg were 30.6, EID091536 1s 0090: Reference: Type: Species/strain: Method: GLP: Test Substance: Results: Reference: Type: Species/strain: Value: Method: 52.53.,2a,nadnd6.228,.r2esg,pewcittihvelliyv.erLwievierghetnlbaordgyemweenitghwtapseraclseontpaogsessibolefin5.6, rwaotuslddosheadvebetloobwe 2c0o0mpmagr/ekdg,inbuotrdaedrdittoioensatalbtleissthatnhids.control ras NDou.Po5n5t-6C1o.. (1961). Unpublished Data, Haskell Laboratory Report tAocxuitceityOroaflaEmfmfeocntsi,uDmoepserpfrleutorreoaotcmteanntoawtiet?h ethanol modify the Male rats/Cel:CD p`eYrofulnugoraodouclttamnaolateeraatssa(66/0g%rouapq)uewoeursesaodlmuitniiosnatetrdeodsaemlmeovenlis uofm200, w48i0t,h eatnhda6no7l0(m1g5/k%g.v/vA)didnitdiroinnaklinggrowuaptserofforrat1s4wdearyesparned-ttrheeanted cdoonsceedntwriatthioanmsmaosnliisutmedpaebrofvleuoornoodcatyan1o5a.teTahtrteheeostahmeer groups of rats were pretreated with a single 6000 mg/kg dose of ethanol via pientrrfalguaosrtroiocctianntouabtaetitornefatomlelnotwaetdh2e4 hloeuvrelssllaitsetredwiatbhovteh.e aAmnmonium additional group of untreated rats served as controls. Groups of rats were also treated with ethanol alone at either 6000 mg/kg or 15% v/v in drinking water for 14 days. Clinical signs and body weights were recorded. Liver weights were recorded at the 14-day sacrifice. No Ammonium perfluorooctanoate, purity approximately 100% pAelrlfrlautosrdoioecdtawnictahtienat8 6da7y0samfgt/ekrgd.osLiinvgerwwitehigahmtmboondyiuwmeight ratios showed an increase in all rats that received ammonium tpheerfalnuiomraoloscttahnactarteecweihveend ocnolmypaertheadnotlo.thTeheunrterweaetreedncoonstirgonlisfiacnadnt differences between the untreated controls and the animals that received only ethanol. There were no siguificant differences between rats that received ethanol and ammonium perfluorooctancateandthe rats that received only ammonium perfliofooctanoate. DuPont Co. (1984). Unpublished Data, Haskell Laboratory Report No. 79-84. Oral LDsy EID091S37 Male and female mice/CD-1 Male and female mice: 457 mg/kg (95% confidence limits, lower 344 `The mtegs/tksgu,bsutpapnecre,5a6s0 amgs/ukspge,asslioopne i6n.c6)om oil, was administer: ed by intragastric intubation in single doses to 6 groups of male and 6 groups of female young adult mice. Ten male and female 16 000s GLP: Test Substance: Results: 4m0ic0e0/mgrgo/ukpgowfetrheeadtmesitnissutbestraendc2e5.0,Th5e00s,u7r5v0i,vi1n0g0r0a,ts20w0e0r,eowreighed `aTnhde oLbDsseorvveadludeusriwnegreac1a4l-cdualyatreedcforvoermytpheermioordtaalnidtythdeantas.acTrihfeicmead.le and the LfDesmoaldeat4a00du0eatnod l2i0mi0t0atmigon/skgofdtohseecloemvpeulstewre.re not calculated in No MAomrtmaolnitiyurmatpioesrfolfuo1r/o1o0,ct4a/n1o0a,te1,0/p1u0r,it1y0a/1p0p,ro1x0i/m1a0t,ealnyd11000/1%0 were ffeomuanldeignrtohueps2,50r,es5p0e0c,ti7v5e0l,y.1000, 2000, and 4000 mg/kg male and Reference: Clinical perineal sigas area, woebaskenrevsesd,inanmdalweeimgihcteloisnscliundaeldl stained and/or wet surviving mice. Other signs included eyeshalfclosed (250 and 1000 mg/kg), r1u0f0f0lemdfgu/krg()2,5a0nadntdrSem0o0rsmg(/5k0g0),anadta7x5ia0(m2g5/0k,g)5.00,Alalndd.eaths in male: mice occurred within 6 days after dosing. Clinical perineal signs area, woebaskenrevsesd,ian nfdemwaelieghmticleossinicnlauldlesdusrtvaiivniendg and/or mice. wet (O1t5h0ermgs/igkngs),intcrleumdoerdse(y7e5s0hamlgf/cklgo)s,eadta(x7i5a0(mSg0/0kmgg)/,ksgt)a,inaenddfraucfefled fur (250 within 7 and 750 mg/kg). All days after dosing. deaths in female mice occurred DuPont Co. (1981). No. 329-81. Unpublished Data, Haskell Laboratory Report Type: Species/strain: Value: Oral LDso Male Male and female guinea pigs/Duncan Hartley guinea pigs: 178 mg/kg (95% confidence limits, lower 144 mg/kg, upper 202 mg/kg, slope 8.9) Method: GLP: `Test Substance: Results: Female guinea pigs: 217 mg/kg (95% confidecce limits, lower T1h87etmegs/tkssu,bsutpapnecre,24as6 amgs/uksgp,ensslioopnei8n.6c)orn oil, was administered by intragastric intubation in single doses to 6 groups of male and g6ugirnoeuappsiogfs/fgermoaulpewyeoruenagdmaidunlitstgeuriendea15p0i,gs2.00T,e2a50m,al3e00a,nd40f0e,moarle w6e7i0gmhge/dkagnodftohbseertevsetdsudbusrtianngcea.14T-hdeaysurrevciovvienrgygpueirnieoadpaingds twheerne sacrificed. data. The LDso values were calculated from the mortality No Ammonium perfluorooctanoate, purity a.pproximately 100% Morality ratiosof3/10, 6/10, 9/10, 10/10, 10/10, and 10/10 were: EIDO091538 7 009.05 Reference: Type: MSeptehcioeds:/suain: GLP: Test Substance: Results: found in the respectively. 1M5o0,rt2a0l0i,ty25r0at,io3s00o,f24/0100,,a1n/d106,780/1m0g,/9k/g10m.al10e/1g0r,ouapgsg, f1e0m/a1l0ewgerroeupfso,unredspiencttihveel1y5.0, 200, 250, 300, 400, and 670 mg/kg sCwilegitansipceoarblisnseeiraglvuesadroeibansaetnrhedvemwdaelianekmngaeulsiesnegaatuipanilgesaleipvniecgllssuitdenescdtlesudtd.aeidOntsehtdaefirancceledin(ai1nc5da0/l,or 2la0c0r,iamnatdi6on70(1m5g0/kagn)d,2e0y0esmgha/lkfgc)l,osaetadxi(a20(607a0nmde3k0e0)m,gt/rkeem)o,rs o(c1c5u0rrmegd/kagt),allanledvehlusntcehsetdedpeoxscteuprte 4(02000amngd/k6g7)0. mgW/ekigg,htAlllosdseaths occurred within 4 days after dosing. Calnidn/iocralwestigpnesrionbesaelrvareedaiannfdemwaelaekngeusisneaat palilgsleivnecllsutdeesdtesdtaeixnceedpt 4pi0g0s ainndcl6u7de0dmcgo/nkvgu.lsOitohnser(c6l7i0nimcgal/ksgi)g,nsatnaoxtiead (i6n7f0emmga/lkeg)g,uinea gasping tremors (670 (400 mg/kg), mg/kg), eyes half closed lacrimation (250 (150 and mg/kg), 250 mg/kg), stained face l(e2v0e0lsmgt/esktge)d,eaxncdeplteftohrar6g7y0(1mg5/0kmgg./kAgl)l. 6 days after dosing. dWeaetihgshotclcousrsreodccwuirtrheidn at all DNou.Po2n9t1-C8o1.. (1981). Unpublished Data, HaskellLaboratoryReport AMcaulteedoTgosx/ibceiatgyle Dsuobgssta(ncger.ouTph)e rfeocleliovweidngcibtihoerch2e0m0icoarl4m5e0asmugr/ekmgenotfsthweetreestmade pohnostphheabtlaosoed.: sugar, When utrheea4n5i0trmogg/enk,g tdootaslecwhoalsesatdemrionl,isatnedreadl,katlhiene ldeevheyldorfogacetniavsietyo(fIlCaDcHt)i,c adledholyadsreo,ggelnuatsaemi(cLDoHxa)l,aciestoicicttrircansaminase (meGaOsTu)readn.dAglruotuatmiincephyermuavtioclotgriacnaslameixnaamsien(atGiPoTn)awnedraenalasnaolysis of T2h2e4-lheovuelrofuvrianreisopuescciommenpownaesntmsaodfetahteibnltoerovdalfsololnowthiensgedaonsiimnaglsw.as cwiotmhpaarseidmiwliatrhmaenasauvreermageentvamlaudeeobatsetrhveesdapmreiotritmoeeoxnposspuerceimnedns fwraosmessttaobclkicsoheldonfyrodomgmse.asFuorretmheenetnszmyamdeeacotnivsittioecsk, daongosr.maTlherange aNcotivity was also measured at least once prior to treatment. TAhmemGoPnTiuamndpeGrOflTuolreovoecltsanwoeartee,elpeuvriattyed9w9i%thin 48 hours in both EID091539 18 cava Reference: dnoorgmsathlartranegcee.ivWehde2n0045m0g/mkgg./kgOnweaswaedemkinliastetre,retdh,eyalwloerfethine the `eTnhzeygmreeastemsetacshuarnegdewoecrceurmraerdkeindltyheelGePvaTteadnd24ICtoDH48. hBooutrsh alantierm.als tDhuaPtoraetceCiov.ed(1495605)m. UgnpudbileidswhietdhiDnat4a8,hHoausrkselalftLerabdoorsaitnogr.y Report No. 123-65. Type: Species/strain: EVaxlpuoes:ure Time: Method: RInahtasl/aCthioRn-CADLC (Acute Lethal Concentration) 4 hours 0.8 mg/L eMxaploeseradtsto(6d/uesxtspoosfuarme mleovenli),uwmeipgerhfilnugor2o5o0c-t2a7n0cagtreaamtsexwpeorseure lheevaedl-soonfly0,.e38x,c0e.p81f,or0.t8h3e,22..22,mg4./8L,.oexrpo5.s7 umrge/Ll.eveElxwphoesruerersatwsehraed wwehroeleu-sbeoddtyoegxepnoesruartee.aTmwmoondiifufmerpeentrfmleutohrooodcstoafnodautsetageernoesrolast.ionIn atpheprfoirxsitmmaettehloyd3,0ahLe/maivnyuctleooufadiwratshrgouegnheraatehdigbhy vbellooscviitnyg Cteus-ttsuubbisntganjceet.suTbhmeeraigrecdarirniaedmetchehadnuisctaplalrytisctliersreidntroeasn e8 rLvooftihre ethxepogseunrereacthoarmabnedr.theSucihtaabmlbeerdiltoutaicnhgiaeivrewlaoswienrtcroondcuecnetdrabteitownse.en Tlahregegaennedrsamtaolrld,iwdenroetdferlaicvtieorneadteintthoetdhueset,xpaonsduralel cpahratmibceler.sizIens,the csoenccoenadtrmaettihonosd., aAgfeanlelriangtosrtrweaasmuosfeddufsotrplaortwicaltemsofsrpohmeraicstdirursetd. craersreirevdoitrheimpparitnigceledsotno aa pcnyeculomnaetihcejaedt.whTehreeaitrhestlarregaemrfornoesm wtheirsejet rsiezteurfnreadcttioontahteiorne.serTvhoeir.genTehriastogrenwearsatrournauchnideevrecdosnsotmaentpacrotnidcilteions aainrdbdeutswt ecoenctehentgreanteiroantsorwearned lowered by diluting the the exposure chamber. stream with The airbome: ecxopnocseinutfrea.tiAotnsthweermiedd-eptoeirnmtionfeedac$htiemxepsosduurrei,ngaepaacrthi4cl-ehosiuzre distribution measurement was made. GL: Test Substance: Results: `Cwliitnhicfalluosriogsncseiwneriemmreedcioartdeedl.y aTfhteereeyxepsoosfurteh.e Rraattsswweerreesstaacirniefdiced fpoorsth-iesxtpoopsautrheo.loTgiicsseuxeasmfirnaotmitownoatra1t,s7d,yi14n,g2d7u,roirng42exdpaoyssure were aNloso examined microscopically. TAhmemmoonritaulmityperraftliousorfooorctthaeno0a.t3e8,,p0u.r8i1t,y0a.p8p3,ro2x.i2m,a4t.e8l,yan1d005.%7 mg/L 19 EID091540 coon e References: Type: Species/strain: EVaxlpuoes:ure Time: Method: e6/x6p,oasnudre6/g6r,ourepsspewcetrievel1y/.6 (Anlolt dteesatthssubosctcanucrer-erdeleaittehde)r,du2r6i,ng1/6, 6/6, exposure or within 4 hours after exposure. eCxlipnoiscuarlesilegvneslso)b,sierrrveegduldaurrbirnegatehxipnogsu(arlel einxcplousduerdeglaesveplisn)g, r(aeldl sdailsicvhaatrigoen a(2r.o2u,n4d.8t,heanedye5s.7anmdg/nLo)s.e C(allilniecxaplossiugrnesloevbeslesr),veadnd p(o2s2t-aenxdpo4.s8urmeg/inLc)l,uadendd s>o8m0e%rurpattusrheaovfinegyeosp,aaqllueotahnerdeyes opaque ocfotrhmeodeeyde-sapwpaesarcionngfeiyremsed(0w.i8t1hafalduo0r.e8s3cemign/sLt)a.inE(x0t.e8r1n,a0l.8d3a,maangde 22 mg/L), with 081mg). the eyes appearing normal after 20 days rIenhaaclhaetdioan moafxtihemtuemst (s2ubtsitmaenscneocramuasle)d7l-i1v4erdeanylsaarfgteemeenxtpowshuirec.h NLiovecrhawnegieghstisarleitvuerrmceedlltomotrhephnoolromgayl wreanrgeeo4b2sedravyesd.afMtiercreoxspocsoupriec. perxoammpiinlayt,iobnutinddiiscaaptpeedatrheadtiancautpeprpouxlimmoantaerlyy e1 dweemeak,dleevaevlionpged70 `rmeiscirdousacloipnijcuarlyl.y.NTohedursetwpaarstiicrlreitsatwieornoefsteheen in the lungs stomach that cleared in o2pawceietkys.anAdmumlcoenraituiomn ptheartflwueorreooscttilalnmoiactreoaslcsoopiccaaulsleydecvoimdeenatl 42 days after exposure. DuPont Co. (1969). No. 160-69. Unpublished Data, Haskell Laboratory Report Keanedy, G. L., Jr. etal. (1983). The Toxicologist, 3:22. Kennedy, G. L. Jr. 24:1325-1329. etal. (1986). Food Chem.Toxicol, DMaelremarlasL/DCshyR-CD 24 houss 6Ra9t5s9wmegr/ekcgli(p9p5e%d fcroenefoifdheanicre olivmeirtsthuendbeafcikneadn)d trunk area. Five 7500 mmagl/ekrgatasm/dmoosenileuvmelpewrefrleuodroosoecdtawniotahte3.00T0h,e5t0e0s0t,suabnsdtance, as 2u.n5d0/e5ar0 asqquuaeroeusofsuaslpuemnisinounm,fwoialsaanpdplhieelddtion tphleacbeacwkiotfh cclaacsthicrat sbpanodnaggeeds.offAfwtietrh2a4mhioludrdsoetferegxepnots,urrien,setdh,edrraitesd,wearned urnewtruampepdetdo, their cages for 13 days observation or until death. During the 20 EID091541 39. 0Yy orp: Test Substance: Results: References: osibgsnesr.vaGtrioosnspepraitohdo,lothgey rats were was done weighed and observed on all survivors and 1 for clinical animal that rwaatssefxocuenpdtd1e.aTdhaet 7L5D0s0p mvga/lukeg.waLsivcearlcwueliagthedtsfwreormethreecmoorrdaelditinyall data. No . MAomrmaolintiyurmatpioesrfwleuroero0o/c5t;an0o/5a,tea,npdu4r/it5yaatp3p0r0o0x,i5m0a0t0e,lyan1d00% 7A5L0r0atmsg/dkogs,edreastp3ec0t0i0v,el5y0.00D,eaantdh 7o5cc0u0rrmegd/kwigthhiand 2inditaiyalsowfeidgohsting. loss. 7500 Clinical mg/kg), wseitgnpseoribnseearlveadreian(cl5u0d0e0dalnedth7a0r0g0y (5000 and. mg/kg), stained pcehrrionmeoadlaacrreyaor(r7h5i0e0am(g7/3k0g0),mgs/tkagi)n.edGnroosses(p3a5t0h0olmogg/ykgs)h,oawnedd an pionsctr-etarseeaitnmelnitv.er weighs in all surviving rats examined at14 days DuPont Co. (1979). No. 659-79. Unpublished Data, Haskell Laboratory Report Kennedy, G. 81:348-355. L., Jr. (1985). ToxApipl.cPhoarmlaco.l,, Type: Species/strain: Exposure Time: Value: Method: GLP: Test Substance: Results: References: Dermal LD Female rats/ChR-CD 24 hours >Ra7t5s0w0ermeg/clkigpp(etdhefrmeae xofimhauimr ofveeasribtlhee dboascek)and trunk area. Faimvmeofneimaulme preartfsl/udoorsoeoclteavneolawtee.re TdhoesetdeswtistuhbsSt0a0n0ceo,ra7s5a0050m/g5/0kg. asqquuaeroeusofsauslpuemnisniounm, fwoialsaanpdplhieeldd tion tphleacbeacwkitohfeelaascthicrabtaunnddageersa. Awfittehra2m4ihlodudresteorfgeenxtp,osruirnsee,d,thderireadts, waenrdereutnuwrrnaepdpteodt,hesiprocnaggeedsoffofr t1h3edraaytss woebrseerwveatiigohnedoraunndtiolbdseeartvhe.dDfuorricnlignitchaelosbisgeurs.vatSiuornvipveirniogd, rats No were sacrificed. `ATmhemmoonritaulmitypewrafslu0o/r5ooacntadno1a/5tea,t p5u0r0i0tyaanpdpr7o5x0i0mamtge/lkyg,100% rpeesrpfelcutoirvoeolcy.tanDoeaattehcoacucsuerdrmeidl3ddsakyins iamfietrattiroenatamnedntw.eiAghmtmolonssiautm pbeortihnedaolsearleeavewles.reIonbasdedrivtieodn,ats7t5ai0n0edmgf/ackeg.and wet and stained DuPont Co. No. 682-80. (1980). Unpublished Data, Haskell Laboratory Report EID091542 2 eed in 8K1e:n34n8e.3d5yG5,..L., Ir. (1985). ToxApipl.cPhoarmlaco.l, TSpyepceie:s/strain: MDaelremarlabLbitDs/New Zealand White EVaxlpuoes:ure Time: 24247h8oumrgs/kg (95% confidence limits, lower 2369 mg/kg, upper Method: R9wae8br1be4itfmisgtt/wekedgrw,eitsclhloippplepaes6dt.i2fc5r0ceoe4l)olfarhsa.irFiovvee,r 5th5e, baancdk2anmdalterurnakbbaictesa,wearned adpeosrslfeulrduroywriwotiohctth1a5wn0ao0ta,etre3,,0w0re0as,spe5ac0pt0ip0vle,ileyad.ntdoT7th5hee00tbeamsctgks/uokbfgsetaaamcnmhcoernawibabusimt,,maadnde tihneto etleassttsiictebawnadsagoecsc)l.udAefdte(rwr2a4phpoeudrswoitfhepxlpaosstiucrew,ratph,e aganuizmea,lsanwdere ufonrwr1a4popred1,5 wdaayssheodbsweirtvhatwiaotnero,rdurniteidl,adenadthr.evDuurrmeidngttohteheir cages colbisneircvalatsiiognasp.erGirood,ssthpeatahnoilmoaglys wwearsedwoeniegohnedalalnsdurovbisveorrvseadndfor c1alacnuilmaatledthfartowmasthefomuonrdtadleiatyd daatta3.000 mg/kg. The LDsy value was Lp: ReTseuslttSsu:bstance: NAmomonium perfluorooctanoate, purity approximately 100% Mortality ratiosofrabbits were 0/5, 1/5, 3/5, and 272 a 1500, 3000, o5f00d0o,sianngd. 7G5r0o0ssmgp/aktgho,loregsipceacltievxealmyi.naDteiaotnhsohcocwurerdednowithi4n days codmospeoulenvdel:s.relCaltineidccalhasniggenss;ihnocwluedveedr,wetihgehret wloasss saknidnliarbriotraetidon at all bnarseaalthdiinsgchataraglled(oSs0e00lemvegl/sk.g)I,nsahdadiltlioown,brleeatthhairnggy ((53000000 mmgg//kkgg)),, p(a5l0l0o0r (mg5/0k0g0),mgw/ektg)u,nddiearrnrehaetah(t5h0e0b0omdgy/k(g5)0,00weaankdn7e5s0s0 mg/kg). References: DaundPocnytanCoos.is(1(977590)0.mUgn/pkugb)lwieshreedobDsaear,veHda.skell Laboratory Report No. 659-79. TSpyepceie:s/strain: Method: : K81e:a3n4c8d.y3,55G.. L., Jr. (1985). ToxAipplc.Phoarmlacol.., MDaelremarlabIbrirtist/aNtieownZealand White aSriexasm,aalnedrapblbaictesdwienrFeDcAl-itppyepdefsrteoecokfsh.aiDroosensothfe 0t.r5ungksaonldidlateral athmemiontnaictusmkipnerufnldueorrogoacutzaenosaqtuearweesr,eaanpdpltiheedteasstasnitaeqwuaesous paste (0 semi-occluded (rubber sheeting was loosely wrapped around the EIDO91543 = 0G GLP: Test Substance: Results: + Reference: wterurnekraenmdosveecdurferdowmitthheasdthoecsksi,vethteappea)t.cAhfetserre2mo4vheodu,rsa,ndthether.abbits reactions No observed. Observations were also made at 48 hours, AAmmmmoonniiuumm ppeerrfflluuoorrooooccttaannooaattee,cpauursietyd ampiplrdotxoimmaotdeelryat1e0s0k%in irritation in when tested 24 on htohuerss,haavneddsilnitgahctt tsokmiondoefrraatbebiitrsriutnatdieorn in 48 hours semi-occluded conditions. DuPont Co. No. 636-79. (1979). Unpublished Data, Haskell Laboratory Report Type: Species/swain: Method: GL: `Test Substance: Dermal Irritation Male rabbits/New Zealand White `aTnwdetnrtuyn-konaeremasa,leanrdabfbiirtesdwweirtehcplliapsptiecd cforleleaorfs.haAimromvoenriutmhe.back perfluorooctanoate impregnated Teflon strips or ammonium bpearcfklouforeoaocchtarnaobabtiet.imTphrreegenraatbebditKsesvelravredsatsricposnwtreorlesapapnldiewdetreo the `wTrhaeptpreudnkionfneoanc-harmambobintiwuamsptehrefnluoccrcolocutdaendoa(twer-atprpeaetdedwimtahtearliaaly,er Afoifeplra4s-t,ic8w-,raopr,2g4a-uhzoeursterxeptochsubraendpaegrieo,dsa,ndthaedwhersaipvpeinsgtsretwcehretape). wreermeovseodakaendditnhae 5e0x:p5o0seetdhaanreoals:wwaetreer wsiopluetdiowni.thThgeauazneipmaaldss wthearte observed No afier unwrapping for skin imitation. Afimbemrso,n3i8u%mTpeefrlfolnuorroeoscitnatnhoaatteinicmlpurdeegdn2a.te9d% TTerfiltoonn X(-4180%0Taenfdl.on 0.061% oil) ammonium perfluorooctanoate, and 14% dimethylsilicone Results: Reference: Type: Species/strain: Method: KAemvmloarnifuibmerpse,r4fl2u%crKoeovctiaanroatreesiinmptrheatgniantceldudKeedv3l.a2r% (T4r0it.o5n% X-100 and 0.067% ammonium dimethysilicone oil) perfluorooctanoate, and 17.5% NDuoPsoknitn Ciomi.ta(t1i9o8n1)w.asUnopbusbelrivsehdeddurDiantga,thHeasskteuldly.Laboratory Report No. 736-81. Eye Irritation ROnaeb-btietnst/hNemwLZ(e3a8l.a3nmdeW)hoiftseolid test substance was placed ino the 2ri0ghsteccoonndjsu,nc|titvraelatseadceoyfeeawcahs owaf2shreadbbwiittsh(steaxp wnoattesrpefcoirfi1edm)i.nuAtfet.er The treated eye of the other rabbit was not washed. Observations EID091544 2 cgenin GLP: ReTseuslttSsu:bstance: Reference: loafmtpheacto|maenad, 4ihrios,urasn,dacnodnjautn1c,t2i,v3a,we7r,e14m,a2d1e, waintdh2a8hdaanyds-,slit aFfltueorr-tIh-estdraiypofsttarienaatnmednta.biomicroscope were used at`examinations No cAAommmmmeooalnniiopuuammcippteeycrfwfliluutoohrraoooosccmttaaalnnlooaaartteee,acopaufursisetedyveg1re0en0eor%paalciizteyd, minotdeerrmaitteent emyoedetrhaattewairstiusn,waansdhmeoddeafrtaetretrceoantjmunecntti.viTthisewohcuelnarteesftfeedctisn a rabbit hpgeerraasldiiusnatgle)ld.y, Aarenncdeedayteed2;d1o-hs2oe8wdedvaweiyrts,hwttahhese smtemisaltldlswuabirstethaavnoacfscecouamlnaedraiplzraotomippoantcli(tysyign of `mwnoaodsrehmraealdtwebiattdohisanlsi7mghadtlalcyosan,rjeeuaxnccotefipvtsiltfiigoshrtwmtiiotlhdmoncdooenrijrauintticectiecfvofamelcetar.eldTnohepseasc,eitywyehaiwncadhs was normal DuPont Co. within (1979). 14 days. Unpublished Data, Haskell Laboratory Report No. 635-79. Repeat Dose Toxicity Type: Species/Strain: ESxepxo/sNuurmeber: Period: TFrreeaqtumeenncty: of LeEvxepolssu:re: Method: GLP: Test Substance: Results: RMeipceea/tCeDd-1Dose Oral Toxicity Study MRaatlse/aCnld:fCeDmale/S/group 9 doses (3/week) 3 weeks 0T,h0e.1t,est1.s0u,b1s0tamncgek,gas aqueous solutions, was administered by rientcreaigvaesdtrwiactienrtuobnaltyi.onBtoodryatwseaingdhtmsicaen.d cCloinntircaollsriagtnssawnedrmeice recorded. the livers Animals were were removed sacrificed 3 days and weighed. after the final dose and No AAmsmigonnifiiucamntpleirvfelruwoeroiogchttanionactree,aspeurwiatsy naoptperdoxiinmbaottehlyma1l0e0a%nd female mice Liver weights at the were | and noted 10 in mg/kg levels. male rats, but oSnilgyniatfi1c0anmtgl/ykign.creTahseerde were no significant any dose. changes in the liver weightsof female razs at EID091545 2 eeoLsy : Reference: oMcocrutralrietdyioncmcaulreremdiicne,2/m5alfeemraaltse, moircfeeamtal1e0 rmagt/skagt.anNyodomsoeralleivetly tfeesmtaeld.eraStpsoarnaddiicnwtehieg0h.t1,los1s.0,ocacnudrr1e0dmign /tkheg0m.a1,le1a.0n,danfdem1a0lmeg/kg DmiucPeo.ntWeCaok.n(e1s9s83)w.asUonbpsuebrlviesdheidn tDhaeta1,0Hmagsk/eklglfLeambaolreatmoircye.Report No. 138-83. Type: Species/Strain: RReaptesa/tCeeld:CDDose Oral Toxicity Study SExepxo/sNuurme:ber: ~~ Male/12 Period: Frequency of 12 days; 14 days of recovery Treatment: Exposure 10 daily doses (5 doses, 2 non-dose days, doses) Levels: Method: 0,67 mg/kg Each of 6 rats received 10 daily doses of ammonium psoelruftliuoonr.ooBcotadnyoawteeigbhytsinwtreargeasrtericcoridnetdu.baTtihorneeasraatns awqeureeokuislled 414hoduaryss alfatteerr. reOcregiavinnwgetihgeht1s0"wedorsee,reacnorddtehde. rSeimxaiunnddeorsweedrretksilled GLP: Nseorved as controls. Test Substance: Results: `ATmhemmoonsitupmropmeirnfelnuotreofofcetcatnoofatthe,eptuersittsyu9bs9t%ance was enlargement of 4th5e%lihveera,viwehricthh,anatthtahteoefntdheofcotnhterdolosraagtse. rTehgiismecnh,anwgaespaebrosiustted. asfotmerewcehsastatlieosnsosfindcoesa1g4ed,abyustltahteerwtehieghlitvedrisscwreerpeanocnylywa2s0% heavier than thoseofcontrol rats. `cTohnetrroelnarlasw,eiagnhdtsthiwserinecr2e0a%sehpeearvsiiesrtetdhaafntetrhocseessoafticoonrorfesdpoosnadgien,g bweeiingght2c2h%anagbeosvewetrheatonfott haecccoomnptaronlieradtsby14modrapyhsollaotgeir.caTlhcehsaenges. Reference: `lTohweerptahncarneatthiocsweeoifghcotnstrwoelrseatslhieghtelnyddoefptrhesesetde,stbaenidngre8c%ovaenrdy 12% pihnacsreesa,serdesipnewcteiivgehlty.afTehrethaedrleanstaldsosaen,d+t1es4t%es awnedre+1sl1i%g,htly rDeusPpeocnttivCeol.y,(bnu.dt)r.etUunrpnuebdltiosnhoerdmDaalta1.4days later. EID091546 x LS Type: SSpeexcNieusm/bSterra:in: Exposure: PeFrrieoqdu:ency of Treaunent: Exposure Levels: Method: 14-Day Feeding Study ~~ RMaatl/eC/r20l/:gCrDoupBR 14 days; 56 days of recovery ad libitum for 14 days 0,30, 300 ppm abRnoadtdsywwewerereiegfhaetdpspfrrooaoxndigmeaadntdferlwoym6a1wa9etde6lk0iseb2io4tlr0udma5,.t aDRmuairtvisalnw.getrAhetehstoteuussdeypedsrtsiaiornd,gltyhe tceascthsugbrsotuapncwee.reDifeetdsdwieetrethpatrecpoanrteadinoendce0,f3o0r,toher 23-0w0epepkmfoefedtihneg wpeeriigohdeadnadnwdeorbesesrtvoreeddfroerfrcliigneircaatledsiugnntsiloufsteodx.iciAtlyl.raRsatwsenroet osbacsreirfviecedddautritnheg etnhed roefctohveerfyeepdeirnigodp.erCiaogdewseirdee wexeaimgihneadtiaonnds to rdeattesc/tgrmooupriwbeurnedsoarcrdiefiacdedraatts twheereencdoonfdtuhcete1d4t-wdiacyefdeaeidliy.ngFpievreiod, wanedigohnedraectoevaecrhy sdaacyrsif7i,ce28p,erainodd.56B.loLoidvesrasmwpelrees rweermeovteadkeanndfor eenrgdoanfotfhlueorfiedeedicnogncpeenrtiroadtaionnd aonnalryesciosvefrryomdaryat7s.sacrificed at the. GLP: ReTseuslttSsu:bstance: Appropriate body weight sgtaaitnisst,icaanldmoertghaondswewiegrhet used data. to analyze body weights, No ADimemtsowneiruemnopterafnlauloyrzoeodc.tanoate, purity approximately 100% tNooxicmiotrytanloitteiedsiwnetrhee o3b0saernvde3d0d0urpipnmg tghreousptusddy.uriCnligntihcealfesiegdnisngof dpiesrcihoadrgien,claunddedhuirnrcehgeuldarporsetsuprier.atiSotna,tirsatpiicadlblryesaitghniinfgi,carnetddneacsraelases rinomuea0nabdoadyys w7eiagnhdts14weofrtehoebsfeeerdviendgipnerraitosdfarnodmotnher3e0co0vperpymddaoyse s7i.gnMiefiacnanbtloyddyewpereisgshetdgdauirnsinfgrtohmetfhiirsstswaemeekogfrofuepedwienrge. iSnigrnaitfsficraonmttihncere3a0seasnidn3m0e0apnpambsdoolsueteglriovueprswesiacgrhitfsicweedraet othbeseeravded Oifntchreeasfeededmienagnperreiloatdiavendliovenrrweeciogvhetrsywdearyes o7basnedrv2e8d.inSirgaatisfifcraonmtly the 30 and 300 ppm dose groups sacrificed at the end of the feeding EIDO91547 x coon spaecrriiofdicaenddoonnrreeccoovveerryyddaayy287,. and in the 300 ppm dose group rats Reference: rMeecaonvebrlyodoadyo0rgwaenrofel0u.o3ripdpemcoinncecnonttrraotlioantsso,fr33a.t2s pspamcr'iifnictehde.on m30eapnpbmloraotds,oarngadn7o1f.l5uopripdme icnontcheen3t0ra0tpiopnms wraetrs.e 0O.n9 prepcmovfeorr.y day 7, controls, 300 pra 19.3 ppm group. for the 30 ppm group, and 22.2 ppm for the DuPont Co. No. 326.95. (1995). Unpublished Data, Haskell Laboratory Report Type: Species/Strain: ESxepxo/sNuurme:ber: Period: Frequency of ETxrpeoastumreen:t: Levels: Method: GLP: Test Substance: Results: References: 14-Day Feeding Study " ~~ MMailcee/aCnrdf%eCmDa-l1e/S/group 14 days ad libitum for 14 days 0,30, 300, 3000 ppm wMearleefaendddfieetmsalceonmtiaicnei(naggaem4m3oannidu4m4pdearyfsl,uowreoiogchtianngca2t1e tfoor38 g) c1o4nccuornrseenctultyivaenddafyesd. oMnallyegarnodunfdemcahloew.conItnrdoilvsidwuearleboobdsyerwveeidghts, wfoeorde croencsourdmepdtiaotnt,hean1d4-cdlianyicsaalcrsiifginces.were recorded. Liver weights No AAlmlmmoanleiuanmdpfeermflauloeromoiccteandoiaetde,afptuerridtoysaipnpgrowixtihma3t0e0l0y p1p0m0.% One. afnedma3l0e0m0opupsme.diLeidveatr 3w0ei0gphptm/.bodByodweyiwgehitgrhattiloosssshoocwcuerdreaddoatse3-00 sriegsnpsonosbeseirnvcerdeaisnecaltud2e3d0upnkpemmpintmhaelaedaanrdeaf(e3ma0l0eanmidce3.00C0limngi/ckagl) aDnudPownetakCnoe.s(s19(8320)0. mg/kg). Unpublished Data, Haskell Laboratory Report No. 12:82. Kennedy, G. L., Jr. (1987). Toxicol. Lett, 39:295-300. Type: 14-Day Feeding Study Species/Strain: Sex/Number: ~~ Mice/Cri.CD-1 Male and female/S/group/gender Exposure: Period: 14 days EID091543 2 0ooy iy Frequency of TrEexapotsmuernet: Levels: Method: GLP: `Test Substance: Results: adlibitum for 14 days 0, 10, 30, Male and 100, 300, 1000, 3000, 10,000 ppm female mice (age 41 and 42 das, weighing 19 t0 30 g) w1e4rceonfseedcduiteitvsecdoanytsa.inMinagleamamndonfiemuamlepecrofnlturoorlosowctearneooatbesefrovred concurready and fed only ground chow. Individual body weights, food were consumption, and clinical signs were recorded at the 14-day sacrifice. recorded. Liverweights No Ammonium perfluorooctanoate, purity approximately 100% Death occurred at 1000, 3000, and 10,000 ppm. All female mice at 3000 ppm and all male 2-week time point. All mice at 10,000 10,000 ppm ppm female were mice dead at the and 3000 ppm male mice were dead at the 1-week time point. Although death owcacsurnrotedreipnotrhteed1.000 ppm mice, details on the number of deaths Reference: Body 3000, weight loss and 10,000 occurred at the endof ppm male and female each mice. week at 300,1000, Liver weighubody `weight ratios showed a dose-response increase a>t 10 ppm in male =a13n00d000f,0eamnpadplme3)0m,i0c0ter.pepmmoCl)ris,np(iac3lal0lo0rsai(ng1dn0s,1o00b00s00erppvppemmd)),,inpscitllauoidenereeddcwpteeiroainknn(e1ea0ls0sa,r(e1a00 (100- 1000 ppm), weight loss (100, 1000, 3000, and 10,000 ppm), and unkempt appearances (30--0 10,000 ppm). DuPoat Co. (1981). Unpublished Data, Haskell LaboratoryReport No. 560-81. Type: Species/Strain: ESxepxo/sNuurmeber: Period: Frequency of Treatment: Exposure Levels: Method: 14-Day Feeding Study ~~ Mice/Cr:CD-1 Male and female/S/group 14 days oh ad libitum for 14 days. Ammonium perfluorooctancate: 0, 30 ppm Nonadecafluorodecanoic acid: 3, 10, 30, 300, 3000 ppm pMeirxftluuroersooocftannoonaatdee:ca1f5/l1u5o,ro5d/2e5c,an2o5i/c5 apcpimd/ammonium Male and female mice (age 44 days, weighing 24 to 35 g) were fed. diets containing either ammonium perflucrooctanoate, : snuobnsatdaenccaefslufoorro1d4eccaonnosieccuatciivde, doarymsi.xtMuarleesoafntdhefetmwaoletecsotntrols were observed concurrently and fed only ground chow. Individual body EID091549 = cays rweeciogrhdtesdaantdtchlein1i4c-aldasyigsaascriwfeircee.recorded. Liver weights were - GLP: Test Substance: Results: No LAimvemrowneiiugmhtpbeorfdlyuowreoiogchttanroaattieo,sphuorwietydaapnprionxcriemaasteelaty a1ll0l0e%vels etensltaerd.gemMeinxtinagpptehaer2edtetsot bseubdsotsaen-creesladtieddnwoitthalter the effects. Liver * snuobnsatdaenccaefsl.uorodecanoic acid appearing the more potentofthe two Reference: NDou.Po5n3t7-C8o2.. (1982). Unpublished Data, Haskell Laboratory Report Type: SSpeexc/iNeus/mSbterra:in: Exposure: Period: Frequency of TrEexaptosmuernet: Levels: Method: GLP: Test Substance: Results: References: 21-Day Feeding Study ~~ MMiaclee/aCnrdlf:eCmDa-le1/S/group. 21 days awidtlhiobuittucmomfporou21ndd,ayfsor(2Midcaeysw)ere mistakealy fed ground chow, M0a,l0e01a,n0d0f3e,m0a.le1,m0i3c,e 1,3, (age 10,30 ppm 41 and 42 days, weighing 21 t0 33 g) (wseursepefenddeddieitns c1o%ntcaoinminogilabmemfoorneibueminpgemrfilxueodroionctgarnoouantdechow) for c2o1nccuornrseenctultyivaenddafyesd. oMnalylegraonudnfdecmhaolwe.coInntdriovlisdwuealreboodbsyewreviegdhts atnhedc2l1i-ndiacaylsascirginfsicwee.re recorded. Liver weights were recorded at No LAimvmerosnwieuremspiegrnfilfuiocraonotclytahnecaavtiee,rpautri3t0ypappmpr,osxliimgahttleylyhe1a0v0i%e.r at N3oppcmh,anagnedsaipnpleiavreredweniogrhmtalwearte10sepepnmait nfemeadlinegalnedveflesmoafle1 mpipcem. or lliogwhetro,fnaond dtihfefseirgennicfeiscaatnc1e0ofptphme, cishqaunegsetioobnsaebrlvee.dTahte3 opnplmy,cliinnical sDiugPnoonbtsCerov.e(d1w98a2s).spUonrapduibcliwsehiegdhtDaltosas,. Haskell Laboratory Report No.323-82. Type: Species/Strain: ESxepxo/sNuurmeber: Period: Keanedy, G. L., Jr. (1987). Toxicol.Lett., 39:295-300. 2-Year Feeding Study MRaalve//C1r5l6:/CgDrouBpR 2 years EID5185 2 CooL IY TFrreeaqtumeenncty: of LeEvxeplossu:re Method: oe ad libitum for 2 years (M0ca,ol0net(rproaalit)rs,-efOesd()ec,o3nat0drm0oilpnippsamtier-rfeeddetiotthheer0a(mamdoinpiiurammpceornftlruoolragsrcotuappoate dgeirreootuupfposr(eCaaPpc-phCr3ro)ax)t,iwmaoarst3ed0el20syipgypneaamrtsea.dmfAmofortnierithuaesmrspihegornrfmmleouanctartloooectvtraaelanutoamtteienotinn ae p(o1i0n/tg)r,oourp/etviamleuaptoiionn)o,fcpeelroprxoilsiofemreatpiroonliefvearlautaitoino(n8/(gr/ogurpo/uipm/ei.me Sptoaibnit)l.ityAolflarmatms ownerieupmropverifdleudofroooocdtaannodattaepwwas acoantfdirbemeidr.by Tahnraoluygsheoautsttthheebsetguidnyn,incgo,ncmeindtdrlaet,ioannodftehned otfestthceosmupdo.und ia the diet and the homogeacity of the test diets were determined. sAtlaln.ratBsowdeyreweaipgphrtosx,imfaotoedlcyon4s9udmapytsioonf,aagnedocnlitnhiecadlasyigonfsstwuedrye monitored throughout the study. 6B,l9o,o1d2,wa1s5,co1l3l,ecatnedd 2f1ormhoonrtmhosnaalfearnailniytsieastiaotnoafptphreoxsimwaatye.lySe1r, u3r,a wfoalslicalneasltyizmeudlaftoirntgeshtoorsmteornoene,(FeSsHtr)a,diaonld, lpurtoeliancitziinngcohnocernmtoranteio(nLsE.D, R1a2t,s15w,er1e8,saancrdif2i1cemdonattthhse ffoorlcleolwlipnrgoliinfteerraitmiotnimaendpopienrtos:xi1s,o3m,e6,9, ptersotleisf,ecraptiidoindeyvmaildueast,ioancsc.esTshoeryfsoelxlogwlianngdo(rAgaSnGs)wuenriet wwietihghfeldui:d, lciovaegr.ulaItmimnegdigalatnedl/ysaefmtienrawleviegshiicnlge,wtihtehlfilvueirdarnedmotevsetdes, fprroosmtate, and palnaicmeadlsinisecleec<toelddfohropmeorgoenriizsaotmieopnrobluifffeerratfioornpeevraolxuiastoiomnalwere psreelpeacrtaetdifoonr. cTehllepfrooliilfoewriantgiotnisesvuaelsuawteiroen:croilglhetctaenddflreoftmttehsteesr,ts gerpoisdsidlyemsiiodness., AAlSlGr,atlsisveurr,vdivuiondgetnhuem2,4p-imtuointtarhy,teastodpearllioodrgwaenrsewith usnaictr,ifciocaegdualnatdinnegcgrloapnsdi/csde.miBnraalinv,eshiecalre,s liver, with fslpuliedern,emkoivdeaedy,s, ASG plirvoesrt,attees,teesp,ideipdiydmiiddyemsi,deasn,dptaensctreesawse,raendweoirgghaends watitnhecgrroopsssy.lesTihoens were examined microscopically. Data were analyzed by appropriate statistical methods. EIDO91SS 1 coo ReTseuslttSsu:bstance: Reference: AInmcmreoanseidurmelpaetirvfeluloirvoeorcwteaingohattes,wpeurreitoyb9se8r-v1e0d0i%n the ammonium palesrofliunocrroeoacsteadnoiantteh-etraematmeodnraitus.m HpeepraftliucoBr-oooxcitdaantoioantea-cttirveiatyrtaewtdsasat salilgntiifmiecapnotilnytsa.lteArmthmeornaiteuofmLpeeyrfdliugorcoelolctBa-nooxaitdeatdiiodnnoort Leydig cell parpoplriofxeriamtaitoen.lyM2o0r-etoivmeers,letshsertahtaen otfheBr-aotiedoaftihoepnatinicLeB-yodxiigdacteilolsn.was uSnecrhuamngteeds.tosTthereornee,weFrSeH,,hporwoelvacetri,n,siagnndifLicHanlteivenlcsrewaesresein serum e1s,t3r,ad6i,o9l,l1e5v,els18i,nanthde2a1mmmoonntihus.m pAetrf1l2uomroonotchtsan,otahtee-atmremaotnediuatms at pwehrefnlucooromopcatraenodatteo-tthreeaptaeidr-rfaetds choandtreolle.vaHtiesdtospeartuhmoleosgtircaadliol levels ecevlall,uaantdiopnarnecvreeaatliecd accoimnpaorucnedl-lrteulmaotresd. iBnacrseeadseosninthleisveedra,tLae,ytdhieg Lesetyrdaidigolcellelvtelusmoarnsdarpepdeuacretdoprboeladcuteintoletvheelsc.ombination of elevated `DuPont Co. (2000). Unpublished Data (Draft Manuscript) Type: SSpeexc/iNesu/mSbterrai:n: Exposure: PeFrrieoqude:ncy of Treament: Exposure: LMeevtehlosd:: RReaptesa/tCehdR-ECxDposure Inhalation Study Male/20/group 2 weeks; 42 days of recovery 6 hours/day, 5 days/week 0,8, 80 mg/m' Houseline air eyclone-head d(uasptprgoexniemraatteolryc2on0nLeicmtiend)towaaspapratiscslee.d through a `aTghietaretsourl-teisnegravioribtohrantecpoanrttaiciunleadteawmamsonpaisusmedpeirntfoluaor3o0ocLtabnaotaetre.y jar exposure chamber. The atmospheric concentration of ammonium perfluorooctanoate in the exposure chamber was monitored at 30-mimite intervals. Rats were exposed, head only, for consecutive days, 6 hours per day. After 5 days, the rats were given a 2-day recovery (weekend), `which was followed by $ daily, consecutive 6-hour exposures. All rats were weighed and observed daily (except weekends) during the elixbpiotsuumraetaanlldtriemceosovetrhyerpetrhiaondsd.urFionogdtahnedacwtautaelrexwpeorseuraev.ailable ad eClaicnhicgarloulapbaorta,to1r4y,eaxanmdi2n8atdiaoynsspwoesrte-cpxeprosfuorrem.edAfotner10a rtaottsalforfom EID091552 3 000 1h a100 ,ex1p4o,su3r2e,sa,n5d r4a2tsdfaryosmpoesatc-hexgproosuuprew.erOerpgaatnhsolwoegriecawlelyigehveadl,uaatnedd absolute and relative organ weights were calculated. GLP: Test Substance: Results: gOrnoutphefo5r%eaynede9x*amdianyastioofnse.xposure, 10 rats were selected from cach No AOvmemraolnlimuemanpecrofnlcueoartoroacttiaonnosatwee,rpeu0r,it1y1a%pp5r,o8x3im=at1e7lfyor1t0h0e%0, 5, and 80 mg/m' exposure levels, respectively. Rats exposed to ammonium perfluorooctanoate showed a ogsfruoprpuerpceoswvsaeirsoyn.mooDrfuebrosidenvygewereealicyghhaetfxftpehocrstuoerudegd,huosrupitonrgtahedexitcpeoscsta.usreTeshoaefnb8dl3ifnomkrgi/1n4mg,days pawing, groups. chewing, and red eye and nasal discharge were seen ip all `elSeovmaeterdataslekxalpionseepdhtoospahmamtaosneiaucmtivpietryf.luEofrfoeoccttsawnoearteesdeuesnt idnisplayed gtlruatnasmaimci-npaysreuavfitcert0r,an1s4a,mainndas2e8arnedcogvleutraymdiacy-so.xaTlahceetiinccidence was related to dose; higher activities were found at the higher exposure dlievfefle.renHtowfervoemrc,onotnrlolys.the latter activity at 83 mg/m' was statistically dPeagtehnoelroagtiicoenvaolfuhaetpiaotnoscsyhteosweind tchleoluidvyerssoweflrlaitnsg eoxrpgorsaenudltaor aefmfemcotnwiausmnoptersfeleunoraofotcetaarno1a4t-edafyoror10lodnagyesr with no recovery. recovery period. This No oretlhaetredcoimnpcoruenadi-snreelliaveerdwheiisgthotlosgwicaschoabnsgeersvewde.re noted. Exposure- References: Nexoamciomneeadla,ftreirc5,oorr9coenxjpuonscutrievadlayesf.fects were seen in any of the rats DuPour Co. No.253-79. (1979). Unpublished Data, Haskell Laboratory Report Keanedy, G.L., Jr. et al. (1983). TThoexicologist, 3:22. Type: Species/Strain: RReaptesa/Ctreld:CEDxposure Inhalation Study SExepxo/sNuurmeber: ~~ Male/24/group Period: 2 weeks; 84 days of recovery EIDO9ISS3 32 009y Frequency of Treatment: Exposure: LMeevtehlosd:: GLP: Test Substance: Results: 6 hours/day, $ days/week bD0,yusp1t,a8a,st8smo0isanmpighgre/rtmeh"srooufghamamgolansis ugemnepreartfolru.orFooocrtathneoahtieghwecroencgeennterraattieodn d(e8t0emrgm/imn'e)d,bcyhgarmabveirmeattrmiocsapnhaleyrseisc.onFcoenrttrhaetiionntserwmeerdeiaptreimaanrdillyow wcoenrceendtertaetrimoinnse(d8baynda c|hmegm/imca'l, arneaslpyescetsiv.ely), chamber atmospheres hMeaalde-ornatlsy(taogdeu7s-t8awtemeokssp,hewreeisgfhoirng6 2ho4u0r-s2/7d9ayg,)5wedraeyse/xwpeoeskedfor 2 weeks (weekends excluded). During exposure, rats were observed oabnsdecrlviendicdaalisliygnfsorwe1r4r'encootveedr.y Pdoasyts-,etxhpeonsuwreeigrahtesdwearned wobesiegrhveedd and s2atcriimfeisc/edweaetk0,th1r4o,u2g8h, 8442,daaynsd o8f4rdeacyosveorfy.recFoivveeryr,atfso/rgraotuoptawleorfe96 test days. cCalicnhicgarloulpabaotr0a,tor1y4,e2x8a,mi4n2,atainodns84wedraeyspeprofsto-remxepdosounre$.raAtfstferroamtotal eovfa1l0uaetxepdosatur0e,s,14, 2r8at,s4f2r,oamneda8c4h dgaryosuppowsetr-eexppoastuhroel.ogiTcahlelyrats were eevxaalmuiatnieodn.grIonssaldydiatnidont,islsuunegss,anhedarotr,gatnhsymwuesr,essplaeveend, floirvemr,ictreostsecso,pic and kidneys were weighed. At necropsy, blood was collected for analysis of organofluoride wleevreelsainnalryatzebdloaotde.acBhloroedcosvaemrpylpeesriford.omBtlhoeo0dasnadmp8l0emsgf/rmo'm gtrheoups dLaayns.d 8 mg/m' groups were analyzed only at 0 and 28 recovery No AOvmemraolnlimuemanpecrofnlcueonrtoroacttiaonnosatwee,rpeur1i.t0y0a.p5pr,o7x.i6mate2.l5y, 1a0nd0% 83.9.2 12.8 mg/m'forthe 1, 8, and 80 mg/m' groups, respectively. Body weight analysis demonstrated no significant differences between controls and 1 mg/m'. Body weights from animals exposed t1o7-833m.g/Bmo'dywewreeigshigtnsiffriocamnatnlyihmiaglhesretxhpaonsecdonttoro8l0sfmrgo/mmt'eswetrdea.ys. osfigcnliifniiccaanltlsyiglnoswedrutrhinagnecxopnotsruorlessfsrhomowteesdtodnalyyss2l-i1g6h.t sOibgsnesrovfatniaosanls a3-n4d doacyuslaornditessctha1rgreat. diHeodweduvreirn,gaetxtphoesuhirgehacnodnc1enrattrawtaisons,acarfiiefriced EID091554 2 00a References: Type: Species/Strain: Sex/Number: winasexptrreombiasb.lyBeoxtphosoufret-hreesleartaetds,haaldthsoeuvgehrepawtehioglhotgilocses.valMuoartailointy c8o0umldg/nmot' deextpeorsmuirneegtrhoeucpaeuxskeiobiftdeedatlhu.ngTnhoeisee odfur2i4ngrattshein12th-eday exposure period. Oinrcgraenasteoibnolduyngw,eliigvehrt, raantdiostedsetemsonwsetirgahttesdafatesrig0nirfeiccaonvte,rdyodsaey-sr.elaTtheed liver/body weight ratios were siguificandly higher in animal eLtihxvrpeooruswgeehdi2gt8hotd8sa0ywsmergoe/fmsr'iegcntoihvfreiorcuyag,nhtbl2uy8thtdihgaihysesmorfairnyetcbhoeeva8enrmyagr./timMf?aecatannciaamubassleosdlubtye ainncruenaesxeplianilniavbelreweiincgrhetasseati8n bmogd/ym'w.eight accompanied by 3 normal aCllkianliicnael plhaobosrpahtaotraysemeiansaullregmreonutpss deexmpoonssetdratoteadmamnoinnicruemase in . perfluorooctanoate after 10 exposures, but this finding was si88g40nidmfagiy/csmaon'ftaroneniclmyoavlaestry8thnaronodudgi8fh0fe1mr4ged/nacmey'ss.owfeTrhreiecsofvoinuecnrrdye..aseAfpteerrsi2s8t,ed42i,n athned ``pCaonmlpoobuunladr-rheelpaattoecdelplautlhaorlohgyipcerftirnodpihngys, icnecntlruodleodbhuelaarvyhelpiavteorcs,ellular hypertrophy, and hepatocellular necrosis in animals exposed to r8elaantdio8n0shmipg,/mb'ut. wTehreesreevfeirnsdiibnlgesbsyho2w8eddayasn oefxproescuorvee-rryes(8pomngs/em') or 42 days of recovery (80 mg/m'). eBxlpooosduroer-graenloaftleudoprrideeseanncaelyisnisallclgeraorulypsde(mionnclsutdriantgedthaencontrols, this dfeincdrienagserdemwaiitnhstuinmee,xpbluatinweads).deBtlecotoadbloergafatneorfl8u4ordiadyes loefverlescovery in DboutPhouthteCcoo.nt(r1o9l81a)n.d 8U0npmugb/lmi'sheexdpDoastuar,eHlaesveklesl.l Laboratory Report No. 205-81. Kennedy, G. L., Jr. et al. (1983).TThoexicologist, 3:22. Kenaedy,G.L., 24:1325-1329, J. etal. (1986). Food Chem. Toxicol, RReaptesa/tCehdR-DCoDse Dermal Study Male/1S/group EID091s:55 34 eed Exposure Period: Frequency of ETxrpeoastmuernet: Levels: Method: . + 2 weeks; 42 days of recovery - 6 hours/day, 5 days/week 0, 20, 200, 2000 mg/kg pdMruaerlvienegartatthisen(g2ea-sgwteieo8enkwoeefexktpsho,esucwroeeimgppheoiruinnogdd.21wA0h-me2nm4o5prngei)eunwimenrgeacnodlglraroeodmtiong perfluorooctanoate, as each rat that had been an aqueous paste, was applied to the backs of eganudzeed pwahde.nCtohlelacrosmwpeorsuehnardveewmdaofsvreewdeiopaffehtdaerifrer.xopmoDstahuierleyra6dt-sa'hyobu1a0rc`,kesxpwoistuhreas. `Throughout the test period, food and water were available adlibitum. Body weights and clinical signs were recorded. After taken exposure day 10 from S rats from aenadchognrroeucpovfeorryhedmaaytsol14ogayndme4a2s,ubrleomoedntwsa,s MoGnreoa$snscaantbessc/orglrouoptusepyaaanfndtedrrheelixaspttioovspeautorhreogl1ao0ng,itacoanbldoeodxnyamrwieenciaogtvhietornysdawyesre1p4erafnodr4m2e.d bpleorfoodrwmaeds.coAlflteecrteedxfporsoumr5e r1a0tsa/ngdroounp rfeocroovregraynodfal`uyaosnrai1ln4yes.aensd.we42r,e determinations. exposure 9,and oEnyereecxoavmeirnyadtaiyosns1w3earnedp4e1r.foTrhmeedproonceedaucrherat after sienmcliumdiecdrogsrcoosspiocbsoebrsveartviaotnioonftuhseinegyaehsaunsginmgaagnbriifgyhitnlgiglhat,mpanadnd a slit-lamp biomicroscope. GLP: Test Substance: Results: Data were analyzed by appropriate statistical methods, No RAamtmsotrneiatuemd wpietrhfl2u0ormoogc/tkagnoaatmem,opnuiriutmy appeprfrlouxcirmoaotcetlayno1a0te0%showed normal body experiment. weights and no During the 10-d auynuesxupaolsuclrienipcearlisoidg,nrsa du ts ring the treated with either 200 or 2000 mg/kg after the exposure period. lost weight, followed Slight redness of the by a skin normalgrowth was observed in these 2 groups, along with salivation in the 2000 `mg/kg group only. recovery days 14 and 42. Clinical enzyme determinations `monitoring liver function (alkaline phosphatase, GPT, treated groupsafter and GOT) exposure 1s0h. oTwheedsdeosvea-lrueelsarteedtuirnncerdeatsoensoirnmaalll at Liver damage characterized all treated groups following by the coagulativenecrosis.was 10% dose. The incidence observed and in EID091556 by ogo sinevtehreit2y0ofmlgi/vkegr gdraomuapge14wdaasysdofseo-lrleolwaitnegd.theRe1c0ovedorsye,waasndcowmapslete iernsescteohnvetei2ra0yl0ldy0acymogm4/2p,klgertegevreoirunspat.lheoTf2w0loi0vemrragtd/sakemgxapggoresoeuwdpastaote2tsh0see0a0staimamglel/yktcigmoehm.apdlOetne bc1oo0adegxyuplwoaestiuigrvheetsn.beacsLriiosvs,iessrohwfoetwihgehedtsead,poibsdoeet-rhrmeiolsnaataendtahiebnsdcorolesuaetseesatonendfeorxelpllaootswiuivreneg30day i11n04c,rdweaiaytsshedaaaldriveietnrutwmhee(i0g2hn0to0rpmmeagrls/ikswgteeigdgrhfotourpsa4e2etnd4ai2nysdtahiyens2to0hfemr2ge0/c0ko0vgemrggyr./okuTpghaet gdraoyup1.0,atlhtehomuegahna kriednndeytwoewiagrhdtnsoorfmtahle w2a0smogb/skergvgerd.oupOnweexsposure skiigdaniefyicwaenitlgyhtgsrefarteorm tthhaen2c0o0nt0romlgs/, kagndgrtohuepmweearneasbisgonliuftiecasnptlleyclaesasnd 2th0a0n0cmongt/rkolgs.grTouhpe smheoawnedrelaasttiavteistteisctailcluylasrigwneiifgichatnstfirnocrmeathsee on esixgpnoisfuicraentdaiyncr1e0.aseOninrtehceomveerayndraeylat1i4,vethkeirdenewyasanadsttaetsitsetsicwaelilyghts of the 200 and 2000 mg/kg groups. References: eBxlpooosduroergdaanyof1l0u,orfiodlelolweveedlsbyshaodweecdredaossee-irnetlhaeteldeveellesvaattiroencoovnery days 14 and 42. These values after the 10" exposure ranged from 45a22n.,d88A1t,appanmbdl(o12o01d,8o2pr0gp0a,mnao(fn2ld0u,2o2r00i00d0,e maceon/ndckes2n,0t0rr0aetsmpigeo/cntkiogvf,ealrype)psrpaoetcxrtieimvcaeotlveyel)ryytoda1y,.4, s1e0rpupmme,ntzhyermeewaectrievintoy,rmaanldlniovecrlwineiicgahltsitogabsoodrybwoediyghwteirgahtitos and dleivfefle.reAncteas bflrooomdcoorngtraonlosf.luOorniederaltevsehloowfedaplpirvoexricmhaatnegleys5a0t pthpims, tmheearenwaebrsoelumtaerkanedd rleilvaetricvhealnigveerswaenidghstisg.niNfiocaontthienrcrtoeraiscesefifnetchtse DwuerPeoaetviCdoe.at(1a9t8t0h)i.s bUlnopoudbolrigsahneodflDuaotrai,deHacsokneclelntLraabtoiorna.tory Report No. 589-80. Keanedy, G. L., Jr. (1985). ToxAippl.cPhoarmlaco.l, 81:348-355. Developmental Toxicity . Type: Developmental Toxicity in Rats SSpeexc/iNeus/mSbterrai:n: ~~ RFaetmsa/lCers/l6:-C1D5/(grSoDu)pBR Route of Administration: Inhalation EID091557 36 009 Exposure Period: Frequency of Treatment: Exposure Levels: Method: Days 6-15 of Gestation 6 hours/day 0,0.1, Female 1.0, rats 10.0, 25.0 mg/m' were mated to males, and mating was verified by dfeotlelcotwiionngoofvserpneirgmhattcoozboaabiitnatthieonv.agTihnaeldlaayvatghaetesapcehrmmoartnozionag were detected was designated as Day 1 of gestation (Day 1G). F24ormEaxtpeedrifemmeanltesI (wfeermealteoshsaavceribfeiceendabsesfiogrneedpatrotucraitcihong)r,oauptotal of (12 females/group/Run). However, due to the degree of maternal ctooxnicceinttyraintieovnidweanscereidnutcheed2t5o.010m.g0/mmg'/mgr?ofuopr in Run Run II, I, this and 15 mated cfoenmtarloelsgwreoruepsas(s6imgantededtofethmiaslense/wgrgoruopu)p.weFruertahdedremdorteo,RtuwnoITm;oornee: wthaes1p0aimrg-f/emd'togrtohuep.25.0 mg/m' group, and the other was pair fed to F1o2rmEaxtpeedrfiemmeanlteIIra(tfsewmearleesdiasltlroiwbeudtetdotgoievaecbhirgtrho),upi.n RWuinthIthe addition of the 10.0 mg/m' group in Run II, 6 mated females were added to both the control and the 10.0 mg/m" groups. pReactfslwuoerroeocetxapnoosaetde winho1l5e0L-bogdlyastso aantdmosstapihnelreesssosfteaelmmRoocnheisutmerwtiypree-cmheasmhbemrosduwlietsh.inCwhhaimcbhetrhecornactsenwterraetihoonsusweedrienddievtiedrumailnleydinby gravimetric analysis either each % hour (1.0 mg/m', and 10 or 25 mg/m') or each hour (0.1 mg/m'), and by a spectrophotometric teexcphonsiuqrueed(aoynfoeratchhe0.o1thmegr/lme'veslasmtpelset,eda).nd on 5-6 samples per `Dcaomnssumvipetrieonwewiagshemdeaasnudreodbsdeurrviendgfgoerstclaitniiocnal(2sifgenmsa.leFse/ecadge). The ddaatmaswewrereecocloldeectdedf,roamndbeufatoirleaslalcsrtirfuiccteuurnatliallatlelramtaitonesmnaoltaenddafmeotanlg `tehexafmeitnuesdesfworergerocslsaspsaitfhioedl.ogiAcftcehrasnagcersif,iclei,vetrhweediagmhts wwaesrerecorded, aluntdeareapnrdodiumcptliavnetasttiaotnusswitaess wdeerteercmoiunnetde.d,Tahnedutmhebenurmobfecrorapndora positionofall live, dead, and resorbed fetuses were recorded. All live and dead fetuses wereweighedand sexed externally and EID09 558 2] e053 Lp: ReTseuslttSsu:bstance: aaillnittveereranwtailholenys,n. arnAedpmpotrhvoeexdliimvfeartfoeemltuytshbee%sodwfaetmrheeweefrxeeatmuesixenasoemdfinfeeoardcehfxotlreirvtniesarcltehraatl were swailemtrieelraaatrlilosyno.s,eTxahanemdifanelteludsstefsuonrtthheaedtaowdreamrlaetelerfaxtoairommnisen.dedfSeeftcoutrsieovsnisswc,eercraoelnetaaxliatnemirianntgietodnhse h22iyfsetesotoluosfgeis3cfaflreltoyumsfeeosarcfehrxoalmmiicnaatcothfietolhnir.tetecrIoonfntRtruhonel Ig2Ir,5o.ou0npem,gfw/eetmra'le hgperraoodcuepfsrsaoenmdd coafch oex4familintetder.s fIrnoamddtihteio1n0;.0thmegh/ema'dsgrforuopm aanldftehteusceosntirnotlhgergoruopupwepraeir ffeetdutsoesthweer2e5 emxga/mmi'negdrofuopr swkeerleetpalroacletsersaetdiofnosr, examination. All FsoarmeExapsefroirmEexnpteIrLimtehentprI,oceexdcuerpetsthuastetdhuendtialmDsawye2re1Gwewiegrheedthleess afnredqutehnetildyendtuirtiynofgegaescthatioofnf,spfreiendgcwointshuimnpltiiteorns wwaass nnoottmreetaasiunreedd., pwBoaelfsyocrnaeortebexodpnaeanctdetecwdaagpsaerttteuhrraitmtecidoonnD,taaeyiance1hdPdPba.emddTwihnaegs.dhaTomuhsseewddeartinee aowfeipagrhteudritainodn egexsatmaitinoendifnodrecxliwneircaelcsailgcnusl.atFedo,r aenadchfotresetagcrholuiptefrervtiialbitiyliitnydienxdaenxd and lactation Day 22 Pp. index were calculated. All dams were sacrificed on `The pups examined ffroromexetaecmhaldaamltewrearteioncsoutnotweadr,dstehxeede,ndwoeifghDeady, and 1 PP. cTlhienriecaafltesri,gnesaocnh Dpuapyw4,as7,w1e4i,gahnedd2a2ndPPi.nspTehceteedyefosorfatdvheerspeups in aolplhgtrhoaulpmsoolofgiRsutnonI (DEaxypser1i5m,e1n6t,IoT)r w1e7rPePe,xsahmoirtnleydafbtyeranthe eyes coopdeende.d.OTnhiDsaeyx3a5miPnPa,ticoanchwapsupcownadsucsatcerdifwiictehd tahnedetxhpeoseuyrees wleevreels fixed for possible future evaluation. Datawere Yes analyzed by appropiate statistical methods. TAhmemaocntuiaulmmepearnflcuoonrcoeoncttraantoiaotnes,apcuhriietvye>d9w5er%e 0 and a10p.p0r,oaxinmda2t5e.l0y m0.g1/4m,?1.e2x,p9o.s9u,raengdro2u1p.s0.mg/m'forthe 0, 0.1, 1.0, N21odeaffmesctesxwpeorseedobtsoearmvmedonati0u.m1 operr1f.l0uomrgo/omc't.anoNaotneeaotft10h.e0 mg/m' died, but they showed similar clinical signs to a lesser degree than EID091559 is econ sptueharrtvfilsvueeoertnoooactttetarhnme,oa2mt5oe.s0wtmaosgft/ohmv'eerlsleuvyrevlti.ovxoiArctst2ho5ardamtgws/eimtn'at,hbaadtom5mm/eo2n4nsi;diurdmedndoitshedbxerpcoorwesnausrdeeidspceforelieoodrdac;toianonsnduamarpnotuuinnodknetahmnepdetybaeopsd,pyenaowrsaeeni,cgeha.tndgamionudthu;nlgethtahregy, bMaasties miandlicliavteerd wtehiatghetxpcohsaunrgeestoaammomnogngiruoumppseorfnlauorreoloacttivaenowaetieghatt bi1no0cd.r0yeamwsgeei/gimnhl'tiovgrearigrnweeiaintgethrhterseoescugclrutoreurdpeisdn,dsweishgpiniictfheicstaihngetnlisyfigilncaiarfngiteclraynlrtivededreusc.creeTdahstiehsein relative liver weights of the pair-fed contrct groups. liNemovpelldaintftefsset,reedm.necaesn fnruommbcehrotrfolcowreproeraolbusteera,veodr ifnettalhedmeaetahninnuamnbyedrosoe.f dDaevmesloopnmDeantya2l1tooxfigceistytawtaiosnnaottadneymcoonnscternattreadtiuopnoonfsaacmrmifoinceioufmthe tpoexrifcliutyo,roeoxcptraensosaetde atsesdteedc.reCaosnecdenftetraaltwioeni-grhetl,aotcecduermrberdyoon-lfyeatatl - 25.0 body mg/m', weight wpehriscihstwedastooDvearytl1y toxic to PP, but the oot tdoaDmsa. y4ThPiPs. decreased vOinvoDfaryosm 15, 16, Run I or did 1n7otPPre,vceoaldecdonecxeanmtriantaitoino-nreolfattehde pups' eyes in emxaalmfoirnmaattiioonnosf.thIen evyieesw oofftthheespeupnesgfatriovmeRruesnulItTs,wasisminloatr in vivo conducted. Reference: hAamzmarodnti0utmhepceornfcleupotruoso.ctanoate did not demonstrate a uique DuPont Co. No. 881-81. (1981). Unpublished Data, Haskell Laboratory Report Staples, R. E. et al. (1984).Fundam.Appl.Toxicol, 4:429-440. Type: Developmental Toxicity in Rats SSpeexc/iNeus/mSbterrai:n: Route of ~~ RFaetmsa/lCe/r2l5:/CgDrYo(upSD()EBxRperiment I, 12/group (Experiment I) Administration: Exposure Gavage Period: Days 6-15 of Gestation EID091560 3% oo Exposure: Levels: Method: 0,100 mgrkg aI1n0m0amopmrgne/itkeusgtm/,d2paeyrnfotlonu-doperrtoeoegcrntmaainnntoeaftteehmeabmlyeagxraaivtamsguwemeardteo1as5de0mtimhngait/sktthgee/redddaamyso.r could tolerate for the planned exposure period of 10 days, dFaoyr tthhaetdsepfienrimtaivteozsotuadwy,erfeemdaelteecrtaetds iwnervaegminaatledltaovamgaelweas,s and the designated as Day 1 of gestation (Day 1G). cFoonrsEuxmppetriiomnendturIi,nbgogdeystwaetiigohntsw,ercelirnieccaolrdseidg.ns,Tahneddfaemesd were wceordeedcoflrloecmtjeuds,tabnedfournetislacarlifsitcreucutnutriallaailltmeartateironnaslnaontdedfeatamlodnagtathe fetuses were classified. Awfetreeresxaacrmiifniecdeo,ftlihveer dwaeimgshtonwaDsayre2c1oGrd,edg,roasnsdpartehporloodguiccticvheasntgaetsus swiatsesdweetreermcionuendt.edT,haendnutmhebearumobfecroarpnodrapolsuitteiaoanozdfailmlpllainvet,atdieoand, awnedigrheesdorabnedd sfeetxuesdesexwteermealrleycoarnddedi.ntAerlnlallliyv,e aanndd dtheeadlifveetfuesteusswesere fweetrueseesoxafmeiancehdfloirteerxttheamtawleraeltaelriatvieownsh.enAprpermooxviemdatferloymtoheftdhaem. m`waelrfeoerxmaemdinfeetdusfeosrwveisrceersailmiallaterrlayteioxnasm.inIenda.ddTithieonh,eaaldlssotfuanltled or tfheeturseesmaeixnadmeirnteodtoftoarlv2i/s3ceorfaleaacltherliatttieornwsearnedfaixseudffaincidenetxanmuimnbeedr of fwoerrheeafidxeadl,tewreartieonesx.amAillnefdetfuosress,keelxecteapltatltheerahteiaodnss.of those that sFoarmeExapsefroirmEexnpteIrIi, mtehentprI,oceexdcuerpetsthuastebdoudnytilweDiagyht2s1wGerweerceoltlheected aonnddtihfefeirdeennttgietsytofateiaonchdayosf,fsfpereidngcowintshuimnpltiitoenrswwaassnnoottmreeatsauinreedd., Ahtoluesaesdtitnwaopodlayycsabrebfoonraeteexcpaegcetewditpharbteurdidtiinogn., cTahceh ddaatme owfas `pawretiugrhietdioannwdaesxanomtiende,danfodrwcalisnitcealrmseidgnDs.ayFo|rPcPa.chThteestdgarmosupwere lfietrtteirlivtiyabiinldietxy ainnddegxeastnadtiloanctiantidoenxiwnedreex cwaelrceulcaatlecdu,laantedd.foArlelacdhams were sacrificed on Day 23 PP, without pathological examination. `Tehxeampiunpesdffroromexetaecrhnadlaamltewrearteiocnsoutnotweadr,dsethxeede,nwdeoifghDeady, 1anPdP. EIDo91s61 "0 000r an `Thereafter, each clinical signs on pup Day was weighed 4, 7, 14, and 2a2ndPPi.nspTehceteedyefsoor fadtvheerspe.ups in Dboatyhsg2r7ouapnsdw3e1rePPe.xaTmhiisneedxabmyinanatoipohnthwaalsmocloongdiuscttbedetwwietehnthe ethxepoesyuersewleerveelfsicxoeddefdo.r hOinstoDlaogyic35evPaPl,uaetaiconh.pup was sacrificed and GLP: * ReTseuslttSsu:bstance: Data Yes were analyzed by appropriate statistical methods, AInmtmhoe nprietuemst,peornfeluroarto(owcetaingohaitneg, purity 278 g) > 95% dosed at 150 mg/kg showed soenvethreemcloimniicnalgsoifgtnhseof5tTMoxdiacyi,tybybywhtihech4%tidmaeyitanhdadwalosstfound dead approximately 40 g body weight. Another rat (weighing 260 g) d5noodtsaeeyddsiaontf11d5ro0astimtnghga/tkatlgo1slt0o0satpmapgpr/pokrxgoi,xmiaatmdeavlteyerls6ye gc1,l1iangnidcbaylwetsrihegen3msi%wndeiarmyea.lnoAitfnttehre o1t0h0ermgra/tktgh/adtaoysdtoaspapgreolxeivmealtwelays j1u4dgg.edOntotbheistbhaesimsa, xthiemum that the dams could tolerate for the planned exposure period of 10 days. pIenrEfxlpuecrroiomcetnatnsoa[taenwdeIr,e 5fooufntdhede3a7ddaanmds1gwivaesnsaacmrmifoinceiduimn a th`meodroisbuinndgspteartie,oda,saclombpuatr|eodfttohe0 dofamthset3h7atcsounbtsroelquaennitmlaylsd.ieDduhraidng wcehtropmeoridnaecarlyaorrchaseaanadndwecrherolmeotrhharigniocr.thTewa.o aAlmsoonhagdthe remaining dInamtsh,e c4ondtervoellgorpoeudpa,ltohpeecoinal,yIclhiandiclaulnsgignnoinsoet,eadnwda|shfaodcadliaarlrohpeeac.ia that developed in 1 dam. FaprpormoxDiamyaste6l-y151/G3,ltehses ttrheaantetdhegrcoonutproiln gErxopuepr,imaenndtdIurgianignetdhe apomsmto-tnrieautmmepnetrpfeluroiroodo(cDtaanyosat1e6--t2r1eGa)te,dtghreobuopdsyigwneiifgihcatntglayin of the ebxocdeyewdeeidgthhtatwoafsthneotctoankterno,ltghreoruepf.oreI,nDEaxypser6i-m1e5nbtoIId,ytwheeiDgahyt g1a6iGns were not calculated. Ftheeeddocsoinnsgupmeprtiiodo,ntwhaestrmeeaatesdurgerdouopnlcyonfsoruEmxepdesriigmneinfitcaI.ntlDyulreissn.g cfoenetdrotlhavnaltuhee cionntthreolpogsrto-uepx.poFseuerde cpeornisoudm.ption was similar to the Mtheeadnifmfaetreenrcnealwlaisvenrowt esiatgihsftiocratlhlye stirgneiaftiecdagntr.ouAptwsaascriifniccree,as1eodf,tbhuet EID091562 41 0001 3N Reference: Miscellaneous Type: MeSptehcioeds/:strain: ldsieavvemre.sraglirveednaaremamsoonnituhme vpiesrcfelruaolrsouorcftaacneoaotfetwheasmeodbisaenrvleodbetoohfatvhee aIensmoEmrxopptneiiorunismm,epnaetnrdf1,leutthoaerlomobacoitdnatyneowanetaiengcahedtmoiwfneiprsretergnanotationancd.yv,eSrtishmeeilliyanrcalfiyfd,eecintnceedobfy `EpxuppevriiambielnittyILo,r0g0raodwvtehrwseasefdfeecmtonosntrraetperdo.ductive performance or on cTohmepoounnldy-ermebleaytoe-dfewtaals taonxiicnictryefaisneddiinngcniodteeadcethoaftfceotuulsdesbweith soiinsgstnihifefiicccaoatnnittornoosnlilgtyerisofuoapnn.atlhTyehzifesirdsdtibflyfueamrboeannecr-evtiaenirltienedcbitredasetn.vceerItsswuaspsrtehsseteanitnciscetiiwdcaeasal.lcye pofrotbhaebdlaymsa.reTsphoenspeosttopgaernteurmalviizabeidlisttyr,esgsreovwotkherdatbe,yatnhed toxic state daemvmeolnoipmuemntpeorftflhueoroofofcstparnionagtferwoemreadndoittiaofnfaelctdead.ms given rIenvveiavloedexnaomicnoamtpioounndo-frpeulpast'edeyaelstebraettiwoenseninDathyesp2u7psa.nd 31 PP Ahamzmarodntioutmhepceornfcleupotruoso.etanoate did not demonstrate a unique DuPont Co. No. 1-82. (1982). Unpublished Data, Haskell . Laboratory Report Metabolism 2FF0ee0mmgaa)ll;eepaarlnebdginnmoaanlrtaetpsrra(it7ms-i/8gCrweaelve:iCkdDasfoledmaalneds w(ewiegihgihinnggaapppprrooxxiimmaatteellyy 2ap0p0rgo)x;imaantdemlayl2e5r0atgs)(waeprperouxsiemda.tTehley rawtesewkesreolhdoaunsdedweciaghgiengand allowed food and water ad libinum. GlervoeulspsinAfEemarlatesrwatesreastaesftuendcttoiomneaosfuproestb-leoxopdosourrgeantoifmleuofroildleowing oGrarl aodAmui(ni2ps1tfreatmiaolnearnadtts)owiansvedsotsiegadtewimtuhlt2i5plmegv/ekrgsousraslilnyglaenddoses. G3rroautspsweBreansdacCrif(i1c2edfeatma4l,e 4r,at1s,/2g,ro4u,p)8,waenrde 2o4rahlloyurdsosafetderwidtohsing. a2.n5d o2r41h5o0urmsga/fktge,rdroessipencgt.iveGlryo,uapndD3(2r1atsfewmearlee sraactrsi)fwicaesd datos1e,d2, 8, EID09 563 2 000v 22 GLP: Test Substance: Results: 11 4, days 14,2, with 4, 8, 25 mg/kg orally each day and 3 24, and 168 hoursafterthe 11 rats were sacrificed dose. Group E at s(a1c2rimfailceedraatts),wa8,s2d4o,saenddat16285hmogu/rksgafotrearlldyosainndg,3 rats wege iGnrofeumpaslFeIratrsatfsowlelroewitnegstiendhatloamtieoansuexrpeobsulroeo.d oGrrgoaunopfFlu(o2r4idfeelmeavleels e3faxtrpsao)tsswuwraees.reexGspraoocsruiepfdsicG(ae0adnsaidtn1g4H,le%(,162-1hf,o2eu,mrp4l,eex8p,roa2st4us,rgaernoodufp1)160w8emhrgoe/umres'xpaaofnstdeerd to Gaanrsdoinu3gplreIat6(s1-w2heomruaerlesexacrparotissf)uircweeadosafte|x%p,mog2s/,em8d,'taoonrad0s.2i14ngmhlgoe/u6mr-s'h,aofurteresrepeexcxptpoiosvsueurlreye,.of 10 mg/m' exposure. and 3 rats were sacrificed at %, 2, 8, and 24 hours after pGrreoguapasntJ-vNerwseursenotnes-tperdegtno acnotmrpaatrs eanbdlotoodcoormgpaanroeflouroarlideexploesvuelrse in avdemrsiunsisitnehraeldat2i5onmegx/pkogsuorrea.llyGornoguepsJta(t1i2opnrdeagyna1n5t afnedma3lerartastsw)ewraes (s6acprriefigcneadntatf4e4m, a2l,e8,raatsn)d w2a4shaodumrisnaifstteerrdeodsi2n5g.mgG/rkogourpalKlyon gestation days 6-11 and 3 rats were sacrificed at and 2 hours aadftmeirntihsete6r"eddo2s5e.mgG/rkoguopraLll(y12onprgeegsntaantitonfedmaaglse 6r-at1s5) awnads3 ras Mwer(e6 sparcerginfainctedfaetmaV4l,e2r,at8,s)awnads24exhpoousresdafvtieartahseing1l0e d6o-sheo.urGroup wienhraelastaicornifeixcpeodsautre taond102mhgo/umrs" aofntegreesxtpaotisounred.ayGr15ouapndN3 rats (3 10 pregnant female rats) was exposed mg/m' on gestation days 6-15 and via inhalation, 6 hours/day, 3 rats were sacrificed at to % hour after the 10 exposure. Blood No samples were obtained from each rat. `ATmhemuopntiakuemapnedrfcllueoarroaonccteaonofaatem,mpounriituymappperrfolxuiomraotoecltyan1o0at0e%from tthhee pbeloaokdroefafcehmedal1e-2rahtosufroslplooswti-ntgreasatimnegnlteaonradlwdiotshevwiratsualratpoitdalwith aclpepaarraennctecbhyan2g4eshoiunrsb.loAoddoorsgea-nroefslpuoonrsiedewlaesvedlesmfoonlsltorwaitnegdmwuiltthipnloe foroalllodwoisningga. A slower single oral clearance dose. rate in male rats was demonstrated wAitshiinngl1e 6ho-uhroaufrteirnchealsastaitoinoneoxpfoesxuproesurerseu.lteTdheintpeestaskubblsotoadncleevels EID091564 0002s Reference: Type: Species/strain: Method: GLP: Test Substance: Results: nroatpiadflfyecctlebalroeoddflreovemlst.heMballooed,ratasndcltehaerendutmhbeecroomfpeoxupnodsumrueschdid more slowly. bPlroeogndalnetvealnsdfonlolno-wpirneggneainthterratosraslhoorwiendhasliamtiiloanreoxrpgoasnuorfelsu.oride `stTrhaeigahmtocuhnationfiasmommeorniincurmeapseersfrleuloartoiovcettaontohaeteonp-ressternatigahsttchheain aidsmoimneirsstraasttihoen tinicmreeafsoels.lowTihnigsasmumggoensiteudmtpheartftlhueoraooonc-tstarnaoiagthet chain cihsaoimnerissoamreerc,loerartehdatframoemtathbeolbiltoeodismporreseearta.pidly than the straight DuPont Co. (1981). No. 593-81. Unpublished Data, Haskell Laboratory Report Metabolism Male Male rmaitcse/Crl:CD s1oClu-tAiomnmwoansiaudmmipneirsftleuroerdoobcytainnctaratgeas(t0r.i5cuiCnitfubmagt)ioans taon8ayquoeuonugs caodnutlrtomlaglreourapts(2anradts6aanddul2t mmiaclee)mwiacse astacaridfoisceedoaft1204mhgo/ukrgs.anOdne t1rceoatnetdroglrgoruopu(p3(r3atrsatasnadn2d m2imciec)ew)awsadsossaecdriwfiitchedcahtol9e6sthoyurrasm.inTehe (sa1c0r0i0fimcegd/katg)9624hohuorusr.sAfaftteerrddoossiinngg,wriatths tahnedtmesitcseuwbsetraencpleazcnedd tihnen iantd2i4v,id4u8a,l7g2l,asasndme9t6ahbooulsiss.m Fcehcaemsbearnsd.urEixnheawleedre'c*oClwleacstesda.mpAlted asapcprriofxiciemattiemel,y 18-m2 LmLofobflboloodowdawsasrermeomvoevdedfrformomthtehreatmsi.ceLiavnerds owxeirdeizreedmoavneddc,ouhnotmeodg.enized, weighed, and 0.5 g samples were No AAlmthmooinugihuamppreervfilouuosfosotcutdayno(aDtueP,opnutriRteypaoprptrNoox.im8a2te8l-y11~00de%scribed lbeetlhoalw)efifnedcitcsaotfedatmhmatocnhioulemspteyrrfalmuionreoorcestiannocaotueldinrtehdiuscsetutdhye,atchuetree `pwearsflnuoorsoiogcntoafnoeantheavnicaefdeceelsi,miunraintei,onorofex'hCa-leadmamior.niTuhem differences babestowrepetniotnhoef2thsetudteisetssaurbestmaonscte.likIenlythbeepcraeuvsieouosf dstiufdfye,remncuecshinof the dchoosleewstaysrapmrionbeabwlayssialdlmiinnitshteergeads.troTihnteesntoinn-alabtsraocrtbwedheanmmonium preermfolvueodroboecftoarneoaatbesotrhpentiaosnscocoiualtdedocwciutrh, cahnodletshutsyrparmeivneea,tweadsthe. EID091565 # [LDERE Reference: acute lethal effects of ammonium perfluorooctanoate. For both followed rats and by fecal maincde,extphierperdiamiar.ry route of excretion was urinary, `After 96 hours, fecal elimination was nearly the same for both asiprectiheasn; thhoewreavt.erM,otshte mnootuasbley,extphiermedoussigeniefxiccraenttelyd mleosrsein"tCheiunrtihnee gtrheaantethrecorantc.enTthriastidoinffienremnocuesien urinary Liver. excretion was reflected as a DuPont Co. (1982). No. 405-82. Unpublished Data, Haskell Laboratory Report Pastoor, T. P. etal. (1983). The Toxicologis\t, 3:82. Type: Species/strain: Method: GLP: Metabolism Male and female rats Male and female mice Male and female hamsters Male and female rabbits A male and female of each species receiveda single 10 mg/kg dose `oTfhe""raCt-s,ammimcoen,iaunmdphearmfsltueorrosowcetarneoahtoeusviead iinntdriavgiadsutrailclyinitnugblaatsison. a`mnedtfaebcoelsiswmeuraeitcsolilmemcetdediaatte1l2y, a2f4t,er48d,os7i2n,g.96,Exapnidre1d20COhso,urusrianfet,er sdtoasiinnlge.ssTshteeelmmaelteaabnodlifsemmaclaegersabibmimtsedwiearteeliyndaifvtiedrudaolsliyngh.ousUerdinien aafntderfdeocessinwge.reExcpoilrleecdtCedO;24w,a4s8,no7t2,co9l6l,ec1t2e0d,. 1B44l,ooadndwa1s68drhaouwrns from the rabbits 168 hours after dosing. Tdohseinragtsa,nmdibcel,ooadnwdahsamdsrtaewrns.weAlrleaanllimsaalcrsiwfiecreed d1i2s0shcocuterdswaiftther kfiodlalcoywsi,ngsptliesesnu,esteesxtceisseodr,owvaeriigehse,db,raainnd, fGr.ozI.ent:rahcte,aratn,dlumnugssc,leli,ver, fskrionz,ena.ndMefattasbaomlpilsems.uniTthsewcearrecawsassehsewderaendthtehne wcaegieghweadshaensd were collected and refrigerated. rUardiinoea,ctCiOvi;tysaumspilnegsa, lainqduicdasgceinwtailslhaetisonwecoruentaenra.lyBzleododdi,refcetcleys,for tissues, organs, and homogenized carcass samples were analyzed lfioqru'idCsccionnttielnlattiboyn tciosusntueorx.idRaatbibointucsairncgaassetsiswsueereoxniodtizaenraalnyzded for HC No content. EIDO91s66 as 00043 Test Substance: Results: Reference: SAumbsmtoanntiiaulmsepexrdfilfufoerroeonccteasnoiantrea,tspuarnidtyh7am0s%ters were observed in ftheemaelxecrreattiaonndofth"e"mCaalcetivhiatmysftoelrleoxwcirnegtaedsionvgelre 9or9a%l doofset.he Tohrieginal tVhCe faecmtiavlietyhbayms1t2e0r hexocurrestaefdte3r9daosnidng6,0c%onovfetrhseeloryitghienamla"leCrarand raacbtibviittsy,exrcersepetcetdivtehley,'*bCyac1t2i0vihtyouarssrpaopsitd-ldyoasnindgc.omBpoltehtesleyxeassotfhe efxecmraelteedraotnalnyd2t1he%omfatlheehaomrsitgeirn.alT'h"eC amcatliveitaynbdyfe1m2a0lehomuircse mpoaslte-daonsdinfge.maTlheerarbabpiitds)exccornettaoirnse(dfneemgalliegirabtl,emaamloeunhtamssotfe"r*,Canidn organs and tissues at sacrifice. The slow excretors exhibited the lheivgehlesstin"t"hCeckoindcneenytsr,atliuonngss,inanthdesbkilno.od and liver with substantial DuPont Co. No. 62-82. (1982). Unpublished Data, Haskell Laboratory Report Type: Species/strain: PPrleagcennatnatlraTtrsa/sntsrfaienrnot specified Sex/Number: ~~ Females/6 Method: `Cc-alrbaobneyllepdosaitmimononaindumhapderafslpueocriofoicctaanctoiavtietywoafs0l.a5beulCeid/mong.thWeater was used as the dosing vehicle. The pregnant female rats received asingle 10 mg/kg dose of "C-labeled ammonium ``wpeerrefliunodriovoicdtuaanlolayteplbaycegdavianggelaosns tmheeta1b9o%ldiasym ounfigtessitamtmieodni.atTehleyrats after dosing. Tafwtoerrdaotssinwge.reBslaocordifwicaesd datraewanchattismaceriifnitceervaanldofre2f,ri4g,earantded. bTohures dpliascseeacttaesd,furmobmileiaccahl octohredrs,,aannddwfeeitgusheesd.weTrheethuemnbirleimcoavlecdo,rds and apnladcefnettausseswewreereinfdriovziednu.alOlyrgpalnacsedanidnttoispsaupeesrwceormebaulsstoieoxncicsoende,s Uwreiingeheadn,dafnedcaflrsozaemnp.leTsheexccarrectaesdsbesetwweereenadlossoiwnegiagnhdedsaacrnidfifcreozen. swuecrceescsoilvleelcytewdiatnhddiflruotzeend.eteTrhgeenmte,twaabtoelri,stanndunaictestwoneer.e washed The washes were collected and stored. eTnhteireptlya.cenStaamsp,luemsboiflitchael mcaotrdesr,naalndtifsseuteuss,escawrecrases,oxainddizfeedceisnwteherier calosuontoixnigd.izTehdeaunrdinaenaalnydzecdagfeorw'asCheacstiwveirtey baynalliyqzueidd sdciirnetcitlllyatbiyon liquid scintillation counting. EIDO091567 PP 009%! GLP: Test Substance: Results: + Reference: No Ammonium perfluorooctanoate, purity approximately 70% P`wlaascesnhtaolwntrtaonsofcecruorfa"fCte-rlaabdemilneidstarmamtioonniouafm pseirnfgllueoorroaolctdaonsoeaotfe fCe-tallalbeevleelsdoafmammomnoinuimupmerpfelrufolruooorcotoacntoaantoea.teTahte2caonmdpa4rhiosuornsof rpellaacteinvtea,toatnhdeoctohnecreontrrgaatnisornesvoebasleerdveevdidinentchee mofatreesmiasltabnlcoeotdo, pfletaaclenctoanlcetnrtarnastfieroonfstohfeamtemsot ncoimupmoupnedrf.luHoorwooecvtearn,oabtye 4inhcoruerass,edthe csounbtsrtaasnttitoalloythmeorrteistshuaens aelxlaomtihneerdo,rgaamnmsoannidutmisspueersfleuxoarmoioncetda.noaItae `inamthmeonfeituumsepsedrifdlunoortodocetcarneoaasteebceotnwceeentnr4a-t8iohnosuwrse.reTshiemipleaarkinfetal `Simganginfiitcuadnettqouatnhteitlieevselosfoabmsmerovneiduimn tpheersfpllueoerno,ochteaarnto,atleuncgasn,,and fat. ptlhaecreefnotrael,bbaerrwiaernsoffefrerreindgfmrionmitmhaelprleasciesnttaancteottohetrfaenrsufserw.ith the DuPont Co. No. 61-82. (1982). Unpublished Data, Haskell Laboratory Report Type: Species/strain: Method: EPfefrefcltusoorfooDcotwaneoxa"teIoinn Exchange Rats on the Toxicity of Ammonium Male rats/Crl:CD A range-finding study was conducted prior to the tes to find the tolerated doseof study, rats were Ddoosewdefxrom1-2X020--Cl1.00(0chmogl/eksgt,yra1mriantei)d.oseInletvhealt, and 6 rats dosed at 1000 mg/kg. noted in this study. No clinical signs of toxicity were Aadmmminoinsiteurmedpbeyrfilnutorraogoacsttraincoaitnet,ubaastiaosnutsopeynosuinogn aidnucltommaoliel,rwatass. _ Four groups, 6 rats/group, were used dosed with 500 mg/kg of ammonium in the study. Group perfluorcoctanoate, [ was Group II `was dosed with 500 mg/kgofammonium perfluorooctanoate and immediately dosed with 1000 mg/kg of Dowex 1-X2-C1, Group dIosweadswidtohse5d00wimtgh/1k0g0o0fmagm/mkognDiouwmexperf1l-uXor2o-oCc1taannodat2e,hoaunrds later GroupIV was dosed with 500 mg/kg of ammonium perfluorooctanoateand 2 hourslaterdosed with 1000 mg/kg of D14owdeayxrec1o-vXe2r-yC1p.eriAoldl rats and were weighedand the sacrificed. observed over a GLP: No Test Substance: Ammonium perfluorooctanoate, purity approximately 100% Results: RPrees-idnoastin1g00or0 pmogs/tk-gdocshiannggweisththDeotwoxeixcef1f-ecXt2s-oCf1almomnoEnxicuhamnge a EID091568 009725 perfluorooctanoate in rats. All rats dosed with the pDeorwtleuxooc1ta-nXo2a-tCel,haeditrheerdubceefdormeorotralaifttieresthceomapmamroedmitoutmhe rats wdoesreed5/w6i,th0/a6,mm1/o6,mainudm0/p6erffolruGoorcotuapnscaIt,eI,alIoInLe,.anMdorItVa,lity ratios respectively. Reference: wAafsoplelrowf-ourpmesdtutdoyd(etDeurPmoinnteRwehpeotrhteNroc.ho4l0e5s-t8y2ra~midneescwroibuelddabove) enhance from the the elimination body. of absorbed ammonium perfluorooctanoate DuPont Co. No. 828-81. (1981). Unpublished Data, Haskell Laboratory Report Type: Method: GLP: Test Substance: Results: Reference: Respirator Evaluation r`TehsepipruatroproscaertwraisdtgeoseavgaaliunastteaMm.mSo.An.iuCommpbeirnfaltuiooronoTctyapneoaGteMAdu-stHfor breakthrough. The cartridge pairs were tested against an average gcoennceernattreadtiinon2 odfus0t.5g6enmegra/tmo'r,aamnmdoinnitruomdupceerdfliunotrooaonctaainrobaltoew of t6e0mpLe/rmainnurmea.inBtoatihneudpsattr5e0a%m arenldatdiovewnhsutmriediatmyaiarnbdoarnmebient room dcuosntcebnytrfaitltieornpsawpeerrecamsosneittteosrebdacfkoredamupmownitihuamnpiemrpfilnuogreoroscatamnpolaitneg `tAaliinqutootsabosfotrhbepaoqsuseiobluesaemxtmroacntisoufmthpeerffillutoerropoacptearnaonatde avlaipqourost.s of the aqueous ammonium piemrpfilnuogreoroscatamnpolaetse.were analyzed colorimetrically for No AfAtmemro4n0ihuomurpserofflucoornotoicntuaonuosateex,popsuurritey, not no specified detectable amount of daomwmnosntireuammpoenrftlhueorboroecattahzionagtseidduesotfotrhevacpaorrtrwidagsefpoaiurnsdtested. The pmeirnfliumoruomocdteatneocattaeb."leBlaimsietdwoansa1.452p0gLoafirasmammoplnei,utmhis would calculate to be 0.004 mg/m'. The mean upstream airborne 5co4ncheounrtsr,atrieosnpsecwteirveel0y..6T7he0.re3s3ulatnsdde0m.o4n8s+t0r.at1e5dmtgha/tmt'heatM4S0.San.d. pceormfbliunoartoioocntatnyopaeteGdMusAt-aHndcavratproidrgceosnecfefnetcrtaitvieolnysfialttetrhae mtemsot nium cDounPdointitoCnso.fo(r19a8m0)i.niUmnupumbofli4s0hehdoDuartsa., Haskell Laboratory Report No. 664-80. EID091569 00043 Type: Method: GLP: Test Substance: Results: Reference: Type: Glove Permeation Testing lFiinveed;tylpateesx;ofnagtluorvaelsl(anteexo;prneenoep;renneeo-rsuybnbtehre)tiwcelraeteexvarluubabetre,d ffloorctheir ppeerrfmleuaotriooonctraensciasttaenacendtoaamm3o0n%iauqmuepoeursflsuoolruotoicotnanoofaatme mdorynpiouwmder. `Spaemrpmleaetsioonf ctehlelsglwoivtehswwaetreer tuessetdedasinacdoulpllieccattieoninm1e0dimuLmgolnastshe `inmseiddieusmurwfaasceanoafltyhzeegdlofvoresa.mAmo1n0imumLpaelrifqluuootorfootchteancooaltleecbtying dsepteecrtmrionpehodtwohmeetnryaadfetteercatanb8le-haomuoruenxtpoosfuraem.moBnreiaukmthrough was perfluorooctanoate was found in thecollection medium. The `1mpign/immLuimndettheectcioolnlelcitmiiotnfmoerdaimummo.nium perfluorooctanoate was No Ammonium perfluorooctanoate, purity not specified Results of the evaluation show that 3 of the glove samples (neoprene; neo-synthetic later rubber, floc lined; and natural latex) do have a measurable breakthrough time and permeation rate afier 8 hours of continuous expose to a 30% solutionofammonium perfluorooctanoate. However, the permeation rates are very low indicating that the materials do offer some resistance to the test substance. Results of the tests performed with ammonium perfluorooctanoate: powder show that in 4 of the samples (acoprene; neo-synthetic latex rubber, floc lined; latex; and neoprene rubber) no abrnedaoktnhlrayougvherwyassmaolblsearmvoeudnatfpteerrmehaotuerds othfecloantteixnsuaomupsleex.posure, DuPont Co. (1981). Unpublished Data, Haskell Laboratory Report No.612:81. Biopersistence Screening Study Summarized in the PFOS section, see DuPont (2000). Haskell Laboratory Report No. 2022. EIDO91570 - 000435 SUMMARY OF STUDIES CONDUCTED WITH AMMONIUM PERFLUORONONANOATE AT DUPONT Mammalian Toxicity Acute Toxicity Type: - Oral ALD Species/strain: Male rats/ChR-CD Value: 187 mg/kg Method: The test substance, as a solution in water, was administered by intragastric intubation to youag adult male rats (1/group) in single doses. Concentrations tested were 10, 15,2.3,34,5.1,7.7, 12, 17,26, 40, 60, 90, 130, 187, 300, 450, 670, 1000, 1500, and 2250 mg/kg. Survivors were sacrificed 14 days later, and body weights and liver weights were recorded. GLP: No Test Substance: Ammonium perfluorononanoate, purity not specified Results: Morality was observed at concentrations of 187 mg/kg and above. Deaths occurred within 6 days after dosing. Slight initial weight losses occurred at 26 and 40 mg/kg. Weight loss occurred for 9, 12,and 15 days at 60, 90, and 130 mg/kg, respectively. No clinical signs were observed below 26 mg/kg. Clinical signs observed at 26 mg/kg and above included pallor, salivation, polyuria, and chewingmotions. Additional clinical signs observed at 187 mg/kg and above included belly-crawling, half-closed eyes, incoordination, ruffled fur, diarrhea, and emanciation. Increased liver weights and increased liver/body weight ratios occurred at 3.4 mg/kg and above. Reference: DuPont Co. (1968). Unpublished Data, Haskell Laboratory Report No. 129-68. Type: Species/strain: VMaeltuheo:d: Inhalation ALC Male rats/Cri:CD(SD)BR 5Ma9l0emrga/tsm*(6/group), 8 weeks old and weighing between 234 and 298 g, were exposed via nose-only inhalationfora single, 4-hour period to a dust atmosphere of ammonium perfluorononanoate ia aDiur.stCaotnmcoenstprhaetrieosnswetreestgeednweerraete6d2w0i,t9h10ab,i1n60f0e,eadenrd4re6g0ul0atmegd/wmi't.h a volumetric feed controller. The bin feeder metered test substance into a glass transfer tube. Air introduced at the tube swept the test substance through asize reducing cyclone and into the exposure chamber. For the lowest exposure conceatration, the atmosphere was generated by passing pressurizaeird through a glass generator. A flask at the bottomofthe generator served as a dust reservoir. A EIDO91571 % 009%: . ore: Test Substance: Results: sctyicrlroinngereoldutargiiattoartewdadsusitnsienrttehde agebnoevreattohre.reAsierrvionirt.rodAucmeodtaotrtihzeed pbaorttticolmeosftinhtoetrheeseerxvpooisruarnedcahtamthbeerc.yclTohneeaetlmutorsipahteorriscwept dust ticnohtnrecoreuvngathlrsafibtliytoerdnsrs.awwTaihsnegdaectatmleoirsbmrpiahnteeerddicvatoclaoupnpcmerenostoxrifamtacithoeanlmyobf3ep0rarmatitinmcuuotlsaeptheewraes sdaemtpelrimnign.edCfhraommbtehre tfeilmtpeerrwaetiugrhet, drieflfaetrievnethiaulmibdeiftoyr,eaannddcahftaemrber woaxtyegrewnecroentaevnatilwaebrlee measured. ad libitum. Except during Body weights exposure, food and and clinical signs were recorded. Survivors were sacrificed 14 days later. Tlioverm,on2igtroorutphseeofffe1c0trsaptsf, a8mwmeoeknsiuolmdpaenrdflwueoirgohnionnganboeattweeoennt2he3.7 Tanwdo2g7r7oug,psweorfe1e0xrpatoss,e8d were exposed toaironly. wtoee6k7saonldd5a9n0d Each control mwge/img'h,inrges2p3e1ctaivnedly2.67 group was exposed , scaocnrciufrirceeaddSlyorwi1t2h doanyesoafftehreetxepstosgruoruepsf.or pFaitvheolraotgsi/cgeroxuapmiwnearteion of the liver. Yes CAhmammobneirutmemppeerrfaltuuorreosnroananngoeadtbee,tpwuerietny293-92%7C, relative wheumriedi2t1i%e.s ranged from 19-45%, and chamber oxygen contents MOonreaolfitthyerartaitossionft0h/e6,5940/6,mg6//6m,'andide6d1o6nwtehree 1o2b%sedravyedofinextphoes6u2r0e,. i9m1m0,ed1i6a0t0e,lyanpdos4t6-0e0xpmogs/umr'e.inCclliundiecdalresdigonrsborboswernvfeadcidaulrdiinsgcohrarge (67-1600 mg/m'), test substance on the head (620, 1600, and 4600 mg/m'), labored breathing (4600 mg/m'), profuse clear nasal and oral discharges (4600 mg/m'), and diminished startle response ce(l4xi6np0ico0aslmegst/idogmn'6s)7.atmgNh/iogmha'edrvtehcrrosonecuegcnhltoirunaitctatilhoenssirgeincnsocvlweuerdryeedpoehbrusinoecdr.hveeCdd opionmsmrtauotrsne, srtuaffilneeddopredriisnceoulmo,repadllfourr,, lreudngornobirsoewonr flaacbioarleddisbcrheaartgheisn,g,weletthoarrgy, limpness, and hair loss. pRoastts-eexxppoossuerde,tofo6l7lomwge/dmb'ylnosotrm1a-l9%weoifgihntitgiaalinb.odAyt wceoingchenttr1adtaiyons bgroedaytewretihgahnt 617dmagy/pmo's,t-rcaxtspolsoustrea,pparnodxciomnattienluye6d-t1o5l%oosfeiwneiitigahlt either throughout the recovery period or until they died. Most 51 009% EID091s72 s5u4r-v7i1vi%nogfriantistieaxlpboosdeyd twoei5g9h0t, w62h0e,aotrh9e1y0wmegre/ms'acrwiefiigcehded12ondlayys post-exposure or at the endofthe recovery period. References: Rweaitgshetxspaonsdedlitvoe6r-7tmo-gb/omdy"wheaidghsitgrnaitfiiocsanotnlytheele5vataenddm1e2a%ndlaiyvesr after exposure. Rats exposed to 590 mg/m' had significantly eLlievveartweedilgihvtesr-ftoor-tbhoedsyewreaitgshwterraetinoostosnigtnhiefi1ca2ntdlyaydiafffteerreentxpforsoumre, twthheeerseceossnitegrenomilifsincoganlnyttlhiyendc5oenpsrdiesastyseoenfdtreochncaotnvhgeeers1y2,weardneadydmuoeefarnteoclsoivevevereryrw.eeibHgoohdtwysever, weight loss in rats exposed to 590 mg/m'. Gross pathologic elixvaemrsinwaittihonproofmriantsenetxlpoobsueldartopa5t9te0rnmsgi/nm4'/5rervaetaslseadcrdiifsiccoeldoroendthe 5 day of recovery, and similar gross liver lesions in 2/5 rats DsaucProifnitceCdoo.n(1th9e851).2UdnapyubolfirsehceodveDrayt.a, Haskell Laboratory Report No. 293-85. Kinney, L. A. etal. (1989). Food Chem. Toxicol,, 27:465-468. . Repeat Dose Toxicity Type: Species/Strain: Sex/Number: Exposure: Period: Frequency of TExrpeoasuuernet: Levels: Method: GLP: Test Substance: Repeated Dose Oral Toxicity Study ~~ MMailcee/aCnrdl:fCeDmal-e1/(SI/CgRro)uBpR 14days Ad libitum for 14 days. 0M.al1e,3a,n1d0,fe30m,al1e00m,ic3e00(,5-1600w0e,e3k0s0o0l,d)10w,e0r0e0fmegd/dkigets containing Vaemrmifoincaituiomnopfertfhleuocroonncoennatnroataitoenfoofrth14ectoensstescuubtsitvaendcaeyisa. the pwreerpearreedcodrideetsd wtherroeupgehrofuotrtmheed.tesBt.odAyftwereisagchrisfiacned, lcilvienricwaelisgihgtnss wapeprreoprreicaotredesdt.atisBtoicdayl wmeetihgohdtss.anSdaclriivfeircweesiogchctusrrweedreonantaesltyzdeady w6itath ccoonncceennttrraattiioonnss ooff 1100000anpdpm30a0npdpgmr,eataenrd, oonn tteesstt ddaayy 184atfor the Nreomaining test groups. Ammonium perflucrononanoate, purity 99% EIDO91S73 52 069.0% Results: * Reference: Mortality ratios of 0/5, 0/5, 0/5, 3/5, and 1/S were observed for the `male mice fed 100, 300, 1000, 3000, and 10,000 ppm, respectively. Mfoermtaalleitmyicreatifoesdo1f000/,5,3030/,5,140/050,,53/05,00a,ndan3d/51w0,e0r0e0opbpsmer,ved for the respectively. Mice fed concentrations of 100 ppm or less exhibited slight to severe sporadic weight loss. Mice fed concentrations of 3le0t0haprgpym, alnodwhpiogshteurree,xhainbditleidmpsneevsesr.e weight loss, ruffled fur, Male and female mice fed dietsof 3 ppm or higher had significantly increased mean absolute and mean relative liver weights. The mean relative liver weights of male mice fed the 1 ppm diet were also significantly heavier than the controls. Comparisonsofmean body and liver weights of mice fed diets above 30ppm were got possible because there were no concurrent control groups. DuPont Co. (1985). Unpublished Data, Haskell Laboratory Report No. 401-85. EID091574 5 [LETRS Co ) A06n1t0h8o7n20y0J0 P02a:y5t9isPM To PaacuklionB/oCsLsDeWUPAoSN/DGUPDonP@O,uPOosrcta,rRTaGbaartzLa/RAiEc/hDeyU/PCoLnIGDOUUPPGorrtt@DuPort, Dawn O Sivjece ca nota|tcihone,ckwehidcthhemeAaCnGsI:H TLV listing for ammonium perfluorooctanoate, and they do indeed give tt an A3 a"CnoinmfailrsmaetdaAnrielmaatilveClayrhciignhogdeosnew,itbhyUfnouktne(osw)nofRealdmeivnainsctreattoioHnu,maatnssit:e(Ts)h,eoafgheisnttoilosgciacrtcypien(so)g,eonribcny `mCeocnhfairnmisamn(isn)ctrheaatsemdaryisnkootfcbaenrceelrevIanntextpoowsoerdkehrumexapnoss.urAev.aiAlvaabilleabelveideepnicdeemdiooelsongioctsstuudigesgdtoheantsottthe e`axgpeonstuirse.li"kely to cause cancer in humans except under uncommon or unlikely routes or levels of 009% E 3 EIDO76894 7 Gaoanad00R0am0s2e.y40 Pm To: DawnDJacksonCLDUPerIGOUPont LynwoodK reandCLIDUPON@DUPont. Pack =Sibiect Me. Grahamof Dry Rum `BosserVAE/DuPont@OuPont, Robert L Ritchey/CLIDuPont@OuPJoonhtn, S Sieg/EUR/DuPont@0uPont Fuadiy MDiv RameyAEDUPOnon08200002:48PU From: To: BHeDmaavriuddAJRaRAmeslaeyyaAnnEI0DD8uu1PP3oo2rn0e0t@0OJu0Po1a:n5n1tR,PBMRoawgmhaGnPASEiaDsn_I@TAOEDuuPPoon@NOGuPOotu,PAsnioddronersotJs pSiebiect hoopaeiDuPor, Pa Me. GraofhOray Rmun DurstGH STEDURGDUP. M.An Eradiey STEIOUP GOUP oa o FoartadbyaBbaemcakredrJ"R<ehfaybAaEc/kDeUrP@ovnettounpOe6an/.1e3d2s0>0o0n010:84181P3M20--00--12--:58--:08--P--M ---- TSiesjeoctPovpeo.aCnrga'namstpaOns.RBuomMua inn`GREGP.SYKES64070 <SYKESGP = REILL2SJ t eTeusemTalkSed vocoCThEyEretiEilnasGyrsafheoarmn,phsottehcneotuiJdselrmesityxxi.cciocviHeedsa.sl'aeiydeaTnnhefsharoosrmt,ttheehseebienhygasRfiaonrcesdy CGEunEeycaIAcTeVrsaicStbieBalfhdoosrnteehistcm.uonmnaetsaTsc`ah.tveiipni1rgn7esfuhesao.rtsnheeercIdososvftafuCnlelstca.erditofihWcishaseetenBiwoobhnIatsoFraoicpdLepsahCunihlgktaassslseythhe(missenotecaslcltyasnsBoscbor)reeen SToHxIcRhaEmonarnStn,anen,Je poonevTtihoennsmeoeapdhtoCnaoe:rapcelodkrivieworinatsshtiifoaon.u:sChoadinsdugigeescterdoubtlhea:t SSaos,cing Eh 2 coe oFroom: BomardFJRoolrlyaony08HD1a1dR4a20m2s0040APE0UDUPonton 813200002:48PU---------------- To: ZOanmkouRAEamPsoery@OAuEFDarU.oorNn@ROBRUoaPwomohaGnnAEDeriG) pont, aWdooorons Bradiey/STE/DUP@OUP, Paula Durst-Gilli/STE/OUP@OUP, Greg P Sykes/RND/Phama@OPC Sibject: RE: Mr.GraofhDrayRmun g CRForwarde edby Bomar J RYAEIn DuPont on08142000on n03200P0U--5--1----1-------- 22 2 009% 1ae5 ElDogg 1 TSou:bjReEcLtLZARSE: Mr GrahamofDry Run e L Torroouind STaElHlcty"ou tIhiaotntIcce eT'idnkthatthatmatihils Lmielzlsadeakete ofSorereEcnomrpClamiscpaeetriroonfs,thSeutTP EClTenvtelriSConEsautitahtaidonssgrewnicena.thLeongWVtilmoecaalgso hat we vould notify het of S--Fereno-tn-::OrBTiuegetisandaaasyld,M3edsuRsneeaiglel1-y3,--(-2s-0a0i0it1o::5S2ernacd.d.ReillyAUSA. duNpont.con] TiSoEihgeGbchet.k:o'FpRa.acseybiMxeH.EaSb:aGcekaRenaraipnhoGf SDteyanRya3nc sors, hank you for following up. ---semnte gg 2 EIDOg6147 000417 . June 23,2000 DUr..S.ChEanrvliersonMm.enAtuaelr,PrDoitreeccttioorn Agency OfficeofPollution Prevention and Toxics 4C0h1emMicaStlreCeotntNrWol,DRivoiosmio4n03 Washington, D.C. 20460 Dear Dr. Auer: As you requested in your April 19, 2000 letter and during our subsequent meeting on MPearyflu1,or2o0o0c0t,anaotattaech(eAdPiFsOa,sCumAmSa#ry38o2f5-D2u6P-o1n)t'ass aU.fS.luoursoepsoolfyAmemrmroenacitiuomn aid including sreulmeamsaersyfroofminDduusPtorniatl shiytegiaenndetdhaetafactoelolfecAtPedFaOt oiunrfUl.uSo.rofplouloyrmoeproldiysmpeerrsmiaonnufparcodtuucrtisn,ga Stiotxei,caonldogaysauvamimlaabrlyeoftto hDeuPeomnptlwoyaesesebnltooudnddeartasefpraormaatescioteveirn othneMUa.Sy.26A, s20u0m0m.aryof the Its important toemphasizethe following points: > DuPont does not manufacture APFO. All APFO used in our processes asa reaction aid is purchased from an outside supplier. > tMhoesytoarfetshoeldAtPoFoOutsuisdeedciussrteommeorvse.dAfrroelmattihveelfylusomraollpoalmyomuerntproofduAcPtsFObefore (worldwide, in the U.S.) leaves DuPont facilities in fluoropolymer dispersion products. > Ofthe APFO in the products sold, most (>97%) is destroyed during customer processing to a non-carboxylated hydrofluorocarbon. > ApoltleonfttiahleaUr.eSc.onDcuePnotnrattoepdeartatoinoenslotchaattiouns;e WAaPsFhiOngwtitohn sWiogrnikfsicianntWeaxsphoisnugrteon. WV. Therefore, most of the industrial hygiene data and blood serum data presented in this document are from that location. calm EID070482 Dr. Charles M. Auer, Director U.S. Environmental Protection Agency Pagei > Extensive industrial hygiene data collected on workers potentially exposed to APFO show airbomne exposures (0 be significantly below the ACGIH TLV of s0i.g0n1ifmigc/amnt'ly8 shir.ncTeWtAhe.coEnvxeprossiuorne tloevaenlsAofPpFlOanstolwuotrikonerfsrohmav2eddrryoppopwedder > Aspartof the ongoing surveillanceofworkers potentially exposed to APFO, in March and Aprilofthis yeaar seriesofblood samples were taken from workers in the U.S., The Netherlands and Japan to be analyzed for serum APFO concentration. DuPont has not received the results from our contract laboratory at this time. DuPont will submit a summary of the results when they become available. The formatofthe information in the attached is a modified UEIP format.If you wish to discuss the information contained in the attachment, please contact Robert F. Pinchot at (302) 999-4074 or e-mail atRPoibenrctFhot@usa.dupont.coomr me at (302) 366-5259. Very truly yours, Gerald L. Kennedy Director, Applied Toxicology and Health 0007" 56 EIDO070483 Voluntary UEIP, Ammonium Perfluorooctanoste Voluntary Use and Exposure Information Profile Ammonium Perfluorooctanoate (APFO) I CHEMICAL IDENTIFICATION Chemical Name: Ammonium Perfluorooctanoate CAS Number: 3825-26-1 IL COMPANY IDENTIFICATION Company Name: E. I. du Pont de Nemours and Company Site Locations: Site where APFO is usedas a reaction aid: Washington Works Route 892 Washington, WV 26181 Sites where APFO containing products made at Washington Works are processed: Parlin Plant Cheesequake Road Parlin, NJ 08859 Spruance Plant 5401 Jefferson Davis Hwy. Richmond, VA 23234 Site which disposes of waste containing APFO: Chambers Works Ree. 130 Deepwater, NJ 08023 Technical Contact: Robert F. Pinchot (D3u0P2o)n9t9F9l-u4o0r7o4products Chestnut Run Plaza Bldg. 71172210 Centre Boulevard Wilmington, DE 19805-0711 cours EIDO70484 Voluniary UEIP, Ammonium Peruoroocianoate [IL DUPONT AND CUSTOMER ACTIVITIES : Narrative Description of APFO Use pTrhoecebslsoecskddiisacgursasemdobneltohwe.back page titled "DuPont US APFO Balance" describes the DanudPotnettraufsleusorAoPetFhOyleansea (reTaFcEt)iocnoa-ipdoliynmtehres.proTdhuectpiroonceosfspuotliyltiezterdaaftluDourPooentthy'lsene (PTFE) Washington Works for making PTFE and co-polymers consists of polymerizing TFE (and other co-monomersif desired) in an aqueous media with a small amount of APFO to aid in the reaction. Following the polymerization step, the polymer dispersion is either dried to remove water and APFO or concentrated (removing some of the APFO), stabilized and sold as an aqueous dispersion. The dried polymer contains very lite,ifany, APFO. `The APFO removed from the polymer is recovered for recycle, captured and destroyed offsite in an incinerator, captured and sent to an offsite industrial landfill, and/or emitted aif or water at the Washington Works. `The stabilized polymer dispersions are sold by DuPont to industrial customers (both in the US and outside the US) for avariety of uses, intemally transferred to the DuPont Spruance Plant for the productionofTeflon fibers and PTFE coated synthetic fibers, or internally transferred to the DuPont Parlin Plant for the productionofTeflon Finishes. A small amountofnon-hazardous waste polymer, water, APFO and other additives `generated at Washington Works is treated in a wastewater treatment facility at DuPont's Chambers Works. This material is either emitted in the Chambers Works water discharge or captured on carbon and landfilled in a secure landfill The intemal process at the DuPont Spurance Plant to produce Teflon fibers involves, for most of the product, a "sintering" step in which the APFO contained in the product is destroyed by the following reaction:" CF(CF2)COONH," > CFy(CF2)sCFaH + CO; +NH; This reaction goes to completion at 350C and 0.2s residence time. A small amount of product processed at DuPont's Spruance plant does not get sintered and thus contains a small amountofresidual APFO. These products are used for industrial pump, valve and compressor packing materials. b77y.h1igKhrtuesmep,erD.aCt.ureRogea.s-"pThhaesrema"lFdNeMcoRm.posAitnieown oAfCl8ifclumortaintattehidervsmuaerflagctraanvtismneddicraenlaileydsimsa,teDruiPaolsntstudied Internal Report. EIDO70485 000s Voluntary UEP. Ammonium Perfluoroocianoate The process for making Teflon finishes at the DuPont Parlin Plant involves a blending operation of fluoropolymer dispersions with other additives including solvents. binders. and pigments. The small amount of APFO emissions to water from this facility is due to waste generated during product changeover. Someofthe fluoropolymer dispersion is processed at contract facilities where the material is dried at temperatures >350C thus destroying the APFO according to the reaction above. This dried material is then incorporated into finishes products. The final product produced is then sold to applicators that apply the product to a substrate (such as cookware) via automated spraying or rollercoating. Emissions of APFO from these operations consistofoverspray that is either captured on filters and landfilled or absorbed into water resulting in a water emission. Product that is applied to the substrate is then typically "sintered" at temperatures approaching 800 resulting in the removal of the APFO from the substrate and subsequent destruction according to the reaction above. C`muossttoampeprlsicoaftidoinsspeirnsvioolnveprao"dsuicnttseruisneg"thsetempatwehreiarleftohreaAvPaFriOetyios fdesatprpolyiecda.tioTnsh.erHeoawreevaer, small numberofapplications where the customer heats the dispersion products to temperatures thatallowthe APFO to sublime resulting in air emissions. There are also a small numberofapplications where the customer's product is not heated resulting in the APFO staying with the product. These applications include industrial packings, and industrial filter fabrics. IV. SITE RELEASE AND TRANSFER INFORMATION FOR TRI CHEMICALS Not applicable- APFO is not listed on the TR V. SITE RELEASE AND TRANSFER INFORMATION FOR NON-TRI CHEMICALS A. Onsite Ai Releases. Stimated Tol Annual Releases (165.1999) [Fugitiv| e Negigble |0 T 0 7] 0 24000 [oT07] 0 J Comments Air emissions are estimated using engineering calculations andjudgements and limited measurements of specific point sources conducted in the past. 000755 EIDO70486 Voluntary UEIP, Ammonium Perfluorooetanoste B. Onsite Water Releases [ | WashingtoEnstWmoartkesd |T1 oPwarlliAnn|nuaSlpRreulaenacsee|s(IbCsh1a9m9b9e)rs Works | [Pomt Source 1 55000 9500 Comments Water emissions are estimated using engineering calculations and judgements and limited measurements of specific sources conducted in the past. oWtahsehrisnigtetso'nemWiosrskisonesmoicscsiuornfsoroc1c0u-r10f0ordaapyps/ryorx.imRaetleelayse3s50ofdaAyPs/FyOr wthoitlheetOhheio River from the DuPont Washington Probabilistic Dilution Model (PDM Works Plant Beta Version were modeled 4.0 Beta June using the 11, 1999, US EExPcAelOsfpfriecaeodsfhePeotllmuotdieoln. PrAevPeFntOiornelaenasdeTdoaxtiacsf)ora1n9d9a6cwoenrsetruuscetdediMn ibcortohsoft SmIoLdewloiunlgdebxeerecixsceese.'deTdhaeboPuDt M50i%nodfitcahteedttihmaet AduPrFinOg ctohnecyeenatrr.atAiPonFsOof 1.0 ug C- concentrations of in the river would exceed 0.1 ug APFOL 90% of the time during the year and 10 ug APFO/L about 2.2%ofthe time during the year. Average annual APFO concentrations in the Ohio River calculated by using a Microsoft Excel spreadsheet was 0.423 ig APFO/L. Modeled AFPO concentrations in the river ranged from a low of0.199 ug APFO/L in March to a rhiivgehrofflo0w.s9,65rejspgecAtiPvFelOyC.-A8v/eLraingeSeOphtieombReirv,erwhfilcohwscaornrdevsoplonudmetohdaitgahcaanlcdullaotwed from the US Geological Survey was collected the spreadsheet model. The Belleville Dam is at on the the Belleville Dam Ohio River 13 and used miles in dloocwantsiotnredaomwonfsttrheeaWmafsrhoimngtthoenplWaontrkwshePrlaentt.hisThtiysperiovferinffloorwmdaattiaonisisthaevacilloasbeles.t In 1999 a drinking water sample obtained fom GE plastics, Washington WV, immediately downstream on the Ohio River from DuPont Washington Works showed 0.552ug/l APFO. LInubaeddciktiPounblsiacmpSlerevsiocbetDaiisnterdicti,n dJaonwunasrtyr2e0a0m0offrWoamshtihrnegetdoinffWeorernktsweolnlsthaetOthheio River, showed 0.8g/l, 0.44ug/l and 0.313 ug/l. APFO. W R Bert, Modeling releases ofammonium perflurooetanoat ito the Ohio River, DuPont tema! Report EMSE-054.00. Coan EIDO70487 Voluntary UEP, Ammonium Perflaoroocianaate C. On-Site Land Releases * CEnhgaimnbeeerrsinWgocraklcsultarteiatosnsAaPnFdOmecaonstuarienmienngtwsasitndeiciant2e wthaastteawpaptreorxitmraetaetlmyen3t0s%ysotefm. the APFO landfilled oinntshitee.waTshteesweatlearndtrreealteeadseiss absorbed on to a are estimated to carbon media that be 3900lb in 1999. is Prior operations have resulted in measurable APFO concentrations in three lsaunrdffaiclelswoapteerramteedasbuyrethmeenWtasshiinn1g9t9o9naWnodr2k0s00inytWdesrtanVgiergfirnoiam.2.A2t3gLe/tlartto' landfill 3th2e40suagm/elwtiimtehapneriaovderaatgLeetoafrt13l9a2ndvfgi/lll.raGnrgoeunfrdowmat6e0r.3muega/s1utroem1e7n4t0s0gt/aklenwidtuhrianng afvreormag0e.0o4f612g5/3L7tuogl3.9gA/tl twhiet"hlaocnaalvlearnadgfiello"ft8h.e83gurg/olu.ndwSaurtfearcceonwcaetnetrrastaimopnlsesraantge tDhrey"Rloucnallalnadnfdiflilllt"herraengaereflriommit0e.d54muega/slutroem8e7ungt/slowfigtrhoaunndawvaetreargeaonfd 1s8u.rf5agc/el. At Water with maximum concentrations in groundwater of 15ug/l and the maximum concentration in the permitted outfall has been 33g In 1999 a RCRA Facility Investigation was completed for Washington Works and w`garsousnudbwmaittetredcotnoceEnPtrAatRieognisoonfIAIIPiFnOJuanteWa19s9h9i".ngtTohne Wroerpkosr.t contains data on D. Transfers to Off-site Locations Washington Works: EE [WasntdeewragrtoeurnwdeIantjemcetniotn Hazardous Waste Landfill Other landAll mated Total Annual Releases or Transfers (1b. 1999! | 16000 1 | 13400 1i 2600 0 ] IV. ON-SITE WORKPLACE EXPOSURE A. Informatioonn the Number of Employees Potentially Exposed 7+ MReapposrotfwathsestuabndmfiitleldoctaotMiaorntsiann.dT.spKeoctifsicch,moRneimteodriianlg lPorcoagtrioanmsMaanndargeesru,ltsEaPeA aRveagiiloabnlellu,pPohnilraedqeuiespthi. # This i the same material that was described above in paragraph | ofsection V.D. 000455 EIDO070488 Voluntary UEP, Ammonium Pefuarosianons The tables below describe the number of workers that may be exposed to APEO during their normal work activities for eachof the three sites where APFO is used or APFO containing product is processed. Washingion Works or Imw Hours/Day 1 Too DaTys1/yr030 [5-- 30 vas mT] 22 -- -- BT1] Routine worker activities that have potential for exposure: > > Handling Handling raw raw material APFO dispersions containing APFO > Maintenance of polymerization reaction systems > > PPaoclkyomuetrodfrPyeTrFoEpearnadticoon-apnodlymmaeirntdeinspaenrcseion products > Operation and maintenanceof APFO recovery systems Coan EID070489 Voluntary UEP. Ammonium Perfluoroocunoite Hours/Day J1 ess <10 0385-1 1 >8 I Parlin Plant . Days/ye 1710-100 100-250 1>250 {] 1 [7 Routine worker activities that have potential for exposure: > > OHpaenrdaltiinognofanPdTmFaEinatnednaCnoc-epoofblylmeenrdidnisgpefracsiilointiepsroducts > Packoutoffinished product NwohteerethtahteaAtPnoFOticmoeuilsdtsheubmlaitmeer.iaTlhhearnedfloerde tathetrheeiPsarliltilnePploatnetntaitalanfoerleevxaptoesdurteemtpoerature ahiarnbdolrinnegoAfPFthOe patolthyimsefracdiilistpye.rsAiloln emxatpeorsiuarlespaoltleonftiwahliicshthcroonutagihns<ki1n%coAnPtaFcOt dwuirtihngmost containing <0.25% APFO. Spruance Plant, Hours/Day Daysiyr 10-100 [100T5-252 0 50| pr ms --T | 1 rr 1 0 | [ET 1 eT rr 7] Routine worker activities that have potential for exposure: > Handlingof PTFE and Co-polymer dispersion products > Operation and maintenance of fiber coating facilities > Operation and maintenance of sintering rolls > Packagingofnon-sintered product. Note that the PTFE and co-polymer dispersion products used at the Spruance site contain <0.9% APFO with most containing approximately 0.3% APFO. B. Information on the Exposure Levels of Washington Works Employees Since mostofthe processing done in the US with APFO and APFO containing ihnytgeiremneedidaatteasias ncdonpcreondturcattsedisadtotnhaetastitWe.asThhiengltiomnitWedormkesa,suDruePmoenntt'ssoafiafibrobmoerniendAusPtrFiOal cmounccehntlroawteironlsevaetlsth(emoostthleyr sniotne-sdwehteecrteabAlPe)FlOevceolnstoafinAiPngFOp.rodTuhcetsdaartea uinsetdhehatavbeleshboelwonw oY EY EID070490 Voluntary UEIP, Ammonium Pecfluoroecianosie arrefeleactcommobniintaotriionng odfonceheomviecralthoepelarsattoryaenardsmaatiWnatsenhainncgetownorWkoerrksp.ersTohnealssaammpplleesr.esults Year | Sample | 7ol Minimam Maximum | Mean| Sundar | Type | Samples Concentration | Concentration | (mpb)| Deviation | (mpb') (mpb) | 1999 | Partial 100 0ST | (Shmioftst[ y [ 85 T | 000 1 [|20 0s78 0 TTo0m0a3s5]]7 0031745|| 199] 6-8 0069 | 1995 |hows) [7327 | ND | 016 J0067] 0.063 tPhaarttihalasshbieftenaiprrseatrmepalteesd awriethtaskoedniautmthheydrraotexiodfe'2e0t0hymlLe/nmeignlyucsoilnigmeathTaennaalx. cTohlleecAtPioFnOtuibse ddeersiovrabteidzifnrgormeatgheentt,ubceosnvuesritnignmgetthheaAnoPlFicOhtyodirtos gmeenthcyhlloersitdeer,. wAhfitcehr awlosroksuepr,vetsheasmeathyl eTshteemiestqhuyalnteisftieerodfuspienrgflauograosdcehcraonmoaitcoagcriadpihs euqsueidpapsedanwiitnhtearnnalelsetcatnrdoanrdc,apatnudreatdelteeascttor tPhrreeceisciaolnibirsaetsitonimsaatmepdlteosbaere+/p-re1p0ar%edreltaoticvoev.er the concentration rangeofinterest. "oTnhleydaatvaearbyofveew sshaompwlaevsearbagoevse ctohnesiTsLtVe.ntlyWhbeerleowretshueltAsGaCreHaIboTvLeVoorfne0a.r01tomgth/em'TLwVi,ththe eenvgeinntieeriinnvgecsotnitgraotlesd)atnodrecdourrceecttihveeeaxcptoiosnur(eadldeivteilosnails upnedresrotnaaklepnr.otOelctdievredeaqtuaifprmoemntthoer f1r9o8m 0rescehiovwinhgitghheerAlPeFveOlsaosfaexppoowsduerre.toIrnetcheeivcianrglyit 129s9a0'nsaWqausehoiusngstooluntiWoonr. kTshsiwsicthcahnegde swhaosulddonbee tnoorteeddutcheatthine tphoete1nt9i9a7l tfiormeexppeorisoudr,etdhuersiintge hwaansdlsitanrgtoifngthuep ndreywpAowPdFerO.reIctovery ffaacciilliittiieess.mOapyerhaatviengcoanntdrimbauitendtetnoatnhceehdiigfhfeicrullteiveeslsasosfoAciPaFteOd winitthhethpeersstoanrat-lupsoafmpthleesse: during that year. Tnoatskinsdpieccaitfiivce moofneimtporlionygedeatexapaonsdurweiapendmaorneitnoortipnrgedsaetnateedxihsetr.e.HoTwheevseersathmepsleesdaatraeatraeken 10 identify areas where additional exposure controls may be necessary. Engineering controls to reduce exposure consist ofthe following: > Reaction systems are closed systems with continuous ambient monitoring for monomer concentrations > > VTehnetiploaltiyomnersydsrtyeemrss oapreeriantsetaulnldederwhneegraetaiivfebporrensescuornetceontcroanttiaoinnsAaPreFsOigannifdicant > oRtehceorvmeartyersiyaslst.ems are in place to reduce airborne emissions. Tempe molespe illon, 056mpb is equivalent tothe ACGIH TLV of 001mg' OBES EID070491 Voluntary UEIP. Ammonium Perfluorooctanoste Personal protective equipment that workers regularly wear consist of the following: >> SIamfpeetryvisohuosesglaonvdessiwdeh-esnhihealdndslaifnegtyAgPlaFsOsessoilnutaillonasreoars.aqueous dispersion > pCrhoedmuictcsa.l protective coveralls and goggles or face shields when the possibility > oAfirslpilnaesrheesspoifratAoPrsFoOr containing solutions carridge respirators is present. where monitoring has shown to have high exposure potential. APrtioWrasmheiansgutreomneWnotrskosf,bbllooooddfsleuroruimdelelveevleslsofhaAvPeFbOeehnatvaekbeenepnrimoeratsou1r9e8d1sibnuctear1e98o1f. limited value in assessing exposure to APFO. identified APFO exposure potential the 1995, A summary of resultsof employees 1989-90, 1985,and 1984 volunteer with dsuarmipnlgintghiesvpeenrtisodios finttihmee,taabnlaelybseilsoowf. tDreunedstoofsidgantiafaircaentdijfofbicaulsts.igTnhmeendtatmaoivnetmheenttable: cboemlpoawrpirsioonrsotof1r9e9la5tairvee floevreelmspolfoAyePeFsOinicnlbuldoeoddinsetrheum19c9a5n sbaemcpolmipnagrdeadt.a sTohetheanttire data. set of blood concentrations is available upon request. Year Minimum Concentration|_ Maximum Mean [oes 7 ol [oss 23 [oa [ross| or | eee (ose| 0[oor (ppm) as Rs eT Ta (ppm) LST | An aa 58 | 7* TThhiissiinnddiivviidduuaallcwoanssiswtoernktilynghaisn hajdobthtehhaighhaesstA: PblFoOodecxopnocseunrteraptoitoenntoifaAlPatFtOhe tsiincmeofAtPFeOsasmpepclief.ic semapmlpolyeese'wserleotaakdens.erTuhmisleevmepllwoyaese l44epman. APFO exposure potential assignment n 1991. In 1995 tis 06075 EIDO70492 | 8/15/00 LPSD Water Sample Analytical Rests (Letter, R. L. Ritchey to Mr. James C. Cox, LPSD dated 10/4/00) BCC: A.V. Malinowski, Legal, D7078 M. A. Bradley, Spilman, Thomas, &Battle P. J. Bossert /H. D. Ramsey/D. D. Jackson 1.1. Zanikos/A. S. Hartten RF. Pinchot R. Banerjee/R. J. Zipfel dow /2:817.2 ECEIVE oct 13 200 Caan EID090036 sv See wn October 4, 2000 Mr. Jamas C. Cox PL.u0b.ecBkoxPu7b0li0c Service District `Washington, WV 26181 RE: LPSD Water Sample Analytical Results Dear Mr. Cox: Attached are copies of the analytical results for water samples taken oon August 15, 2000 from three LPSD wells and the LPSD Building 1 main water line. If you have any questions or need additional information, please contact me at 304-863-4271 Sincerely, R. L. Ritchey Sr. Environmental Control Consultant Washington Works RLR/gw:dsw Attachments cc: William J. Gibbs Lubeck Public Service District P.O. Box 700 `Washington, WV 26181 EID090037 ' cooven E E R E TA E RS R E EeAEB e Sa aRaE s Sr Rs ESSNaL Ree e a r L r a y Rae oP Where quality is a science. Lancaster Laboratories Sample Ho. WH 3439739 Collected:08/15/2000 13:40 by a DsRiueibpmeoiarcrtedee:dd::100/904/831//110/600/0200a0x 0055::1208 2 WpWlKa-sGm-LPWD-WELAL Unspiked Wacer Sample Faget Account. umber: 07032 rSRoi6um-ti5ee.sy7.H4biu1iraonFti4a8scee, Neimeo.urs25& Co Wilmington D2 E 1980 I --. J a . ft Arla e M--i--te me -- rn FTeoorrtrReemeuptt0ysrveceosmcatoeicaenebisrerceetuepesreirdge"itcheso6L6eieLsinitehseefoorrkshesev5e5p.vinHSt,e tasek mmieecovecy The 110-07 sad 2150n mevogmee secovesies are ocaide She GC Liniea. a Laboratory Chronicole n agen She cans MND sess Aiversie waser | Sfoismokos SO 10/m pl cv A + caress een tu-- 1 } wauaza ELEN cooen EID090038 a Ey a &b Wherequaliistayscience. Ee T es SPL eee o ara e A RI anes ea 2a an rari TORRE raoe rvseScsHE ETTTee eEesemsSmoeso meeetveEFrooe 2natmaete io Tee 02 oetee atobe 2n0itni1a n,steav8r t,etar erieneie. E poir sat soon sseopen secveen axe nei sae at inten. aLo Laboratory ind rChergoonii clte o seri vsssoeion ia. naan ateistooes - EID090039 aoa B R eE as a re A Er emL eS ST a Le T & Where qualiistayscience. Lancaster Laboratories Sample No. WW Collected:08/15/2000 13:15 by am SRuebpmoirttteedd:: 090/81/21/60/0200a0z 0093::1206 DViHsEc-aGrd-:LPW1D0-/E1L3L/_03F Water Sample LUBBCK WELLS 3050 weLLE 3439741 Page Loi Account Number: 07032 CBaRrGl-e5y..MDiulplonPclazdae, Nesmlaogu.rs27& Co WRiolutaeisagt1o4n1.4DE4815805 Vo. Aasiyeis vase one sera 8 wmber ramar sessaen oom a DoeLotiemcstion TThoee The T1s4Ca5-m1p4el3ecoravesacroyvTeerf-yoxrcirstahceotuetsdseicodpnaedsetehxeBiorGlaCdcitnLigiomnittismveasfGoworittchhoienfniLrcASsc,eoprKtiii,gnicmaesatdLiKrseDis.eviscs Scoipnotrisaasdemits vere chisined for both excracts. Origiaal remits vers The LH-PFUA and pron surrogate secoveries ase cucside the QC linits cates passer wi aSWoria waseailysts vasa Laboratory waned TCeharleoniccatoleseisrnadtstime asaya shuase RES by cena 1 auiiriees sion Rik smcbex G35 pesticide Aitemmace acer oPEmAY 10/33 1 oaau/000 08:00 oeboran w. Timerman wruess dsaema aSrImTaEs : EID090040 : caou es Se ne <b Where qualiitsya science. LO FFreri iar SE SEaE ssot asi semis es saan 2o art ve ae l Se e stein Sig P edLnOUR,ioyxAr... JON...) fo 1 40 11 mr hid th A hs oai2 rea Laboratory Chronicle Fe-103byoc/ED 08/31/2000 20134 Rick Shcber T [EID090041 009. EY, - I Environment cuemicaLs : of I)Ve~oe t eamndteteherrrsstshtoafoutsheSaitnsegtarfl.s WdSehcaestimewveaiosnres| i y <a MOTICE: | a"uThtiey fttoosneGe"0cistion hoighlitghrtsautthehptsoemd i i TEE: SATERIAL MAY| concernwithinthechemical industr3y BE PROTECTED BY |Posen smvironmencat money: Toil ig i|i COPYRIGHT (TLE 17US. LCAODWED|3g3e5e%er1Ve2r2iyn, h esrfabacrhicveopfnSvnemaadsnerieofntdfoLeo ,oansttoy teienmtmroe. Some Nave sevady been anos iH| |------ ------: ----------f--orem--ost.--am--ong--th--em--its--sbi--quit--ous|| roSinunprrSorhnaaendlyaymam3g0e,,eS+me an J: i Why it decided t0 pu thepl lugl on ||mS57eo0srldesopBiolt ocamhwecumoifcesmalsmmoSeoeutsnotthnhteset|| sbevcstshiengr.eThmeies I oma sis out of atl orporate eve 4 |i |itsbestselling | momnaiof ter almeegernv. Co iil |i | stain repellant h set,rDce.hLraryry R.1Z4obCeol. aBnpd. || Slien"eTchsHe onroenwob,styctBatuehheseeobdchle2oefartgnpuhasoehnvdatssayrhbsnrtieoscccibkaspnerislee: A |iHl | Ga irkee.wiTianvgeisv inggpiiosowbe nasdctrsior msbeemC5o,ammcaslh.|||dccaoodbsrss,hoasvap,vs rvheeorisydtontetoo iohgsmhtshsoien: . Ne 3 kH| | L`oonriuqgeuehst,oroswcceanrtohheibnmlgoodspoomfoeoa3ds4esrpruafmaicshtt1oerayy||| tmshoheve.all,o2saas oefdxpSocromWttch3hiFgaarsmdti.yn`E:evbe:.n gl " y:, H{{|| oiensogteaabbluniapshhaftybhsaesseehnssaalimitenii.evsladfo3der vhtsrheheskmauammcsehaitnTdehmsae:.y|||| "ombnaaancdrniigges5tSssowmaaripennmsgeoawvradtl'ies sprayit Ppoocphuoldaarictlyy | : " J] |aes he oun, svenin lacs or|serve rentari oriene. WE (Ga : Dearly 40 years were showing up in|notewarthy,given t3hMwa asut n- 4 blood drawn from people living all| der no mandate to act. "IM de- i: : 3k A il] | fftrraoetm ai3tlMwafacthoereimersi.et"sIrtetecosorkmZoacnbvteihlnsTebasefd-||| tashoicsbiopnaroAbnlnemsysanAdEdcovmoiniug rfnorwCaPsarrdt. Fe YE eRH| i [| medoeiFcot arldireco tthoe1r."aTten heyehr1e9i9wt7g atesuspd,tirsbr. eaeliaenfl"|||cMi.ioB ss ir thLo iEWavdsew hniEne-gnn vCirreaoe nnmecr nntatol. snac-l eT 1) that virtually all Americans--and folks| Resources Defense Counc, gives plan- " siormbeemyonidthneUau.mSou--snataocfybaIueMcal crhyeie mnig- || sdaiysst,oetvheencifthoey mdi"dpTitttoaauctkngouftsfy,e"ar.hoef FERS<i (GP | |(etQrhleesrecailwnlheedcthhpeierrstiyotcreoooumcd.tHapaooewesr5ulofhaoneaothte|||cgoomvemseerncntmSeniotnagctm,iwohng.eopn"oTashaoseoffiutthis ,otohna.t| EERTNmNe N Lali ! | | rGSiusektaoindn,smSotrheti3mporteaxnetc,uTtwohoeayt HE ROBLAN=u T>hOANAEL he she EID089501 - | lt driven to ask. Although WITH SCOTCHGARD CaisPersist intheenvi- a || | o eBndEiveStr rhEeameTams enhe?STi,frm epceolnstwam einrgPaOr nSEdaln esos compraeanryesd can urn nko &send DatndSoPFOsSsahows uhpeirne G1 Spy RepLet l &a LSD:U || i1t6,o3aMdradsetciicdeddetco sphOiasnoeMnaou.yt folutosriinnteo,mPaOmSm,awthiegmnit CS201F 31 005E 63A,LPC vFeOrSyT hhiagsh 33]| r77i0sedandcphreomduicnt,s cfonrtainaingg 9l0e + bkoilmlerdamtosnikneoysb atnedssn.ew Tents Agn a A EID089s0; -" ot E oiin pm ereToenrragitsThnrscocehninrfloeiysitsei2erte...||||| rFpSa hrleieysssssthpnioneltShteyeLpwfioafnrrtogeiWnsearkmgecst nhnds,||||| B5fwhesna, BpaxannnmisDfproeoackdsuspeeer?rrosfohSema iiidtcSsrezedne 2=t fonankinonrsme to| e oe eee n pBpm|| h22eneettdmteeisan]gheehmey ipegwtorn >= pEL mSly of hmeosst oaan 19T8HEA rPesAeaTrcHherTaOt tAh PUnAivIerNsiFtyUoLf RCocHheOstIeCr E S=aterviodeovytoofnis a decided nott2 wait until all the finds organic fluorine in human blood samples from chanced on them. The siafer - pB RLa Emco SaYe inStoo plTace. L athe7greneAecrRaadlaepmotipcuT alrateimoanar.hgPeumbrliarsehne3seftineodiaangnrinroNantdurr,e. EC-rowilnlea e,toJiThy ELi NuEotwisSt: r T roede oamr Siao0t iehoeBewAgtRe eOalhrOe [f1aatc7oto9ory3wr4orkrleervsieewxsp3sop0soeydnettaarsoorfgadneiactfhlrueocroinredosanmtohengab|+ ,PoOLWAmEepToawienrsee.employe mn oSinelrAliamfb,ammaT,t MlhinenesoGotaom, levesen EAsRaLnY w19e3s08,in3gMbouastesRen,ehayncesdomansss cspoecrnameety HtLheoern19e8t0nso, threwceomuppanBylheamd lit T ichlieflyfhpoaeSpYree r5emaSadnUdkStaeebrxtse RfragOSIE The fe bg tingonauidglro naestewaa oahrtcn mhheemerm slteavenlToUnfi0vye.ee 5rpsairwvton sfopMtemirenmnienlsmlaoietoan.tpynpst |t(ibS 0pcJaa.oentSmnedciUimanAsngtJhthheeatlesaeh er0slolsykl1ep9o9so0fest--laeeainnedyd )!|]3 SCE To oTrwiyerSBserB Tnte EiBne S1a9y8n6er Universith y oaf W"cine ynssta reesrearche1rsSpHbieeWE n. ra Seom the effects of water fuorida- | rBoemei S fa naa ahosemsmeeBa = henhefoundtiny.Juan 333M0 repeprtraktc-girns fol od chain st poet oS from PFOS exposures. 1997 Researchers at Michigan State University and detection techniques changed ineSFeeivnnensooftvnth Sreyting,oenew Jo way, 1998 SM advises PA that found organic JERSE human LRA3] ||| E p there anm d whae t its presence Sflucreine inR blood-banT k samplese in tinyt amountsn . SZobeel ddry.ai"ItVts elike2s50 sec- ) = | Fnofuootsorei.nreTSsh,enenktinfioionwlndniinSgahsaadPnsroesywT3,atrsto4eiol,kl ~S3SaEn0riPm%TTalEE-WOMVtIeBBsEEtRRf,,n ind11i99ng99s98.cCSTrohWemnproeafsfndesyaiprrtciwehnlegilrsosnfEnPrdaAdtasorfv.h0edaisvsiitlvuyrrbsieng Hy`woyoorpkkGing7bfeouCrn3)E , foEundpRtahevpeross. SeUnievResCithyA aofyFlToriideas, ocoorns. oot, hough ned a om tFhrheEeaBlBtRehUaAelfReCfYec,ts2fo0r0o0m oRnne-stehaerd-cjhoebrseixspolsrutTrSaeMtotPnTFaOcpS.roRs CF 2In8cPheE os anESE stT seernsiangtibotoeanrld Shen FELT anyRepsoetaenrtcihaelrsfacattor3yMs,ourwchei.ch wIMjoAacRyiCnH6,g220t00e000e3sMr3sovand hEcPeoApdsissecuomssselmatteosnthmofsinndi+ng.% Kiae War 20 v2ed eBrr aiEdo,resatnorWedarblvoeotdersaanmsp.leTshe refr-om PR | BLered en paying particular attention. pany willvoluntarily ee phaseoutthe ic fluorines. TTTri Se Shed except in the veterans , T B| r2EoCmoinitgtdenargaelCeGoermmf osavreine(wMoiu rwangknre)eer,rBseDgmr eeicatahurlks g(sAtlnnha)e,||||| 7SmrpoaspBeunslbalmhtyifeeov nrsasliEoke oteab hoias,cr"rhbeagsoanyr nstAeZnoFbrgeEls.|||| SSoae3aMmnefereseglunrloiarlyor ywuphdeanter0 d2tehreeetEnPyA onwaill GreiFneonSneRppeovfpaicohhnraottenhedmy ipecmedieotn..s ||| nd3h0eYrpornhtwea t sep n tonndoa ||| na Baefcoo piWnoreSoheecoWlayhwinin 000". BUSINESS WEEK 1 LUNE5. 2000 37 & EID089S03 | CO J 3M deservjes grea. t credi.t for i. dentiifny.ing thi.s problem and comiing forwaard rd vvoluntarairliyl,v"." saysavs the EPA'0s Browner tShoelecsoncaenndtriantilons e1 guaysspthinNoaukr| flievseosfswihlbieseueroillhacndnIn t1h2 || isnkpwhia hhaenvswrdseverShey be unhradrleRwcepusosrueer5cyPetrsoasoDce1hf3aenbassoveetmrCosaunchcaoilvno'asgtGre4enrtd.n||||WSS(hroioeilenzoeeembrts,e,oaGwfioreensttsyolffnoorutnnedestvuhpeimicslhemSipocaoaseleesain| | || tSUwhaeeypesraositse'pSomafferstprEtienegolbwyeetrenmdymin8griwittohnnitn ieedsesspdoecedned1d eS0Hy.:mwdouCsolmdmpoaesnvyeaspncaslelye||| PePnaoecRdi eaOcpeeaaniHundeCrcneh.cgmBvaeBlsieoroegipootnnes||| srndegSdSasohrrEtoB ofehe n eysc oonoy SBBuleoernmidenenost.ssu."cWheftoboegiaSnhleteo arcersoiscbeBenstdhoermnee,||| G8a0wi0a8ay t2astnuheoewsAalrmpealeesyanddrhaoAwunmgfahorstan5 ounr||| sSoewTnloieoorsrAhloofua esnheF,sTPCrohsaskseetKgteesn,chtyhe'e fHShrerrtioastgthiassvweonluddeeoyxn irTrmeiacaladtmaesrhatoceksbdvaeteeinansodf Sly be toed ih 5% PE. neh na evens SSCroiniEmreenestaBleSecedevhehebe3gasatcterhv,da"emwisovseiaheyews = 3[3A? Bjon}Z: nmRrentes.o.i.arreor:ll-utiops-nyaWolaurrtslyieenvgesn" SEerin ei. E -3 S sfhaomantrav JNoiOpmoSEehxUe,RocEutTiClHvoIoeNsdnG".sacStgtyuailnyld,c3v"o)uie'ltrsd \ 3 SN oTovilergrytnoinmSe.ahs"ieree3d dcotexepocrluiltaihveeegs neaentlieEtpkaecveewmroenvotensdpeB?arrTshha3et FlErobnumctsg, bnetyatdnpadosspneieyd TEineeKd aharcdsehiouaatshee rae, whe woes he 9 TrioonmedgaoTvnhtiyrnialsh"eepoietase hr tw vie ey rF$3eikaeprotrhoenrstiupsplsSiehshuclom8a. Rrc Ao ND CoN: 22deta1s0hwdd n0oaaddevmerhheaalltlh.WftE cloneineg Susoue wsenesmeeienng of giRnegealSriadepRotIiaLnrteetdh2e8todnwaoatrahdnweo50 ahdhuemsaatnnh|||mtheeWhoeecnmrGsie1leyvSesHaaortih.enpcroesmepnFatnieyngbrh,cs|||SddoeeacleddhssnsoosteotbheKasr5o0soSof ei8onhaoy6n CCGeivceceipgrpemyseisndteWnitllfaor esCeoamrec,hSo2inrd|| spEeurstOyisrBperwLeaissvseDunmmDofeonkreidCmoHbnEe kEsevie:s.||| waptds,eTtEhoe.osoilm 6dseoyciSn.gthmiFnooerhbtevhe steBpuptrhohadeuncst3p1ds utOpordkfeisreddcoouupcploesotfiocceruhciokanl|||EmmpoSotriaScntis2shSeercGuPr erocesn"ae Tnn wesitosc||| 4Fokepshdobit tSeslcyooSnotcanaSdeapnt 10 b ihAanskdimheercaoevmysm,idsonseidosnoeodpfr#m7oS0r5heamTieegshattrocdehos,||| enTtHio sstiheaStfuiuirsd.sfuvnnygisoipnmlaano+mHSsoreonsa,.l fhroer|||inW kesl.bnrfoobseprrL ondodfuPcr,roobedsaa"bnyBVoEesrEe f3SoidrekWiihniegegaavhenrei3emS3st0as0Lt0oe0as0Urenfesi.tJvueasTrnhseiehtyvrepsous'risoeeo:ef||||SssiasehyaeTsrmcKHihaatlaSshnlerocstiomuninA5veeieemsSeRdsnnadfogtdaoossrfwtiimnanangb.csiiotenhns|||| oWorgonhtohs3eucver$s1rpBonafiay,rtkppheeioloccnoigssmerpcGasantySdfSJoooEr nPrh"ohveeewicidoiteftoetrstt,shehcaooumngfhieerprtmhienirayl,|| maoeesn.tralihaeocphcnaapalagcs.:or1"csWeebrceaslnoowonstihwre||| oHpeeel,noswinacvBraknoetpeweainheeoAebndoeirv fSteaacre onfvtehersMcLyexTeecsutairvcehs:ereJtoampaP||co Thee myos daumpimng egvince apie | EosS. eSpaeriaomn sectmaweobranasotnstwvros | |: SGeiesTyoo,xtih3ceozloooglhyoogtiCssetntNaenard,inafaofuaFncodulotd#yS10mu8eemyn.||| TP(POisbanegaentitcefh smeowesrid n gSeepitos efnmmbooegefrs.sciwe19od%.e|||aorreenaeodtyypBeoteoagvertFaoorrsyoektatrseto come, 3M E|[; if ssoommeevveerryy Soidddppaiaccees..SSccaarninningg esaamm-|| addmmiinniisetrereedd 0to arcatee----1100,000000 ttoo i100000000|| BByyJJooespeph WebbeerriinnSStt..PPdaul,, Mivnnn.. |{2 ae nieces wer 1 ne & ann 009, iy | a] _-- EFFECTIRVEEVIPDSAITAOEN.3GNowoFi:E1se32 EeEXmPARATTOIONNADTATEE:asavriur TEFLON NON-SALABLE PROCESS WASTE DISPOSAL. "GROUND izamefdorisTpoEsPaLlOaN: th'esDupProocnetsLsevaarstteL(aenxdcsliuldiwnigllRcCeaRsAe ehfafzeactridvoeuTsawnausatr)y.1,T1h9e9p.roTcheisss awnadssiilithaadTbEeFenLtOeNdisipyosal #0."i7s clgosingt,oLaelttearrutatceandigsepnoesraalllsiytbesewcillalshsiafvieedtaosbCe-u8secdonftoarmTinEaFteLdOwNast'eparnodcensosa-wCas-t8e.wasAtpeo.rtSiionnceotfhTeELFetLaOrsNL'asnds process waste is currently soda scrap, however,notall ofthe process waste is salable. FwaosrtteheaTnEdFiLiOnENmellDei,viAsliaonbaamtaW.asIhtiinsgatonn Wtoriksct,haithtetphCe-a8matcjooenrittadymionfatTeEdFprLoOceNss 'vasCt.e8acolntbaemisneanttetdowabsatezatdhaatuiss s$e1n4t5topteor Edmreulml.evillbeshippedia $5-gallon testdrums. Theestimatedcost 0sendprocesswastetoEmele is PLarnodcfeislslwiassntoet tpheartmidtotcesdfnoortdciosnptoasianlCo-f8wawisltlebienssetnetltoorDpulPaosntti'csdrDurmysR;utnheLraenfdoSri,lpfroocedsisspwoassatl.e sThaetD0iDyrRyuRaua will have to be shipped in bee containers. Tt is estimated tht th disposal cost at Dry Rua ll be $15-525 per drum. `WTAHSISTEP.ROCConEsDulUtRthEe TDEOFELSONNOTWCasHtAeNDiGsEposTaHl EMaDnuIaSlP(O4S30A)fLoPrdRiOspCoEsaSlSofFROCRRRAChRazAarHdAouZsAwaRsDteO,US 20CEDURE "sTohledparsosccersasp.wasAtreeahsassbheoeulndtacbounltaitneude tionstehle asctraacphewdhetrabelepso.ssiSbolem.eoHfotwheevemra,tiefrtiahleisctrhaeptcabalnensamibgehstalcudr,reintslhyoubled be psurpoeprevrilsyodriospnodsuetdy.. IfIfhaedrdeitaorneaqluaessstiisotnasnacse tsoshtiollwnaeepdaerdt,iccuolnatrawcatsotuersehnovuilrdonbmeednitsaplosceodo,rdcionanttoarc. th(eToadraya,sthhiits is BKeEitShECNofTfmTanO,DX4R3Y70R).UNITLIASNEDFXITLRLE.MELY IMPORTANT THAT NO C-8 CONTAMINATED WASTE `Packosing of C-8 Contaminated Process Waste - Emelle Landi 1. WofasBt-e16w4il(lsbeee aptaacckahgeeddBi-n164reWde5s5t-gPaaldlodniastgerealm)d.rumC.onDtracutmsPowliyllSbheacavkaeillfaobrldeiaftatdhdeitTioEnFalLdOrNums aPrasdnnooccdhdw.est EBXLCAECPKTSITNETEHLEDCRAUSMESOFFONROWAASVATIELDAIBSLPEOSSAULP.PLY, TEFLON WILL NO LONGER USE. Tassie ou Pats nt ems E1D031901 CONTROLLED DOCUMENT IF RED vi . - : ' Cui ATTACH MENT 122 is Den 6Ts3ca01C0A0I.00!0 No Sani tized Version was provided. | 0005773 | = e Federal Register Vol. 65. No. 202 Wedney sday.T Octobb er 18. 2000 Prpopoorseesd Ruullees 5S2231 ART S--LABELING woAhSanEUASC OT I 25 m48o0o0.n3s0 Uns ening or mera 'a| 4T0h1eoasutihmoruietysciartiaodnaorlCowFs.R ro2v.inSgecttihoen8a0bl1lee4a3e0psuraagmapenndoedhbiy o g(0)+n - Ranges of absorbency n grams Corresponding tem of absorbency -- a i5w0ans%na uncer fpELignrrtEaebosmodrbbaernrscyyrd - pirnaicy} oSm y 31810Tres3s05aSresGa pTi2)nersabmarapFaans12 3305 1c0snaLnescs nSa)n r15s3arow0er aHans1573 4rpe0gearndPraang5185Toagnmd pceands7p3 aria T4o"n EERE Come PE StSe Ctdentit esaiutoeresspSarPto3pveiilssieeocnRaaoaeudltnTrteeldAseegswieghnaotison AEGNEVINRCOYNMENTAL PROTECTION A f(oF Doc0C0-C2o62m4a9Pneed o10-Fo1r7-00.84s5 a47] tm AoDnAam BlifStoora OttShhiesBaopapcmtriolovnaleAidaseedttavifaloerndth in OPPTS--S0830; FAL-6T45-5 . gNoVImRgONmMeENmTcALenPioTeTon SLAthdaevebdriSsareecsctocfEmiomnnatelenmrtpullsea.tredeIf rnToecroeRvleevdaSnita. in ratiotno S PPoNrt2l5u1o0ry5oa4c0t8y8I l Sullontes:q Proposed . 2400CrFRePrarets o5n2 and 81 esses atihdivoserawcsteiwocno.mIrmfeEnePtsA, rnetcdeediavilerlsepcruteblflieinvcaalntrule AAACa5TeO7nNc2::P(ErExoPvpAio)rsoeadmeraulteal Protection u mAppplroomvaanliaantdioPnropmaunisg:atSiaotneooff cosmumbesenqtusenrtecieniavledulwiellbabsoeaddd0r0ehsisesd 5 Ssuumwmaa:rlEyP(ANisORr)opaonvidnegs s+oScpkoines eT`MQoiuswoasniosknuyhriiP;pilaDrnensoiignnngamPtuiaropnnoosPfersAo;rteeDcaetsinoftnor Alr 29`psA%redoiycpoopsanendcditceiasocotmniimnosnte.ehnroteEuslPtpdeAedrdiwoiold5lcooa1xmotmthehiinnsssttaiiicottmuisetoe|n.. 3sAsco0(tas8}(a(2(Tn)BScoFCefOAstS)hfAePTooTtsolnxhuidoecrmfoSoouovlbmlisaontwsaieonnpfcguecsihoCenomniitccraoll : ' Arne EP) oures: Comments on is proposed sPco:roprlso. sed ato mustberomived a wmtingby (FOSS), prefluoracuzenlons [oun CERSTL SRR oJ SUMMnARYs :eEPAdSpropnooyseasiasarnpaporfovse KAouomneJsosneass:oaC.oEmnmveinrtosnmmeaiyalbePrmoatielceiodnt.o cPsuFobOnsShtFii.nacePasn,EdOcaoScrAitoaaidmnidontg1hpeobrloycmmhaeelrmsoi.gcuahelast15 : TCieematoesnresnrtdhonMiClsoasudnotusyn.osmMavirsobsitomuiorincttosna BABsC:o0cAi1sNPloaratnhiSoigp3S2idwD.evKealsoipnmse|nt ssuubbsstracnecuesseasr.oAalfrof tteccolhleocrtievaely | Chy. Kansas 59101 insproposed upl eruoroneyl raianimennmtoeofftnhheetNaNattiioonnalal AAmTEbSaAALT ron rRTHER WFORMATON CONTACTi Kita Sloanse.rox FO,1sPpOroPpOoSseSd rl GulesSoars(ARE OR ro pn Sprldaenefworhithcihs awraesa sinuclbumdiingted awciothnsheent SiUnfPoPrLmEaMtEiNonTApRrYovIiNdFeOdRMiAnTtIhOeN:diSreeectthfienal {`befopre orctomofmneensceicnhegmitchealmasnuubsftaacntcuerse foor w R1r0eedaseptspicrgionovaetnitoohnfeErremqeiuvemisistio.onnastnoodfoMailasssodoupnrFtosrpoomses sreucletiwrohsnoifchtoidsalyo'csatFeeddeirnatlheRerguilsetser SToPucTiLoesnsdSSmemnaesRoehfonry re Deaated:s GrSeapmt:ember 27, 2000. ttthhiiesosdinognsciufmnieeccnanetts.snaEerPywAbuboseeclsaiuedvesesschretihbahtedtehiinsa TSulbesthaanycebstiansclaurddeoduisn 1thihsupmraonpohseedse Perminens in soles amnion Regional mitt Region? ni environment. Th eae reductions by clarifyiag the emissions (FR Doc. 00-2650 Filed 10-17-00: 8.43 am] notice would provide EPA with the " limits for the Doe Run Resource rT `opportunity to evaluate an intended WRehciycchlicnogulFdacihlaitvye. aalnodwreedmotvisesatchientyext a`neecwasuisreya.nfdo apsrsoohciibaitteodraictimvititehsatand. - Ee FStoeodreaertsaruelmReienogplieerrrau,ttison9sa4csi1aos napponpmfratoorvdyianyg'ste aSaScuootrvcieevksri::tmyoCunbomremfbm1oeer7enr2titO0s0oF,c0PcduTreSs.n3i0e83d5b. stehedue cea 62020 Federal Register/Vol. 65. No. 202/ Wednesday. Ocber 18, 2000 Propesed Rules i pSAoiaobrnmeeinsnseeBdsle:baysCsommBamlelnoswtitsechmiaodmyeibtcloaeld"y" ori DMivaFionirotDneocm(ha4nii0ec9ka)l. iOCnfoffaoirmmciaoctafiloPCnoolcnloutntatilaocnt. tiLhmoepaoTreStsCceAeprsuaethcoteianotsnocn13otd(es1qbUueiSdeCme.n1t9s2,C0F1a2Rn)d pforostoEmuvuEiNicTatdfAUoRnierYiostdWns1EcsOohRfMtmAhaTetIhNo.d a5 To on su re aPPrrvoeetv.eeNcntWtii.oonnsAWgnaedsnhcTiyoo.ugtie1os2n,0,0EDaPCevnrn0osn4ym8ie0vna:tnasls iT13.n1h8coorsmeoppluiaegncherwmiu1tss2h.t1cho8ogmaaSnntdyV1sR2 2t8ater are . BeEoi n oydEoPcAk cponosnmsai"or Steulmebpheorn(e2D0u2m)b2e6r0.-10093)6:28a.0t-a7l708ad;drfeasxs srequuiprempoefnotisa.rpoTrthteceErPfAipcoaltiicoynianppears GfrsPtPpTpaSa-gge3e0of6of:3v9ounsrtheepsepsuobjnect ios orth sduopmpBAeKrmraarynStepFOaRoMwAevToRIMOATNON: aIddSitCioRn.Rspavapearsronspwuhonexport ox : intend to sxportany ofthe chemical gFeonnerral iEnforWmaatGiRonMcAoTnOtNacCtO.NTABCuTba:raor 1. Gener1althIisnfNoomtiacteAipopnly to Me? oSfutbhsitsana cesaai rteesdubt aleTt 0ath2eboexTplaobrltee3 OPEfirfloingmpioanmfghPMaoamln.augDtieormencetnPortr.oaOvfnefdaictEeovnaolf3unatdion, yA.oYuDoomueusmmuathiays cbreNuoatrifcefee(cdtAeefpdipnbleyydttbohyisMsetaicttuitoen if cS1oo3tm0ip)cl(ay1t3iwoiUtnSh.pCt.hre2eo6xp1ov1r1tio)fnoTasunScdiCaAmtouissoetncntison WTAovasniescrs.h(7i1402n10)0D.gCPtEa2aov0ni4nr6ao0.ns;meyenlltsaApvlvhaoPrs.noeNtieWcat.ion Tsinuacbblslutedaenicoemfstphohiarst)iaatea.yloiPsfotahrdeoisacThwaebhmlioceian2lt0|end CreFqRpuipraoermte7tn0t7as,feifsencuta0bedpbCuaFyrRtDta.h7eE2l1aS.i2N0ty1UosnRd 40 i. TDuSmCbAer,Hi(o3t0h2e)dSe5p4a1g1o0v4: oul address: S(0ouvmeporrotaebydy cahneamlicSaNlUsRubasrteasnucbeloct 0 afocqiudier.odabntusartiatahoitsLpireodposeulde may :| TABLE 1.--ENTITIES POTENTIALLY AFFECTED BY THe SNUR REQUREMENTS - Coors WaGieom Garcesclean secesoes Crema manasa moore Cromes excoras f|| 2a5s PaPra"rsrsoaonnsss wihhoa amaarmnpuais.acouurssaasnnecdi1eneasdebpy s.ancihaao0rnuadmeofmohoer)spoevcatfcmraamseaofl i| a{oxrbTahtuiosastdlaviress.tirnLgooigstuersnido.ngisntpheiraedoasdvLtiiokebdlgeyue1i0dsbea ycwohouesrthnbeuersaihtnieissessacitsTioofncdmtieegdthbteysrpmphilifynyatcoogtuioonr. tsahsoalsteilwgypnirfoibccaebnstosuctaohovewlecruheseddembsicypaaltrissobnsastcathinaotcnes : i SStaicorsecbdoyx(lihsstsecdiisonTabOlteheorftypheiseuonfit AYopupUsEhAobuIlLdcI puroevifsiexouanamslti4lDCtyEheR 721.5 hwaovueladayaotqubeesstiounsbopj0artedhicrcugtltheeyou Couldal be ffscied. The North To SNURtied obgions, Also. + sppliocfathibs siciloni15y3 ! PSmryaotrveicdmaed(sNttAoaI4dCu5Ss3)i5ncao0ldeCdsaehstarsvmfeicnbaeatetonon0s of| BScroAonBpsAoo(slSeCdUTaUriuNlDe1g.w1o0NuodltLdeBdhpeaOstrigibnneagctaeSucasunrvttihiilenss pupWemFriOscRouMnlALaTirIsOtseNadCyUOn.NdTecArCFToORnFhUsReTtHuoEcRhlaictal :!1 TABLE 2.--CHEMICALS REQUIRG A SGNIFICANT NEW USE NOTICE ON OR AFTER JANUARY 1, 2001 eTwec en aeewmowanm iBBcOIhTEeTa E2TRP1 rcaanmo0 e 0eg.sH 2 Buie epidNep AcNatpuoa rroeoyt alutsoonrypi flaaenmneooc rliaa2nn1yyssaharred rN a1 1223344556677 805 O 1650E-25 2mPSerpaioaagcraserounia:2 maNmN. 2(nhecpaacecaafuoanr3oosayPsaulroenymy atyiay moslan2y|3s3s4.4.5568.ne6pa7ca7ca8no8r- B$51U20S-77I-9 | S1 br rianaens o2i3o43sn00sa. 1e12s20341455r 66 6ine decatua or. siaus iomysoanto hen ln amalcs aooy.moncpassm at h Sreetias| |iCmBomahenemrtuatcaarammiadna, NNaatmi1.1112320343444555588007778888B8rpeepaasecahOsoRn {2 oEroascroncemm: dammanum SGeRrISSe00T1s4| CrZrCaooraynpmete.aaonadnceaoscscm.saapaomnnt,shapare uokoyrsoombanaum tb(wrauitemcnrnoe asimioenynnteyr c)p-a3dpares sopaansrsaaso atnEs. nas2en tommr!ayrmya(yaimdlegpcteyaoe2tsna0uoleoecnrrasmo,nrahuanxnsycec73y. fassa3 pa raanveonnosus a2am cate SAa memtm.s m arsiSe pls nosmSrtaee optamscpaet rcpaaemntosne5o.cso2euarcmatpnsAtear7isn3oeSnsayds8eeysce3rpaopterstuoeomomsaarrianwgihy 2: Sass 2Pi eotSann aapaaorc dameao smoeoSp TaE any smom3o mamSSoAsaIn noIaStsOT1dNs A ScS h 2m2maeSt5n1.Sroeppoeomnms: wi 2 IrreramiasmossoeannnaatosusseorconsomhuoyaosmsrotymoTnmaasrcniriasonineaaammilte3mmtany. cpancsteT.i2mramaem3ia(ruonpacrneoccpaaatnn.aota.panmpscnyiamecletiis maa mepanae ahssade 5 rei-reparone N i eagle e Federal Register Vol. 53. No 202 'WadneT sday October 19. 2000TPreopoisedfRulees S6E2321 TABLE 2.--CHEMCALS RECURIG A SIGNFICANT NEw USE NOTICE On 0% AFTER January 1, 2001--Contnued ot m Se EiRirm cSuoe lo ocmaemaasnsm w iaCi]darse m ne ser m me Ne e ams r iee e monn m seans a wm a n manm m ent 50500-1SSr5eE9aesr2caZo3iy0ma3mamySraatanaasy!ssseheecras. aas)onemesSsaocttwoaahonmytASnaarnrnenaconnseaaynac)ySsSeacarecleeee 2 2iM(enamraScerseactaetes caocoenshsnteanonaemo asoens re 2seneoasrdosnneanas codeenauyi %sruraedmmyn Araarcaoaa rananeySenott|coonarmc2is5Staisensce5namomneyecohierym5oSawmeissntseornoennis1s 1seseansconemao enseee0rea 432 3 TIRTGE T1 GFrrooeeonmuenelasumsnaomrsnocsoasatcuaun2c31nsasaor rmveaao nHnsdEanmmoneommenmSoeam oocaekrsaa) rseenesisnulosylsamocl a2oyotonno.emmoanoosnoadeumsanotn ny. s3rui3rs4ea5r ns e s1 SSeoSsn meirenyelsaast umidoooinSeseme3RyE3mmFsaErmoae eycnanysaam rwoinepe Bvuemsanus ascheicsei a.tuasns iroexpsacsntiaoine2aamnadeose2){.mmeamrios(opsourmisaoncs EEaTEnEGtS E003 AFSmarmEaSyeClCaoi lsrkiimnsmweess.ai22snneeNnmssr eeanmoso oeeylsn aasui)toona niammaimaan meotcniesnnyusesters Fam seas Ciainana mers 2 mam ncecstuarnaniscaonyTaman, soars TCHREIESESSS ESEiaFanS1mo0oeas rmCCli3ECaxn3aNnssrnyeaeTmrreeiagsshsea32ermmienammncmielacboaeepveanhdaeuyscitoaonnnsistaonmsoernsansocyseesotse.rnsin 1 8sceyanaonesine PPIHRASEIINS-IN2E2-3LLPErS3ua7rn0saavcmmhbeaersIsyntsCeSnLsmseaersknoaorhmneoaS:rnisrSeaO2rrPLaoESeDeecmyoa ansie2 eTSN aacymaaES) yoiohSc:HmA4oS pMasSoa mSeEa1ssScii,oyhn1iO.sr1BeomaESmoYrcakbsi3t1t0o0c4y7a6n5a0c3o1anNaNre2l PALIT PaTT HriEacnsaaeartae i, nSLepMaEGnePS sya SriaSreaeyo maadrsync2n a3nmieocssTe tewoeinhamsiccSieyoSannnRd sNwoiadham1.sma3tw0hhyy3a3na4Rbai4m2 {8i5s5oo5p5n5ac8 bSaencrSesn5see8]cSS anTsdoan1b2e3.e: p00 CCatiipone.asawiroineammaacsreaanea paomd. 2m2a334 4558|6513793p4 1a558n57 1s5 Bc4emnameacaMEebesasst SEG CETUS ptr, ime nay. resin srs wi 12a30 0 24 PaO P0035 SFFuarlrooaetasaemamciuacsernare1Cn0s3iuoSn3akNiAmneSrmeCepatsetroNuiornr2sCoh2NmaaSminutNrh10yxd0.oS2nrecempyan,oyorsfyeerciiyeoln. products smide. wn Zeman 30d yma win 8 cyte, 8 PUD aSrecsemamaic JoErsmsaanacolmanad iSapnanaSshesr eSNoaymie m stho aarna o: Cmocsae eyey neesion 2aSmiiz.. P:34-2205 P20 SiPToaotmnaaenmeisceamnaetn:sdoRhSoiInAcennNeT ysa.EnehciybC eanyameteaA arndCtBosCNhCCSO-p1gaheaerryS mpaeianeleo (sAcieanra gGATSp wih eeSy. phOeYxTarnSl w2h:02 PDAITNIGOS FLaFainaccis nCToE reMas,aNGrNcrmSaymemSpAewnr1Cea3S3T 05 S BDB0reemte5.deca5tuc-4ccar8essi7ons aca P0025 PSOE p2Pe rreiocbnaennasn o caScaa0.2ndt smueesmta.wsiSoimeremsa1nw0yi0hsisSyceiaaomvosey,r eZsS4emeapioyymm{aorpmsaauwcieCbnre8ssoavakieydsvlscoaar.nyl2am{CnmcoeimrepnyyiiapceueCo4ira3snss: PAI arSiiemn!caamTimaaepnaans) PTCCONr NPEIN-TR Sao C8 hAare sufonam. 48 ea 36 ee P0310eP3i yomto2emn asonrecy ana {2(meromyeg--aa{11me.3e-- iaaua-- mienym-- Duyylgnlaso-n. ibertucrs CLs re E i TABLE 3p .--CH-- EMICALS SUBSJIEGNCITFITCOANVTOLNUeMwEUCSEaNROETSITCREICOO TNIOONRSAOAFNTEORR.JAAA FNTUEARRYJA A1N, U2A0R0Y01, 2e001 e aN e REQUIReINeG Ae wSSoEorasTetN orwweOTOcn uanessaC leom ffoo oandee 11e 122m 2275Te 3io413C77o32m 8l884i5gn5ne3a154pid an0ce15ex55cca15trm uor5o7errnesec5mo oasmaeo8rsw - ncme Font 2 Prsoenor 308 Sma 2am nessa Ane Shr 00a SEIRTTEos3 --EConEnCAcA SSoongpceehrvNoeowV1(oEnrSooa3nr00eOEsneToRdmcCaaodonynsdA SioobanenrAteTIonaSiewyCTomo1 e2p0s0e mo men" or x || O Oo aL e TTT L TleoIo {| I gHIhE SoErhe EEmRE U t R E ]neoes n : BBHEOEeEEr a EE o e m r e arE. nr ere. nL . BBEBEEEEE E C I TE E Eeee r Se e E E EER n ear vHo, EporrNnete ee ,: wwoas L[mhathEEytimoEuraneeempoE vymoerrmM wiah Gurtasneoommonede-210roE SpHenicpAlee And 1-ccianee iha test speoveerrSEeEmsean n33 t:| 2 EE ER rm er onT ,E LI aLmPet Eo0m.sm So0h0 e0 uyr .3. wns EF ECseR er sor F E D o a tn E e reneiteLe oiwaenm0y33 rs e 0 aTL aB S arL eetLnoIrean0otye. d3osSonnTesRrie 1 mmeasd E E r Cl R em e h=er = re met see tenSe eT so EE EeemmeBrrnnnEET hEmen R 0 solrgnTSOEeomemnrdy afrriyoens sora ire SE CTTLEET.a Sp Ua ate oA Soer S am rCE eRr)Aue Am sra e anrt sSemsare i,srdee a rns AB FE a TEr n re mTr rh h Eor el E E ey, Egn ee isrR saemntm vaaspnet snaonrnreey pros oT EESrCeara am enerste . 009.775 _ eh Federal Register Vol 63 No 202 Wednesday Ociobor 18. 2000 Proposed Rules 62323 TreLE 3 --CHEMICASLcSaSuUPBiIaEnCtT NTe0wVOULsUeMENOCTIpCEROENSTROIRCTAIFOTNESROJNANOURARAYFT1.ER20J0A3NUACRoYnt1.in2u0e0d1 a0 REGURNG A TZoesnoe Samo SPCooerneoas SoiarsTam seasey eIn Cm onTcmrEoro -- cer-- ca -- evr sonar win Zeman CAS skys aoe ee a TaoEonIt BSoeeraemonns CileanSouOt mCrema{o(SSoov20ca6xs3tzoFseomyeoimaayrry e NEmany a 2S ae Emam Soca ser paymers win Syatenmeny2) soparamce. 2am {etree #IaE 5ErRo I ST`u oakEmyisan uEtnonylESarTmhanEoiC olsehRiaihycsnl mpSeameaaceriyNslnoar treNdc.eNossmTieaarpylwemheatshraaecavrsyealarayteaeSnanHosngsreIvorEiony5hoceepnSeenlecorSibSnon1Eda0eAErAEoEsS PCASm Ampo sse * 4mrin sagas ShameanCCranane parry N3 amemysroamosteor poassum sats io S5rHmolaw Gnra.n (GecrtieaddiiltnigaoCndoapleosdouftmhiasns C1i0no1fonMrem3as1t.icoSonWmCeontgeWria.sahmRionmognmtosnoN.pEDi8O--nC5.0T7h.e ianfeHoorsmw'atSihonouthlad1t HWaanndlteaCBSIubmit tothe Elecroncall Youmayobtain Mooday through Friday. excluding Cai oho eeddocumens hat Cones i (202) 280-7099 dsctamiallythacioucomierto be sabesallescioncll fom owand to whom Do Submie sou ub hestpotohm eR atermer Home Page SPY Comments document as CBI by marking any parotr uGnoCdcoubmioepnnotr-ReoodnpRutuhielieoHsnosmtehePRsaegtgeouskaelnueocptshse hseeYmoimnuaehmpariyopspsuebrcsmooicnt.sooctobmsveenSctpwasahnpeoeounruls| hTo foSorciimsmeadsisnox3mcmauseaesdkpseectdwowridliannnlcaoettbwbesi no fo this document undec Federal Register--Environmental Documents. Comments must ident docket control `number OPPTS-50639 in the subject Endaien io ose Somplo veraonof tn Re `T Yeoguicsatee nrasltsioe naggossdaithrhecpet:lyO'CtwPoFePtwThoseSnecFoeepddaeirna0lv/ "his document go ively ts the [Dion1cguo5mnetnmhtaeiClfoinrSstturbpomlaigOtefofvfiocuyero(uc4ro07rm)em.seponOnftsfsei.ctoe: ofl Prevention aad Tovics 0cinofnopftoariomfntpthihoeencncoflmocalramiimmeemdanetdtisa1os5nwCChcBBiIIc.l.haosdyaoineiamsstCoiezBtde.d us: be submitedfo inclusion i the S"daapiinr.novomueemgtauyiaadcceceulsisnotehe(repnagov/ WA(giOehPniPcya).goE1an2v.0i0r0oPCnemn2en0n1et6v0ai.lvaPrnoiteAcvtei.on.NW. pwpiullbollribmceatvieinrocsnliuondnoetodfmitanhrtkhoeefdfpicucobanllfiiccdeovnertridsailon {nformation sbout the Offic of 2 tn person or by courier, Deliver 91hoffical record by EPA without | SPruebvsetnatniocne.s (POesPtPiTcSi)deasnadndreTloaxtiecd. yCoonutrrcolomOmffeinctes(DtoC:O)O.PPETa'sts TDoowceurmeRnotom pPFtIOtF nCotBiceo.rtIhfeyopurohcaevdeuraensy fqourecstliuomnisng p{artosgmreatmisopatprhsutpi// www epa gov/ CWa0s9h9i.ngWattoenrsDCi.deThMaellD.C$O01sMopSte.n SbWo.m S5tercoFnOsRulFtUtRhTetHeEcRhnFicOaRlMApTeItOsNon list | mcso2u. bmIlnmsphieersedoansn.oTdhofcek cAfgoeennicceyochnuamsoabrecrlhis l8Foadmao.y.n(e0x4cmlpu.edmi.nsgMolonodrgaynhtohlDrlCooOungs2hTbhe) coWnChaotmSmehroforCuoEnlPsidder as Prepare {Choinssiascttsioon.f tahendopucbulmiecnctosmmreonatrsenced in 3. Electronically. You may submit onWheevianrviitoeusooupttionpsrowveidperoopuotsev.ieawsn received during the comment period. your comments electronically by e-mail 4pproaches we have not considered. the and other information related to this to: oppt.ncic@epa gov. or mail ot deliver potential impacts of the various options 1| Crlualiemmaekdi1nsg.CoinncdleudnitnaglinBfuosrimnaetsison `iYdoeunrticfoimepduitneUrndiits{kCt1o thoerad[dCr2es0s0es108 c{ionncsleuqduienngcepso)s.siabnled uanniyndtaetnadeord i Information (CBI). This official record submit any information electronically information that you would like the. iit$n5ccel0uadGdeooslccktuhmtmeenedotnocstc.autmThenhantetthapsreetehbdraietccraeroaenrcsaeo5dnwienol.fl _ CtcAhhoSaamCtrImavIceotnfuetlrecss.omovfunoasisndyibitnedoogersbtmrueheboCfsBIInee.codrEfV-4Ems5iao3oic0lnie.adl dmAFsageeelylpnfaicuplaymdtfmooetrnchreotneaosplfialdtneoherwnigdnnuaogrluisnusSgggCCteohRsemt.mioenYnsotus he official record doesnot include any Comments will 1so be accepted on a information claimed 3s CBI. The public standard computer disks in WordPerfect i i1F! version of the official record. which. 6.1/8.0 or ASCII file format. All eiSlnuecbclmturidotenseidcprcdionmtumedenpratanspeiptrphavltneirmcsasigoylnebseofany ciGdoPemPnmTtiSef.ni3te0ds6b3iyn5.deolEeclcketecrtoincoioncnitfroocrlommnmumumesbntetrbse Use23..d:PDreosvciridbsecoapniyesaossfuamnpytitoencshntihcaatlvou. Ceosmpmaecnitopeirnitohde TisSsCaAlaNbolnecofnorfdental mDaeypoassioorbyoLliberadrioesn.line 4t many Fodecal Sfuoprpmoartisoonusanvdi/eowrs daa sou used that 089.25 62024 Federal Register Vol 65. No_ 202 Wednesday. October 18. 2000 Preopoesed Rules } Comrts.efp am sluhomwea sopdosn reeesdbur5dheen or Providespecific samples to YPSor4ho1d2u)ctioTofno:s3ethecCheoexmseiscan1l0 wcsahbeonine4eRcuhse Changestn pe. or. TaBBAIR Or SsluiisbapnsararoenpcaPoeoeRsuwlOeo3dSrEptyaofcraossleerisv]elay Chemica sebotaanvceeis potential hleistG peroepovseoduocei oscoerrdnTsw.hs on liemnp.os| i G4udialonoofeuxpossesL1i0 tcheasubmancah,t oSfubipmraodnucceingGaocfeOTmPaArwmiaskkemsarhapiion he 1S 0 deY ad bS ecnk dto FPEEOOSANtpr hne Ddeegbrardea nTetr Sohnoncbee haga i co"mmNeinktes sbyurhe0dseubailniitngyosuprecified in tTeSrCmAismenctiioonnSsnadIprBomuelgualteesrsPSeNrsUoRn.s rStoundigeswaodveencFsoubnedoPESsrcoma] hSeisSidroechu1meepnbrto.epegriy nHonefinssnougshecomments. Secure Fou rs commentionng. To (h1eSsyuVbmUmaintu1l0aaEcstPiugRrneia.fficaiasmnptto3nre0twdoafuyspseronbcoletosirscsehe qBmuucamnamtaitntiipegsoahpaitthmeesxblposooasdelofi0thrtehgeennerae} r Chemal ubsHBCE or nH SGTIBCABt Chamacas wren recent : mCosmmnentpsrompuerstrecdeiptobY HEnPeAJ,Octykoeutr| Cfmanhieoslubnlumebtegr es8igth ntroesthdipsaagcoofn n.e(IwoyhhhuiscehGeG(ne1er3anleUrSaCl.Pr2o6v0Promsans8toIAnIpsHpBlIe.?Aply? aca provisioonsr SNURs we {LPeEOwSsShSaEvcSlfeaevveeldoRpeErmmeneRtlrAesprhodounnciaens3. Theat Tciors ten ger. aoe yBoeurlreesponse.wYdouemadyealsgo perorvide PaublrishuendTehre4p0CrIRopanrt 7d2r1ive cSonRcerTns fo orlongterm poT tential adverse. cibtgat-- ion. pChl eei p eS d nU e, , iTfPEFORS,shoualdncdon,ti1nnudebtoubkeu the A Whatot Actonetioniss tthhee gencyAgency TaTkaiknign?g? 4L0dSaPpSpUoUfGRheASalEIstIoLusOyesS+S |SETPuAvboeleiemveesntthu the chemical o This proposal wod uld require persons Rhaaelarulde. nNoitasthait beScauosesthisfan Ususbstanceps alisted sitn oTra2baadlnde3osf cOSFotehmemcSehanemciictaohlgesaumbanwnuAcfRaCecetsuIrdGeeoenunrfUieTmdOiPEnO1R3 mouassnsiugfampcitmubrciiinganteonnadwmoiemnssptoprtepinrgesornsascuhavaci"tt?ies (LBo CMPoirtnedaResioaAtathMeEinUinintSegdandnStatges oraleyrby ! dsoigcnuimfeinctan.t nTheew cuhseemsidceaslcrsiubbesdtainnctehsis twhuatlwdouaoltdbbeescuobvjeercted10bybethriuslaection 3th4ose5).chIeMmichaaslscvoomlmuintttareidlytobyphase out i1cAda.etntiiianfcilheuiddgiehnoPrTFatObdlSeAo,2waPenOrdShSToa.mbloPelFo3OgSouFfe.sUnoift P4prr0ooCvpiFosRsipeodansrStrN7eU0l0aRi.nwPgetrosoounbsseerusrufeebcellsuesatpetdpdoefatohri|sat C sdiisocboanltoio fbnatushiienssgeftcohrhc eetmmhaeisecuamfloascstruuwbrisedtoeafsnprceeoasad PCphFeuOlmSmiAceaannsdaubPlsFuOcnSocFe.nsaancdPluRcdeOriStnaAignsaotdhetrs coCromimpcpelldyyowweiistthhusthhseeub3msaimtmeesraOosUtoiCfche ry tuvetoueldsuimleytoehnduhceeindorgomfatDihenscieapmgrbocedhruecm2ti0ic0oa0n,lsby !|| omologies 1s substructures These cehleommiecdaltosruobusatgreaihconlolperccoutpeiovstesley amanufachuen Notices (PMN) under TthSeCseAesqecutiioeniS(tWsI1IhAcYi.idIen phareicular, t'hbserscoeuogPnhEA2Oa0S0u1iatanhcgde h2m0a0ne2bu.fmyaaDcniteducrbceeymaoabftealrrlsl3sl1oyf. | ls PFOS ee ents of 2002 (Ref 1Thechemicals iedin | is"1ThoTehtseiigcmnaianfriuecfaancttnureewourseismpdoerstcrfiobreadnbyy s5TxS(aC0mA)ps.ioe(n2)cs, a0tu35)t(ihbao)nroaidznne(d5d)Sb(tydheT1Se):CxAtphoesection 2BTay5bDlceeo2cm0mefiUmtnbeiedt1r.oLA2.e0a0a0rs.eetThmhoaeasuecfhwaehcaiaticucrhaila3sgM | Tuaasebooleft2y0ffUnittheLAc.he0maiocraalstelristJeadniunary a1otitf2icaan(tsidotnbhpereo}xvpi3so;0irotCnosnBootfiefiTocSatCniAo.ns.ection h1501id6cdthiInhMT0heaaesbsns3cleooemfmmaiUntnituteiLdsAcfitasitertitohbarogyesdeu.ce. | uso2 oTfhaenymoanenourfmoarceoortfimuhperorecthefmoircaunlys ESuPbApmaarDyt,aGkaecreegEuPlAatorrescesicveisonSunUdNer, 3DAecmeamnbUeArchu31r.2o00f2 iEmPpAboerlioefvheessethat olfpiosautnenaddgsignrpTeoagbaplteeer3svooonfluUpmneeritcoafLlA1.e.n1di0na0re.vx0ec0ae0rsson aTwphSpiCrcoAphrsiieactateis.ontrsoecSce(oionv.terSdolUthteh6e.SaoUcrtNi7v..itifiIesEoPnA P801F0ObmaSlagcpnhhieamtsiuecd-aeoalustdodactdceuusramwtaoigounlaodffeirnxcMpro'esassuere orTaaafutaerryJ3a.n2u0ar0y31. 20and0bef1or.e unddowesrnoTtStCaAkeascetieoinn, sEPgAtoiserxepqluaiirnedin FIOthPeEsSeIcghe0midceaslsi.gnaTtheerhefeorfel.oEwPiAcigs1 uTsi3m.leTofhs3en1maoifnetuafe.cahceomtmoiucfoarrilmsespeohrarttFefndoir0aarayy tahkeinFgedaercaolnRegister 1s reasonsfor not $u1s8e1niofAfinctayhnetmncahenowumfiacuacsletssu:rbuotedim1porTtabfosr a3aoyf 1.2003. 8 Whatsthe Agency's Authorityfor isThSperocupheomsimecoaSlfmNtsUhuRibasasPtrranrocpesostsyesedudb1lRaeutlTaetbole Usen2.oifAtntAhy.e0mcaaohnfueaetmneiurrcJsaatnoleurdsapryo11.rTt20of0o1rb3aoinyf + 2TS6ae0k4ci(tn0ig(o2tn)hi)sSaIAuZct)htoornoifTzes ESPA(1tCo5UdeSAtCer.mine cSPhFaeOnmSdiScT,aalPbFlsOueSbdsFt.oafcnUconemistiinLnAc.hliuTgdhhaeerPs3FeOnSdA. a<UanRpniutfaLrlA.m1aninuafieaxtccsetesusrceohfaaenmmidcgaigmlrpsoorgtiveolume |! mhakessatscutshieisofddetocheuersmmieicaaTlahtsueobvnsAteanlnece"t3er PsluoRbwOseStrEaH.n1ocnem.dacl(oogaucuedsnionfgPepForOlcyShmAeemraisacdadlat 4Cnh1da0bn0e.df0ao0r0eYpuJoraunonundarsfypa1e.nr2p0e0r3soaarpyr1. 2000 CionncsliuddeirnignogsaieesvtaedntaaTctSorCsA. section CuobnstraiunctPuReOsSAAlslaodf1h3ehsoemhoeloUgEuRels 4s use3 oAfnaynymoafntuhfeacchtemuiorcefalmsp[osrttedfor ny i ees in i Federal Register Voi_55. No 202 Wadnesdar October 18. 2000 Proposed Rules 62325 TThCoahne3nnbotflUhnieot cLAo. m58p5a6satceorvearnbuaarny Jafar cartels produc the CnoeuhwlamramnSeueefgagircteooursEdienlRrgetOcoaSpmwWahehceraOnyNfoErkTRtIheeSste feSiorUhaaRatnhuasoI3epdpgneomseimihagRenpaaeotnieutdFoFbyinontdhodiesesTE4pPrsAoposed mCCoa pheaeethemnuaegduivesaceoTbmemmSeoarf UcniiaalLnlAd. ACShenrmuGeael thIeoemdpmhaorpirBoOpeoPsEaeOdSLle+yro es mneodmaertdv tohye0adni d imeneccReosmsairyb SUhneisiekRoclshetmhSiacRtalcEs.oTmpEEaPnAViebRsewlIioeNuvelNsdtAiinRcuSr cSoHpmUomRnenmcoinnesagstttha3en0ymaodnfauytsfhaecbsetfuomrre iorca xsens Tiviedin proptahseed folowingseveTnatbyle TasLE 4 --SumaRY OF PROROSED SNUR RECURENENTS TT Vou ;must te 2 gricant er new use noice (SNUN) you A a Crees Sraenceo veiae TTiamvea 30511 UUnntt 134 SAeaormnaeOyncamp3a0r0 v2e00i0n Oscambar 31. Aoyepaaompooma aaauroxncheeaung 1100000 5 or Cram susiarces tea Tae 30 nt 1 Aves Gecamoar 31.202 aaa 1.ChemicalrCeompound History Smohioewtnydi ethissuncibtryctohnietsibamscemuordree hte rporelomeviealpl foshrsitrsiocnglcysuggeisotni/veof gAroTuhpisofprou8lposeRduroulre iapnpalekssygt)oa large CC1h3oeiitmhie1cAias,ltsOsnualbsytTtaahnbecleest2teahdanndcahTreaembilscepaedlcioffied bppiroeocsoensncceeentoroifatfOpitosnSi.nsnTspuhoygengewsa itdsetsaepawsedlla. lihlinccahttvoeceeCunoznadiaitiicanetrgyv.iScbTashlaenaiNmeisen,tshna+ oamdeof 3sium0bpshotaarnsecdevso.sluxncwtlhauirsicvlheyoltcyeobmmymeimtueaadncdirowichersiescodehr ocwtrathteeerrr,wiiobsnuetm(o(Rhdeea.lmt7()iEQmUCse)idnsigusgfgq erstsprobvided SESoAafSColRiattgipLnAoarNneudmfsboretrhsesT(apbCelAecSiNeaondwThaelne SEprProAcdutcuisnngl.cilaaesgssoufbjchehcetmeicattlisssuSobvNseUuranRlcles bpByaottiP1oE1nG5Sminwopouutnsl.dx(lhelumowsa(seaoiwfaintaydei1rc2aa0tnesd hCrhoeafmpoirscoasvlidssiSuonbsiaNcnlocnoetrsaUsihnaaemdtpRlianes.thsiussbnjrecyt#to8.Sanid3omnb2tapapkroapScriitaitoee.nal regulatory lSoii1nTogCe01oH2ned2awirig0sssLiaswoghvraulbeuieysvcaa3ll3uc1eulsa4toefd SYYaooTc.t1aa7n6be33sl-s2ofe3foU1snifcisotetLdhAe,.cliosmtpsoCuAnSd. named PFThOnevcrboahnsmieenbmtuaiill1dcinPFagRatObleSloEsc.k wofhislclhofish|e sL3Ie7a0tw.aa5t7fe0er..sh5n.wdaantide.c25epaudurielslweiaagtwraeat,me/ruL.intieirte(rmegd/ LIBaSEpBrFTaOdS5ucA0a)fkuAglsels.of5hc6oem0m7coh7enm0licy0al0r,eferred10 Bipndrraoo30dosiferstmhoeecdaPiRaOGitSeacihfnelmtohieecannls oeofrp4ie7ctmi9oi.lmy7l2yis5el.hd9em.d6sH4phEou11ry,ssasinpdwr3v2maluces SSSnu5ib7csUrtuanrnececsotnsheiasdtviening'Tocfo4maPm2EoObnaSnChdlmeTamalitebcyla.e PsonFmOmSaAnt1cahnydrsooxlniyrasmieslySoufFPpaFpbOolSreF.shuabCsatracnecnet Cavuaubpoesrd pwrareemnoolbeti.nrmdeeswdpaecoeimveolTua.tbliel4T.sho 16 5olHeucSurlaied hers. somewhere i he DhWihliocgihirceaiapartoscbedsrseeesgsk.aadTotwrnoenmbyoprcrshodeFumcRitcOaSflAoomr otIfMh.ethEeSnuMplaofomrnmcaet1hnet,d.2P0e0S0go,lurowcohecsehDaipmsacppeaerrlssiboyinn. FF oO FfoOrmSRCeihs.em1iacnadsla2)d.s wil porest va thar FCraet vaanldueEsfsoucgsge(Rseft.ha3t) vTohlelsiszHaainones FoCI mC-S-Y doEnPaAticoannneotacurreently conducat. fRroormdwiantegrt1o0aMi.r itsnesottivngerbsyplliakenlny.ed RA a, aadior underrayfor he savicomental [Er FF oO B tioning O of AeCmiaeCanvUeaiylraib0bloe 4%data W[PrRoeopfer1utb)ieeWlsai.bftdlahteem.tooanrmdackotemrpaslnoswrpeoddrofatfian.isPFECiPveA inTthheemnoulmebcer aorficsarfboonmaettooms10prxes=ent gesutiamlatioofndmtodeplus tis alitmoitheed rby the aAsgseenssemyeactasn.onWliythsptheelsprieeseonnt data. the SG3-i9f)afraemdonncghhiaertmhiieclraielsotmeNdanncnchteimeoixcnaamalpsll.e(slrno.oef anDedplnenidsiznegopf.ooPniEhwrOehSastovodaayn,tsaBaeironelaocgolincsatulletaendd~~ mPAAfvRoiLrroimnomanetinotnanglosfugtPgrEeasnOts.sposrtohaonnucgghthcautren5t Su(altFcana(siYi=dhOanHsdd)e.ssmhe1otra=dlosXcailvtssatu(ilYvoen=sa)Om'TihdMee+,)s. Cspaomrmppleoiunsngordeefscneoinnrctfltiyeshdsinspdcooicvtneurhoeerdhoetnhelen.ting per1s01iesatlent EaenEdfectmay bioaccumulate. pliosl"tTyehmdeecrcshleamsicoaflchseumbistcaanlcseusbasltsaonciensclude bSlioorcudatsthiaocPnaescoisifshicCtha[nRaUdlnai,1t1.eSdTwhSetedaetwenisdaaennddt1h8e SPlRToOhmSoeniAigso5ernricenyvg'isedwahaoizfa(hrRedaelatn1ha.lbyTasoixrsiacfooralaodgy includingth perfuoroslil slfonyl diibution of he chemicals in high Studies show hat PFOS fa well absorbed 0001 dx 52526 Federal Register ol 65. No. 202/Wednesdas October 18. 2000 Proposed Russ ry deeispm he Short wl ge 30%iosonpn.PL oowmnni pmori Trnee formed 15 2 metabolite of other Eiot withdiayne ale bith, AS3 biosccumulatuve potential snd the | oE S peprfelruiortionbaeteBfdurrsetuE hlefronmaetAetsa.boalItiS nzdeeode.suaraotped Frr{oepeedsoEonusfeltrsghtreouoppEsuy,pSsomnolrcytaatlahietbsmytaaiwaootanhlerorwt,ewsot. tpE irheeporocohdeeue mscitciaavle aanrnadiscesnsubcScsohnuerc2doen0rhinpecsoectoohfxporeirlcreiytnydof :J ES EE R e ean eEn oReta Soinoe]nOAdBEoe)tadndbTSloreFenOiALTs,r oa 3 tnotmaosnaoaus82 rode {dapproTximateElyLoaumTso)aaAmSnumssTaedooAoamnth),e ESEpouhvpisesirweopsrnecT0aao1soemcpgb/ododbyanywdaaoondkg0phomsac!al [of aa5nipi e sriankd1wiUiplid he1ie.igPciEhOeSehsla eae ASSESS SSoyv:epamenc actomndtoe sShoewnaos oSfhwerdisSeueest,a ipxpooarvs tSotons dcehnemn Parmates wars ote. potential for davelopmental PEGS hat been 1a commercial use since IATL A erE rJT PFOS bas shown moderate acute F`EneturootpoxmiceitnyafollleofwciI ntgsewxpaoT srueresto tnbpheie1ee9a50'pts,ioprecndoaomadinnoaanptglsey idanasooiloannd BEEniibemalis6nhamegoathrsebe BSamoe udaovgedaoshhpehmaabotSSaTyvoehoew,rle. SeFaapnospeoamede)aeeedianosnnagdoef croeat eisduaca e asmce taooieh atnds bheabvoeen SdomesesoafSeudtoysPHeOSanGdo,iln?g FCSaoobliunamnnfoPsEtOcTopoeonvdonineotndshpcdeet bnoUeialionaeOpEsmpeasBrednAopbeesoonrodCOoARiEBAeS!| SvB SepAeealenAmaebd tasalosnartedbsmoesnrSoeysafdv fSSLoohbdueBenoe1dAipABeOsSntuntpeeenoysrtsomPEorOSp.oeeatl CoBoymaaobithrvO ed a 3 R ko. tatttoed Gheoaperle sowpoehtTonEoeTdoAndotvebse SSSiocomneikseTx nheomle70sswehbicpisomeomadla B Dlorrsp.ecsoenrovthuiyiopnse e.maonoditdseaetnh TwfEoheaehcWsse.R CSboooapvesn.TtAdIisRyoeCrAnsSoidrfdSudcHmiyvncshyur ma ahi.dHiSpr nhcdiluudpeinndgLhDAipaoarnyaLavakie ofooelm tihe eCoeO oSr hiardedsisAmosweesentmsao?yr SaaStboriveoesdnaoeohnendwFaOeStmerge.d tn oceommsnitnotEEoEpOledetooemnsaouTPtHOeaSt.bn neo sgenmi gEsvvepn anotnoroPh prmoshreuoioduna.sd ebheonfSniNeoeSmtn oaeolldhneesnuem(epplueesSooSPfpRapOiSouanstr1. faeCeblrseitiietnpeinSetFdsoOnoSpreaeieneds [E PEE r ss Stecga pore. be ona ond ent, et FFGk Coe boCeontwreeaesnm1S5e-3r0y0imggS/kgd/nada.y.orwNeeotsontde mBapnoufapacut,uyriengenemplcooyleeesee dhabveobree elnoacsh MuPoUrsFeoOcDhaaetnmadicrlolsataed sloodnvbaasesd of hoWeetiksaeLiltyoodtanCryeahltomdeidnetornastmdpsmosioensonnat,se"low0735+ IEbaalnIeikbsoStanenLddemEcedonRmesmeProrcoOiaSnloBsaodkuorecresehSau0v%eg pDapriooetdrsuicimtmsaln.nwchcSctihphcahetsrcsaoineebnfa(decnivfidS3we1dgoTnotoeo "Haetusoltiezeastailoinvaabatnid:oenh.ejnpaabtoorrceeeedlddli`ubtlraoerarthsin0g. i SfroomE saaivnasemeh.tL yaIonnfdosniftese1,aFciERroesnsftoUhnspiatceasd DvvaooprlrliuaiomcunseieostanuforPsfpaEceOoeSetortpermaohtdameuecngnttiaoatnmneudenBEdepid roe ns dE ienavioepb lumoepnmni eednssfeivccassendwwearraeedsfdaoeponrn"eed dthsSBekpEolptouopmestaocfesFhedRviORee.omMboebeecspepheotpfnaaemlebnsle,ess. eoPtFOwOinSRdecSshgpecemiaidpntoomppernneedosudntsPlEfoOorSicreir RSkreeE/epdraroyd.iupcBautiphvvesostuorxvndiicvoiatslayisaOtftmuhdeyari3cns0tordast3se.1tA1t.38 opEafRipsPgFUcOnstSeihdnaSnvpetoeaxaiylcsieoetbynesestnouddiemeutsneccptpreeoedstiusnmdatbhely a4aPpnnopddnlaiwhccaoahttroeisrnonrRssetrsmsimnshithpaninusctle.stseonScpdaeptreosegosnocarlis aipnBpcaolruerdle nFneesnrertoionn m tspriawg 1 pauhps) he"Altfoulghthee PseOnSorlavPelsodetpecteaad 6in AUpEhBoLlsCtMeroyi.s4adtwcaarpret.rTehness eaIvern Federal Register/Vol 65. No. 202 Wednesday October 18. 2000. Proposed Rules 62927 ldushtrimaillssotonvgserbyncnusetorm.ersSsauschhe1s3 O out produE cers. and carom lsae ate ipoEzaaiptnsgealargsesntwwsah1dorumnaednesuJrfiotaaocmkteeuenrRnemoatimnbaagls.pyebry aoq fpprAoNxiYm.a1te0lya 210.10300millolwoinnpgounds (Ref niSeoddmlaionabtaihfeet.eirunmptaherorkleistotrewrbesy.sttcmhaeeropgteetnoefraaanpldparel cdahnodemmpieacspalepcfrodotodhudict(siReoufnsev4c1a.ot1e2glo2ro0yu0f0ismFhOeeSS coomrersimaelnevteheanpncrouohnsceienigbnsSh=,aatiwsoouuld Su1bai2c0o00.prtohfeesdsoiomneasltiScppplriocdiuocrtsio(Rnef. <simated tbs appro mates 3.7 milionpounds (Ref 6). ail Fr wuts Lridiant products tn 1s semen. 3 vSiegorloSufOPmUFOeTSiHch0emi0ca0ls for his(uRseef COprROBSoAcfhseCpmhiececaglisaeidwnetdhUuescpkearilfno,armiandcse cpSrooomdmluictettierodn'tobyT"hsuoebsotasandtioealflcy ephnatsesoeutse FrOScchheemmiiccaallssprporodduuccededCfXorPpUapRer Scoommnerncieala.pplacndaioCnosnsiumnecrhsapphlriscations. cproomveisdpeodndaesncchendwuilhs dtohecuAgmemnciyn.s31Ms B FeErsootE aornd.ssSeppuaetncao inssespdpfvsliipcoipsienassealand msRueactfabalucnapnlatftsoia.nmagsc,aindmdimneiisltoegcstuaapnnpdirceosrslsiacwnhetilsnlgor rmCeaolnmauptfleaedctctehueprmeliaocffaoslpefdcoiirsficmcoonPtsFinOsuuSirnfaagncadel hinnioCnoprlatee s ooo d contcionma Ophyoetogarapihinc Ailm.udesaturTeoocrlepaonleirss,hes. (ientcluumdainngn{5d08paCpoenrtapcrtosteecstiroenguulsated End Ddrug wArdampism)iseugautliuoined(FbDYAt]heunFdoeord cthoummipnagosad.dicthiveemsi.caclaripaettosrpmootdiclneeasn.ers. dbyishcoonFtiDuAi)nbgytlhlemaenufnoafc2e0du0r0,fo3rasday ZCoanCtcaPikRneaErps7p5lci1ac7sa0bt,oi2no0insewssefloflod5rimnangsocanan-rdtooonds,| sapnurnsoddu(4Rc3et4fim.on4r)mva1sacoh2c0li00do,euftaPhmeFbdOeuoStmescsthatetmiiicocn|aslosr sucsheesdbulye,tahaadneIonfs3a0n0t3ic(iRpafa.te5)d. This productionvolumes. are summariziedn asking papers) The spphicationof lor this ae category s esumated tobe Table'. TABLE 5.--ANTICIPATED ANNUAL U.S. PRODUCTION VOLUME (POUNDS) FOR PFOS USE CATEGORIES Gre cares 20 2000 ES wa EaSSraiarararcmeapnavcocsarrmoanartmes m2pame0) o:Torso TYoSar i5o fo sa 191% "8% 5 cuAmceoctolrydianvgaitolbtlhee tionfEoPrAm,atMionis the SflesctmeadgubfyachtiusrepsroopfoPsRedOSSNchUeRmi(cRaelfs 1. 3`TaMsupailaacnis2buotrofedoClifostctaoeen3tci.hneu(mei1tcghaoelassrield.attfhioesed sPe0op5ce0iraapaerodtteowcidttiihsoncsouwnrtoaicaeueesetshtehtecawheatmdiaocfanl|ds SdeenanrialedboisnsTaabslseac3ionfedUnwiitthLA (is Berraromanrceachemical plsiocpatlicoanso]nbbyy VP.rOobpjoescetdivReuslaend Rationaleforthis aIn mdetaercminringiwnhatewoBunclhdecmonisctaitlute substancesthatare the subjects of this stsshlseeosvciuaibaetrdainncfeoswirh .mlaitpkoietoelnnytoeinaxlpthouessuetrsoexsicity of {sionufrocremsa.tiaonnd prothve ifdoeurdbfayctionrsdulsitsrteyd in TSuCsAedsecotniohneSss42co)ns1id2edraUtniiotnsL.8.EPA. wObajnetcstitvoesacwhiitehveretghardfotlolhoweinsgignificant Rew ses hat areCosignated in his phraotposed rule. EPA wants 0 easure elxlitmafnruofmatchteurmearokfeth,oEsePAchboemliiceavless that per1s.onE'sPAiwnoteunltdtoremcaemiuvfancottuicceeoofraimyport lciokneclyerwnieldctahaste.maHmouwfeavcetru,seEcPoAul1d2 be B3RgOniSficchuentmiScealws0forbaedfeosrigtnhaatteSdVity iOnpiPtOiRaAtYeiYd10thsevarluuaet,e aanaddcwoanntotls.h1e beg5insE.PA would have an opportunity to raview and avaluate dats submited 12a hthot apcye. pThoe nnotsiceohatc would d be _foquirod by the SNUR would provide SbeNgUiaNs bmeafnourfeacthteurnionigcoersiumbmpiotRtienrg th+e EacPuAviwtitehs atshseocOipaptoerdtuwniittyhatosiegvnailfuicaatnet SuSEbgjReIcfntcacahitameidcwalbuseseua.bbslteantcoersefguol3rae naunpespweowrusstoeuns4ai5bylpetroosppkorsos.teedfctahaeagr.iensFsotamad4a pmrposoprecatsivoefmtahnufsuabcjteucrtecrhseamaidcal Soxnpotsirs to the substances which could socicubras.sceproavifderd ssuchfregutlatioonwis| se IMGiavreencuhrartenntglycompapnroiduceinsg tthbe an r JAnEECT 0 TER secon ci hemicalselieedsc an Tabele 3or f Unit sLaAd as concernsregarding the tory smvronment associated wi BCnlhotaucmsci,ccpthrsaolipbobsaedagSpeoNstUehnRtaitaIliMo.sfttihhneeclsouldsed tlnhaiwkGemolasyntutsfhaeacvtocucortmiepnadgncwiaiepsahcwisoteuylafdolriihnencsugre MTiaintuefdacSttautrese,ofnasecsheoscehn avomluiatcaiarnilltyhseto discontinue their manufacture and sale CEhpPeuAmrsiwucaianlltsu[0isnetha(eafnorvrtemaoadtatotiroeoynrsUupribdmsaittmeiaeRrdukleet omarnsauulbfsatucatsnutoriaeblylfoyDrretechdieurcmembhoe3esr1i.wi30d0e3s.prnedad 4p[8r0otdhCueFcvRtpeionantrvto7hl1au0t1mhetesoprhofaacstkehe-hsoeeucthoefmihceasles use byDacomba3r1. 2000. Wh nfs checaicalsdoesno progress as [LL 02028 Federal Register/Vol. 65. No_ 202 Wadoesdsy, October 18. 3000, 2roposed Salas odESeiyscprbpiruboerdpursiseGhSiuHnLdooprmro)TpoSTsCeAdAEcsAinoarcCPiscAi4.on shphsoatwsoeuc-saosuetodfowfBnahssossaemnyoCwhaAamRnieceldss Bfsoiunsmaiotan aftohrleslsoccwninihstemsptvossuiublirsanhecipecr aodce pVe 1 Aloraatives SCEeiodnarsrdmhipiisdiodocyioSanhcsaodnpurse RLmoiupoerninycSiaimdyise.amdmdueto viisnpmyooraseas roy propBosSsUiRaEgA prope Sea oni and BCiotpilaacyhasctoagdsiforTatbhleecshaemnidcalof VUsIeLsAcpcuprrilagiBoacffoPrasrobposledlRuyleto Sinld meechWanisSuc stPudiehs,aBascaeuosfthe UBCSnaoiutnthemcLaAia.tnioIocnnthaodsdmiruiteiceqolunti.rsmuEebnPtrFsAaenddceeetsrerammined cDGaiEteeaPgAonf brSliaaoiviues)athgsatot28m3hSesgirAnmtReCenAtdStotfyTdSoCwA B`rSsopceocsninfsiacgaecsonscSEneWrddUnbsNiStoshsauectboEmluPurBeAmrahslagEstooEfnorpwtrhoeen.ds STCoaSSnH EmoiomcafUauclnahioniv1ct8t4.es CUstovvmoniecdgaiTldTSaMpaCabAecalsiroaSccsrito2n anhinarsrohlf.ahLef vfprsopbGooosgalfdeaatceotrofPtdUheaSLSEoUAfEtRhO.eR oftheproposed SwNareU considRered. oEmerusmhnaet,donavaoncsanoevrirhoelmamsaunatdlgFotearnd pti content (log Pr. log of ton 3{i0on)wphloerh.teEyfPolrAamtaceotduilo1d9nSrtoeHhnwAAaBnGVyRpEYose b31oo0cnHcuthlemirf,oeraaEebPaeAtrtbthsoanncusaebws4, 0wSoNrUuoRlnd Kaaoci)s:gebiinsoecnnonocsedbnsoteiirnopgniPiocmor,nr(VhABcpCeeRnF.t 10g E ai{dpooSiroo tftehGdyaistnuo[tbisAsanaTprociorsptoshteedesdgGia1fmrcTaoa1nbt3tlseee2sw cphorluolpdbosodecadufngtsaAthielnStN5UdaRtwbhyeusLs1i5ua0ftoBanbtoe Daur omoly" B0orddeastgtryeu,atAHieLonRnr).y'bsaouLminavsEngonnteso,xndacon Squib caron lov lf EGE 1) `TEesPetcAtuaitovonart8(mao)eorvanththoeurmtahlBanrnptSnNrdUaReraumothsoroeirty mSpglPnoeipirioscroaemnndstSwsiYhaoUx'wRcuhspassorcsnooomFvmdepOrircoSoihapilosorahse S`oofmmousdgesllsi(-Reenfa.sgd10c)ep.aonHytoo2onwge5avplecorFt.oekc.noymtFporlreotninonnsof a{vsnasoonmceicdateaetsdswtsiotd.hotfhyecaewawcsiuossensoutfontdahkeesse bPaerfs5oorpnushbewlihasohfceoedscsmveuedsdtatshttooosopefhaiacetviIntaCelsYlw)ioll mwSouaupylmdduetbmiodfnwstihrooawtsctohsnaetceessnomcp&iiaaSytieUndgRNeatk ETboSiRnttacnotfiadoudnitt(i0otnhofSasPcchAivimotanyybSea0foot1r0e i hrhoaaqvuenr.ovimcmeeenevttsiaeallawdSpVweUariRiodun.aomiccletuhdeoiangdlolf SrsFeycAtwimoinalySlai)knecrsceiaohsneubkearhToSoCdAhar oScaeeilrvslbuypsionrestseaas:.mbnpefcofaruomsamnttiThoSonsCehAoAsrmcmhson eSLxcottwovnia1ieosnBsdo.oetnfego,arntepnoo4gdr5usgoAinaGdwRhaIoCaAbaByoaao SwiNEtUhPNthoeonArcgoyvuaracogyfebsheypfeoPrrsRoOFnSsubtboircEaoSncsguelts SEPiAbp'osEraainncnsegcorewass5etthouttehseisrncLhboaemeviiwcnagslot|fh|o tcphroeomspmeoescrahclaimaailncdmaLueinbufsecacnntrcieevesordbatrempoooffshioehfe| CeAosupdpaultaaoifToinh,liseAdopotxwiTioalnbpsleeeuaosofsiUcstpsecLiAf.ic iSpnbeporosmspcoau1deefdpupoleantdtitnhgaeshdeesoubsuiarcdes cS5oUm5Rpl)mioanmocstesheeccopodnlodfietndioantws4oi0faCldFvRia+ ce ohssvutalmduiasttciasbtiogalnniivfcieecsasnatraoanosdeeadacvaeisnoetftth1ooe h{SaiRrrlboTerSmiCioen SSdhoeuLdcnoenoABgStt)GoUucRlyCIbfAeoLrtooeivsee Caonqndamredetoohraveiaetathcrifisna.l SNR. smiuoabmlvissebreoTndoonvtooegpesadelanecctcimoonrudofitsnegstoto ltho SCEhPioAc'anadinnhteocChbeiwmeoicucilavdesausbostmanceesa VseIcLoATner,otcpDogeeierzasensodanOstthathae0r eunbqdaruoismdeTno . dSFot30aE mnaydiraaeo4srDtCdriPnsRyEpaArsRt7nr9d2i?nFagiltuhraetto unlSidesetgerdue3TSwTCaaAdbleesrseTc2St3CinoAd8nsSeCocPfAoUnNmuL6sLftA|h.ere dsreavueeblodip dmoan3iylySipNA0nUriNSgc,uubaRasatttoees.4dp4arstbo5enashrasreee sr42su4sbopnmuaibbtslydas htealathmamaphslfebiicchaiueeionintso1oaffotcosse 5hi%oenascsoiomnacbilin bcuoLsimmpfeoocrronpwcoalceuedonernhsa.t pLsasoycsesomeasniinoandbaolfeabcyokntathroeonlma0(n1d5 tUoSedCess.ocnriabley CphrEoavPiiAcdaegl ssdeuvbuSiseuUdmRiensfbormattiosn o5 human mGpaiortsersaseloon"ifpbrnesceihnnatksmoiofcrmlwiarllbtsparteonscoennutomre4aa h3e5aH0lo4twh)e:vaen4rd0.eCinaFvivRrio7en2w1moef2n9t)hael apoktseapioasled wsSoomduclisdpqravreresodnttmooerncteollupdEoronemiateshosenstaiabgtblmRyecant cdSiesaiisoinorsbhyetmhaaevusiiooaencmtmuuemnauatigacGtteeusrnseriIheM 0 ScabhyeimhiTecgaaitalsduobbsftUalnnctoeseLwtAuosdeEsPoaAfTrheaqbouleest2s as3ntedeadtsion 7Tf2a1b.tlh9e5023cahonefdmtiThceaalpbruo3blpomoefasneUdcetsLA. CorFhsoeiacatalx,EsPiaAnagcdophontucelsnutd0iaeldreramkovwmehtkihcehbtuhlky tdohavattaatpaointteonnwtiooaufllSdkNpaUoNprostsueadbarbyetsetheseesadeclude rppeoegtrueslnoatntiisao1ln0.bIsaeuadbsdiitoiifontfnho.ersEmeaPtcAihosennmcoiocnuarlngss F5iinapgpareboaapebonlstyedsncoStiNonUneRucnwdieelrsaTlaSoChwAioscntcmieo.n CCinuhtremanadlemyd ssbugebnessvthaecnsacnettsawtwhtwhenuksuensoeEdwPnAo.rora CpSuoobsmseptdaargbecyedshtedosakedcsnhieopmroimscaeatdlibosyunbposotnsaanscikebsse | Ageaty 10 addres he potoail rks essondble asconaiaable results of he subsite. 069d | FederalRegister Vol 65. No_ 202 Wednesday. October 19. 2000 Proposed Rules 52320 SE EconAomieCorse tens ecoyns S rHnIsTpSrS ocecopa peTde tmilbeansapasy aselm mned Hsbimobilsteio2snaopfdSoTaNbtla O3stofhNeaUansitpsdoLrAe mmcene], woul o ceauired forthe fst export to. $333 for she est rn Ltan exporter SE Serena aren information les maintained in the abined as dascibed imCon183 srecitioonni12(bb).sanndd thed. vdelvpemleonptsooff S TTytan den Ppe omtaacesSulfhoenaEtend ver UFsnoluefsscal tihaotncroEa emqpuiaArneymednetesc.idaethsoetsnoencpouern,ssue oJmuu"brimEeyq1bu+Noe4aTtT9SGCexAS4p0oCsret0nsIismSo1aiftIice9aotih)an A|L 3Mo. StFhrr Pyauil MN.e oMTr ahc0eh s1,Se20r0v 0.o, aEesvuss E Sf ompies at wiy l Blethese Sotces pSeorf e Eo entFg o aoSau pBeeicobnfeuancoeuurteasirntnieeSs eNlatedtteo FLpareArer ETPAeExpSechatTttshe oi tal ost,Sy PaAul2,2M0N0.5J2a0nu)arFy2o1t.c16b9e9m.ind Ue `oStNlaUllRba.ennsEuuPabAlmiicstoseutndoafbalsceaortomescpuallltciouflatawnthieicttshheethe 1S12053x) 0Pi1arlieTlnEbc,eeTliiwimtehiTStdCeAbBdaassseeecddtooinnon|hBifosrticoarlical 0si. 5.ppaaRunilct,e,wMiNCo..dySM.iaDys2oam6ee.sat19is9c0. 2M cfinoalsrtule.forHopwreovpear.raEtPiA4onendstSimUaDtIesSSthOatN. oSSfa iS3NUnN0raingeTss rSaom apEproxiEmatelpya PuShrooOmcmcuRcomnumeiofnnisoccefrnacwpcoihateahbmmiuAilusnspirteeoicadaaestnsabndodstnhhe yelilimited `SMGeaPnmPuniTf(c/aeAaEcRlEtausTatDOee.tr-hsgWea0orsr0hT0uihnawmgniapopnSop.M.nrDoeUCt.fSePwEAFPriuOAgSls!u.set Seahna3u0nmiRloitonLaerbioSog. mpamraofteeischSeURmoriecxplesr|only. proaducve. o3,FSeta.PfaourlFMTV. uryed7. r1ed d0ucdedluosweo rfe oeocfo o$o1r f0sS0.HsUwNita hwshichR 1aFsshoecsiieacteodgmwipitahohneixepaspordtecsiadnetodtc1iaf0ditcoa9tni8o0ne4ev2nv.en *2py%7t0e,rcsoma, 5y. a,n.d DCioGwuaaCnFr.iEvaluating SR e sRubmSite edTone 2SaOnonuanbaSsyTs GEPA nSSmetobtemiwneot,lsfwtosuSnldndaisbmipcaacncaotenmeptlemteouan ss EpoPib AntLiSal wTiipTEeovCiEtoinoimeenntlasl )FGaeiTofa oha aVcaSroi0e0tsynofd CT RRC required to suabSNm UNi fortthe rag Pe 1996. Vol. nie an 15. No. 9. pp. 1627-1637. mthaantucfoacmtpuarneyofdeicmipdoerstattoiboengitnhose cerItnaiUnnittesVtsILt.hatEPSANUhaNs siudbemnititftieerds may FeriluioormoooncittaonreiSnuglDfaotnaatoen--PFOS, CcUEihecmiocoaSlsm.nAnsdaopm ayunSreabsulept.dhnaiEm PciiA Bdexerpa,eEecrtRss nthat SSCGchhhuomooistimseeaetdoisdcf5boeensadsaguonatcfcktsehsstposph oaosunsoiddsst ts EoPhyAneiessnrof|nom PUSo3E,PhA3/E,iPeA2V/0na0R0AR.D1g.o.u2W0as0so0himanegtofon. DC.St fGrreitors meus SVU. SShahsnjror hsee terAo 8 se10nCioolrddsnaucanbee udn te B EwaxhpgorretdNoitmifUicnatiIon perp who eet spoToaalfNUR $r tmeiks"ltbAblEayotnoftnohreoihnaho oalati 2-isopnecireosut tcReat or(cRhienfLo.ogr S1e3n)C.i,cRit.y SFOSEeaPrieTe.sS83H5.saFaaLrtel.mTeeraoTnsesnpsarotriGtouiAzndnedleinTedhsie,se nEeFoiitdEonSs SeuCsARpoenRahSIovloaEBahnRar SSuE(panecmioeesmsBswnwnniilBlcpoencdoetndauetcsdtS0erN,e PETDEEFAL(pWooarndalpWdaie epocWbvuacmbeeino imtem)UBgnnet0e? | unmofe aacetd mrnoCP Myoaweo BBe eaoeecam0e metTE arases om he lI eivees han ot msonasotnarcgoi mpaneiSerosinca ngomgptl)iyiees, kS likylytooR crceateaE SgmihceaB ntSaadRvdersee. a rUeS. Goeon venrn3m1sessnNttoPAhrrsincaCtilnadignOgfkfiBceipd p CiB feaChnerco kredpteo St oahftshmnea dRcehermiarcln avll oars U+nXT.doRenesfeersepfnkcaescrceomsapheaamvibeevrnOhFoeFdS.in S cfSopviees.fte TihfeEoEmAGm Ctemodea l isCavoan irabnleyor r om eae m SF, motos, OAT ls dOomT SkIaT)ASRaaneccoono7w5 Cesfcuaenfor 00OVE" 62330 FoderalRegister Vol. 65. No. 202/ Wednesday Occher 19. 2000 roponed ules ES0x7i2stiAngRC0h20o03n5u8-s0a(0i0an)da(TgCSeRC)A1S1e8c.t0i6o,n OMB 125) _ GSTuaaikddieAnlgisvn"essasfuornidtohfuedUEanvaeaalaunttahcteiicoEpnxueeaocfdutRiivsek oSarauNdmUvbReorrissoefslosytmasImlxacploscptieSdeus0bbTsehAissiBginLiofnicaalnte (N1C5o7au9h5ni3a0d.toOn oVfChNeom.i2c0a7l0-E0x8p3a0ts ER oco"niFsoesiastceitoonndsooefsSAaoMtEOavRaRlATsApIecIiAaClS (aormrAadbmvaionvaceapacrioyovinbdefd toSthoelCiSeesiCoounmiet TCeTSnSgKieRCnE.eFcOCooPTmdEymE.eETnEDdx,etdmWaaftsoheidPoCRgoOtnoStna,SoNfDUC.R. Olarddaderrde1s1si8sEs9nu8veisrsoosnnlmreendetaFlqedaebrusYaleEeAxecicenuu+toindvse,10 p"eecpgevuccaouriodaniiAonvcdgyOhPReAe)P4apF4ueprUewrSouoCrkkaso1 ! July 2. 3500. inomPopsontdLaawrcosme So0, WRTBY Sel condue er X1 Regultory Assesment Popula(5t9FiRo76n2s9. Febrary 16. pind io colsofciliorohavnon | ReqUuinrdeemeBnatscar Order 3365, eRntoitnleedRenguClaOtoTrySPlaSnnoinlgearndven. O"eThisSactsion sis enotdsuBbjeoctctoaExecutive CB hildrenfrSoi m EnBviAroLnmeG ntal Henaeltsh PLiRa,A2ua5nes% OebMatBsbaopprodvpaplruovnedde the OCvipL42C9 displays Tchurentlyaolind iyf i a oteOaffiseicgenioffir canMtarneaa gguleamteoat rnnytadctioe Bun" SAspcrriiolln2D3s.s du19e97l).apbbee yExc nectuhattiisvu ipesOnos rodoteeraen W 4E24S1ST 8 1dSdoritU onEPAtotshdislplaaytentc.oanayo | subject to review by OMB. because 12866. and this action does oot address 2'a err In instrument, ase listec SNSSoNBRgUaiRs:osendSd3t0o0a0taEfeotPleAmoec3eEat,oxxetapcheauerdticirsiviateoceOereriwadieitnrh past Seinsvp1nhirroaodpvndaimrtaeuinootnna.caltsiehhnlecayelmattfhhcioSsirnuAJagcfdteroysnmdckhoimlesdrseen,efont frAeeTqvduh9iearienbmfeoonrptamusranpetsli,paotnrecdootlroleetchtdOiisoNbnaGcytion have SSBoaevuesermdlioenyemaraetkassihooansgvesioGaoonkeclbiSeevPvaeAGidmoupnatsctaaeotd|by T(1r3Naan)TsioAerf)ataPduNAbadltivioaLnnascweTme0ec4n-ht1a1lA3oc,rgays[ec1u9o9n5 po11uu6m8rb0o6sr).u2la0To7in0hs-ts0a0Pc3R8cAo(uEnddPoaAsOs(CaMoRtBNioa.pcoonsterol S{phuetTeodcabyohmsilleagosvienrngmeAnst uwlclhba EPRhas determined tat 1 epulaory 413p00p)lt(y1oPu3r.shuanits5t.eeCc.it2ni7o3nn6o0e)5.d)onosfsthoe + S4Sp0UprbNouvar1ld0eitnfheraAgeauanicyyn. wsthadieaotnonsslsubObmMuirBtden Scveioowntmedisoshnasvoear ysaoyipnAoteucnatdoyodnemSamnandlalt+eo. "or RUcaSerCig.eis60at1haetFrperqio)m.ullhgeuAiAogRnenoEcfyhAihseSrSebNyUR_ asouaimo1a1t8e.dd03 phtoooursrttoaprocargeoesmbpooafnbbseestsw1e83e.3n5.8 aOUFovncorodanmoasntV2s0is2du.2ba0c5rt 11R0o4tfhooerrmre3Aq0cu8tiorofeftmh1ee9n.9t5s Swniculrolanbaoeomrtibocfaivsmeplalcstisg8nail8iiecnaM,nbtAAaadSvtNeArUlsRe b$u5nr,od0od5ea7ndae1nsdirme8av7ti.ee49wn2bipniosurrduSecsNitUohnNes.,iTmsheieasrch (hUelMeRiAnlYe(.rPaubtolhiticsafLcoawopno10t14sc3oa)n0suslutbalieocnt to oS1f raomgyfess0ieaaiebyti]pdeerwsschoronibi(enadtce1nhadihsne(g6u9ls0me8a14l8l0 Cmsoampiwentted,iatrhaeesvndoiuaerwacg4ensne.depduerde.btaandnhde o Llpuecidn edCionEnreaxltogenovacOenrrddmueCeront1ot3i0one8s4s.ion 3tf"nosorvgminaoirthdicoaannstc.unrsaewanatdsye:baavsaBeiydabdnleaeRin0liiEoPAn.o|f rnDeuqruduiernedbstSiiiegmaiesRaqcuidnonetndsneawoctowriednsca.ToiHhces1.haoudr nSrehhssiniiaonnT1o0bo30l0G8a )ovNoerdrwemtioan8nf3tcFsRon Sites no ebobondsbosteunha" CSpUueRabsmabnuaoargoeoimSamrsaulelcho a[cArhsgeoat.SpSUaiEniccSea BOIkons 10 SagRge in Such SEL ocShfnyeSeUht3ai0eEc0ailouboafsemUoefqodRae Fro4esr.du3e0bofmpsociruosBstsonoimtooeFrn opoE ennSsoivbaice samsenotnapevnheinSoddeuss or ba sovermment s spoced in IbmphamectrwniilevmBeudstAocBeiussoumoomnltyommEiPeAcO(n SkNesenSd41s39a1my00ocTosompesurassmamdsoeso swstielsosh los dec0eingalgeaethsose action As, Sond BYcommebnoutthse | EFTaoecourtiavslOrodAaFR131552,8saAiuedg i0, septlaoudmm0a0rm3ydesbtilone.drinsmcsibsoymantatihbeiipdeaetorsoonn S22ePco0uMdS)eEaoBtf btuerobduenr.dem Lnaecsutdimiaas tge sod aassaeuybiebnevgontiasndprTmoppeousO erdyu.l.U mEiPmAizhaes sS Altuhobh ugmhisha onmeeSisUol maNgl tchao attehsemmpaoyems 1L 3 rgDeS uiioormS CsadlceSeaolneC SceioS gn, PFeriimenciinTbdypusssetcooFonnts3oaodfEdSxrcoenocdneudstecOihensvot.oer dthoouwi,naafEoyFcAoancdnauvnc.ttmthpuercrehesamencatuylvybidoioseEoPmtAi'hnsee DSeiLncoorna2tO8,of2n2c,)e1So2afE0vP8ioovaamierartaoannPrmoaetencAtaioln RT548L07H5:8ahanstFieciboemrdpuCiailrey7d.Fws1it2tc5he0ExReecfuotrivme(61 Sm (hexApgg eencmytna odscaastraeocfieofivtvheradtif3en0weorstphoOamRnsSe15to euvigeswe1o0s42biaccoomhDeefCsp2iho0eOn4od8Me0nnEceP.lCbeoutwnds|eeo, OSCrodenecnuruss1o2on6cn3l0dl.yeengtfirrlneodeccGeeoevdiePrrnompeenrtsayl SSfuNocUnkNeEspB.eAOuferthxospoe teSooNcrUmeNtcsimvsselubomeiwtm.tieda..48.a 295Submit List of Sl 4a compl Fe{hxiisimpirngo5ipn3aghFsteRhdte8f4kl3sie9o,igsMsaacricmcpohlrid1c5aa.nt1cie9on8wsi8tO)hfb.y STshNaeUtrNeefGsorfia,reoE3PpeAoanbeesleiLe0avregnsoytoartSs.NUathRle. AHiakEzoaavrSiidkfzeostounsmemnattaal2slP4sr,oOteRceCtciofEornad,sRitCehoe5pm2ii1caasls, Lie FACrany Generals Supplements] scomomie impact of complyiog witha aad reporiag requirement. coands a ETH i creer William H. Sunes. 02 1. The authoritycitationforpart 721 a)Chemical substances and Taemes stan cr os 0c Wa H Lee TTw iaber sa adoof ttsp poapgnertt Tate 1 CHemcaL Ream SOMCAT NEw USE ROTEE O on AMER nr 1. 2301 | EE Taste |A a r NemCo owcRw m Eenda ecren mcua nAa T bmoe ar Te IT 2EaA rttmLM 2eror rsLcATe e EEtO at R essvacnsna pe snc Snes lm ErIe evs ent, oieng Zid |Rr E JEEr Em nE LAr Ta A AS TEE p ATE]Ne eINEarer resreeee,ntti 7 | E2 a E ohSmEL E ET e T Lomeoemy n,i 2 | E e Ea eSERe E EETR LISaEaussar eoeCtC Es arr s or :: otuiols arreree Et R e e, LtL ER oIe a GSETdEr stagne, HrTae reoaews m 1et5eti taeye es | ee = 3 TRE I mrt E So A I n s ERrt LomIo aLm. armirns Ie, sBSsRLs ene ||{S r E SEIe aZEE taDT eER L oopeT porerpbroI C sseeparrtyrseyrtorisnmeot rte R J HSER AnemStee mn H s T e e ee c m msr eSee te rtyl sHaErEa pan |||SnSmneSmtIOCSeESIAreFBeA oEncepv,oSaoernern.e,sBsToireaT ses ecoL oerruatres tans ranron He E iae aruSroea,,TTeLotomEdEranst SerpnrcteydnSok oR & 6202 me Federal Register Vol. 65. No 202/Wadnesday. October 18. 2000.ProposeA d Rulesve TABLE 1, --CHEMICALS HEQUIRING A SGNFICANT NEW USE NOTICE ON OR AFTER JANUARY 1, 2001--Continued Cas on Nm Gotecive nces crameat rama Fai CPrfeEoptamneostt15a6.mSsharaon 2armom$3a23n42AmeiSRnETS61s7o7ySpmEerewinh |s1RmEeaImarevoo estdoseon scypaneacaroaetrisaneerlI0du133. manson SCoSmpanEwiSmaIsnTaiSne cetor Niven sem. resin sos wn 12ers 3 100 1. 000795 Poucss 1SuaSoltmiaamdmayeancnaemgGoaLybmnaannayneaa,remopeaorncreE,.ZNmaaTAiNPnYyGGhRo1AoNp-)e,n0yxofn0la-eny2.pSrooddusct.s wih darytnesane poymers win 8a acta. and Bu S07 2PrCeemnacoo yealsBm an1.SS3m imoapAina epdaeltSoarnmssCaSoodvIaapxayniasceu.irc4ncy.aSnaNaaytaeyT wayhcoa2lnesoicnnpaetduoo:1Cmoeyabkeanratseunieon,2aammie2s P.54-2205...._ PoSomanac.TenydoannaasaNnegAhTaYnAyAaSn:sTsaorcyoannyaetey)a1n-CBAs.C4BCOpgarhoaunRyamneeNsaanieonreaamctnion prods wih 2hexan, 25a Paezaos Ps6-less FSaitrynaamecsspaCalorunSraksaan.es.sdihmyeGrtsk.a,n2ymMiaoemNmhIolAloa2mmmyaicTCaeot1Soe0.1u5R0d2sSa0el0aoaynmmToammaarsmORUaSsHtoerm.nald. SoYTArS wi 2 a Pascast zaoomaacns.ca. Nac bun esr, dram coymars Sn win 112235445 568775.8BhepadecaCteuaroarswih acriamcde, 2{mePy(paarkisoonyrlasme-ciCamy sciae 3c an 381272... 2Pc robeno oe aua d Zev.aHeinmeraovnsiiPperoovoeyr esBe.epoymmearrscswune.scTiria0e.s2{omnemsye{teriwuhon.Ca3: .90-0188 Harare 1Sasian. nemepomer. NAPYHSRYOY ma pau CA-&-akare storie: ans Ses 99-0019 |P"oSytaony1a2enmasnoandey.. sone {2{manyameslanyl omega{1.133 erametionanon. Ni(perueroCed: TABLE 2.--CHEMCALS SUB`JSEICGTuF1C0ANVTOLNUeNwEUCS4E?NROETSITCREICOTNIOONRS OAFNTEORRJAAFNTUEARRJYA1N.U2A0R0Y31, 2001 AND REQUIRING A Ea NehGotcees caimcvasrs SSorreseerr 2BOrccaaapnamenesonscstaot0ny,fof2romcneed.m.111231a8mh323a4p2.4a535d86e37c784a898h5981iS05r1oe0rp5aaca6ecaa1u0t7rutamarr7omoensnysataotoerr- sToaes2armsar| {ToOeratcnioenanenssatmsoitnvoamnm,faoe3:4n{d1eac3u2c11e3c33a2t4u34a0r5o45o4c55y6i5s16u1t8o65ny8ls6raemecataptoerNas.itenre:ty ade Te TO6T5a I1E5Y|| OTTOCcciaenmenasisntano3sn.6oes. n|1 12a2232223330443443457568045878876h3hoe5p6p4a5a.dce87auc6epai7teur7a8so.scseoascNeuEtmsMaRYnAiTEYrOToY- RT17E12R30T721 GCioveemnnerNseiamntsooitpN3aamsi4otc31ah28so24ass3si4ae0ny8546c354o68Su886csEo5rni6esunaa8dsta7ee6caa7rt7ou:o7e:mmonumsat 2SL5O266E857s753 TT 2||oPCrcooasteminecnneetaannntdasamo2snn.{1 1h1e35p1 3a04s4 e5c56a0 6i7sou88m5 o6i4nr5hesnne4 eypopaaamdstee4 ecycciaaleneisaons5 sows.aasr5 Mmoosnu6 mosna6 tNe.m i1| B3SU1S15T05T6I38S2|11 bO1CaCovaianonenassuu2taaonvanarnaaeenady1.111a32p22n3a393{44a4s45v55i5665D76e7p7a7d85e8c8a53turnoeepnvaoaccdmyecscauatltooounroyr:Wumaamr:S:at megs Mycry: 33S0700356007i10z1337 1T|1T. CPpirroohpoeenpmaaamninansueim.o.neSN{S10{4ft,eocaacnheiycoaarcir)poeoNnceayfhdusruaolaoSrn4y1plSoasmsuNnaNlismoaetoraCaEornodHhea nSuclcraylacrinid. inner sak SS0i6l5 | democpuamamsnaaarsnacuetcaiatns6ueedsd.ro1 ne2s5n23su3o4rp4yea5m5po0c6al7es7m8te85cS.r9ao7p0ei.na1cti0s1oe0om,hasemrrwaocomoyocsoamlwyuaycsreo-baoaymvmeemrrownishamwsoemreinre G25wi0n0008.2. 8541-000 2Parhsicoennrcan2edsSoomrmerwiwhicharZinlaeTmpol3phrneoppasInAeGaanC1SAtoaRnnOAeIMAO:C0ISSTY 2memyt2 ropancste and ocadec 2 69555-30-0 2F(Prroarpseneearcsmacra. oburnt amesaattermr.yomipronoysmoeearcsruwhiony2oa2rr.{oa(pneeepnisoautdeeaciaat2uro{araorocaylmsuylopn]anrmceaomsmyanemscienaosanoisnmss2ooaHrrAopresncpaeine. 33 Sss6-1t 2[Preaomeynuanedacstuacorosanmp2a(shioempiaadmencciaotnoy!ro arnopeneoatsnamide ser warmer wh 2. (ETrmEsapmaeipnsiaone.any2.amegsoenocn2ssemchaabaisrrleoopa0oaxrn0m2eoorosoipyna}Sa2mre0l0ger(e o6Seo.mpaaTnyc1ma3al0la3npo1oRpSEeTe mAGooRosAnyyGr2rAanmPasceec. 32: 00978 fFeeddeerraall RReeggiisstteerrVVooll,653.,NNoo.,220022)(WWeeddnneessddaayv.,OOccttoobbeerr1918.. 22000000 PPrrooppoosseeddRRuulleess 6522333333 B TABLE 2 --CHEMCALSSGNSPUCBJAENCTT N7e0wVOULSUEMNEOCTIaCPEROESrTROIRCe TAIFOTNESROJrav0u%aRAYFT1E.R20J0A8N-U-ACRoYm1i, n2o0e0d1 And REGUANG x oa Gsreemrn C_ ra menonEi_ 3na3n4NyaT_ reair3aab9eMemi3maleeC4omtm4esre8r5ssoevrweea 5sooammmaoa6nnnonTar82ors2e3a 73. 3 7Ie O8I, A[oEoASnRoSP5aE5Sn8 17oh sor 2EoiraamsTaarresisrraeserneamaoe ens cryeg slteaaseSa esItToaS 0ngyMeaeaFnOOaA ss, pobo mo ar we in. reeermeasnceacatuccoonystamornoerastos 2aanoetnoonns sannoAo:n 1.9502 com arSemn maPonrgs: sors 2eia eiesnemneoraapacornseansa2soaotnmmm.esoAmots2taanmaymyaSeooaScbmemcoase tuaosnoeenpac.Bryautteo,OnasmorcaisesnymhSmaaaso.rEpoimmpaetrameawn n32. sora crriemoemoesmmaamamyaaahnii2earracesceh)mu ay ppchcatorooc ute Bao K3098.0 KSPR:ma FE soTrEa dpTeonenesnSseamraasanectS 2on5tmm{2aaammmaymohoaslaoa smetc"ir2ssorccsyvasrrcaire,yiunLCg aircmlaermaVonynEo smhT aogpaomoa astoA omnm:ie, raa1tion Hosancee SE omparsieniorosyaeryiamnaaty Yomi: 5i 1 nnTasSnaAmataRmnorciaaroe av1mai1ns1o m32c2ea0easot4tter84st noe.s5arco 5eSecmit6timos5hNeeoE7ypeaao.tmm7orms8aNe.ceTn8iLri.n5ico4naoSa.mneer S78. SuSNJ lheemnamna,sscCayTaSnthS eatr7aad. NsaN.na soa onnammfh 5ay(,1t05n0L2reoPsaaR) oPxyF.esr S oervroimh2aabrE ys art, 12700505. LIS. 2+SFriSrheaaennoonan,ecaSmEaC1tacD2haoly3oeaetse0psycmh4aorro e4+s8hErZn5est3.sAEt4aayar6ne(aP7batpaPcyaFrBehtssooposyeonhaoSnaenson Nc: Zn3 P23a00n18s5. |e LL TSurakiisoasarmsireaesteeCuLssGnSaetkaoanmns.sopceSirnsoi,amvneaiscsolomboemmrar3mwehrrh oo,epesaicoivoens.oa 2c1Ciambmw(hdasrea csencalaommsaenynaan101 P25A00I11S1 Pats FBSo uroiononrhCSetmaCsLaonsarsaaSaksaaars.em.SohpnaGteewarer,dNoasmeeem.s Coo(nm3yaccawsyanheeyNsycxcoSr<1uy8smzaos)ke-iymurnmaeanainayam]idne., 2yma mam {meiypercCrLo Pp235Ra01Ei20 ISSce hsUumeeCa rscCCoa8 asm Sannmeea.apaaLameyasmayhNcaIoHmmoeocasc)rlweTonrmapuomsnyhaisemnyaenwreoos aesn) aoooo sn3oSw mherb seeosnmamr aAeCnaLeEe sar am)vaove:er s 25018 SRiariyaCenhuokacrarpeerWsei3sGmatonmoaoo assum sats a(se(12)oAfTnhayaeymsCihgineimfiinccaanlutTafooefwduiumTspceaosbrautlwf:eosraaaefy (acgh4ge1rm)eigcafattlesivsloilsstueecmdteiionnfoTr0aalblecofe2ofshpseasosfeagraph ianny(Tia)belAoenf2ysommfaypnaourffataghrccauprhhee(orm1i)impcoofiarhtslsefsodr {Braesahms(41. 12o)0f0t1his secon omar| Cpheresmoincapalrocfal1e.n1d00a.r0y0e0sspoounnodrshpaerr Sc(i0o(nReosneorrveade Jaguar 1.2000. (i)Any manufacture or import for [38485 1. 00142dbefor A3uAry1. (7 Oo. 00-2671 Filed 10-17-00.0454 anyuse ofany one or moorftehe 2003. oun COO saaoto-s oan 000730 "124 (028 On VUALI bEIEC ML 00/60/10 Public Service District --_-- es M. Cox, Manager Jarses M, Gx, Mariage TeFlaecpehmolnee ((330044)) 886633-33739411 Dear Lubeck PSD Customers P.0. Box 700, Washington, West Virginia 26181-0700 October 31, 2000 CouMiSSIONERS: JamesE. Smith, Chairman LDoavsi"d0D%. SJtoehenlsea,nS,ecTrreetaasruyrer In compliancewiththe Safe Drinking Water Act Amendments and the West Virginia Bureau for Public Health, Lubeck Public Service District (LPSD) must provide our customers with an annual water quality report, which was done in an advertisement in The Parkersburg News and The Parkersburg. Sentinel on July 1, 2000. In order to insure that tap water is safe to drink, the U. S. Environmental Protection Agency (EPA) prescribes regulations which limit the amount of certain contaminants in water provided by public water systems The presenceof those contaminants LPSD routinely monitors your drinking water does not necessarily according to Federal indicate that water poses a health and State laws. The July 1, 2000 risk. advertisement provided the results of monitoring for regulated contaminants. `manufacturer, the 3M Company. An unregulated chemical for which LPSD has monitoring data is ammonium perfluorooctanoate (also knownasPFOA, APFO, FC-143, and C-8), which is used at DuPont Washington Works. Amention has recently been focused on PFOA because it is one of several products being phased out by its have bePenFOexApoisseadpetrosiit.steDnutPcohnetmirceaplortthsatthiastsilt ohwastotobxeiceolliomgiincaatleadnfdreopmitdheemibollooogdicsatlrdeaatmaotfopseuoppploerwtho confidence that exposure guidelines established by DuPont are protective of human health. Although PFOA is unregulatedfor regulatory agency), the DuPont Company drinking water has established purposes (that is, it has its own drinking water no limit established by guideline of | part per a dbirlilnikoni.ngTwhaeteDruaPoWnatsChoinmgptaonnyWhoarskasdv(i0.s2edptahrtesDipsetrrbiicltlitohna,tolropwpbc,onacsenotfrAautigoinssth2a0v0e0)beaenndfionutnhde iLnPSD wells (0.2, 0.5, and 0.1 ppb, also asof August 2000). These levels are below the DuPont. guideline and DuPont hasadvised the District that it is confident these levels are safe. LPSD is committed to providing safe water to our customers. If you have any questions, you can reach the District at 863-3341 or Dawn Jackson at DuPont at 863-2513. cerely, m. Ga JameasgeMr. Cox. 0 vs SNIINTNd ACESS aIS ean an evizsasee eziot eaazise TC 000727 12s WALLS ISS BAAN MEDIAL CU CE UC ': \ EE I ve P Graigrams.T AiPEuTSTOsKWORKINGE GROUR P Ooscplon CONFERENCE CALLTIST Members: D`aRpevteiir tlFhoaomrfomredC@eFoevecnce.com 0% 2 a.a736 CE0l1c1o-4m4be1-0D2u8n.d5e1e5--1(40811-44-1362.889 SbMinadgr-Hoorscghos(01145.6190.807-354 o(SCo01io1m-ne35n.:0a V44eA5.sr0a6na3-847) oGleinnnnaDisayki-AnDuTp$eo1nT4t.Y(6350625.13506).5207) JO'Connor- Dupont(302-368-5503) a Adminiaration lsonacaSCooteMUS Karras VRaottdaornaacd.ans CorponaaMus Tooiewhodveiy Ves wow ews 4332299-.2333)0 , 0 2| g 1ST CLASS MAIL sp P. Thomford SsTC N YftG ucteSnt ADDLe .meeDIE STT .---- L Biespl p --_-- -- TOX FILE CLI 0304 ' Covance Laboratories MadisonW,I 009.2% MAY 19 1999 Receiv#e1d5 WLS I OE NEDA CU cE uC . wow nw May 19, 1999 To: APFO Sub-committee: APME From: Paul H. Lieder Anached is the preliminary analytical results for the animals at the end of the dosing phase of the study. One animal in the low dose group died during the dosing phaseofthe study as did one high dose animal. In summary, the low dose and mid dose animals had similar serum and liver values. Three high dose animals became very sick during dosing and consequently dosing was terminated mid-study. The serum and liver PFOA levels from these animals appear to be much lower than the high dose animals still receiving compound, indicating a relatively (vs. humans) short half-life(?) The resultsofthe histopathology and hormone analysis will be sent by Peter "Thomford shortly. Regards, PHL ee. CLI 0305 Caan ey Se NAL CU GE UC won . 6 Month Capsule Toxicity Study wit APFO in Cynomolgus Monkeys Sera and Liver Analysis at Study Termination Preliminary Results: 18/5/99 Part 1: Serum Analysis Control Group 0mg/kg/da .D. Conc (ug/ml) nous 5709 0.393 5714 0.229 5715 0.099 5718 0.215 5719 0.322 5725 0.142 Average=0.233 Low Dose 3me/ke/da Conc (ug/ml) 5702 49.7 5706 66.9 5716 45.7 5721 41.7 5723 62.2 Average=54.5 Mid-high Dose 1Lm0De./kCeo/ndea(ug/ml) 55770078 3837..30 5709 49.4 5712 104 5717 81.0 5718 67.6 Average= 70.5 cones CLI 0306 : MAY. 19. 1999 8:44AM MEULLAL 2U Ce Ue MwOYILL fd High Dose 2010 30 mg/kg/da On dosing (receiving compound at end of 6 months) LD. Conc (ug/ml) 5703 60.8 5713 192 Average= 125 High Dose--Moribund-sacrificed mid-stady LD. Conc (ug/ml) 5724 403 High Dose-Recovery-removed from dosing mid-study due to toxicity 1D. Conc (ug/ml) 5703 7.76 5711 0.909 5722 6.90 Average=5.19 Part 2: Liver Analysis Control Group LD. CoOnmcg/(kugg/gd)a 5709 <MDL 5714 <MDL 5715 0.0474 5725 <MDL Average=0.0474 Low Dose 0 mg/ke/da 1D. Conc (ug/g) 5702 5.77 eet CLI 0307  ual inv Dea EVLA CCU CB UC [RITE 5706 6.81 5716 4.12 5723 6.80 Average=5.88 Mid-high Dose 0 me/kg/da 1D. Conc (ug/ml) 5707 8.7 5708 3.61 5709 5.64 5719 5.50 Average=536 High Dose 30--20mg/kg/da On Compound--receiving compound at endofstudy LD. Conc (ug/ml) 5704 8.03 A57v1e3ra2g8e3=172 High Dose-Recovery-removed from dosing mid-study due to toxicity LD. Conc (ug/ml) 5703 1.05 5711 0.0278 5722 1218 Average=0.766 5724 30.3 Moribund-sacrificed mid-study eu CLI 0308 126 000735 John L. Butenhof, al. DRAFT 12000 mTitle: ToxicitMyoonfkAemysmmafotneriTuwmenPteyr-fSliuxorWoeoectkasnooaftOer(alAPDFoOs)inign Cynomolgus Authors in sequence to be determined c: DRAFT July 28,2000 Q09ray EIDI01453 Page | John L. Butenhoff etal. DRAFT 112000 Abstract: `The purposeofthis study was to identify the earliest clinically measurable biological response from repeated daily exposure to ammonium perfluorooctancate (APFO) and to comelate this response to serum concentrations for purposesof isk assessment and medical monitoringofexposed populations. Groupsofmale Cypomolgus monkeys received daily doses of 0 (six per sex), 3 (four per sex), 10 (six per sex), or 30/20 (six per sex) mg/kg/day ammonium perfluorooctanoate for 26 weeks by gelatin capsule via gastric intubation. The high-dose group received 30 mg/kg for 11 days, afer which dosing was discontinued for ten days (through study dosing day 21) due to signsoffew feces, low food consumption and weight loss. Beginning on study dosing day 22, the high-dose group was given 20 mg/kg and remained on this dose through termination of the dosing phase with the exceptionofthree animals for which dosing was discontinued between days 43 and 81 due to emaciated appearance, weight loss, few or no feces and low or no food consumption. Two males in the control and mid-dose (10 mg/kg) group `were followed for ninety days after cessationofdosing and observed for reversibility, persistence,or delayed occurrence of toxic effects. One high-dose male was sacrificed in `moribund condition on day 29 ater exhibiting hypoactivity, body cold to the touch, few feces, lowor no food consumption and weight loss. One low-dose male was sacrificed in `moribund condition on day 137afterexhibiting limited use and paralysisofthe hind limbs, ataxic and hypoactive behavior, few feces and no food consumption. There were no effects on estrone, estradiol, estriol, testosterone, cholecystokinin, thyroid stimulating hormone, or thyroxin. Triiodothyronine tremded dow in three high-dose monkeys who were taken off compound for the remainder of the study. T3 values for these monkeys trended up after cessationofdosing... Atall dose groups, significant increases in mean absolute liver weight and mean liver-to-body weight percentages were observed. The. liver weight increase in the low dose animals occurred at a mean serum concentration of approximately 50 ppm. Mean liver-to-brain weight ratios were increased in the mid-dose group. Organ weight and body weight effects were not evidenta the end of the recovery period. No test material related macroscopic or microscopic changes were observed in any organs, including liver, adrenal, spleen, pancreas and testis. The liver weight increase at the low dose occurred at serum concentrations which overlap those which have been observed in some workers with high exposure; therfore, the liver enlargement was considered a significant effect and the low dose of3 mg/kg/day is characterized as the lowest observed effect level (LOEL). < Z DRAFT July 26,2000 EIDI0145 08950 Page John L. Butenhoff, etal. DRAFT 112000 INTRODUCTION Ammonium perfluorooctanate (C,F,COONH,; C.A.S. Registry number 3825-26-1; `ammonium perfluorocaprylate, ammonium pentadecafluorooctancate; FLUORAD TM Brand FC-143 Fluorochemical Surfactant; C-8; APFO'; PFOA'; Mol. Wat. 431.1 g) is used as a surfactant in the aqueous polymerization of fluorinated monomers such as tetrafluoroethylene. `The assumed presence of PFOA in general population blood and in exposed worker blood, coupled with the observed persistence in workers, has led to extensive research into the potential health riskofexposure to APFO (Guy, 1972; Venkateswarlu, 1975; Guy and Taves, 1976; Guy et al, 1976; Belisle and Hagen, 1978; Belisle and Hagen, 1980; Singer, 1979; Paez, 1980; Ubel, 1980; Belisle, 1981; Yamamoto, 1989) APFO has been produced since the early 1950's. Medical monitoring of employees involved in PFOA production began in 1976, by measuring serum levels of organic fluorine (OF) and performing medical assessments. Serum PFOA levels in production `workers have been measured ashighas 114 ppm. Eighty percentofthe workers had serum PFOA levels less than 10 ppm. Average serum concentrations have been approximately 2 ppm and individual values have range from 0 to 114 ppm. Past studies have demonstrated that the primary target organ for APFO-induced toxicity is the liver (refs). The hepatotoxicity manifests as increased liver weights, hepatocellular hypertrophy, liver degeneration, increases in liver enzymes, necrosisofthe liver, and proliferationofendoplasmic reticulum, microsomes, and peroxisomes (rats and mice only) yet does not result in hypolipidemia (Pastoert a, 1987). Manyofthese effects `were demonstrated to be reversible when animals were provided with a recovery period. APFO has been demonstrated to be aperoxisome proliferator in the rat. APFO exposure in the rat was found to be associated with tumors in the liver, Leydig cell, and pancreatic acinar cell. Peroxisome proliferation is associated with: increases in number and volume of peroxisomes; an increase in DNA synthesis and liver growth; and liver, Leydig cell, and pancreatic acinar cell tumors. Several known peroxisome proliferators (clofibrate, HCFC-123, methylclofenapate, and Wyeth-14,643) are reported to induce this triad of tumors in rats. The phenomenonofperoxisome proliferation is not uniform across all species. While rats and cats, dogs and primates (miincceluadriengpamratnic)u,laarrley psreendsiotmiivneatnotltyhisnopnh-reensopmoensniovne,. guinea pigs. i As noted above, chronic dietary studies in rats have produced hepatocellular adenoma, * : pancreatic acinar cell adenoma and Leydig cell adenomas (refs). The mechanisms of tumor formation have been studied. Hepatocellular tumors in the rat may arise from the proliferationofperoxisomes (refs). In investigating the role of increased cholecystokinin (CCK) or CCK, receptor binding as possible mechanism for pancreatic tumors, APFO DRAFT July 28, 2000 EID101455 Page 3 eoats John L. Butenhof. tal. DRAFT 12000 failed to bind directly to the CCK, receptor and it failed to inhibit trypsin, 2 common mechanism for increasing plasma CCK levels (ref). Jn vivo studies with Wyeth-14, 643, model peroxisome proliferator, suggest that these peroxisome proliferators produce `pancreatic tumors by cholestasis, which may be responsible for the decrease in bile acid output which contributes to the increase in plasma CCK levels (Obourn et al, 1997). Therefore, the pancreatic tumors produced by APFO may be secondary to hepatic cholestasis. The Leydig-cell tumors appear to arise from an inductionof aromatase with a consequent increased conversion of testoterone to estradiol an As iheotweohsotrtmaorutasltitybsotlutdyv:onf.wdoarndkieerpsdensogeaIgeadiniAPGAglroogdluiogtrioosnftotuend ao asi eea: Sli ; Hepatic toxicity and hypolipidemia have not been associated with the PFOA levels measured in APFO production workers (Gilliland and Mandel, 1993; Gilliland, 1992; Gilliland and Mandel, Am J Ind Med 129:560-568; Olsen et al, 2000). Based on toxicological findings that suggested PFOA may increase estradiol du to an induction of hepatic aromatase activity, Gilliland examined and found a positive association between serum total organic fluorine levels, used as an approximate measurement for PFOA, and estradiol (Gilliland, 1992). Gilliland and Mandel also observed thatserumtotal organic fluorine negatively modulated the effect alcohol has on high-density lipoprotein (HDL) levels and exacerbated theeffectthat obesity has on hepatic enzyme tests among these workers (Gilliland and Mandel, AmslndMed129:560:568). However,ananalysis of two subsequent medical surveillance examinations on this APFO production workforce, which specifically assayed for PFOA, did not confirm these associations (Olsen etal, 1998 and Olsen et al, 2000). Neither didOlsenct l find an association between plasma cholecystokinin and measured serum PFOA levels (Olsen et al, 2000). The occupational exposure limit in current use is the American Conference of Gmogv/emr'n,maenatnal8-Inhdouus,trtiialmeH-ywgeiiegnhitsetds (avAeCrGaIgeH)wiTthhreasnhootladtiLoinmfiotrVsaklinueex(pToLsuVre)aondfa0n.01A3 designation for animal carcinogen with questionable relevance to humans (13, 45 The purposeofthis study was to assess the effect ofAPEO on critical enzyme levels, hormones, and other selected biochemical parameters when administered daily by oral pcearpssiuslteentcoe,cyonrodmeollagyueds omcocnukrereynscefoofrtaot xlieacstef2f6ecwtesefkosr a13ndwetoekasssaefstserretvheers2ib6i-lwiteye,k treatment period L : MATERIALS AND METHODS EIDI01456 5 Aobntiamianlesd farnodmhCuosvbaanndcrey.ResYeoaurncgh ParduoldtucttosadInucl.t(mDaelneveCry,nPoAm)olognuAsumgounskte2y5s, w1e99r8e, and DRAFT July 28, 2000 eda Pag4e John L. Butea, al. DRAFT 112000 weighed 3.2 to 4.5 Kg at initiationoftreatment. Animals were acclimated for 35 days before initiation of treatment. Each animal was assigned a permanent number upon asrursipvaelndaendd sitdaeinntliefsise-dstweietlhcaacgoesl.laTrhteaga. nTihmaelarnoimoamlswawsereenvhioruosnemdenitnadlilvyidcuoanltlryolilned to `maintain 18 to 29C, a relative humidity of 30 to 70%, and a 12+hr light/dark cycle. Certified primate diet, (#8726C,Harlan Teklad) was provided once or twice daily along `wwaittehrfrwueirtseoarnaadldyizteidonfaolr ssupepcpilfeimcemntisc.roWoartgearniwsamssapnrodvciodnetdaamidnlainbtist.um.DuSraimnpgltehseo:fsttuhdey, severalanimalsexperiencing low food consumption inthe high-dosegroupwereoffered supplements to rehydrate and stimulate food consumption. Adnesiimganlesdwteoraechaisesviegnbeoddtyowteriegahtmtebnatlgarnocuepwsituhsiinngeaacchotmrpeuattemreinztegdrboluopc.king procedure M3a3t2e)riwaalss,obdtoasienepdrefpraormat3ioMn(aSnaidnttrPeaautlmeMnNt.; Apumrmitoyn0i0u)m.peGrefllatuionrocoacpastunloeaste(T(oArPpaFcO,,Ilnoct., uFasierdfifeolrd,dNoJs,e aSdimzienNisot.ra2t,iLoon.t NCoo.nt1r2o2l9a3n2i)mcaolnstraeicneiinvgetdheemapptpryogperliaattiendcoaspesuolfesA.PCFaOpswuelrees were prepared at least weekly. Individual daily doses were calculated based on the most recently recorded body weights. The dose preparations were stored at room temperature. Since the APFO wasaddeddirectly to capsules as supplied without the useof avehicle, no dose analysis was performed. Dose levels were 0 (control group, n = 6), 3 mg/kg (low-dose group, n = 4), 10 mg/kg (mid-dose group, n = 6) or 30reducedto 20 (30/20) mg/kg (high-dose group, n = 6). The c(a1p8s3udleasysw)eerxecaedpmtiansisntoetreeddboerlaolwl.y oOnncee afedmaayl,esienvetnhedlaoyws-pdeorsewegerko,upfonreaetdleedastto2b6eweeks irneiptliaalceddosfeoronnond-atyre1a7.tmHenitg-hr-edloasteedainsismuaels.s wTehreerienpiltiaacteemdeonnt 3a0nimmga/lk(g1;0h5o72w1e)verre,cediuveedtohis t2o0ximcgi/tky,g.dosAilnsgowdause dtiostcooxnitciitnyu,eddofsreoamddmainyis1t2ratthiroonugwha2s1alasnoddriseccoonmtmineunecdedforonthdraeye h2i2gha-t dinosbeotahnitmhaelcsonotnroelitahnedr dmaiyd-4d3os(e10g5r71o1u)p,s dwaeyre66de(s1i0g5n7a2t2e)doars draeyco8v1er(y10g5r7o03u)p.aTniwmoalasnainmadls were observed for reversibility, persistence, or delayed occurrence of toxic effects for 13 weeks after the 26-weck treatment period. DRAFT July 28, 2000 EIDI01457 Pages C0950 John L. Butenhoetfa,l. DRAFT 1120000 Observations. The animals were observed twice daily for general health, behavior and qualitative food consumption. Ophthalmic examinations were conducted on each animal before treatment and on weeks 27 and 40 (recovery animals). Body weights were rfoercodrodseedcwaelceukllaytiboen,foorne tinhietifairtsitondoafyotfretartemaetnmte,nto,natnhde dwaeyekbleyfotrheerienaifttieart.ion of treatment Dfaestteerdmainniamtailosno1f8,b8l,oaonddh4ordmaoynsepsr.iBotlorooinditwiaatsiocnololfecttreedatfmreontmatnhed foenmodraaylsv3e5i,no66f,n9o4n-and 183oftreatment. Blood collection from recovery animals occurred on days 220, 248 and 276 after initiationoftreatment prior to collection. Blood samples were split into serum and plasma samples for further analysis for various hormones. Plasma samples were analyzed for cholecystokininandtestosterone (with the exception of recovery animals in which case serum samples were used for testosterone). Serum was analyzed for estradiol, estrone, estriol, thyroid stimulating hormone, total and free triiodothyronine, total and free thyroxin. Clinicalpathology observations. A clinical laboratory evaluation was conducted before initiationoftreatment, on days 31, 63, 91 and 182oftreatment and during recovery on sdaamypsl2e1s7,we2r4e5,coalnldec2t7e5d affrtoemr ianniitmiaatlisonthoaftdhoasdinbge.enAtfaesatcehd osvaemrpnliignhtg.tUimrei,neblwoaosd caonldleucrtiende overnight on wet ice before blood sampling; water was provided ad libitum. Blood was collected from the femoral vein. Sodium citrate was used as the anticoagulant for cAonatgiucloaatgiuolnanttesstsw,earnednpoottuassesdifuomrtEhDeTcAlinwiacsaltchheeamnitsitcroyagtuesltanstamupsleed cfoolrlhecetmiaont.oloBglyootdests. was collected from animals with unscheduled sacrifices. Otherwise, animals with scheduled collections were bled in random order. `The following hematological parameters were measured or calculated: erythrocyte (RBC) count, leukocytes (WBC) and platelets (PLAT); hemoglobin concentration (Hb) and h(eMmCatHo)cr;itm(eHaent)c;omrpeuasncucloarrpuhsecmuolgalrovboilnucmoenc(eMnCtrVa)t;iomnea(nMCcHoCrp)u;scudlifafrerheenmtioaglloblboiond cell count of segmented neutrophils (N-SEG), lymphocytes (), eosinophils () basophils (; and blood cell morphology and reticulocyte count. BdeltoeordmicenleldcoounntasA,bhbeomtotgCleolbli-nDyconn3ce5n0t0r0athieomnahteomlaotgoycraintalMyzCeVr.,DMifCfHer,enMtiCalHcYe,ll wceorunets were determined on an Abbott Cell-Dyn 3500 and reticulocyte counts were obtained using a Miller Disk microscopy technique. Bone marrow smears were prepared at euthanization EIDI01458 DRAFT July 26,2000 coded Pag6e John L. Butenhof, etal. DRAFT 12000 Coagulation parameters measured were prothrombin time, activated partial thromboplastin time, and fibrinogen. Clinical chemistry measurements were made for glucose,urea nitrogen, creatinine, total protein, albumin, globulin, total bilirubin, cholesterol, triglycerides, aspartate aminotransferase, alanine aminotransferase, alkaline phosphatase, gamma glutamyl transferase, sorbitol dehydrogenase, creatine kinase, calcium, inorganic phosphorus, Sodium, potassium, chloride, bile acids, amylase, lipase, and pancreatic-specific amylase. Clinical chemical analytes were measuredon aHitachi Model 704 Chemistry Analyzer. Serum globulin concentration was calculated from the total protein and albumin concentrations. Urine was analyzed for volume (approximately 16 hours ovemight), specific gravity, pH, protein, glucose, ketones, bilirubin, blood, urobilinogen, microscopic examination of sediment, and general appearance. Determination of serum and liver PFOA content. Approximately 2 ml of whole blood (for serum) were collected from the femoral veinof non-fasted animals during week 2 and every two weeks thereafter. A sectionofliverwascollected at sacrifice from each animal, weighed, flash frozen in liquid nitrogen, and stored at 60to~80 degrees C until shipped on dry ice to 3M for analysis. Sera and liver samples were anlalyzed for PFOA content by 3M methodology (refs). Concurrent with blood collections for PFOA determination, at least 2 ml of urine was collected on wet ice and at least 5 goffeces (overnight) were collected from each animal. Results of urine and fecal analysis will be discussed in a future paper. Anatomic pathology. After 26 weeksoftreatment, four animals in the control, low and. `mid-dose groups, and the five surviving animals in the high-dose group were fasted overnight, anesthetized with ketamine and xylazine, weighed, exsanguinated, necropsied. Similarily the two animals in the control and mid-dose recovery groups were sacrified 13 weeks following the last dose. Necropsies were also performed on the low-dose and high-dose animals that had unscheduled sacrifices on treatment days 137 and 29. respectively. The adrenals, brain, epididymides, kidneys, liver, pancreas, testes and thyroids with parathyroid were collected and weighed. Organto body weight and organ to brain weight ratios were calculated. The following tissues were collected for microscopic evaluation: adrenal; aorta; brain; cecum; colon; duodenum; epididymus; esophagus; eyes; femur; gall bladder; heart; ileum; jejunum; kidney; lesions; lung; mammary gland; mesenteric lymph node; pancreas; pituitary; prostate; rectum; salivary gland (mandibular); sciatic nerve: seminal DRAFT July 28.2000 EID101459 Page onal John L. Butenholt, etal. DRAFT 12000 vesicles; skeletal muscle (thigh); skin; spinal cord; spleen; sternum with bone marrow; stomach; testes; and thyroid; trachea; and, urinary bladder. Tissues were embedded in paraffin, stained with hematoxylin and eosin and examined by light microscopy. Palmitoyl CoA oxidase determinations. `Samples of the right lateral lobe of the livers from each animal at scheduled and unscheduled sacrifices were flash-frozen in liquid nitrogen at necropsy and analyzed for palmitoyl CoA oxidase activity (need Cliff's method here). Cellproliferation determinations. Representative samples of the left lateral lobeofthe liver, left and right testes and `pancreaswerecollected from each animal. Afterfixation (formalin or zinc formalin), samples were embedded in paraffin,and sections stained with hemotoxylaindn eosin were prepared. Previously described methods were used tostaintissues for PCNA (Eldridge er al, 1993). Bileacid determination. Bile (up to 5 ml) was collected at sacrifice of each animal, flash frozen in liquid nitrogen and analyzed for specific bile acids (insert Cliff's methods) Statistics. Levene's test (Levene, 1960) was used for variance homogeneity. In the case of heterogeneity of variance atp 0.05, transformations were used to stabilize the variance. One-way analysisofvariance (ANOVA, Winer 19712) was used to analyze initial body weights, body weight changes, continuous clinical pathology values, and organ weight data. ANOVA was done on the homogeneous or transformed data. Ifthe ANOVAwas significant, Dunnett t-test (Dunnett, 1964) was used for control versus treated group comparisons One-way analysisofvariance (ANCOVA, Winer, 1971b) was used to analyze body weights, with initial body weights as the covariate. Although Levene's test for variance homogeneity was done, no transformations were used because covariance adjustment removed extraneous heterogeneity. Ifthe ANCOVA was significant, covariate-adjusted `means were used for control versus treated group comparisons. Dosed groups were compared to the controls at the 5% two-tailed probability level. Blood hormone levels were compared by ANCOVA with significance at the p=0.05 level For CCK, all data were analyzed using Jonckheere's test for trend (p < 0.05). RESULTS Clinical observations. During the first week of dosing, all animals in the 30 mg/kg dose: group had qualitatively low food consumption and and lost from 3.1 to 7.5 percent of DRAFT July 26.2000 EICDI010014E60 Pages John L. Butenhoff etal. DRAFT 12000 body weight. Fourofthe six animals also had few or no feces. Dosing was suspended on Day 12 and recommenced at 20 mg/kg/day on day 22. Only two animals were continuously treatedatthe 20 mg/kg/day dose for the remainder ofthe dosing period. Dosingoftheother three high-dose animals was discontinued on Days 43, 66 and 81. These animals exhibited low or no food consumption, few or no feces, and dramatic body-weight losses prior to being suspended from dosing. Bodyweight losses were 17.5, 23.1 and 18.7 percent prior to suspensionof dosing on days 43, 66 and 81, respectively. The remaining high-dose animal was sacrified in moribund condition on day 29.Thisanimal had lost 12.5 percentofbody weight, was hypoactive, cold to the touch, exhibited low or no food consumption, andfewor no feces. There was a lackof opthalmic effects in all animals. Overall, body-weight losses in the 30/20 mg/kg dose group were significantly lower than controls (14.3 percentoverthe 27 week period). Dosing at 30 mg/kg during the first two d`waeyek2s2,cawuesiegdhtcolnosssidwearsabsliegnwiefiigchanttlcosos.mpaArfteedrtcoocmomnternoclisndgurtihneg2w0emegk/sk7g,/d9aaynddo2s4in(gTaobnle 1. Clinical signs and body-weights were normal in monkeys receiving 10 mg/kg and all but omnreoimbounnkdecyonrdeicteiiovninogn3dmagy/1k3g7e.. IHnotwheisveorn,e oanniemlalo,w-pdaorsaleyasinsiomfatlhweashisnadcrliifmibcsedainnd ataxia occurred as well as few feces and low or no food consumption and loss of 9.5 percent of body weight in the week prior to sacrifice. `Blood homone determinations. No effects on estrone, estradiol, estriol or testosterone were noted. Mean group estradiol values in all groups including the controls tended to be considerably lower dutring the treatment period than the corresponding pretreament values. In the high-dose animals these values appeared to be lower than the other groups. N`Toheseisgtnriafdiicoalntvaclhuaensgeisn tihnetreestcoosvteerryonaenivmaalluesstwenedreedsteoenbedusriimniglatrhteottrheeatpmreendtospeerviaoldu.esI.n the last recovery sampling, mean values (9 and 15 ng/ml) tended to be higher than means during the rest of the study (1-8 ng/ml). Taken collectively, values for the thyroid hormones in APFO-treated monkeys appeared 0endboefutnhafefescttueddy. reWmiatihnetdotraellaatnidveflryeecoTn3s,tamnet;analvtahlouuegsh,frmoomnkteesytsdaiyn--the thhirgohu-gdhosteo gthreoup eprxehtiebsittdedaygsen-e8raalnldy ~l1o8wewregrreocuopnmsiedaenravballyuehs.ighIetrsthhoaunldthboesepodiunrtiendgotuhtetrheasttovfatluhees sotnudy. ; Group period, mean total T3 values are shown in Figure 1, page the three high-dose animals that were eventually 56). During the treatment takenoffcompound for to xic it y : tteennddeedd ttoo ihnacvreeadseecrteoawsairndg pTr3e-vsatluudeysvparliuoerstaoftreermcoevsaslatfiroonmotfrteraetamtemnetn.t.ThFeisgeurveaslu2e(spage DRAFTJuly 28.2000 EID101461 Caos" paged John L. Butenhoff, etal. DRAFT 112000 57) and 3 (page 60) represent the individual trends in Total T3 for the control and highdose groups, respectively. No statistically significant or biologically significant alterations in plasma CCK. . concentrations were observed. Clinicalpathology. Administration of APFO at 3 or 10 mg/kg produced no apparent effects on measured clinical parameters including hematology, coagulation, clinical chemistry, and urinanalysis. The 3 mg/kg dose group animal that was sacrifeed in `moribund condition on day 137 showed marked hyperfibrogenemia, moderate: Iymphopenia, moderate hypoalbuminemia and mild hypocholesterolemia. Findings inthe 30/20 mg/kg dose group were complicated by the unscheduled sacrifice of one animal on day 29 and the cessation of treatment for three others by day 80. Only two animals remained on treatment during clinical pathology tesing intervals on days 91 and 182. In this group, mild increases in triglycerides and mild to marked decreases in absolute neutrophil count, total protein concentration, and albumin concentration occurred. The differences in triglycerides were statistically significant on days 31 and 91, The other differences were not statistically significant but were consistent over time. Absolute neutrophile count and albumin concentration were mildly decreased prior to cessation of treatment for the three animals for which treatment was stopped early. One `monkey at this dose had moderate increases in serum activitiesofaspartate `aminotransferase, alanine aminotransferase and creatine kinase when dosing was stopped `on day 66 and moderate increases in serum bile acids on day 63. The high-dose dose group animal which was sacrificed in moribund condition on day 29 had numerous nonspecific clinical pathology findings commonly observed in animals that are very ill along with marked serum activitiesof aspartate aminotransferase , alanine aminotransferase, sorbitol dehydrogenase and creatine kinase as well as unusually low cholesterol (14 mg/dL) Eleven days prior to initiationoftreatment (day ~1 1), the animal in the low-dose group `which was sacrificed in moribund condition had a high hematocrit (49.7%) and albumin concentration (5.6 g/dL), possibly indicativeofmild dehydration, and it had the lowest neutrophil count (1,600/L)ofall animals. PFOA levels in Serum andLiver. g Steady-state values for PFOA in the serum were attained within 4 to 6 weeksof dosing. z In the 3 mg/kg group, this value was approximately 110ppm and in the 10 mg/kg group it was 100ppm. Although difficult to determine becauseofdiscontinuous treatment, peak g values were highly variable and averages of around 150 to 1000ppm were seen in animals receiving 30/20 mg/kg. It is apparent that the relationship between APFO administered and APFO in the serum is not linear (Table X) EIDI0I462 DRAFTJuly 28, 2000 00 Page 10 John L. Butenhoft, ta. DRAFT 12000 Amounts of APFO in monkey liver averaged 14 10 16 ppm in the 2 lower dose groups (Table Y).In the higher group the values for the 2 monkeys which continued through the entice treatment period were 17and 87 ppm. In animals from this group that were rmiedm-odvoesdefrreocmovdeorsyinmgo,nklievyesr ,coAncPeFntOractoinocnenotfraftrioomns0.i2n ttohe1.li5vpepr mwewnetrefroobtmaianmede.anInotfhe142 ppm to 0.1 and 0.3 ppm respectively. Preliminary data from urine analysis for PFOA suggests that most PFOA is excreted in theurine. Thiswilbepresentedin afuturemanuscript. Palmitoyl Cod determinations. Theewereincreasesover coinnpetlmirtoyolGolA. oxidase activity. Cellproliferation results. There were no significant differences in cell proliferation observed in liver, pancreas or testes as measured by PCNA. Anatomic Pathology. Increases occurred in mean absolute liver weights and mean liverto-body weight percentagesinall dose groups at terminal sacrifice after 26 weeks of dosing (Table Z). Liver weight increases showed a positive dose-response tread. The silmoiw-ldaorasendansdigmniidf-icdaonstelyaenliemvaaltsedgroovuepr mcoenatnroalbvsaolluuetse.aTnhderetlwatoivheiglhiv-edrowseeainghitmsalwsetrheat wwehriechtrweearteedsuingtniilfitchaenetlnydoefltevhaeteddoosvienrg tpheeroitohdehratdreaabtsmoelnuttegaronudprselaantdivceonltirvoelr.weights Nthoe AtePrFmOi-nraellsaatceridfimcaec.roTshicsopiincclourdemsickreoyscoorpgiacnschsaunchgaesswtehreeliovbesre,ravderdenianl,asnpyleoerng,ans at pancreas and testis. At the recovery sacrificeofthe 10 mg/kg animals, there were no effects on terminal body weight, there were no macroscopic or microscopic findings, and liver weights were normal. ili "Table Z: Absolute and relative liver and body weights at scheduled dosing termination. mgkg(m) | (8) 5) 0Control (4) | 3947 591 | 60.16693 [100| 1.530.07 | 100 30) 348630 | 81.79281 [[1315 .822005 [119 020) [3025 58 [895.01379294.2662 [[1520 402T08730106 : dTuwroinagntihmealdsoswienrgepferoiuondd. iAn m3o0/r2i0bumngd/kcogndaintiimoanlawnadsssaaccrriiffiicceeddaotnundsacyhe2d9ualnedd tfiomuensd to Thhaivse aendiemmaal aalnsdoihnafdlalmivmeartlieosnioofnts,hiencelsuodpihnaggmuisd-aznodnsatloamnadchceinntdriiclaotbiuvleaorfhdeopsationcgelilnujluarry. EIDI01463 DRAFT July 26,2000 0305 Page 1! John L. Butenhof, etal. DRAFT 112000 degeneration and necrosis, diffuse hepatocellular vacuolation, and hepatocyte basophilia in centrilobular areas indicativeofliver regeneration. Involution of the thymus, a common stress response, and degeneration and necrosisofthe heart, probably agonal changes, were also observed in this animal. Although the esophageal and gastric lesions are complicating factors, the contributionofAPFO to this animals moribund condition `cannot be dismissed due to findings in the liver, which were likely due to APFO exposure. A3 mg/kg animal was found in moribund condition with hind-limb paralysis and ataxia and sacrificed on day 137. The blood supply tothisanimals hind limbs was severely compromised, as indicated by the cool temperatureof thehind limbs on final medical `examination and the fact that ketamine injected into the thigh muscle failed toreachthe systemic circulation. The microscopic and macroscopic findings did not reveal evidence: ofspinal cord injury or impaired blood circulation. DISCUSSION Qualityofthe study (GK) Dose-level selection (PL) +HiHgihg-h-ddoossee ucenssscahteidounolfeddossacirnifgic(eB()JB) Liver findings (/B) Sex hormones (GK) Thyroid hormones (JB) Recovery story (PL) Mechanistic endpoints (PcoAO, PCNA, CCK, bile acids) (GK) Pharmacokinetics (PL) + LOEL/NOEL (GK) Low-dose death (GK) Relate to thesus study (JB) + Relate Relate to to rhoudmeantnssttoorryy ((PULB)) CONCLUSIONS <5 DRAFTJuly 28.2000 EID101464 000515 Pagel? John L. Buteahot etal. RAFT 12000 Resource material for discussion follows: `These findings were non-specific and, with the exceptionof low albumin concentration, `wweerree nwoitthcdonrsaiwsntefnrtowmitthretahtmeefnti.ndiTnhgesroebfsoreer,vetdhefocrlianniicamlalpsatihnotlhoegyhirgehsu-ldtossefogrrtohuispltohawt- dose animal were not assumed to be due to APFO exposure. "There are no known metabolic processes that degrade PFOA. The urinary elimination of PFOA in rats appears to be hormonally regulated (refs). Female rats and castrated male rats rapidly clear PFOA in the urine; whereas, male rats have a significantly longer urinary clearance half-life (refs). Sex differencesinurinary clearance have not been found in [species] (ref). PFOA is excretedinthe bile and enters enterohepatic circulation (Johnson, J.D. et al. 1980; Johnson, J.D., et al., 1984). Follow-up on blood levels in retired workers indicated that, althoughtheconcentrations detected wereinthe few ppm range, the chemical was present in some individuals well after the possibilityofexposure had ceased, suggestianng elimination half-life on the order of 18 months (bel, 1980). A reelciemnitnasttiuodnyhoaflf3lMiferiestiarpepdrcohxeimmiactaellypl3a0nt0 wdoarykse(rBsursruigsgeesttasl,th2a0t0t0h)e mean serum Liver tumors `Th finding of liver enlargement in male cynomolgous monkeys at all dosesin this study is significant in ligtofprior information available from a 90-day oral gavage study in `male and female rhesus monkeys. The rhesus study was conducted with APFO (FC-143, Lot 340) in male and female rhesus monkeysat doses of 0 (control), 3, 10, 30 and 100 mg/kg/day in 0.5% Methocel.. Unfortunately, all animals in the 100 mg/kg/d group and 3 of4 animals in the 30 mg/kg/d group died. No treatment related gross pathological . lesions or alterations in urinalysis values were seen. Significant effects (and LOELSs in mg/kg/day) included: weight loss (30); anorexia (10); emesis (30); black stools (10); pale. swollen face (10), swollen eyes(30); decreased activity (30); prostration and trembling (t1i0m0e)s;(a30n)e,mdieac(r3e0a)s,esdlisgehrtluym ianlckraelaisneedpphroospthhartoamsbeinacatnidvitayct(i3v0a)t;edinpcarrteiaasledthsreormubmopalsapsatritnate aminotransferase (SGOT) activity (30); increased serum creatinine phosphokinase (CPK) activity (30); diffuse lipid depletionofthe adrenals (30), bone marrow hypocellularity (30), splenic and lymph node follicular atrophy (30). The NOAEL for this study was 3 mg/kg/d (ref). Subsequent analysis of serum and liver samples showed dose-related FC- 143 concentrations. There was no apparent difference in serum or liver FC-143 levels between males and females (ref). o Testosterone inhibits urinary elimination of PFOA in male rats. It has been suggested Z that the gender difference in elimination may be due to a testosterone inducible serum or 5 tissue protein which binds PFOA [48]. = DRAFT July 28,2000 EID101465 canis Pen John L. Buteahoff, etal. DRAFT 12000 No changes in liver weight to body weight ratios were seen in female rats given single oral dosesof upto 200 mg PFOA/kg. In male rats, single oral dosesofeither 100 or 200 `mg PFOA/Kg produced an increase in relative liver weight. Castration reduced the magnitudeofthe liver weight increase [13]. Estradiol treatmentofcastrated or intact male rats produced PFOA excretion rates similar teoxctrheotsieoninbuftenmaolteas.s eCfafsetcrtaitvieolny wasitehsoturatdeisotlrtardieoaltmternetat[m5e1]n.t also enhanced PFOA PFOA induced hepatomegaly, peroxisomal B-oxidation, microsomal 1acylglycerophosphocoline acyltransferase and cytosolic long-chain acyl CoA hydrolase in male rats to a much greaterextentthan in female rats. Testosterone was shown to be necessary for these effects and estradiol blocked these effectsin male rats [53]. Activitiesofliver microsomal 1-acylglycerophosphocholine acyltransferase (AGA), cmoimcproossiotmiaolnostfeairvoeyrlm-iCcorAodseosmaatlurpahsoes(phSaDt)idaynldchpoelrionxeis(oPmCa)lweB-roeximdeaatsiuornaendditn hraetsacfyeld a diet containing 0.01 % PFOA for 2, 22 or 26 weeks. Females showed only slight changes. in these parameters. Inmales, activitiesforall three enzymeswereelevated by two weeks. Activities of AGA and B-oxidation remained unchanged throughout 26 weeks. `The activityof SD declined but was stillhigherthan contraotl2s6 weeks. The acyl `compositionofmicrosomal PC was significantly altered in males. All ofthese parameters retumed to control levels within 4 weeks after PFOA was withdrawn from the diet [72]. hPeFpaOtAicipnetrhoexdiiseotmoafl mfiatctey aatciadcoBn-coexnitdartaitoino,nodfe0c.re0a2s-e0d.h0e5pa%tifcorm5i-t1o0chdoanydsricaalussiezdeianncdreased increases in the following hepatic enzyme activities: @-hydroxylation of lauric acid and cytosolic epoxide hydrolase, glutathione transferase and DT-diaphorase. There were no significant differences between males and females [85]. PFOA has been shown to induce hepatic peroxisomal proliferation in rats and mice There was a marked sex difference in rats (38, 53, 54, 58, 83]. PFOA-induced hepatic peroxisomal proliferation in male rats is most prevalent in the centrilobular region and is associated with increased peroxisomal palmitoyl-CoA oxidation, marked hypolipidemia, an almost 10-fold increase in hepatic free acid soluble CoA, and altered peroxisomal polypeptides [83]. c5 Perfluorooctane, CF, did not induce peroxisomal proliferation in rats, indicating the importanceof the carboxylic acid group in causing this effect [54]. PFOA caused peroxisomal proliferation in primary culturesofrat hepatocytes. PFOA- mediated increases in the peroxisomal enzyme fatty acyl-CoA B-oxidase (FACO) were inhibited by cycloheximide and correlated with elevations in FACO mRNA levels. Thus, EID101466 DRAFT July 28,2000 0ooRLs Page 14 John L. Butenhof. etal. DRAFT R000 PFOA appears transcriptional atondintdrauncselapteiroonxalispormoaclespsreosli[f6e9]r.ation through the regulationof gene pPrFoOliAf-eirnatdiuocnoefd shempoaottohmeengdaolpyliassdmuiec prerteidcoumliunma,nmtiltyotcohocneldlrihaypaenrdtrpoeprhoyxiressoumletsing[38f]r,om pPrFiOmAar-iilnydiuncethde DpeNriAposrytnatlhreesgiison(.hypIenrcprleaassiead)DhaNsAalssyonbtheeesnisshococwunrrteodoicneutrheinabrsatenlciveero,f hneepcarotsoicse,llsuulgagresintjiunrgy.thPatertohexiceslolmperoplriofleirfaetriavteioanctoicvciutryriesdnportiamarreigleyneirnatthievecernetsrpiolnosbueltaor region suggesting that PFOA-induced independent processes(73]. hyperplasia and peroxisomal proliferation are dPeFcOreAasiendtbheoddyietweoifgmhatlaendmitchee aftolcloonwcienntgrhaetpiaotnisoc feff0e.c0t2s:thoe0p.a1t%omefgoral2y-,10dedcaryesasceadused imnictroecahsoenddrciyatlossoilziec, eipnocrxeiadseedhymdircorloassoemaanldPD4T5-0d,iaPp4h5o0rarseed,ucatnadsedeacnrdeaespeodximdietohcyhdornodlraisael, glilpuitdatpheiroonxeidpaetriooxni.daHseepaatnidcsmuipcerroosxoimdaeld,ibs,mauntdasceytwoesorleicnogtlustiagtnhifiiocnaenttlryanasfffeercatseed, [84]. bHeepdaetpoemnedgeanltyo,nbuctorntoitcopsetrerooxnies,otmhee pprroilmifaerryataidorne,ncaalugsleudcobcyorPtFicOoAidiinnrraotdsewnatss [s7h3]o,wn to hUynploilkiepimdaenmyiah.epRaattohcearr,cPinFoOgeAniccaupseerdoxaimsaormekepdroilnifcerreaatsoersi,n PheFpOatAicdilidpnidotsycnatuhseesis [38]. cDhioelteasrtyertorleaatnmdenttroiafcmyalglleycreartoslswiatnhd PinFcOreAas(e0d.l0i2v%erfforree7-c1h4oldeasytesr)ocl.ausHeedpadteoccryetaessedissoelartuemd hfyrdormoxtryemaettehdyrlagtlsustahroawteed bruetdnuoctedfrsoynmtmheesviasloofnactheo,leisntcerreoalsefdroomxiadcaettiaotneo, fppyarulvmaitteataenadnd rreedduuccteadsefaatntydaaccyidl-syCnotAhecshiosl.esAtcetriovlitaiceysoltfrlainvsefrerhaysedrwoexryemertehdyuclegdlu[t8a2r]i.c acid-CoA hPeFpaOtAicimnitthoechdioentdorfiamlicperotfeoirn,uphetpoat1i0c dpaeyrsoxciasuosmeadlgpraealtmeirtionyclr-eCaoseAsoixnidlaitvieronw,eilgahutr,oy a`cCiodsA.oxPiFdaOsAe aicntcirveitayseadnpdecraotxailsasoemaalctfiavtittyyatchiadnfd-iodxipdeartfilounor(owahciectih,p-rboudtuycreics oHr,0d,e)catnooaic c DmiuectharygrelaevteelrseoxtfePnFtOtAhanascaltaolwasaes (0w.0h0i1ch%recdauucseesdHsyig,nitfoicwaanttecrhaanngdesm[o6l1e]c.ular oxygen). : tPrFipOhAospchaautseed(IeTnPh)arnecceedptaofrfsiniintymaanlde rraetdsu.ceIdTPmaisxiamsaelcobnidndmiensgsceanpgaecritiynvooflhveepdatiinctihneositol `mobilizationofcalcium from intracellular peroxisomal proliferation [74]. stores and may be involved in the process of EIDI01467 DRAFTJuly 28,2000 hak Page 15 John L. Butenhoft, eal DRAFT 112000 Valproate (2-propylpentanoic acid), a non-fluorinated analog of PFOA, is a hepatotoxin `which impairs mitochondrial function and fatty acid metabolism [97], Induction ofperoxisomes by treatment with PFOA did not increase rates of hydrogen peroxide production in rat or mouse liver [12]. Oxidative stress resulting from the increased production of hydrogen peroxide has been postulated as a mechanism by which peroxisome proliferators cause liver damage and cancer. PFOA induced hepatic microsomal carboxylesterase isozymes in male rats 106). PFOA. displaced efluorescentlylabeledfaty.acid from iverfatty-aciddlingarotsin ie oe raBammiteas`seperiunmaR lbuT tiinim n:vifro-(YDc9]o:mpe gTiotesvtihbedIiuyplpoettEQsmAeEdnoid `(5m-deimaetshyularmilnoniapnthvalientesrulloofsp-shooafniysnli)at-iuapnldfeeicbrarnceosieccennaccteid. (10DJAVUADPAF)OfRrcoamuLs-eFAB4P8w%as reductiatofinital fidorescencewhenadded:to solutions containing 1 MAFABPand W1MMofDhAeUkDnAo.wTnhoerLsOusEpLectfeodrpPeFrOoAxiisnomtehpirsoalsisfaeyrawtaorss0:.p5e-rf1l.u0ouroMo.ctBaynecsoumlpfaorniiscoanc,id10 * E(tPhFyOlSp)r,lWuyoertohg,tNa-nEetshuyllfpoenrafmliudcereotohcatannoelsu(lNf-oEnaFmOiSdeE)(cFaXu-1s2e)da6n6d%,N4- 8%,a4nd539%% reductidaofinitalflnorescence; respectively. Results for BSAvierevery4itilirtohose seen with L-FABP [109, 122]. `The serum concentration at which this liver enlargement occurred (approx. 50 ppm) is `within the range experienced by workers with higher exposures. Studiesin exposed workers have not indicated liver toxicity. However, the enlargement at the low dose in the cynomolgus monkey was not associated with any clinical manisfestations of liver toxicity; therefore, it is not possible to knowif workers with similar body burdens, as represented by serum concentration, experience similar liver enlargement. Pancreatic tumors The absenceofan increase in cholecystokinin is also also significant in lightof Cook et al.'s findings in rats (ref). This may indicate a decreased risk ofpancreatic tumors in primates. It is also important to point out that CCK, receptors are distributed differently in the rodent as oppsed to humans and primates (ref). [comment on CCK, receptor agonism] PFOA has been asssociated with elevated CCK levels and pancreatic tumors. PFOA did not bind directly to the CCK, receptor in a competition binding assay, and did not inhibit trypsin in vitro, thus two possible contributing mechanisms for pancreatic carcinogeneis were ruled out [111]. Leydig cell tumors EIDI01468 DRAFT July 28. 2000 Canal Page 16 John L. Butenhoff eta. DRAFT 112000 aIbnstehnecmeaofltehriats, eefsftercatdiionltihseeplreevsaetnetdsatnuddyteasntdotienrosnteuddieecsroefasweodrokenrrsepseuagtgeedstesxpthoasturteh.e The primate is not responsive to the hormonal changes seen in the rat. Since these changes are thought to occur in the ratviainductionofaromatase and are related to the formation of Leydig cell tumors in the rat, the risk of testicular tumors in primates from exposure to APFO is assumed to be much lower than that in the rat. In fact, the spontaneous incidence of Leydig cell tumors in rats is ordersofmagnitude higher than in the humans (insert detail and ref). `The historical incidenceofLeydig cell tumors in Sprague-Dawley rats ranges from 1.4 to 10% with a meanof 4.7% [60]. The incidenceofLeydig cell tumors in man is estimated to be less than 0.0003%. A numberofchemical agents, nutritional and hormonal factors have been showntocause Leydig cell tumors in rodents. However, wherethere have been studies on the same chemicals in man, there appears to be no evidence of Leydig cell tumor formation in man [0]. Elevated estrogen levels havebeenassociated with Leydig cell tumors in mice,ratsand humans [91,9596]. Serum estradiol levels were significantly elevated in rats treated with PFOA at dosesofmorethan 10 mg/kg/d and accessory sex organ relative weights were significantly reduced in rats fed 50 mg/kg/d PFOA for 14 days. In addition, serum testosterone levels showed a dose-dependent decrease which was, however, not statistically significant. This decrease in testosterone levels was shown, by human chorionic gonadotropin (HG) challenge, to be associated with inhibition of steroidogenesis in Leydig cells [10] The increase in serum estrogen caused by PFOA appears to be due to inductionofthe enzyme aromatase (Cytochrome P450 XIX) which metabolizes testosterone to estradiol. A two-fold increase in serum estradiol showed a linear correlation with a 16-fold increase in total hepatic aromatase activity (57, 118). PFOA caused a dose-dependent decrease in hCG stimulated testosterone secretion and. also reduced the basal release of estradiol by rat Leydig cells exposed in vitro, suggesting that PFOA may have a direct effect on the ability of Leydig cells to produce testosterone parnoddeuscttriaodnioiln [h5C5G,-s1t1i9muInlactoentdraLsety,deixg-vcievllos sftrudoimesradtesmtornesatterdatweitahn 2i5ncmrge/askeg/idn atyesAtoPsFteOrone for 14 days, indicating that the direct inhibitionof testosterone synthesis seen in-vitro is reversible in-vivo. Furthermore, in the in vivo studies serum estradiol and testicular interstitial fluid estradiol and transforming growth factor alpha (TGF alpha) levels were also increased, consistent with the hypothesis that estradiol may modulate growth factor expression within the testis. APFO produced a 4.5 fold increase in hepatic aromatase invivo, suggested as the primary cause of increased serum estradiol (120). ; PleFveOlsA, aitnc3r0e0aspepdmheipnattihce pd-ieotxifdoart|ioynea(rpeirnomxailseomreatpsrcolaiufseerdatiinonc)reaansdedinscerreuamseedstrrealdaitoilve DRAFTJuly 26,2000 EIDIOISY pugerr COOLEY John L. Butenbof, es. DRAFT 112000 olxiviedratwieoing,htosr.sePrFuOmAtehsatodstneoroenfef,ecFtSoHn,hperpoaltaicctionroLrelyudtieginciezlilngprholoirfmeroanteiocno,nLceenytdriagticoenlls.pThus, PFOA did not induce peroxisome proliferation in Leydig cell at dietary levels which did induce hepatic peroxisome proliferation 56]. The lackofperoxisome proliferation seen in this study in not unexpected. Primates are plaerstsiraellsypodnuseivteo ttohepefarcotxtihsaotmperipmraoltiefserhaatvieonmfurcohm fxeewnoebriPotPiAcRcGomrpeoceupntdosrstthhaannrrooddeenntts,s. Since the hepatocelluar tumors observed in ras with APFO ere thought to derive from rpiesrkooxfistohemseeptruomliofresraotcicounrainndg tihnepprliemaitoemsoripshciocnsriedseproendselofwr.om activation of PPAR, the Waxman et al 1999) have studied the effectsofPFOA on transactivation ofPPARG and PHPuAmRayn PinPCAORS:-1wcaesllsletsrasnesnfseicttievdewtiotPhFmOouAstehaanndmohuusmeanPPPPAARR.aHaundmaPnPAaRndYmroecuespetors PPARy were non-responsive to PFOA. Thyroid hormones AfLorTma4lveasl,uaensdwe1.r3e 7wi.t6hiungt/hme Lrafnogr efpeumballeissh(eDdefPoaroRlhoeasnudsMmaosnakreoy.s19o8f90)..8T-ak6.e6nutgo/gemtlher, thedatasuggestthatthechangesin T4values observedappear tobesystemic trendsthat are not compound related and not biologically significant. A1IgL/1T030vmalluaensdw6e5r-e2w9i5th0i/n1t0h0ermeflfeorernmcaelreasngaenfdofremmaalleesa,nrdefspeemcatilveeMlayc(aDqeuPaeosl(o5a4n-d115. Masaro 1989). Cell proliferation discussion Membrane secretionof EIfgfMecftsr:omAtcuslutbulreetdhhalumcaonnceonrtmraotuisones,B PFOA cells. did At not alte the expression lethal concentrations (> or 0.8 mM), PFOA caused have suggested that a detergent-like solubilization of someofthe biochemical changes membrane and target proteins. The authors organ effects observed in vivo with PFOA may be secondary to cel ysis [92] PFOA caused lipid peroxidation in vitro [80]. Z PorFgaOnAizaantidoontahenrdpfelrufildiutoyroinfacteeldlsmuerfmabcrtaanntessca[u6s2e.9a2l.t9er3a9t4i]o.ns in the fatty acid composition. EIDI01470 DRAFT Jlyy 26,2000 6925 Pag*e 18 John L. Buteahof, etal. DRAFT 112000 At sub-lethal concentrations, PFOA did not affect migration or cappingofcell surface immunoglobulins after antigen recognition in lymphoblastoid cells in vitro. However, PFOA (0.9 mM for 15 min) did cause changes in membrane lipid architecture. It was. suggested that direct, physical disruptionofcell surface membranes is the likely `mechanismofacute PFOA toxicity [93]. Sodium perfluorooctanoate had a much higher affinity for dipalmatoylphosphatidylcholine vesicle membranes than did the corresponding nonfluorinated compound, sodium octanoate. This difference was attributed to the greater hydrophobicityofthe fluorinated acid [compound [94]. PFOA did not inhibit cell-to-cell communication in cultures offreshly isolated or established (ARL) rat liver cells as did PFDA [76]. mPiFtoOcAhounndcroiualploexdid(aEtDiyv,e =ph0o.s1p8homrMyl)atainodn aitn hviitgrho.er cTohneceanuttrhaotrisonhsypionthhibeistiezdedratthat uncouplingof mitochondrial oxidative phosphorylation by PFOA in vivo would lead to reduced cellular ATP levels and elevated intracellular unsaturated fatty acids which would activateprotein kinase leading to increased cell turnover which is believed to be involved in the carcinogenic process for nongenotoxic carcinogens [67]. PFOA (100 uM) exhibited a general detergent-like effect on mitochondrial membranes as reelected by a decrease in respiratory control without uncoupling oxidative phosphorylation phosphorylation in-vitro. FC-143 slightly increased the activityof enzymes and respiratory chain, the most probable mechanism being of oxidative. the fluidisationofthe inner mitochondrial membrane [121]. PFOA at concentrations up to 500 pg/ml did not impair clone-forming ability in L5178Y mouse lymphoma cells in vitro [77]. DRAFTJuly 26,2000 EIDI101471 Coons ml John L. Butenhof, et al. DRAFT 12000 : CONCLUSIONS DRAFT July 26,2000 5< 5 EIDI01472 ce09:5 Page20 John L. Butenhof, etal. DRAFT 112000 REFERENCES ny Abdellatif, A.G., V. Prat, H.S. Taper, and M. Roberfroid. The modulation of rat liver carcinogenesis by perfluorooctanoic Toxicology & Applied Pharmacology 111 a(c1i9d9,1a)p5e3r0o-x5i3s7om[eSupbrmoliitfteerdatMora.y 25. 2000). 2) Abdellatif, A.G., V. Prat, J. Vamecq, R. Nilsson, and M. Roberfroid. Pdiecrholxoirsoopmheenporxoylaifceertaitcioanciadn,d2,m4o,d5u-ltartiicohnloorfropahtenloixvyearcceatriccinacoigde,nepseirsflbuyor2o,o3c-tanoic 2000). acid and nafenopin. Carcinogenesis 11 (1990) 1899-1902 [SubmittedMay 25, 3) Belisle, J., and D. Hagen. A method for determinationofperfluorooctanoic acid in blood and other biological samples. Analytical Biochemistry 101 (1980) 369376 [Submitted May 25, 2000). 4 Biegel, L.B., M.E. Hurtt, and J.C. Cook. Effects ofammonium perfluorooctanoate (C8) on Leydig cell function:In vivo, exvivo, and in vitro studies. The Toxicologist 13(1] (1993) 399 [SubmittedMay 25, 2000). 5) Biegel, L.B., R.C.M. Liu, ME. Hurtt, and J.C. Cook. Effects ofammonium perfluorooctanoate on Leydig cell function: Ivnivo,exvivo, ain nvid tro studies. Toxicology & Applied Pharmacology 134 (1995) 18-25 [Submitted May 25, 2000). 6) Borjes, HK. and R.G. Thurman. Peroxisomal proliferators inhibit Acyl CoA synthesis and stimulate protein kinaseC in vivo. Toxicology & Applied Pharmacology 126 (1994) 233-239 [SubmittedMay 25, 2000). 7) Clapperton, RM. B.T. Ingram, RH. Ottewill, and A.R. Rennie. NMR `spectroscopic and neutron scattering studies on ammonium decanoate-ammonium perfluorooctancate mixtures. In:Mixed Surfactant Systems. ACS Symposium Series 501, Eds.: P.M. Holland and D.N. Rubingh, American Chemical Society: `Washington, DC, 1992, 268-277 [Submitted May 25, 2000). 8) Clegg, ED. J.C. Cook, R.E. Chapin, P. Foster, and G.P. Daston. Leydig cell : hyperplasia and adenoma formation: Mechanisms and relevance to humans { (abstract). Reproductive Toxicology 11(1) (1997) 107-121 [Submitted May 25, : 2000). EID101473 [DRAFT July 28, 2000 C001 Page21 John L. Butenhofeft al. DRAFT 112000 9) Cook, J.C. SM. Murray, S.R- Frame, and M.E. Hurt. InductionofLeydig cell adenomas by ammonium perfluorooctanate: A possible endocrine related mechanism. Toxicology d Applied Pharmacology 113 (1991) 209-217 [Submitted May 25, 2000). 10) Cook, J.C, ME. Hurtt, SR. Frame, L.B. Biegel. EffectsofWyeth-14,643 (WY) `and ammonium perfluorooctanoate (C8) in Crl:CD BR (CD) rats. The Toxicologist 13(1) (1993) 399 [Submitted May 25, 2000). 11) Cook, J.C, ME. Hurt, S.R. Frame, LB. Biegel. Mechanismsof extrahepatic tumor induction by peroxisome proliferators in Crl:CD BR (CD) rats. The Toxicologist 14[1] (1994) 301 [Submitted May 25, 2000). 12) Feller, D.R. and U. Intrasuksri. Mechanismofperoxisome proliferatibony perfluorinated fatty acids in primary culturesofrat hepatocytes (abstract). Toxicologist 13 (1993) 395 [Submitted May 25, 2000], 13) Gilliland, F.D. Fluorocarbons and human health: Studies in an occupational cohort. Unpublished Ph.D. Dissertation, UniversityofMinnesota, 1992 [Submitted May 25, 2000). 14) Gilliland, F.D. and J.5. Mandel. Mortality among employees ofa perfluorooctanoic acid production plant. JOM 359] (September 1993) 950-954 [Submitted May 25, 2000). 15) Gilliland, F.D. and 1.5. Mandel. Serum perfluorooctanoic acid and hepatic enzymes, lipoproteins, and cholesterol: a studyofoccupationally exposed men. American Journalof Industrial Medicine 29 (1996) 560-568 [Submitted May 25, 2000). 16) Griffith, F.D., and J.E. Long. Animal toxicity studies with ammonium perfluorooctanoate. American Industrial Hygiene Association Journa4l1 (1980) 576-583 (Submitted May 25, 2000), 17) Handler, JA., CB. Seed, B.U. Bradford, and R.G. Thurmond. Induction of peroxisomes by treatment with perfluorooctanoate does not increase rates of H,0; production in intact liver. Toxicology Letters 60 (1990) 61-68 [Submitted May 25, f 2000). Ss 18) Hanhijarvi, H., M. Ylinen, A. Kojo, and V.M. Kosma. Elimination and toxicity of = perfluorooctanoic acid during subchronic administration in the Wistar rat. Pharmacology & Toxicology 61 (1987) 66-68 [Submitted May 25, 2000). " EIDI01474 DRAFTJuly 26,2000 0096. Page2 John L. Buteahoff, et aL. DRAFT 1r000 19) Hanhijarvi, H., RH. Ophaug, and L. Singer. The sex-related difference in perfluorooctanoate excretion in the rat. Proceedingsof the Societyfor Experimental Biology & Medicine 171 (1982) 50-53 [Submitted May 25, 2000). 20) Haughom, B., and O. Spydevold. The Mechanism Underlying the Hypolipemic Effect of Perfluorooctanoic Acid (PFOA), Perfluorooctane Sulphonic Acid (PFOSA) and Clofibric Acid. Biochim. Biophys. Acta. 11281] (1992) 65-72 [SubmittedMay 25, 2000). 21) Hosokawa, M, and T. Satoh. Differences in the inductionofcarboxylesterase isozymes in rat liver microsomes by perfluorinated fatty acids. Xenobiorica 23 (1993) 1125-1133 [Submitted May 25, 2000). 22) Hurt, ME, SM. Murray, S.R. Frame,and J.C. Cook. Investigation ofa hormonally-mediated mechanism for ammonium perfluorooctanoate (C8)-induced Leydig ceil adenomas. Taxicologist 10 (1990) 192 [SubmittedMay 25, 2000}, 23) Ikeda, TK. Aiba, K. Fukuda, and M. Tanaka. The induction of peroxisome proliferation in rat liver by perfluorinated fatty acids, metabolically inert derivativesoffatty acids. J. Biochem. 98 (1985) 475-482 [Submitted May 25, 2000). 24) Inoue, T, T. Iwanaga, K. Fukushima, and R. Shimozawa. Effectsofsodium octanoate and sodium perfluorooctanoate on the gel-to-liquid-crystalline phase transitionofdipalmitoylphosphcahtoilidnye vesile membrane. Chem. Physics Lipids 46 (1988) 25-30 [Submitted May 25, 2000). 25) Johnson, J.D., S.J. Gibson, and R.E. Ober. Cholestyramine-enhanced fecal eliminationofCarbon-14 in rats after administration ofammonium perfluorooctanoate or potassium perfluorooctanesulfonate. Fundamental & Applied Toxicology 4 (1984) 972-976 [Submited May 25, 2000 & April 21, 2000) 26) Just, W.W.,K. Gorgas, F. Hart], P. Heinemann, M. Salzer, and H. Schimassek. Biochemical effects and zonal heterogeneity ofperoxisome proliferation induced by perfluorocarboxylic acids in rat liver. Hepatology 9 (1989) S70-581 [Submitted `May 25, 2000). 27) Kawashima, Y., T. Matsunaga, N. Uy-Yu, and H. Kozuka. Induction by `perfluorooctanoic acidof microsomal I-acylglycerophosphocholine acyltransferase in rat kidney. Sex related difference. Biochemical Pharmacology 42.(1991) 1921-1926 [SubmittedMay 25, 2000). EIDI01475 DRAFT July 28,2000 coains Pee John L. Buteahofe,t al. DRAFT 112000 28) Kawashima, Y., S. Suzuki, H. Kozuka, J. Sato, and Y. Suzuki. Effects of prolonged administrationofperfluorooctanoic acid on hepatic activities of enzymes which detoxify peroxide and xenobiotic in the rat. Toxicology 93 (1994) 85-87[Submitted May 25, 2000]. 29) Kawashima, Y.,N. Uy-Yu, and H. Kozuka. Sex-related difference in the inductions by perfluorooctanoic acid of peroxisomal B-oxidation, microsomal 1acyglycerophocholin acyltransferase and cytosolic long-chain acyl-CoA hydrolase: in rat liver. Biochem J. 261 (1989) 595-600 [Submitted May 25, 2000) 30) Keller, BJ, D.S. Marsman, J.A. Popp, and R.G. Thurman. Several nongenotoxic carcinogens uncouple mitochondrial oxidative phosphorylation. Biochimica et Biophysica Acta. 1102 (1992) 237-244 [Submited May 25, 2000). 31) Kennedy, G.L. Dermal toxicityofammonium perfluorooctanoate. Toxicology & Applied Pharmacology 81 (1985) 348-355 [SubmittedMay 25, 2000]. 32) Kennedy, G.L. Increasein Mouse Liver Weight Following Feeding of Ammonium Perfluorooctanoate and Related Fluorochemicals. Toxicology Letters 39 (1987) 295-300 (Submitted May 25, 2000). 33) Kennedy, GL, G.T. Hall, MR. Brettelli, JR. Bares,and H.C. Chen. Inhalation toxicity ofammonium perfluorooctanoate. Fd. Chem. Toxic. 24 (1986) 1325-1329 [Submitted May 25, 2000). 34) Kinney, L.A, N.C. Chromey, G.L. Kennedy. Acute inhalation toxicity of ammonium perflurooctanoate (abstract). Food Chem. Toxicol. 21 (1989) 465468 (Submitted May 25, 2000). 35) Kojo, A., H. Hanhijrvi, M. Ylinen, and V.-M. Kosma. Toxicity and kinetics of perfluoro-octanoic acid in the Wistar rat. ArchivesofToxicology (Toxic Interfaces of Neurons) Supplement 9 (1986) 465-468 (Submitted May 25, 2000). 36) Kun, E. Fluorocarboxylic acids as enzymatic and metabolic probes. In: Biochemistry Involving Carbon-Fluorine Bonds. Ed: R. Filler. ACS Symposium Series Number 28, American Chemical Society, Washington 1976, 1-22. (QDI Am3s #28) [Submitted May 25, 2000) 2 37) Kuslikis, BLL, JP. Vanden Heuvel, and R.E. Peterson. Lackofevidence for 8 2 fpeermfallueorraotdse.cJa. nBoiyolc-hoermp.erTfolxuiocrooloocgtyan7o(y1l9-9c2o)en2z5y-m3e6 A[SfuobrmmiatttieodnMian yma2l5,e and 2000). 2 DRAFTJuly 25,2000 EIDI101476 edgar, Page 2 John L. Butenhoff, etl. DRAFT nao 38) Levit, D., and A. Liss. Perfluorinated fatty acids alter merocyanine 540 dye bindingto plasma membranes. Journalof Toxicology & Environmental Health 20 (1987) 303-316 [Submitted May 25, 2000). 39) Levitt, D,andA. Liss. Toxicityofperfluorinated fatty acids for human and `murine B cell lines. Toxicology &Applied Pharmacology 86 (1986) 1-11 [SubmittedMay 25, 2000). 40) Liu, M.S. and D.M. Long. Biological dispositionofperfluoroctylbromide: Tracheal administration in alveolography and bronchography. Investigative Radiology 11 (1976) 479-485[Submitted May 25, 2000). 41) Lpieur,flRuoCr;oocMtEan.oaHtuer(Ct8J).Co.nCaorookm,atLaBse.aBcitcigveilt.y iEn tifssuoefsfaofmemmaoclneiCturml:CD BR (CD) rats. Toxicologist 14[1] (1994) 300 [Submitted May 25, 2000]. 42) pLriovl,ifReCraMto,rsCo.n rHaathenL,eyadnidgMc.eEll.fHuunrcttti.onThinevdiitrreoct(aebfsftercatcotf).heFpuantdiacmpeenrtoaxli&some Applied Toxicology 30 (1996) 102-108 [Submitted May 25, 2000} 43) Liu, RC. ME. Hurtt, J.C. Cook, and LB. Biegel. proliferator, Ammonium Perfluorooctanoate (C8), Effect ofperoxisome on hepatic aromatase activity in adult male Crl:CD BR (CD) rats. Fundamental & Applied Toxicology 30 (1996) 220-228 (Submitted May 25, 2000). 44) L`Goenngosttoaxfifc,itE.y,aMn.d Rcoarbciinnsoogne,niCc.itByroafdfblruooorko,caJ.rAb.o,nsa:ndASstsyelesss,mFe.nHt.bPyurschhoarste-.term in vitro tests and chronic exposure in rats (abstract). Toxicol. Appl. Pharmacol. 72 (1984) 15-31 [Submitted May 25, 2000). 45) Nabbefeld, DJ. An Investigationofthe Effects of Fluorochemicals on Liver Fatty AUnciivde-rBsiintdyionfgMPirnotneeisno.taA, Atphresiils1s9u9b8mi[tStuebdmtiotttehdeMGaraydu2a5,te20S0c0h)oolofthe 46) fNraobmbeFfaetltdy,Aectiadl,CaDrirsipelraPcreomteenitnsobfay WFlyuoertes--hce1n4t,l6y4L3,abAemlemdoFnaittuymAcid Analogue Perfluorooctancate, Potassium Perfluorooctane Sulfonate and Other Known 2 Peroxisome Proliferators, Abstract, Societyof Toxicology, 1998 Annual Meeting (Submitted May 25, 2000). 2g 47) NHielpsastoonc,arR.c,inBo.geBneiicjei,tyV.ofPprearto,xKi.soEmreixporno,liafnerdatCo.rsR.aCmheelm.icOanl-tBhieomleogcihcaanlismofthe Interactions 78 (1991) 235-250 [Submitted May 25, 2000} EIDI01477 DRAFT July 26,2000 canine Page 2s John L. Butenhof, tal DRAFT 112000 48) sNoerrdubmya,lbG.uLm.i,n.anJdouJr.nMa.lLoufcBki.olPoegrifclaulorCohoecmtiasnotircy a2c1i9d (i1n9te5r6a)ct3i9o9ns-4w0i4th(Shuubmmaitnted May 25, 2000] 49) Oboum, J.D., SR. Frame, RH. Bell, Jr, D.S. Longnecker, G.S. Elliott, andJ. C. Cook. Mechanisms for the pancreatic oncogenic effects ofthe peroxisome proliferators Wyeth-14,634 (abstract). Toxicology & Applied Pharmacology . 145(2) (1997) 425-436 [Submitted May 25, 2000]. 50) Odell, W.D., RS. Swerdloff, J. Bain, F. Wollensen, and PK. Grover. The effect ofsexual maturation on testicular response to LH stimulationof testosterone secretion in the intact rat. Endocrinology 95 (1974) 1380-1384 [Submited May 25, 2000). 51) Ohya, etal. Determinationof Perfluorinated Carboxylic Acids in Biological Samples by High-Performance Liquid Chromatography. J. Chromatography, 720 (1998) 1-7 [SubmiMtatye25d,2000]. 52) Olsen, G.W., F.D. Gilliland, MM. Burlew, JM. Burris, 1S. Mandeland JH. Mandel. An epidemiologic investigationofreproductive hormones in men with occupational exposuretoperfluorooctanoic acid. JOEM 407] (July 1998) 614622 [Submitted May 25, 2000]. 53) Olsen, Geary W [etal], An Epidemiologic Investigation of Plasma Cholecystokinin and Hepatic Function in Perfluorooctanoic Acid Production `Workers, 3M Final Report EPI-0003, (1997) [Submitted May 25, 2000} 54) Olson, C.T., and M.E. Anderson. The acute toxicityofperfluorooctanoic and perfluorodecanoic acids in mate rats and effects on tissue acids. Toxicology & AppliedPharmacology 70 (1983) 362-372 [Submitted May 25, 2000]. . 55) Olsson, U. C. Sundberg, K. Andersson, and J.W. DePierre. Further studies on the involvement of selenium in peroxisome proliferation inra liver: Comparison of effects with clofibric acid and perfluorooctanoic acid and the pharmacokinetics of (14C) clofibrate. Biochemical Pharmacology 46 (1993) 1805-1810 [Submitted May 25, 2000) 56) Ophaug, RH, and L. Singer. Metabolic handlingofperfluorooctanoic acid in 2 rats. Proc. Soc. Exp. Biol. Med. 163 (1980) 19-23 [Submitted May 25, 2000), g 57) cPyaclleopdue,xRt.r,inasndwiVt.hC.soRdeiiunmsbpoerrofulguho.rooScotlauntoiaotne.inCcalunsaidoinacnoJmopulrenxaelsooffChemistry 67 = (1989) 1550-1553 [Submitted May 25, 2000). DRAFT fly 26,2000 cada EIDI01478 Pages John L. Butenhoff eta. DRAFT 12000 58) Pastoor, T.P,, K.P. Lee, M.A. Perr, and P.J. Gillies. Biochemical and `morphological studiesofammonium perfluorooctanoate-induced hepatomegaly and peroxisome proliferation. Experimental andMolecular Pathology 47 (1987) 98-109 [Submitted May 25, 2000). 59) Perkins, R. Investigation ofammonium perfluorooctanoate effect on hormone levels and peroxysome proliferation in the rat. Toxicologist 12 (1992) 38 [SubmittedMay 25, 2000). 60) Permadi, H, B. Lundgren, K. Andersson, and J.W. DePierre. Effectsofperfluoro fatty acids on xenobiotic-metabolizing enzymes, enzymes which detoxify reactive formsofoxygen and lipid peroxidation in mouse liver. Biochemical Pharmacology 44 (1992) 1183-1191 [SubmittedMay 25, 2000), 61) Permadi, H., B. Lundgren, K. Andersson, C. Sundberg, and J.W. Depierre. Effects ofperfluorofatty acids on peroxisome proliferation and mitochondrial size in `mouse liver - dose and time factors and effect ofchain length. Xenobiotica 23 (1993) 761 [Submitted May 25, 2000). 62) Peterson, RE., BLL Kuslikis, and J.P. Vanden Heuvel. Protein acylation by the peroxisome proliferators perfluorodecanoic acid (PFDA) and perfluorooctanoic acid (PFOA) in rats. Toxicologist 11 (1991) 185 [Submitted May 25, 2000). 63) Reich, LL., HJ. Reich, L.A. Menahan, and R-E. Peterson. Synthesis of "Clabeled perfluorooctanoic and perfluorodecanoic acids: purification of `perfluorodecanoic acid. Journal ofLabeled Compounds & Radiopharmaceuticals 24 (1987) 1235-1244 [Submitted May 25, 2000). 64) Romer, M.A. The effect ofperfluorooctanoic acid upon microsomal membrane peroxidation. Pharmacology 41 (1981) 2997-3013[Submitted May 25, 2000) 65) Simister, EA. EM. Lee, JR. Lu, RK. Thomas, RH. Ottewill, AR. Rennie, and J. Penfold. Adsorptionofammonium perfluorooctanoate and ammonium decanoate at the ait/solution interface. Journal ofthe Chemical Society 88 (1992) 3033-3041 [Submitted May 25, 2000), Z 66) PSeorhflleunoiruoso,cAtKan.e,sAulMfo.niEcraickisdsoins,aC.poHteongtstirndoumc,erM.ofKpiemrloaxnids,omJa.lW.faDtetpyiearcried.B- 3 oxidation and other activities known to be affected by peroxisome proliferators in mouse liver. Pharmacology & Toxicology 72 (1993) 90 (Submitted May 25, 2000), EID101479 DRAFT July 28,2000 QRS pager John L. Buteahof, ta. DRAFT 112000 67) Sohlenius, AK., K. Andersson,andJ. DePicrre. The effects of perfluoro-octanoic acid on hepatic peroxisome proliferation and related parameters show no sexrelated differences in mice. Biochem. J. 285 (1992) 779-783 [Submitted May 25, 2000). 68) Staples, RE., B.A. Burgess, and W.D. Kems. The embryo-fetal toxicity and teratogenic potential ofammonium perfluorooctanoate (APFO) in the rat. Fundamental & Applied Toxicology 4 (1984) 429-440 (Submitted May 25, 2000). 69) Staples, RE. Improper interpretationof data concerning teratogenicity: Acase report. Prevention ofPhysical and Mental Congenital Defects, Part C: Basic and MedicalScience, Education and Future Strategies (1985) 161-163 [Submitted May 25, 2000). 70) Takagi, A., K. Sai, T. Umemura, R. Hasegawa, and Y. Kurokawa. Short-term peexrpfolsuuorreodtoectahneopiecraocxidi,socmauespersolsiifgenriaftiocrasn,tpienrcfrleuaosreosoocft8a-nhoyicdraocxidydaenodxyguanosine in liver DNAofrats. Cancer Letters 57 (1991) 55-60 [Submitted May 25, 2000). 71) Thottassery, J., L. Wingerg, J. Youssef, M. Cunningham, and M. Badr. Regulation of perfluorooctanoic acid-induced peroxisomal enzyme activities and hepatocellular growth by adrenal hormones. Hepatology 15 (1992) 316-322 (Submitted May 25, 2000), 72) bTerteiwneeer,n Cw.a,taenrdanAdKa.lkCahlaitpteorfplaudohryoaoyc.taTnhoaetepamritcietliloens.coeJfofuircniaelnot offvCaorlilooiuds&alcohols Interface Science 92 (1984) 447-458 [Submitted May 25, 2000]. 73) Trosko, James E. Oxidative Stress, Signal Transduction, Cell-Cell Communication, U.S. Dept. of Commerce, 1999) (Submitted May 25, 2000) NTIS # F42960-97-0022 (February 28, 74) Ubel, F.A., et al. Health StatusofPlant Workers Exposed to Fluorochemicals- A Preliminary Report, Am. Ind. Hyg. Assoc. J. 41 (August 1980) 584-589 [Submitted May 25, 2000). 75) Uy-yu,N,, Y. Kawashima, S. Horii, and H. Kozuka. Effectsof Chronic z2 AdministrationofPerfluorooctanoic Acid on Fatty Acid Metabolism in Rat Liver: g Relationship among Stearoyl-Coenzyme A Desaturase, 1- 3 Acylglycerophosphocholine Acyltransferase, and Acyl Composition of [MSiucbrmoistotmeadlMPahyos2p5h,at2i0d00y)l,choline. J. Pharmacobio-Dyn. 13 (1990) 581-5 EID101480 DRAFTJuly28,2000 canesn neem John L. Butenhof,etal. DRAFT 112000 76) Vanden Heuvel, J.P., J.W. Davis, R. Sommers, and R.E. Peterson. Renal excretion ofperfluorooctanoic acid in male rats: Inhibitory effectoftestosterone. Journal of Biochemical Toxicology 7 (1992) 31-36 [Submitted May 25, 2000). 77) Vanden Heuvel, J.P, B.L. Kuslikis, and R.E. Peterson. Covalent binding of perfluorinated fatty acids to proteins in the plasma, liver and testesofrats. Chem.Biol. Interactions 82 (1992) 317-328 [Submitted May 25, 2000). 78) Vanden Heuvel, J.P., B.. Kuslikis, M.J. Van Rafelghem, and R.E. Peterson. Tissue distribution, metabolism and eliminationofperfluorooctanoic acid in male and female rats. Journal ofBiochemical Toxicology 6 (1991) 83-92 (Submitted May 25, 2000). . 79) Vanden Heuvel, IP, M.J. Van Rafelghem, L.A. Menahan, and RE. Peterson. Isolation and purification ofperfluorodecanoic and perfluorooctanoic acids from rat tissues. Lipids 23 (1989) 526-531 [SubmittedMay 25, 2000). 80) TWwiot-zdmiannenn,siFo.nAa,l CE.leFcutlrtozp,haornedtiJ.cLPiapttsecronmsbo.f THeopxaitciacntainnddRuecneadlASlttreersastiPornosteiinns. Electrophoresis 17 (1996) 198-202 [Submitted May 25, 2000), 81) IWmimtuznmoagnlno,bFu.lAi.n, BH.eMa.vyJaCmhoati,nDB.iNn.diPnargkPerr,otJeiWn.(BClIaPc/kG.rpM7od8i)fFioclaltoiwoinnogfEHxeppoastiucre to Structurally Diverse Peroxisome Proliferators. Fundamental & Applied Toxicology 23 (1994) 1-8 [Submitted May 25, 2000} 82) LWDiSt0zmEanxnp,osFu.rA.e,toD.PePrafrlkueorr,oacnadrbBo.xyJlaimcoAtc.idIsndDuectteicotneodfbEynTowyol--dCiomAenHsyidornaatalse by Electrophoresis. Toxicology Letters 71 (1994) 271-277 [Submitted May 25, 2000}. 83) Ylinen, M., A. Kojo, H. Hanhijdrvi, and P. Peura. Disposition of `pBeurlflleutionrooofcEtnanvoiirconamceidntianltCheonrtatamaifneartsiionngl&e aTnodxiscuoblcohgryon4i4c(a1d9m9i0n)is4t6ra-t5i3on. [SubmittedMay 25, 2000). 84) ofYltihneen,urMi.n,arHy.exHcarnehtiijodnrvoif,p1.erJfalaukoornoaohcot,anaonicd aPc.iPdeiunrat.heStmiamluelaratti.onPhbayromeasctroaldoigoly 2 Z & Toxicology 65 (1989) 274-277 [Submitted May 25, 2000). $ 85) Yclhirnoemna,toMg.r,aHp.hiHcandheitjerrmviin,aPt.ioPneuorfaP, FanOdAOa.sRthiemb.enQzuyalnteistteartiivnepglaassma and urine. ArchivesofEnvironmental Contamination & Toxicology 14 (1985) 713-717 [Submitted May 25, 2000). EID101481 DRAFT July 28,2000 000 + Page 29 John L. Butenhof,et a. DRAFT 112000 86) Youssef, J. and M. Badr. Extraperoxisomal TargetsofPeroxisome Proliferators: Mitochondrial, Microsomal, and Cytosolic Effects. Implications for Health and Disease. Critical Reviews in Toxicology 28(1] (1998) 1-33 (Submitted May 25, 2000). 1. 3M Company. 1992. FC-143 FluoradTM Brand Fluorochemical Surfactant. MSDS No. 10-3808-2, 3M Industrial Chemical Products Division, St. Paul, MN. 2. 3M Company. 1981. Fluorad TM Brand Fluorochemical Surfactant FC-143. Product Environmental Data, 3M Environmental Engineering and Pollution Control, St. Paul, MN. 3. ACGIH. 1991. Ammonium perfluorooctanoate. In: Documentationofthe Threshold Limit Valuesand Biological Exposure Indices. 6th ed. , Vol. 1. American Conference of Governmental Industrial Hygienists, Inc., Cincinnati, OH, pp. 61-2. 4. Behr, FE, Johnson, J.D. and Ober, RE. 1979. SynatndhChareactseriizatison of FC-143-4C. 3M Commercial Chemicals Division and Riker Laboratories, Inc., St. Paul, MN. 5. Belisle, J. 1978. Memo to J. Pendergrass regarding [BT 8532-10654 and IBT 853210655. 6. Belisle, J. 1978. FC-143rattoxicity study. Request No. A67821, 3M Central Analytical Laboratory, St. Paul, MN. 7. Belisle, J. 1978. FC-143 analysis ofIRDC 137-090 samples. Request No. AG8616, 3M Central Analytical Laboratory, St. Paul, MN. 8. Belisle, J. and Bunnelie, V. 1979. FC-143 inhalation study - analysis for F' and RF. Report No. 7166, 3M Central Research Laboratory, St. Paul, MN. 9. Christopher, B., Marias, A.J., Amold, D.W., Kinoshita, F.X., and Bonahoom, Y. 1977. 28-Day oral toxicity study with FC-143 in albino mice. IBT No. 8532-10655, Industrial Bio-Test Laboratoies, Inc., Northbrook, IL 2 10. Cook, J.C., Murray, S.M., Frame, S.R. and Hurtt, M.E. 1992. Induction of Leydig z cmeelclhaadneisnmo.masTobxyicaolm.moApnpil.umPhpaerrfmlaucoorlo.oct1a1n3o,at2e0:9-a17p.ossible endocrine-related S 3 11. Dean, W.P., Jessup, D.C., Thompson, G., Romig, G. and Powell, D. 1978. FluoradTM Fluorochemical FC-143 acute oral toxicity (LDS0) study in rats. Report No. 137-091, Intemational Research and Development Corp., Mattawan, MI. DRAFT July 28, 2000 EIDIONS2 peso 039.25 John L. Butenhof,et a. DRAFT 12000 12. Handler, J.A., Seed, C.B., Bradford, B.U. and Thurman, R.G. 1992. Induction of peroxisomes by treatment with perfluorooctanoate does not increase rates of H,0, production in intact liver. Toxicol. Let. 60, 61 -M. 13. DuPont. 1988. Ammonium perfluorooctanoate. Toxicity Hazard Information for MSDS. 14. Gabriel, K.L. 1976. Primaryeye imitation study -rabbits; T-1395. Biosearch, Inc., Philadelphia, PA. 15. Gabriel, K.L. 1976. Primary skin irritation st-uradbbiyts; T-1395. Bioscarch, Inc, Philadelphia, PA. 16. Gabriel, K.L. 1976. Primary eye irritation [washout] study - rabbits; T-1395. Biosearch, Inc. Philadelphia, PA. 17. Gabriel, K.L. 1976. Acute oral toxic-irtatys [LDS0 with T-1395). Biosearch, Inc., Philadelphia, PA. 18. Gabriel, K.L. 1976. Acute oral toxicity - rat limittestwith T-1385 (sic)). Biosearch, Inc., Philadelphia, PA. 19. Garry, V.F. cytotoxicity and Nelson, in C3H 10T1/2 RL. clonal 1981. cell line An for assay the test of cell chemical transformation and T-2942CoC. Stone: Research Laboratories, Minneapolis, MN. 20. GFolludoernatdh(aRl),FEl.uLo,rJoecshseumpi,cDa.lC.F,C-G1ei4l3, nRi.nGe.t,yJdeaffyerssuobna,cNut.eD.raatntdoxAircciteyo,stRu.dJy.. 1R97e8p.ort No. 137-089, Intemational Research and Development Corp., Mattawan, MI. 21. Goldenthal,ELL, Jessup, D.C., Geil, RG. and Mehring, JS. 1978. Fluorad(R) Fluorochemical FC-143 ninety day subacute rhesus monkey toxicity study. Report No. 137-090, Intemational Research and Development Corp., Mattawan, Ml. 22. Gortner, E.G., Lamprecht, 2998CoC in pregnant rats. E.G. and Expt. Case, M.T. 1981. No. 0680RRO01S, Oral rangefinder study of Riker Laboratories, Inc, TSt. Paul, MN. 23. Gorter, E.G., Lamprecht, E.G. and Case, M.T. 1981. Oral rangefinder study of T- Z5 3141CoC in pregnant rabbits. Expt. No. 0681RBO331, Riker Laboratories, Ine. St. 5 Paul, MN. 3 24. Gorter, E.G., Lamprecht, E.G. and Case, M.T. 1981. Oral teratology study of T2998CoC in rats. Expt. No. 0681TRO110, Riker Laboratories, Inc., St. Paul, MN. DRAFTJuly 28,2000 EID101483 Page 31 C3900 John L. Buteahof,etal. DRAFT 112000 25. Gorter, E.G., Lamprecht, E.G. and Case, MT. 1982. Oral teratology study ofT314ICoCinrabbits. Expt. No. 0681TBO398,Riker Laboratories,Inc.,St. Paul, MN, 26. Griffith, F.D. and Long, J.E. 1980,Animal toxicity studies with ammonium perfluorooctanoate. Am. Ind. Hyg. Assoc. J. 41, 576-583. 27. Jagannath, D.R. and Brusick, D. 1978. Mutagenicity evaluation of T-2015CoC in the Ames Salmonella/microsome plate test. Project No. 20838, Litton Bionetics, 28. Johnson, J.D. and Conard, G.J. 1983. Extent and routeofexcretionoftotal carbon14 pregnant rats after 2 single oral dose of ammonium "C-perfluorooctanoate. Riker Laboratories, Inc., St. Paul, MN. 29. Johnson, J.D. and Ober, RE. 1979. Absorption of FC-143-C in rats after a single oral dose. Riker Laboratories, Inc, St. Paul, MN. 30. Johnson, J.D. and Ober, RE. 1980. Extent and route of excretion and tissue distributionoftotal carbon-14inmale and female rats aftear single IV dose of FC1434C. Riker Laboratories, Inc., St. Paul, MN. 31. Johnson, J.D. and Ober, RE. 1980. Enhanced elimination of FC-95-"C and FC143-4C in rats with cholestyramine treatment. Riker Laboratories, Inc., St. Paul, MN. 32. Kennedy, G.L. Jr. 1985. Dermal toxicity of ammonium perfluorooctanoate. Toxicol. Appl. Pharmacol. 81, 348-355. 33. Kennedy, GL. Jr, Hall, GT, Briteelli, MR., Bames, LR. and Chen, H.C. 1986. Inhalation toxicity of ammonium perfluorooctancate. Fd. Chem. Toxicol. 24, 1325-1329. 34. Kennedy, G.L. and Keplinger, M.L. 1976. Reverse mutation studies with T-1485 2 IinndfuisvteriSaallBmioon-eTlelsatsLtarbaionrsataonrdieosn,eInSca.c,cNhoarrtohmbryocoeks,sItLra.in. IBT No. 854G-09238, z 8 35. Metrick, M., Marias, AJ, Amold, D.W., Kinoshita, FX., Phillips, SM. and Bonahoom, Y. 1977. 28-Day oral toxicity study with FC-143 in albino.rats. IBT No. 8532-10654, Industrial Bio-Test Laboratories, Inc., Northbrook, IL. EID101484 DRAFT July 28,2000 C00sIn Page32 JohnL. Butenhoff,eta. DRAFT 12000 36. O'Malley, K.D. and Ebbens, K.L. 1981. Repeat application 28 day percutaneous absorption study with T-2618CoC in albino rabbits. Expt. No. 09790ABO4SS, Riker Laboratories, Inc., St. Paul, MN. 37. Palazzolo, MJ. 1991. 13-Week toxicity study with T-5180, ammonium perfluorooctanoate (CAS No. 3825-25-1) in male rats. Draft Report No. HWI 6329-100, Hazleton Wisconsin, Madison, WI. 38. Pastor, TP, Lee, KP. Perri, MA. and Gilles, P.J. 1987. Biochemical and `morphological studies of ammonium perfluorooctanoate-induced hepatomegaly and peroxisome proliferation. Exp. Mol. Pathol. 47, 98-109. 39. Rusch, GM. and Rinchart, W.E. 1979. An acute inhalation toxicity study of T2305CoC in the rat. Project No. 78-7184, Bio/dynamics, Inc. 40. Sibinski, LJ, Allen, JL. and Erickson, EE. 1983. Two year oral (diet) toxicitylcarcinogenicity study of fluorochemical FC-143 in rats. Expt. No. 0281CRO012, Riker Laboratories, Inc., St. Paul, MN. 41. Staples, RE. Aftosmis, J.G. and Barba, CM. 1982. C-8 gavage: embryo-fetal toxicity and teratogenicity study in the rat. Report No. 881-82, DuPont Haskell Laboratory, Newark, DE. 42. Staples, RE., Aftosmis, J.G. and Barba, C.M. 1982. C-8 inhalation: embryo-fetal toxicity and teratogenicity study in the rat. Report No. 881-81, DuPont Haskell Laboratory, Newark, DE. 43. Staples, R.E., Burgess. B.A. and Kems, W.D. 1984. The embryo-fetal toxicity and teratogenic potential of ammonium perfluorooctanoate (APFO) in the rat. Fund. Appl. Toxicol. 4,429440. 44. Ubel, FA, Sorenson, S.D. and Roach, D.E. 1980. Health status of plant workers exposed to fluorocheampirecliamlinsar,y report. Am. Ind Hyg. Assoc. J. 41, 584-589. 45. ACGIH. 1993. Ammonium perfluorooctanoate (draft). In: Documentationofthe `Threshold Limit Values and Biological Exposure Indices. American Conference of Governmental Industrial Hygienists, Inc., Cincinnati, OH. . 46. Hanhijarvi, H., Ophuag, R.H.andSinger, L. 1982. The sex-related difference in gZ perfluorooctanoate excretion in the rat. Proc. Soc. Exp. Biol. Med. 171,51-55. G 47. Perkins, RG. 1988. Summaryofthe reviewofthe FC-143 two-year feeding study report (reviewed bythe consultants). 3M Internal Correspondence to F.D. Griffith. February 3, 1988. DRAFT July 26,2000 EIDI01485 Page 33 00050 John L. Butenhof, ta. DRAFT 12000 48. Vanden Heuvel, J.P., Davis, J.W., Sommers, R. and Peterson, RE. 1992. Renal excretionofperfluorooctanoic acid in male rats: inhibitory effect of testosterone. J. Biochem. Toxicol. 7, 316, 49. Cook, J.C. 1993. DuPont Internal Correspondence provided to J.L. Butenhoff. September 23, 1993. 50. PAFT. 1993. Safety implicationsof Leydig cell tumors associated with HFA-134a in ats. Program for Alterative Fluorocarbon Toxicity Testing Consortium. SI. Ylinen, M., Hanhijarvi, H, Jaakonaho, J. and Peura, P. 1989. Stimulation by oestradiol of the urinary excretion of perfluorooctanoic acid in the male rat. Pharmacol. Toxicol. 65, 274-277 52. Hanhijari, H., Ylinen, M., Haaranen, T. and Nevalainen, T. 1988. A proposed aspnedciraets. dIinffNereewncDeeivnetlhoepmreennatlseixncrBeitoisocnioefncpeesr:fTlhueiorriomopclitcaantaiocoincdsfionrthLeabboeraagtloerdyog Animal Science, A.C. Beynen and H.A. Solleveld, Eds. pp. 409-412, Martinus Nijhoff, Dordrecht. 53. Kawashima, Y., Uy-YuN,. and Kozuka, H. 1989. Sex-related difference in the aincdyulcgtliyocnesrobpyhpoesrpfhloucohrool-ioncetaancoyilctraacnisdfoefrapseeroaxnidscoymtaosloloixcildoantgi-ocnh,amiincarcoyslo-mCaolA 1hydrolase in rat liver. Biochem. J. 261, 595-600. 54. Iprkoeldisf,erTa,tiAoinbien,raK.,iFvuekrubdya,peKr.flaunodriTnaanteadkaf,atMt.y 1985. acids, The inductionofperoxisome metabolically inert derivatives offaty acids. J. Biochem. 98, 475-4822. 55. Bicgel, L.B., Hurt, ME., Frame, SR. and Cook, J.C. 1993. Effects of ammonium perflucrooctanoate (C8) on leydig cell function: in vivo, ex vivo and in vitro studies. Toicologist, 13,399. $6. Cook, J.C., Hurt, ME., Frame, SR. and Biegel, L.B. 1993. Effects of Wyeth14,643 (WY) and ammonium perfluorooctanoate (C8) in Crl:CD*BR(CD) Rats. Toxicologist 13, 399. 57. Liu, RCM, Hurt, ME, Cook, LC. and Biegel, L.B. 1994. Effect of ammonium 2 pRaetrsf.luToorxoioccotlaongoiastte1(4C,83)00o.n aromatase activity in tissues of male Crl:CDBR(CD) 3g $8. Uy-Yu, related N,, Kawashima, Y. and difference in biological Kozuka, H. responses 1990. Comparative studies on of livers to perfluorooctanoic. sexacid between rats and mice. Biochem. Pharmacol 39, 1492-1495. DRAFT July 25,2000 EIDI01486 Page 34 ee0sir John L. Buta etal. DRAFT 11200 59. Abdellatif, A.G., Preat, V., Taper, H.S. and Roberfroid, M. 1991. The modulation ofrat liver carcinogenesis by perfluorooctanoic acid, a peroxisome proliferator. Toxicol. Appl. Pharmacol. 111, 530-537. i 60. LLeosnigo,nsP.iLn. th1e9C9r2l.:-SCpDontBaRncRoauts. NCehoaprllaesstiRciveLre,siIoncn.s, KainndgsSteolne,ctNeYd.Non-Neoplastic 761-70. 61. Permadi, H., Lundgren, B., Andersson, K., Sundberg, C. and DePierre, J.W. 1993. `Effectsofperfluoro fatty acids on peroxisome proliferation and mitochondrial size in mouse liver: doseand time factors and effect on chain length. Xenobiotica 23, 62. Olson, C.T. and Anderson, M.E. 1983. The acute toxicityofperfluorooctanoate and perfluorodecanoic acids in male rats and effects on tissue fatty acids. Toxicol Appl. Pharmacol. 70, 362-72. 63. Kennedy, G.L., Jr. 1987. Increase in mouse liver weight following feeding of ammonium perfluorooctanoate and related fluorochemicals- Toxicol. Lett. 39, 295300. 64. LGoenngosttoaxfifc,itEy.,aRnodbicnasrcoinn,ogMe.n,icBirtaydobfrfolouko,roCc.a,rSbtoylness:, aJs.sA.esasnmdenPturbcyhassheo,rtI-. t1e9r8m4.in vitro tests and chronic exposure in rats. Toxicol. Appl. Pharmacol. 72,15-31 65. Lundgren, B., Meijer, J., Birberg, W., Piotti, A. and DePierre, J.W. 1988. Induction ofcytosolic and microsomal epoxide hydrolases in mouse liver byperoxisome proliferators, with special emphasis on structural analogues of 2-ethylhexanoic acid. Chem. Biol. Interact. 68,219-240. 66. Revici, E. 1986. Treatment of symptoms of neoplastic diseases. U.S. Patent No. 4624851, 11/25/86 (Avram, Elena). 67. Keller, BJ, Marsman, DS., Popp, JA. and Thurman, RG. 1992. Several nongenotoxic carcinogens uncouple mitochondrial oxidative phosphorylation. Biochim. Biophys. Acta 1102, 237-244, 2 68. Perkins, RG. 1992. Investigation of ammonium perfluorooctmoate effect on 3 `hormone levels and peroxisomal proliferation in the rat. Toxicologist 12, 38. 2 395 69. Fuller, D.R. and Intrasuksri, U. 1993. Mechanism of peroxisome proliferation by perfluorinated fatty acids in primary cultures of rat hepatocytes. Toxicologist 13, EID101487 DRAFT yJuly 28, 2000 Qea 9:3r%e hs 3s John L.Butenhoft etal. DRAFT 12000 70. Gilliland, F.D. and Mandel, 1.S. 1996 Serum perfluorooctanoic acid and hepatic enzymes, lipoproteins, cholesterol and triglycerides: a study of occupationally exposed men. Am. J. Ind. Med. 29. 560-568. 71. Gilliland, F.D. and Mandel, 1.5. Mortality among employees ofa perfluorooctanoic acid production plant. 1993. J. Occup. Med. 35, 950 -954. 72. Uy-Yu, N,, Kawashima, Y., Horii, S. and Kozuka, H. 1990. Effectsof chronic administrationofperfluorooctanoic acid on fatty acid metabolism in rat liver: relationship among stearoyl-coenzyme A desaturase, 1-acylglycerophosphocholine acyltransferase, and acyl compositionofmicrosomal phosphatidylcholine. J. Pharmacobio.-Dyn. 13, 581-590. . 73. Thoftassery, J., Winberg,L.,YouJs., Csunneinfgha,m, M.andBadr,M. 1992. Regulation ofperfluorooctanoic acid-induced peroxisomal enzyme activities and hepatocellular growth by adrenal hormones. Hepatology 15, 316-22. 74. Youssef, J. Igwe, O., Cunningham, M. and Badr, M. 1992. Regulation of hepatic inositol trisphosphate receptors by peroxisome proliferators. Toxicologist 12, 37. 75. Gilliland, F.D. 1992. Fluorocarbons and human health: studies in an occupational cohort. Ph.D. Dissertation, U. of Minnesotz, Minneapolis, MN. 76. Rogers-Back, A.M. and Clarke, J.J. 1986. Effect of perfluorinated carboxylic acids and polychlorinated biphenyls on intracellular communication ~ processes. Toxicologist 6,39. 77. Andersen, ME., Rogers, AM, George, ME. and Back, K.E. 1983. The toxicity of perfluoro-n-decanoic acid and 2,3,7,8-tetrachlorodibenzo-p-dioxin in LS178Y mouse lymphoma cells. Report No. AFAMRL-TH-82-50, Air Force Aerospace Medical Research Laboratory, Wright-Patterson AFB, Ohio. 78. Kubinski, H., Gutzke, GE. and Kubinski, Z.O. 1981. DNA-cell-binding (DCB) assay for suspected carcinogens and mutagens. Mutat. Res. 89, 95-136. 79. Guy, W.S., Taves, D.R. and Brey, W.S. 1976. Organic fluorocompounds in human plasma: prevalence and characterization. In: R. Filler, ed., Biochemistry Involving g Carbon-Fluorine Bonds. ACS Symposium Series No. 28. Washington, DC, American Chemical Society, Vol. 7, p. 117. g 80. Rozner, M.A. and Taves, DR. 1980. Comparison of lipid peroxidation by perfluorooctanoic acid or CCl, Presented at Society of Toxicology Meeting, Washington, D.C. EIDI01488 DRAFT July 28,2000 east Page36 John L. Butenhot, tal. DRAFT 12000 81. APbedreolxlaitsiofm,eAp,roPlriefaetr,atVi.o,nVaanmdemcogd,ulJa,tNiiolnsosforn,atR.liavnerdcRaorbceirnforgoeinde,siMs.by1929,03.adciicdhlaonrdopnhaefneonxopyianc.etiCcaracciidn,og2,e4n,e5s-irsi1c1h,lo1r8o9p9h-e1n9o0x2y.acetic acid, perfluorooctanoic 82. Hefafuecgthoofmp,erBf.luaonrdooScptyadneovioclda,ddO.(P1F9O92A.),Tpheerfmleucorhoaoncitsanmeusnudlefrolnyiicnagcitdhe(hPyFpOoSlAip)eamincd clofibric acid. Biochim. Biophys. Acta 1128, 65-72. 83. J1u9s8t9,.W.B,ioGcohregmaisc,aKl.,efHfaerctts,aFn,dHzeoinanlemhaentenr,oPg.e,neSiatlyaozafrp,eMr.oxainsdoSmcehiprmoalsisfcerka,tiHo.n induced by perfluorocarboxylic acids in rat liver. Hepatology 9, 570-81. 84. Ppeerrmlaudoir,oHf.a,ttLyuancdigdrseonn, xBe.,noAbnidoetriscs-omne,taKb.olainzdinDgePeinezryrmee,sJ,.eWn.z1y9m9e2s. wEhfifcehctdseotfoxify reactive formsofoxygen and lipid peroxidation in mouse liver. Bioche. Pharmacol. 44, 1183-91. 85. Socothalneoniicusa,ciKd.,oAnnhdeeprastsiocn,peKr.oxainsdoDmeePpireorlirf,erJ.at1i9o9n2a.nTdhreeleaftfeedctpsaroafmpeetrefrlsuosrhoo-w no sex-related differences in mice. Biochem. Toxicol. 285, 779-83. 86. Ttaekramgie,xpAo,suSraei,toK.t,heUpmeermouxrias,omTe.,prHoalsifeegraatwoar,s,Rp.earfnlduoKruoroocktaawnoai,cYa.ci1d9a9n1.d Shortperfluorodecanoic acid, causes significant increasesof 8-hydroxydeoxy-guanosine. in liver DNAofrats. Cancer Lett. 57, 55-60. 87. Ypeirifnleuno,roMo.c,tanKcoijco,aciAd.,in Htahnehirjataravfit,er Hs.ingalendanPdeusruab,chrP.oni1c99a0d.minisDtirsaptoiosni.tionBullo.f Environ. Contam. Toxicol. 44, 46-53. 88. oHafnhpiejrafrlvuio,rHoo,ctYalnioniecn, aMc.i,dKodjuor,iAng. asnudbKchorsomnai,c U.ad1m9i8n7i.strEaltiimoinnatinionWainsdtatroxircaittsy. Pharmacol. Toxicol. 61, 66-8. 89. rOaptsh.auPgr,ocR..Saocn.d Singer, L. 1980. Exp. Biol. Med. Metabolic handlingofperfluorooctanoic 163, 19-23. acid in < 90. Vanden Heuval, J, Kuslikis, B., Van Refelghem, M. and Peterson, R. 1991. Tissue Z distribution, metabolism and eliminationofperfluorooctanoic acid. J. Biochem. Toxicol. 6,83-92. 3 91. Bonser, GM. administration and upon Robson, LM. 1940. male mice of various The strains: effects of prolonged oestrogen developmentoftesticular tumors inthe strong A strain. J. Pathol. Bacteriol. 51,9-22 DRAFT July 28,2000 EIDI0I489 page; 080.7% John L. Butenhof?,ta. DRAFT 1120000 92. Levitt, D. and Liss, A. 1986. Toxicity of perfluorinated fatty acids for human and muriBnceell lines. Toxicol. Appl. Pharmacol. 86, 1-11 93. Levitt, binding D. to and Liss, A. 1987. plasmamembranes. Perfluorinated fatty acids alter merocyanine J. Toxicol. Environ. Health. 20, 303-316. 540 dye 94. Inoue, T., Iwanaga, T., Fukushima, K. and Shimozawa, R. 1988. Effects of sodium octanoate and sodium perfluorooctanoonatthe gel-to-liquid crystalline phase transitionofdipalmitoylphosphatidylcholine vesicle formation. Chem. Physics Lipids 46,2530. 95. Due, W., Dieckmann, K., determination of oestrogen Loy, V.and.Stein, H. receptor. progesterone 1989. Immunohistological receptor and intermediate filaments in Leydig cell tumors, Leydig cell hyperplasia and normal Leydig cells of the human testis. J. Pathol. 157, 225-234. 96. Castle, W. and Richardson, J. 1986. Leydig cell tumors and metachronous Leydig cell hyperplasia: a case associated with gynecomastiaandelevated urinary estrogens. J. Urol. 136, 1307-1308. 97. Rail, T. and Schleifer, L. 1990. Drugs effective in the therapies of epilepsies. In: A. Gilman, et al., eds. The Pharmacological BasisofTherapeutics. New York, Pergamon, pp. 450-1 98. Nordby, G.L. and Luck, JM. 1956. Perfluorooctanoic acid interactions with human serum albumin. J. Biol. Chem. 219, 399-404. 99. Belisle, content J. and Hagen, D.F. of whole blood, 1978. Method serum/plasma, for the determination of the total and other biological samples. fluorine Anal Biochem. 87, 545-55. 100. pBeelrifsllueo,rooJ.ctaannodic Hacaigdeni,n blDoFo.d an1d98o0.ther bAiolomgeitchalodsamfpolres.theAnadle.teBrimoicnhaetmi.on10o1,f 369-376. 22 101. Venkateswarlu, P. 1975. Determination of total biological materials by oxygen bomb and reverse fluorine in serum and extraction techniques. other Anal. 2 Biochem. 68, 512-521. 102. Belisle, J. 1981. Organic fluorine in human serum: natural versus industrial sources. Science, 212, 1509-10. EIDI01490 DRAFTJuly 28,2000 000.27 Page3s John L. Butenhof, etal. DRAFT 112000 103. Vbeonuknadtefslwuaorrliune, Pi.n 1o9r8g2a.niScodcioummpobuinpdhesnyalndmetbhiooldogfiocraldetmaetremriinaalst.ion oAnfacl.ovalCehnetlmy 54,1132:37. 104. eJlimoinahtiJon.noD.f,scGaiorbbsoonnn-,1S,.4J.inarnadtsObafetrer,aRd.mEi.ni1s9t8r4a.tioCnhoolfeasmtrmaomniineu-menhanced fecal ["Clperfluorooocrtpaontaosasituem ["Clperfluorooctancsulfonate. Fund. Appl. Toxicol. 4, 972-976. 105. K`upselrifkliuso,roBd.eLc,anVoyaln-doernpHeerufvleulo,roJo.cP.taannodylP-ectoeernsozny,meREAE.fo1r9m9a2t.ioLnaicnkmaolfeevainddenfceemafloer rats. J. Biochem. Toxi7,c25o-2l9, 106. Hosokawa, M. and Satoh, T. 1993. isozymes in rat liver microsomes bDyiffpeerrfelnucoersininattehde fiantdtuyctaciiodnos.fcXaernbooxbyiloetsitceara2s3e, 112533. 107. pVearnfdlueonriHneautveedlf,atJt.yP.a,cKiudsslitokipsr,otBeLi.nsainndtPheeteprlsaosn,m,REli.ver19a9n2d. teCsotveasloefntrabtsi.ndCinhgeomf Biol. Interact. 82,317-328. 108. Glaza M.S. Laboratory PSrionjgelcetdnousmebdeerrmHaWlIab6s3o2r9p-t1i5o3n./toHxaizcetlytsotnuWdyisocfoTn-s6i0n7I5nci.nMraabdbiistso.n 1W9I95.. 109. Nabbefeld D., Butenhoff fluorescently labeled fatty J, Bass N. and Seacat A. acid analogue from fatty acid 1998. Displacement of a carrier proteins by wyeth- o1t4h,e6r43k,noawmnmopneriouxmisopemreflpruoolriofoecrattaonrosa.teA,bsptroatcats.siAucmceppteerdf,luoTrooxoicctoalnoegissutlf1o9n9a8)t.e and 110. Olsen G.W., Gilliland An epidemiological FD, Burlew M.M., investigation of Burris J.M., Mendel J.S., reproductive hormones and in Mandel men J.H. with `occupational exposure to perfluorooctanoic acid. Abstract, Final Report, Manuscript submitted for publication 9/97. 111. OefbfoecutrsnofJ.WDy,etFhra1m4e,64S3R.,(AbEslltiroatctG.1S1.8,1)anTdoxCicooolokgiJs.tC..361,99273.2-P2a3n3c.reatic oncogenic 2 112. Johnson J. D. Final absorption/toxicity study of Repon- T-6075 in Analytical study. rabbits. 1995 (in Single-dose vivo reference dermal number: z 8 HWIH6329-153, Study number: AMDT-011795.1) 3M Environmental Laboratory 113. CMuhrilnieseH.haMmusttaegrenoivcairtyy(CteHsOt )oncellTs-.61395986.mCeaHsVuriSntgudychNroo.:mo1s7o3m8a8l-0-a4b3er7r.atCioomnsinign Hazelton Inc. Vienna, VA. EIDI01491 DRAFTIy28.2000 C3 Page 9 John. Bush cal DRAFT nas 114. Murli H. Mouse micronucleus test on T-6358 in an in-vivo mouse micronucleus assay. 1996. CHV Study No.:17388-0-455. Coming Hazelton Inc. Vienna, VA. 115. Maller W. Perfluorooctanoic acid ammonium salt, solution 30% Chromosome abberations in vitro in V79 Chinese hamster cells. 1996. Study number 96.0003. Hoechst Aktiengesellschaft Pharma Development Corporate Toxicology. Frankfurt am Main. 116. M`umlulteagreniWc.potPeenrtifalluoirnosotcrtaainnsssoufreSaamlmmoonnieulslaaztlypshuingmur(i3u0m%(AiMg)ESSTtuEdSyT).of199t6h.e SCotrupdoyratneuTmobxeircol9o6g.y0.00F2r.ankfHuoretcahsmtMaAiknt.iengesellschaft Pharma Development 117. Murli H. Mutagenicity test on T-6342 measuring chromosome aberrations in human lymphocytes with a confirmatory assay `with multiple harvests. 1996. CHV study No.: 17073-0-449CO. Coming Hazelton Inc. (CHV), Vienna ,VA. 118. L`ipue,roRxiCsoMme,proHluifretratMorE, ,ammCoonoikumJ.Cp.erfalnudoroBoicetgaenloaLt.eB(.CB1)99o6n. Effects of the hepatic aromatase activity in adult male Crl:CD BR (CD) rats. Fund. Appl. Toxicol. 30, 220-228 119. Liu R.C.M., Hahn C., and Hurtt M.E. 1996. The direct effectof hepatic peroxisome proliferators onratLeydig cell function in vitro. Fund. Appl. Toxicol. 30,102-108. 120. BpieergfelluorLoBo.c,tanLoiauteRoCn Mle,ydiHgucretll MfEunEc,tioann:dInC-voiotrko,J.iCn.-vivoE,ffaecntds eox-fviavmomsotundiieusm. 1995. Toxicol. Appl. Pharmacol. 134, 18-25. 121. Wallace K. B. and Starkov A. 1998. The effectofperfluorinated arylalkylsulfonamides on bioenergetics of rat liver mitochondria. Dept of DBuiloucthhe,miMstNry5a58n1d2M,oUleScAu.laSrupBpioorltogeyd,bUynivgerrasnittyfroofmM3NMSCcohmopolanoyf.Medicine. 122. Nabbe Fatty fAeclidd-DB.in1d9i9n8g APnrotIenivne. stMiagsatteirons oTfhetshies,EfUfneicvtesrosfitFyluoofrMoicnhneemsioctaal.s TohnesLiisver research performed at and supported by 3M. 2 Jams 1/26/98, replaces: fscg 9/14/94 z DRAFT Jlyva 28,2000 EID101492 005:.7L% ea John L. Buteahoff, tal. DRAFT 12000 DRAFT July 26,2000 s : EID101493 CEEIT puget John L. Butenhoff etl. DRAFT 12000 References: Astdaatumss,anMdRa.th,erKoaspcllaenr,osIisR.i,nCClyanrokmsoonlgTu.sB.maonndkeKyosr.itAnxitkerDi.oRs.cl1e9r8o5s.isO5v:a1r9i2e-c2t0o0m.y, social Baselet R.C. and Carvey, R.H. 1995. Dispositionof f Toxic Drugsand Chemicals in man, Fourth edition. Chemical Toxicology Institute, Foster City, CA. PCaotptpleJyAR,CR,obDienLsuocnaDJE, ,ElSccohmwbetezC,B,FTenungewro-CordisJ,p WP,ahLlaikeW.BGD,oMpaerrsoxmiasnomDeS,prPoalsitfeoroartiTnAg, compounds pose a hepatocarcinogenic hazard to humans? Regul Toxicol Pharmacol. 1998 Feb;27(1 Pt 1):47-60. iCnoclrveians,ePc.hLo.l,eWstaegrnoler7 Ja.-DH.y, dArdoaxmysl,asMe Rm,RNanAd iSnonrcoin-hTuhmomaans,prMim.aGt.es1.9M98e.taSbeolxisstme:roids Clinical and Experimental. 47:391-395. C`aomomkoJnCi,umMuprerraflyuSorMo,ocFtranaomaeteS:Ra,pHoussstitblMeEe.nd1o9c9r2i.ne-IrnedluactteidonmoefcLhaenyidsimg. cTelolxiacdoelnoAmpapsl by Pharmacol. Apr;113(2):209-17. TDehPeaCollioniLc.aVl.ChaenmdiMsatsryaorfoLaE.bJ.or1a9t8o9ryEAnndiomcarlisn.e EHdosrmWo.nLeoscIbn aLnadboFr.atQouriymbAnyi.maNles.w YIonrk :Parmagon Press. (Note: These are secondary references. Eanltdirgiedng:e,aSm.aR.r,keBrutftoerrhweoprattho,ceB.lEl.,ulaarndproGloilfdersawtoirotnhiyn,rTo.deLn.ts.ProElinfveirraotni.ngHeceallltnhuPcelresaprect. 101:211-218, 1993. SEludlrfiodngiec,ASc.iR.d PFoetbarsusairuym25Sa2lt00(0P.FO2A6;-Twe-e6k29C5a)psiunlCeyTnooxmiociltgyusStMuodnykweiytsh.PeDrrfalftuoCreololctane Proliferation report. Client Number 6329-223, 3M T-6295.7. Pathology Associates International, Frederick, MD. 2 Gdoalydesnutbhaaclu,teErLat sJteusdsyu.p,SDt.uCd.y,NGoe.il,13R7G-.0,8J5e,ffInetresmoant,iNon.aDl. RaensdeaArrccheoa,nRdJD.ev1e97l8o0p.meNnitnety & Corporation, Mattawan, M1. EIDI101494 DRAFT July 28,2000 089510 pagenr John L. Butenhof,etal. DRAFT 112000 Goldenthal, ELL, Jessup, D.C., Geil, RG. and Mehring, J.5. 1978b. Ninety-day subacute rhesus monkey toxicity study. Study No. 137-092, Intemational Research and Development Corporation, Matawan, MI. Gpluays,maW:Sp,rTeavavleesn,caenadnDdRc,haBrraectye,rJirz.a,tWioSn. (1(I9n7)6)B.ioOcrhgeamniisctrfyluIonrvooclvoimnpgouCnadrsbionn-hFluumoarnine Bond, pages 117-134. Hefafuecgthoofmp,erBf.luaonrdooScptyadneoviocldac,iOd.(P1F99O2A.),Tpheerfmleucohraooncitsamneunsduelrplhyoinnigc tahceidhy(pPoFlOiApeAm)icand clofibric acid. Biochim. Biophys. Acta. 1128, 65-72. Jdooshen.sonPr,oJj.ecDt.Naon.d8O9b0e0r3,1R02F0.0,1 R9i7k9e.rALbabsoorrapttoiroineos,fIFncC.-,9S5t.-1P4auCl,inMraNt.s after single oral Johnson, J.D. and Behr, F.E- 1979. Synthesis and Characterizationof FC-95-C. Project No. 8900310200, Riker Laboratories, Inc. St. Paul, MN. tJioshsnues.ond,isJt.rDi.b,utGiiobnsoofnt,otSa.Jl.caanrdboOnb-e1r4, iRnEr.ats19a7ft9e.r aExstiennglteanidv.roduotseeooffexFcCr-e9t5i-o1nC.andProject No. 8900310200, Riker Laboratories, Inc., St. Paul, MN. J`aonhdnFsoCn-,1J4.D3.,-CGiibnsorant,s Sw.iJt.hacnhdoOlbesetry,rRamEi.ne19tr8e0a.tmEennth.anPcreodjeecltiNmoi.nat8i9o0n0o3f10F2C0.0-,9R5i-kCer Laboratories, Inc., St. Paul, MN. Johnson, 1.D., Gibson, S.J. and Ober, R.E. 1984. Cholestramine-enhanced fecal eliminationofcarbon-14 in rats after administrationofammonium ["Clperfluorooctanoate or potassium [""Clperfluorooctanesulfonate. Fund. Appl. Toxicol. 4, 972-976. JBuisotchWe.miWc.a,lGeofrfgecatssKa.n,dHazrotnlalF-hUe.t,erHoegeinneeimtayonfnpPe.,roSxalizseormMe.praonldifSecrahtiimoansisncdkucHe. d 1b9y89. perfluorocarboxylic acids in at liver. Hepatology 9:570-581 et al. 1989 Kennedy toxicityu G.L.Jr., Keller D. A., of fluorinated acids in Biegel LB. and Brock W.J. 1998. Repeated rats. Toxicologist Volume 42. Abstract No. dose 1829 p. 371. LEnadroscorninP.oRl.ogayn,d8Ingedb.arEdSs..H.J. 1D9.9W2iTlhseonThaynrdoiDd. GW.lanFods.teIrn,Wpipll3i5a7m-s48T7e,xtPbhoiolkadoeflphia: i : W.B. Saunders Co). NlaabbebleefdefladttDy., acBiud taennahloogfufe J.,fBraosmsfNa.ttyanadciSdecaacrartieAr.pr1o9t9e8.insDibsypwlyaectehm-e1n4t,o64af3,falumomreosncienutmly EIDI101495 DRAFT July 26,2000 Page ss 00oas John L. Butenhoff, etal. DRAFT 12000 perfluorooctanoate, potassium perfluorooctane sulfonate and other known peroxisome proliferators. Toxicologist 41. 1998. NolJd.B.July 13 1999. 26-1 af i with Perfl e Sulfonic Acid Potassium Salt (PFOA;T-6295) in Cynomologus Monkeys - Draft Pathological Report (Ancilliary Study) Electron Microscopic Evaluation of Liver in Cynomologus Monkeys.Client Number 6329-223 PAI Study Number EM 99.76. Pathology Associates International, Durham NC. Nold, J.B. May 30, 2000. 26-weekCapsuleToxicityStudywithPerfluorooctaneSulfonic Aci i A;T-6295) is = Pathologic Re; (Ancilliz tud n Micros i ive le Monkeys (Recover Animals). Client Number 6329-223 PAI Study Number EM 99.76. Pathology Associates International, Durham NC. Osc'rCeoennniengr bJa.tCt.,erFyracmoem, pS.aCr.,etBdoicagnelinL-.uBt.erCooeoxpkoJs.uCr.eafnodr DdaevteicstiLn.gG.thSeenessittriovgietny roecfaepTtioerr 1 agonist 17 B-estradiol. Tox. Sci. 44, 16--9 184, 1998. Olsen G.W., Burris J.M., Mandel J.H., Zobel L.R. Serum perfluorooctane sulfonate and hepatic and lipid clinical chemistry tests in fluorochemical production employees. JOEM 41:799-805. Reimers J.R. 1999. Hormones. In: The Clinical Chemistry ofLaboratory Animals. Second edition. Eds.: Loeb W.F and Quimby F. W. pp 455-499, Philadelphia PA. Taylor and Frances. Smith, D.R. 1998. Animal models: Nutrition and lipoprotein metabolism. Current Opinion in Lipidology. 9:3-6. Turley, S.D., Spady D.K., and Dietschy JM. 1995. Roleofliver in the synthesis of cholesterol and the clearance of low density lipoproteins in the Cynomolgus monkey Journal of Lipid Research. 36:67-79. `Wagner, J.D., Zhang, L., and Adams, M.R. 1997. Effect ofestrogens on arterial LDL a metabolism. In Hormonal, metabolic, and cellular influences on cardiovascular disease = in women. Ed. T.L. Forte, pp 153-174. New York: Futura Publishing Co. g Wallace K. B. and Starkov A. 1998. The effectofperfluorinated arylalkylsulfonamides $ on bioenergetics ofrat liver mitochondria. Dept of Biochemistry and Molecular Biology, University of MN School of Medicine. Duluth, MN 55812, USA. Supported by a grant from 3M Company. EID101496 DRAFT July 28,2000 0005.17 Page a4 [ 121 0005.15 PaatthoollooggyyAAssssoocciiaatteessiInnteemrantatiioonnaal! sppeye P1a5tWhoolromgaynA'sssoMciilaltCesouIrntt]Suite | Frederick, MD 21701 September 29,2000 CDro.vaPnecteeJrL.abTohroamtioroireds,IPnch..D. 3301 Kinsman Blvd. Madison WI 53704 Dear Dr. Thomford, Enclosed please find a copyofthe Draft Cell Proliferation Report for the Study identified below: Pe2r6f-lWueoreakocCtaapnsoualteeT(oPxiFcOit)y SintuCdyynwoimtohlgAumsmMoonnikuemys Covance Study Number 6329-231 Sincerely, Kim Claggett RCeelsleaKricnehtAiscssisDtiavnitsion 301-624-2917 8 Lahoraloriss corFaison, of 27 02 2000 Enclosure Recaived #15 {x 5 11SST Class mal Y7 sso Imma 3Jl SC hing reese --_-- 7 \ ADD-- L DIST. \ | -- -- _-- TOX-- FILE -- e1e 5 Worm-- on's Mil-- Cour, Se ue| Fe reder-- ick. Mayland 21701 -- GOT)663-1644 + (301-- ) 863-8994 FAX 000s EEE| rnotcoy associates temational == A Company of Science Applications International Corporation Erosaneicirssy DRAFT CELL PROLIFERATION REPORT 26-WEEK CAPSULE TOXICITY STUDY WITH AMMONIUM PERFLUOROOCTANOATE (APFO) IN CYNOMOLGUS MONKEYS COVANCE STUDY NUMBER 6329-231 PREPARED FOR: 3M TOXICOLOGY SERVICES BUILDING 220-2E-02, 3M CENTER ST. PAUL, MN 55144-1000 PREPARED BY: PATHOLOGY ASSOCIATES INTERNATIONAL 15 WORMAN'S MILL COURT, SUITIE FREDERICK, MD 21701 SEPTEMBER 26, 2000 --_--TS Wormans Mill Cours, Suite 1+ Frederick,Maryland 21701 + (301) 663-1644 + (301) 663-8994 FAX. 009." TABLE OF CONTENTS Section Report Narrative 1 Tables n Figures m Individual Animal Histopathology Findings wv Signature Page v Quality Assurance Statement vi 000. Covance Study No. 6329-2TM31 Draft Cell ProliferanonPaRgeepo1r1t CELL PROLIFERATION REPORT FOR: PER26F-LWUEOERKOCOACPTSAUNLOEATTOEXI(ACPIFTOY) SITN UCDYYNWOIMTOHLGAUMSMOMNOINUKMEYS COVANCE STUDY NUMBER 6329-231 INTRODUCTION The purpose of hormones, and the study was other selected to assess the biochemical effect of the test parameters when material on critical administered daily enzyme levels, by capsule cynomolgus monkeys for at least 26 weeks. "This report, Toxicology Sseurbvmiictest,edrebpyrePsaetnthsoltohgey cAeslslopcrioaltiefserIanttioenmaftiinodnianlgs(PaAnId) to the study interpretation Sponsor, 3M for Covance Study Number 6329-231 entitled "26-Week Capsule Toxicity Study with Ammonium Periluorooctanoate In Cynomolgus Monkeys" REGULATORY COMPLIANCE wAlilthastpheectEsnvoifrtohnemteanstkaslasPsrooctieactteidonwiAtghePnAcIy'sGopoordtiLoanobofrtahtiosrystPurdaycwtiecree(cGoLnPd)ucRteegdulinatcioomnpsliasansceet forth in Title 1983effective D4e0ceomfbtehre 2U9,S19C8o3)d,eaonfd wFietdheraanly Raepgpulliactaibloensa,mePnardtme7n9t2s,. issued November 29, MATERIALS AND METHODS Treatment Group. 1 (Control) 2 (Low-dose) 3 (Mid-dose) 4 (High-dose) Experimental Design Dose Level (mg/kg/day) 0 3 10 30 NumberofAnimals Main Study Recovery 4 4 2 0 4 2 4 2 A1l,l3aannidma4lswe(rmeaidnessitgundayteadndasrerceocvoevreyr)y waenirmealtsr.eatTerdefaotrmuepnttoin2t6hweeseekasn.imTalwsowaansimdaislcsonitnignruoedu.ps and the Sponsor determined the recovery period. 000. Covance Study No. 6329-2TM31 Draft Cell ProliferationPaRgeepolrzt Tissue Collection for Cell Proliferation Representative each of the 22 samplesof animals the was left lateral fixed and lobe of the processed liver, lef and right testes, and pancreas from to paraffin block by Covance per protocol sspleicdiefsicwaetiroensp.reTpiasrseudefbolrocHk&s Eweerveaslhuaitpipoend taondPAiImmfuonrosheicstitooncihnegmaincdalstdaeitniencgt.ionForfopmroelaicfherbaltoicnkg, cell nuclear antigen (PCNA), a markerof cell proliferation. Immunobistochemistry for Cell Proliferation Sections of (Superfrost paraffin-embedded tissues were cut Plus, Fisher Scientific, Pittsburgh, = 5 um PA) to and placed on positively ensure adhesion during charged slides processing for sPtCaNinA.tissSuteas.ndaBrrdieiflmym,untoishsiusetsoecchteiomniscawlermeetihncoudbsatfeodr PwiNthAa m(oEnldorcildognea,letanatl,ib1o9d9y3t)owPerCeNuAs(edLotto (#M1s0l7gEGxKpi.t1L1o/t0#0 PDKA6K1O0,2 ECaxrpp.in4t/e2r2i/a0,0,CAV)ecatonrd,rBeuargleintnsgarmeeq,uiCreAd)fmoretthheodavfiodrint-hbeiodteitnecpteiroonoxifdtahsee antigen-antibody complex. and M) was localized by PCNA expression in cells in all phases of the cell cycle (G1, S, G2 the chromagen 3,3-diaminobenzidine (DAB Lot# 108HS210 Exp. 820/01; Sigma Chemical Co., St. Louis, MO). hematoxylin. Tissue sections were counterstained with Cell Proliferation Measurements bPorsoiwtnivetostbalianicnkg rfeoarctPiConNAprowdausctcattheagtorciozrerdelbataesdedwiotnhcetlhleuldairffdeirsetnrtibupthiaosnesanodfinttheenscietlyl ocfyctlhee (fEorldSripdhgaeseet cale.,lls.199A3).celUlniinfotrhem,G,daprhkabsreoofwtnhteo bclelalckcynculcelehaardstdaiiffnuisneg,wsatsipjpuldedgenductloebaer psotsaiitniivneg that was lighter than cytoplasmic stippling a cell with or in S phase. Cells in the G, phase exhibited distinct, diffuse without nuclear staining. Mitotic figures were conspicuous with dciofnfsuissetecdoytfosptluadsmyitcissstuiepp(lainngi.malAno.ne1g0a5t7i0v9e)ctohnattrowlasslniodte iwnacsubaitnecdluwdietdh itnhetphreismtaariynianngtirbuondya.nd For cell quality proliferation of staining, evaluations, slides were fist perused at low processing and sectioning, pattem of cell magnification labeling (c.g., (100X) to judge centrilobular or panlobular, extrahepatocellular proliferation, endothelium), and histomorphologic changes. such as The later Kupffer cells, bile was further assessed duct epithelium, by evaluating the serial H&E slide for each animal evaluated for cell proliferation. Cell proliferation was then quantified at higher magnification (200X) as described above. For cell proliferation measurements in the liver, the percentage of dark, nuclear-stained hepatocytes that represent cells in S-phase was determined by scoring at least 3000 hepatocytes in 10 randomly selected fields per animal. Cell proliferation within islet and exocrine cells of the pancreas was scored subjectively with 3 = exocrine stained greater than islets, and 4 = islets and exocrine stained heavily as determined by positive PCNA staining. The entire tissue section 0085 Covance Study No. 6329-2M3m1 Draft Cell ProliferationPaRgeepo1r3t represented on the slide was perused at 100X and 400X. For measuring cell proliferation in the testes, the section farthest from the slide label was scored. The percentage of PCNA-labeled Leydig cells was determined by scoring at least 100 Leydig cells in the entire section that was examined. Statistical Analysis Due to the small samples sizes within main study and recovery groups, and because not all animals within 2 treatment group were sacrificed on the same day, statistical analysis was not performed on cell proliferation data. RESULTS Cell Proliferation Individual animal cell proliferation data are presented in Section I (Table II-1) and graphically in Figures [11-1 - 3. Clearly, cell proliferation was not increased by treatment in the pancreas or testes of monkeys as determined by examining the scatter plots in Section II, Figures III-2 and IL-3. In the liver, however, there did appear to be an enhancement of cell proliferation in the highest dose tested (30 mg/kg/day) as revealed in Section II, Figure (III -1). Data points 6, 8, 9 and 10 (30 mg/kg/day; animals 105704, 105713, 105711, 105722, and 105703, respectively) were greater than or equal to the highest control value (data point 1; animal 105714). The lowest dose tested (data point 3; 3 mg/kg/day), however, had one animal (animal 105706) with a labeling index that exceeded all animals examined. Thus, an apparent increase in cell proliferation was not necessarily dose-related. Histopathology Sections from the same tissue blocks used for preparation of PCNA-stained slides were stained with hematoxylin and eosin (H&E) for histopathologic evaluation to facilitate the interpretation of the immunostained slides. Individual animal findings are presented in Section IV. Representative histologically. sections of liver, pancreas Each tissue section was stained and with testes from hematoxylin 22 and monkeys were evaluated eosin. The purpose of this evaluation was to determine whether or not morphologic changes were occurring in these tissues that may alter or confound the specificityofthe PCNA staining observed in these animals. The results staining in showed that no significant this study were observed changes in the that would alter liver, pancreas the interpretation of or testes from male the PCNA monkeys. Aoclctuhroruegdhacchrroosnsicallingfrloaumpmsa.tioFnurwtahserrmeoproer,tetdhefoPr CseNveArallabaenliimnaglsi,nditewxadsidminnoitmacolrrienlasteevewriittyhatnhde observation animal with of inflammation the highest liver in the liver. For example, inflammation was not observed in the labeling index (animal [05706). Numerous findings were reported. for animal [05724 that included hypertrophy, inflammation, fat infiltration and possibly bacterial enn Covance StudyNo. 6329-2M31 Draft Cell ProliferationPaRgeepolrat colonization. Based on the substantial non-specific PCNA staining observed in the liver of this animal, clearly these lesions confounded the ability to measure hepatocellular proliferation; therefore, no attempt was made to evaluate the PCNA labeling index in animal 105724, DISCUSSION In the present study, cell proliferation was measured within the liver, pancreas and testesofmale monkeys from control and treated groups after up to 26 weeks on study, as well as a recovery period. An increase in cell proliferation, as determined by the PCNA labeling index, was not observed in the pancreas or testesofmale monkeys. Cell proliferation in the liver, however, was equivocal. SUMMARY After up to 26 weeks on study, enhanced cell proliferation was not evident in the pancreas or testesof male monkeys, whereas in the liver the findings were equivocal LITERATURE CITED Eldridge, S.R., Butterworth, B.E., Goldsworthy, T.L. (1993). Proliferating cell nuclear antigen: a marker for hepatocellular proliferation in rodents. Environ. Health Perspec. 101: 211-218. [LTE IL TABLES eanet = ] : i 3 3: RERROEEERI iT) jifpeiseaRsagesaissaen FR i e2 le g[| renade i faapeseainaateinas : ia Zd | RHzEegHegRlsMsEcaMlsMseEzyNgsEesE: 8EE) 2 cg | . 833 g 25% % |5 Ininiy 3 ie Bgl di a a 3843938888 885538 838 25 33: HEHE hi O JeggN gegE dddfeiFoEtcoeFdtdeecEzisE:s E32 aisle i hil: fagzzraaaaaiidd i i 23 g 2 Hi 3 S33ist 3| EE228L 5 gg: i is 222.58 8 3osfis 08aeiy IIL FIGURES Legend for data points on Figures III-1- 3 Group Treatment Day of Death 1 2 Omgkg/day Omgkg/day 26 weeks Recovery animal 3 4 3mgkgiday 10 mg/kgiday 26 weeks 26 weeks 5 6 10mgkg/day Recovery animal 30 mgkglday 26 weeks 7 8 30 mgkg/day 30 mgkg/day Sacrificed day 29 Stopped dosing day 43 9 10 30 mgkg/day Stopped dosing day 66 30 mg/kg/day Stopped dosing day 81 000.5" BROa1eH 2 rEzig | *8 |J |: x |CE 2 3 3|IZ | B2E |2 || || EI E | ! >lo el || | ?Y | &x8 =R)X &= oc S> EE E| a || | [o INT | | | | nN e2 || || C0e| YY: oY i| Lt ) | Lo | PP|o Cr a e 1 |; | DL|do S3RX >3xX ES | - = 2| oc> oS oS J IER i 2 oe HEE EE F= l . TL 1 ] | TF qE i 0 2 o|| .|| flr1 LLL er NE | + oo 3 i: : i 8 @o = |x [=] [| =32] 3 | Cw || g=> ioD | |[ || I | T | | |o | | o| | | > | v| | F| o | | | I = || || || v| co | vPrs0| bo | w | L | m oixo || --_----| ~. | , | || | | oo. . el | | Ro ORoS X o RoS oXR ooS r| eS & 8 gg & 9g o 0 o<o o o 3 o -~ o || 080s IV. INDIVIDUAL ANIMAL HISTOPATHOLOGY FINDINGS ofa Individual Animal Findings Counce SudsynNo. 329231 Page V.1 26-WEEK CAPSULE TOXICITY STUDY WITH AMMONIUM PERFLUOROOCTANOATE (APFO) IN CYNOMOLGUS MONKEYS ANIMAL SEX DOSE NUMBER GROUP HISTOLOGIC FINDINGS T5705 M 105714 M 105715 M 105725 M 10s718 M 105720 M T0570 TM 105706 M 105717 M 105721 M T Tver - chrome inflammation, minimal PTeasntcersea-scr- uasuhtoalrytsiifsa,ctfocal Spleen - NSF ' LPiavnecrre-acshr-oNnSicFinflammation, minimal Testes - NSF ! SLpilveeren- -NNSSFF TPeasntcersea-sN-SNFSF 1 SLipvleeren- N- NSSFF PTeasntcersea-sN-SNFSF 1 SLipvleeren- -NNSSFF Pancreas - NSF TSepslteeesn--cNrSusFh artifacts ' LBiavnecrre-aNsS-FNSF TSepslteeesn- NNSSFE 7 CPiavnecrre-aNsS-FNSF TSepslteeesn--NhSemFosiderin deposition, mild 2 LFiavnecrre-aNsS-FNSF TSepslteeesn -- NNSSEF 2 LPiavnecrre-aNsS-FNSF Tests- crush artifact 2 SLipvleeren- -chNrSonFic inflammation, minimal PTeasntcersea-sN-SNFSF Spleen - NSF Legend: NSF = no significant findings 000.5 Individual Animal Findings Covance Stud3yMNo. 6329-231 Page 1V-1 26-WEEK CAPSULE TOXICITY STUDY WITH AMMONIUM PERFLUOROOCTANOATE (APFO) IN CYNOMOLGUS MONKEYS ANIMAL ~~ SEX NUMBER DOSE GROUP HISTOLOGIC FINDINGS 05707 TM 105708 M 10710 M 105712 M 105716 M 105719 TMM 105703 TM 10704 M 108711 M 105713 M 3 Tiver - NSF Pancreas - NSF Testes - NSF Spleen - hemosiderin deposition, minimal 3 PLiavnecrre-aNsS-FNSF Testes - NSF Spleen - NSF 3 Liv- eNSrF Pancreas - NSF Testes - NSF Spleen - NSF 3 Live-r chronic inflammation, minimal Pancreas - NSF Testes - NSE Spleen - NSF 3 Liver - NSF. Pancreas - NSF Testes - NSF. Spleen - NSF 3 PLainvecrre-aNsS-FNSF Testes - NSF Spleen - NSE 7 PLiavnecrre-aNsS-F.NSF Testes - NSF 4 Spleen Liver - - NSF chronic inflammation, minimal Pancreas - NSF Testes - NSF Spleen - hemosiderin, minimal 4 Liver --chhermoonsiicdeirnifnl,ammmiantiimoan,l minimal Pancreas - NSF Testes - NSF 4 SLipvleeren- -chNrSonFic inflammation, minimal Pancreas - NSF Testes - NSE Spleen - NSF Legend: NSF = no significant findings 000557 Individual Animal Findings Covance SnadayMNo. 6329-231 Page V1 26-WEEK CAPSULE TOXICITY STUDY WITH AMMONIUM PERFLUOROOCTANOATE (APFO) IN CYNOMOLGUS MONKEYS ANIMAL SEX DOSE NUMBER GROUP HISTOLOGIC FINDINGS 108722 M 105724 M 4 Liver - hemosiderin, minimal Pancreas - NSF Testes - NSF, Spleen - NSF 4 Liver - ppeerriippoorrttaall,, cfeatlliunlfairlrhaytpieonr,trsoepvheyr,esevere `pemriidpzoorntaall,, ncehcrroonsiics,imnofldaemrmaatteiotno,smeovdeerreate centrilobular, fat infilration, severe centrilobular, cellular hypertrophy, severe random distribution, bacterial colonies??? Pancreas - islets, at infiltration, mild to moderate Testes - NSF. Spleen - NSF Legend: NSF = no sigaificant findings 000-30 V. SIGNATURE PAGE Submitted by: Project Manager: Sandra. Eldridge, Ph.D. Date Project Pathologist: Carolyn Moyer, D.V-M., Diplomate, A.C.V.P. Date Qa VI. QUALITY ASSURANCE STATEMENT 000s EEH retPartohloolgogyyAAssssoocciiaatteess Iinntteerrnmaattiioonnaall SpE ----------------------------------------------------------------: Cell Proliferation Report 26-Week Capsule Toxicity Study With Ammonium Perfluorooctanoate (APFO) in Cynomolgus Monkeys Covance Study Number: 6329-228 QUALITY ASSURANCE STATEMENT This cell proliferation project has been inspected and audited by the PAI Quality Assurance Unit (QAU) as required by the Good Laboratory Practice (GLP) regulations promulgated by the U.S. Environmental Protection Agency. The cell proliferation report iisnsapnectaicocnusr/aatuedirtesflpeecrtfioonrmoefd tahnedrreecpoorrdteedd bdaytat.he QTAhUe.following table is a record of the Date of Inspection 1009//2065,/0979/00 09/06,07,25/00 Phase Inspected. Date Findings Reported to PAI Management/Project Manager PStCuNdyADDaitlautainodns/Staining Supporting Documentation Draft Cell Proliferation Report 10/25/99 09/07/00 09/07/00 Qed) cnet Doraine Dundee Quality Assurance Auditor Loa Tomn fut #5 2000 Date 00a" 15Worman'sMillCourt, Sue| Fradenck, Maryland 21701 + (301)663-(3101)68634-89494 FAX APPENDIIX 00a: Date: Study Number: Title: Protocol Deviation 1. Reason: PROTOCOL DEVIATION REPORT September 28, 2000 Covance Study No. 6329-231 26-Week Capsule Toxicity Study with Ammonium Perfluorooctanoate In Cynomolgus Monkeys Representaive samples of liver, testes and paneress were to be collected for cell proliferation eSlviadleuaftoirocn,omwhliacihveinmcolrudpehdoplroegpiarmattieopnorfeaatnoHnXoEf the cell proliferation findings. Samplesofspleen were inadvertently submitted to PAI and the H&E slide examined for this tissue. Spleen was inadvertently submitted The HAE slide was inadvertently evaluated microscopically and the histologic findings reported. This deviation had no impact on the study. Submitted by: SPaAnIdrParoRj.ecEtldMraindgaeg,ePrh.D. LrSe Sandra R. Eldridge PAI Project Manager 22p 00 Date 000875 | Local LE My-o0Y Mu 0G Mw- oq Jf 19ar 39 9 at In ay NO 199g ze q ND ORY Quw LF 0061 OOTLET LEACHATE STREAm T RoPELTY BontitY my-13 MH-G 9% 2 qq 1s" 14% qe 33 2 u z.0 re lo " 5G Lo 8 aa NA qq OTHER OFFSITE. PEW LUBECK WELL slat 24 SITE Dewi TAK z eo 3 PANA f 8LdG 212 t.G Fy EIDI103018 CODY WASHIGTON WoRKS gies C8 SAMPLING LETART LAspFILL doog levi wong 1100 VRPFE Beh vg MiG Nuch ited Leeet cSnreeeTn R 3c 9c 260 WCCO 3300 a1 a fm T-38 [foam J 0 Leodd 26 Li. 06 q Miv- 09 ~D `~ 22 RESULTS 43/L PLasT <upee - Bea 5= Goo ee wdilyizeie L4o.s3s WEST Ey FED NA 3.9 Ueo S3 sic 20co g2.o0 Yee 14at pera Em Foe hi outrals 1 1 AD Si E) lag 103 ur L "0 Fo 1a8 aD SE IT Lo " rE ue ai oesier 13 33 LF~CHeTE Net Mu [3 Vina vie GA fiap- 13.4 Ze GC 9.2 eo xo wp L se on 33 Is 6 xi Ie Xoosee- no 23 Jr fRopeery Gunite 20 toce FT 0.5 3. z Z =z EID103019 00055 =8 OFFSITEsampLIng 3S//1132//8878 11/2/88 LLPUSBOECKHOMBEUSITANPESS-pTap (2) LPSD HOME Tap -p S/ 7/89 LPSD HOME Tap -p 85//2239//9911 LUPPSSDD HHOOMMEE TTAAPP -C 8/8/91 LPSD HOME TAP -- HERAAAAkAAAAA kkAk 33//1133//8877 3/12/88 VLIIETNTNLAE HHOOMCEKINTGAPBUSINESS TAP LITTLE HOCKING HOME TAP -R FEARRk AA AA kA 11/28/90 LUBECK PRIVATE WELLS (2) 8/ 3/31 LUBECK PRIVATE WELLS (2) HA kek AA 6/23/91 NBM LUBECK WELL (*) CHZMHILL CONFIRMED *PRESENCE OF C-g C-8pry 12..92, 10s 10..47 33..88 3.9 00..66 0.6 0.6,0.6 <1.0,1.0 2.4 0) > EID103020 C60 C-8 HUMAN EXPOSURE LIMITS TW (a AEL (DUPONT) CEG (AIR, WATER) WeM3 100 10 HASKELL ESTABLISHED: _8_ uG C-8 PER 24 HOURS 80% BY AIR ....... 6.4 uG/ 20M3 = 0.32 OR 0.3 uG/M3 20% BYWATER ..... 1.6 u&/ 2 L = 0.80 OR _i PPB OUTSIDE CONTRACT LAB: CHZMHILL $23 AUTH TO PROVIDE 0.1 PPB C-8 IN WATER ANALYSIS Z EID103021 Cone _Pem 28 SAMPLING (MARCH = JE yoga) ocation PKSBG-HOME TAP HH-DRINK FTN OIST. CTRMELL HASHINGTON-STORE TAP LUBECK-STORE Tap olsTance cies) 7.5 UPSTREAM a 0.23 oan 0.25 bow 0.25 baw . HOCKING-STORE TAP 3 DOWN BELLEVILLE-PRIVATE WELL 12 DOWN REEDSVILLE-STORE TAP 14 DOWN RAVENSWOOD-STORE TAP 29 DOWN RACINE-STORE TAP POINT PLEASANT-STORE Tap GALLIPOLIS-STORE TAP(*) s0 DOWN 74 oon 79 oon -8 PPR(O.6 (inyr) < 1.2,1.0 1s 0.8,0.6 < < < < (*) NEAREST COMMUNITY TO TAKE WATER DIRECTLY FROM OHIO RIVER. z EID103022 Co0a7t C28 ON SITEsamping IEST WELL e227 3&/114//8887 11s// 44//8889 108/241//8839 24/2270//9900 7713/90 108//193//9300 REVISED TEST 41//1185//9911 87s/224//9911 ADJACENT WELL :Mu-4 83/131//9911 4 DRINKING WATER 111/3/26/20 ssLodaa 2312 31/2/8/8889 ssooaa 221122 c=8 ppg 21.s0 01..63 1.3 1.3 11..53 1.6 <110 (33..00)) 32.09 sEXo] 11..45 00..66 00..66 > . EID103023 eon ) 0R8o/b1e4r/t2L000Ri0t3c:h5e2yPM STEo SHeoDarvgiedWReaomMsEeNyACELDDuWPPoonntG@ODuUPPoanntt, Ritchey/CUDUPont) Andrew SHarton ASIDuPon@0uPont (be: Raber. Subject GE sampling resuts foo o ehloAnAcugusVta15n, Well#4 analyzed at d2o00V0elsdaempatioGgE 275 ugh. otfhidsaanfkeirnmgawcant.eHr ewellgso.t WhieslFlC#.014a3narlyezseudsstba70c7k sfgewn days ago THoeooatrsak5sle0wed%e.ifffswreeoonmhtaaeada0csshuewtsen.lMnl,uewmehbsietcrismwaaostuhelid8gb4heatcosobntsheie8s.0te70n0-t77w0ig0llfheaehntedfucr|aptroheeirrrtdceoodwomnrupitovse1ri.iHrreosbtuhanetssitosestoThvoytpehusp aSnOd tmeosdtealcecudrarcesyu.tlotEinPAth.ewhiviecrh.hWeohabs raiceopdyisocfu,swseeddIinsfcluusesncaes8usuychre5suilvtearnflaoLwu,bdaicaknweesydoanwsner6:5 He indicated that they plan to continue to sample periodically. z 2 EID103379 2 Gone ATTACH MENT 130 | ;s TSCA00eon0o.! 0 becw w3pr0 version No Sani +i zed was provided: 008875 iteaitais Ieiautsz awaisis Dara seer slime sareiz os LHavLname TaIIC aveTIONL ING SEa e3m0itares iertarneoeoo3ast0o0m.mn 100 wi --_-- ACasr HSaTmole 12 FiE--E DSHaantee aDnevatreyeereess: LEL3EE re erenr t er ae fBraetsltesrrsnanie frieBEdxB e t 0 27 oiusB a Uw UinsereeztesResy= EstiS matesTConcentratioTna a 8a = Found in iene Pde 1s T 2568 207Ri37a2.1 I33AMICS ANALYSIS DATA SeEET cLtEnT saves no Las rams ZaIIFIC ANALITICAL, ING Las famote 13 870s SDlienrteeitziniiriiZirimeeeacs uiVelma. trezian: 1000 ul SCaamnpcle wart DDaattee Eanxazlryatceises Time analytes mou wil B aies Tels furnigane Reside, Seriilzrsicaencic aciz faze 0 1205 0 nisr ar ZL0s2iUisisieiseczizaResultosx SsziEmaateRdesuClotnceEnrtcreaedtsionCalibr8at=ioFnounCdarvien Flan 2233.72=71F0r0a0i0t0i0zalRasGuanenitcaotriroenspoLnidmiintg Laneies reterence 00057 26 T 2578 132 000879 "The Arizona Republic, April 29, 1990 Page 23 Focts for faster computers to d*eCvaerlbooprucnedruammicCo.m,ateNriiaaglasraanFdallpsr,oduN.cY.t,s foorpenmeidcroaelpelcanttroniincPchoomepneinxenltsa.st Tyheear coalmlpanuysedmakaess isnisluilcatoonrscarabniddeh,eataludimsisniupmatneirtsridfeoransdemibcoroonnducntiotrridceh,ipswhich are PhoeniW.xL.stGilolre&finAdsisnogciuasteessfoIrnc.a, subbassetdancien pDealtaewnatreed, ihnas193t7e:amsTefilnon.FlaGgosrteaff and sryenstehaertcihcersbloiondFvleasgssetlasffanwdorkartoinfinceiwalmedLiicgaalmenptrso.ducRtess,earscuhchersasthleirneersandforincasts, fPuheolenitxankwsork on electronic products such as cables to detect leaks in buried mate+riHaelxscelsiCnocrep.1,386SaninFCraasncaisGcraon,de.has Itbseencommpaoksiintge,lihgohnteweyicgohmtb-tsetxrtuuctruerdalmaterials lighten many aircraft and cushioned the first manned landing on the moon. GRAPHIC: Photo LANGUAGE: ENGLISH TMI-ACC-NO: 9021645 LOAD-DATE: June 10, 1994 eosin Pages 3215T STORY of Level printed in FULL format. copyrightcopMyarningihntg P1u98b5liWcMaItioInnsc.;fnc 1386; BusVienremsosntoaBtuesliinnees;s anary, 1985 secTIoN: Sec 1; pg 24 LENGTH: 1745 words HEADLINE: Grand Tsle's one Manufacturer a One-of-a-Kind BYLINE: Michele Pacenauds DATELINE: South Kero; VE: US s00T:here is only one manufacturer in the entire county of Grand Isle -- Phoenix oWniere-ofIn-ca.-kiNnodtionnltyheiwsortlhde, faicrcmorudniinqguetoincoimtspancyounotfyf,icibaults.it is alse insu"lHaetedowiornelywointeh Ttehfilnogn,"."saTyhse Hcoomrpaacney'Csorbcilna,imthteo ffaimrem'sisprneostidiennti,nsu"lwaeting wiinrethewitwhorlTde.flon. Many companies do that. Phoenix insulates the tiniest mires hunaCnallhaeidr.micrSoingmlieniastturarnedswirceasn, besomveirocfualtlhyemianrveisisbelveeral times finer than a he TshteayrtewderweeatroiTnogmglPaasriszeos, siPxhomeonnitxh'ss vagioc.e pr"ePsrioddeunctt aqnudalpirtoyduhcats einmgpirnoeveerd, until cremendously since I got them." he jokes humaTnhesberaitninoyrwiarnesinmsatyrumeenndtuppanienlsounchtehextrspaaocredisnhaurtytlpel.acesTheascothmebiniantsiiodne ooff a msemdaillcinseizeandanedleTcetfrloonniccsoating makes them ideal in applications involving at IPnhomeonsitx ctaoseiststhfeinawlirehommeakeisn aa plioencgeanodf ecqoumipplmiecnatt,edsojoCuorrnbeiynfrisomnoittssourreigins wehaetraebliitshnaellntsendfsamuopu.s aBruotunNdAStAheiwsorald.regulHeardoceusstokmneorw afnord ssuorearethamtediictalis used in cardiac catheters (cubes), pacemakers, probes and sutures uniTqeufelopnr,opeartDiuePsontthattramdaekenamiet efsorpecpioallyltyetarpapfrloupcreitahteelenfeoroufsePTFiEn,sidheasthseomebody. Cthiesmsiuceasllayn.d fitluiidss,inwerhti;chitmakdeosssni'ttonreeacoft cthoeotshaefrestsumbasttearnicaelsssuacvhailaasblbeodyfor implantation in the body. Also, because Teflon can be applied to wire in extremely thin layers, it is 00052" Vermont Business, January, 1986 Pages miadteealriaflosr use for eilnecmtirniicaatluriiznesudlaetlieocnt.ronics. And it's one of the best of all The modern kmoisttcheobnvi-o- usisprtohapterntoythoifngTefsltiocnks-- tooneit. knowFnortothaatnyorneeasofnamisolmiearofwith a cPhhooceonliaxt'es cpruotdtuicntg ainsdustehde ciunttsiuncgh o"flopwlatsetchi'c boapgesr.atioPnhsoenaisxcWoiorkeie iscuattisnmga,ll scoimdpeansyt.reetOnliyn afivbeuilfduilnlg-taismesamanldl tawnodpaurnta-stsiummeingempasloyietsesprwoodrukctosn. theExcSeoputthfHorero wLoirsdt-inogfs-moiuntThhoamfafsa'irRegister and the Yellow Pages, advertising is a ptohopnOlehamcecexallCanorhbeoirndr,eercHeoifrvoeardces'oismseciownuidrsieicnatheiavnedhaodtfhebeheofnwirmst'hhsaotwnswaoblreykssa.maSnpaAagnneirsI,hridssohacystdoorcataortrecaecnatlled conference in Isreal. The wire had been coated at Phoenix. theCuUsntiovmeerrssitycaolfl Vferrommonats 2f0armialweasy asosutFhr.ance, India and Japan, and as nearby as PhoeAnLiLx,chewhewroerk itis idsonceoatoenda tocusthteomspbaesciisf. iedThtehicckunsetsosmerandshcioplsort,he anwdirethetno Lsihvieppweidthbianckfitvoetmhielecsustoofmetrh.e buHsoirnaecses.andThOahtm,erpCroorbbaibnl,y masoreweltlhaansanTyomotPahreirzo, factor, is the reason for the plant's location on Station Road in South Hero affoBredcsa,useGratnhdeyIasllle'slovLeakeliCvhianmgplnaeianr tehnevirwoantserofafnedrtthehebmoaatpiengrfeacntd pfliascheingtoitlive banedatewonrkp.athAnhdelpmsuckheetpo stahleeirspedoeplilgehtfrotmhebyeahtaivengdaispcaotvheretod tthhaetcobemipnagnyofdofort.he The fitiramnmyahinatradienrstoa pfirnodf.ileCosonspliowcuotuhselyy'dabhsaevnettoiscaamnoyufkliangdeoftheanbuiidlednitnigfyitnogmaskiegn The location, for the business. whiPlreodcuoctnivoenniernetquifroersthleittplreincsippaacle,s, feisw rnoetsouarccersitiacnadlshciopnpcienrgn is done through United Parcel Service. coul"doubreparnoydwuhcetreiswea wlaingthetdw.e"ighTth,at hifagcht-vahlasuelperdodPuacrti,z"o staoyssugHgoersatcetChoerybipnu,t "We the wwhionlteeroappeprraotaicohnesinatnodathleargleaketrabieglienrstrtouckfraeenzdedorvievre. south to Florida as the CounEtiyghtis mitlhees stwaidtee'sandsmamlolreest.than Lo3c0atgeedntliny trhoellinnogrtmhiwleestserlnongc,orGmrearnodf Isle Vermont afnadrmscoamnpdriaspepdlemoosrtclhyarodfs.islaTnodusr,istist is known and cows ffoorrmittshe bebaeudtryo,ck iotfs sithsoreelcionneo,myiatsnd undoubtedly will for a long time to come. to Parizo, broaden tahenattiavxebaosfe.thePrcoeusnetnyt, dewvoeullodpmleinkte to in see the mcooruentyligihstpriinmdaursitlryy there rcoemsmiudneinttyi,al.consPuamreizomoreexplianinsservtihcaetshotuhsaens,theandtaxtehse families they put they into tbhreingcoftfoertshe c"oTmomehracveiala gaonoddinedcuosntormiiacl.system you have to have a balance between residential, COor3T Vermont Business. January, 1986 Pages CounRteybecDceavelKoapimseenrtagCroerepsorwaittihonhi(m.GICDCA)s, thseheexweocuultdivaelsdoirleickteortoofseethemorGeranldighItsle oifndu12strVyermionntthedevceoulnotpym.entGcIoCrDpCoriastiaontsw,o-yaenadr-ioslds,upnpoomrptreodfibty organization, one public and private funds. provide Its board more jobs of directors are resident for the community. volunteers and its mission is to forPmraensuefnatcltyurtihengGIcoCnDcCerinss.devAelorpeicnegntalycocuopmlpeletofedsictoeusntyawsidpeotesnutrivaely lioncdiactaitoenss rfeasviodreanbtlse atoreliogphptoseidndutsothreyavy industry being located there, but are more of Kthaeisetraxsabyassethaendsuthrevegyenreersautlitosnsohfowmo"rreesildoecnatlsjgoebsn.e"rally support an expansion indIursotnriicaallldye,velfooprmeantcou--ntbyotshurgreotutnidnegd by it water, water is and getting rid the major obstacle of it. The area's to cinlayfrosmoiltheislaakepootro osnheorefsoridesepsittiecs,leaacwhaiyngf.romAnshdoraelthwoautgehr wmuastterbecandribellepdumpfeord, and even then it is often found to be contaminated with sulfur. proWdautcetrionisprnooctesas.probIenlmthaftorprPohcoeesnsi,x Wciarleledbec"aduissepesrosiolnitctolaetiinsg,u"sedwirien tihsedrawn TthherowuigrheatmhielnkytralvoeolksintghrloiuqguhidanwhiocvheniswhiacchtubaalkleysathTeefclooantainndg woan.terThseusppernoscieosns. is repeated over and over until the required thickness of insulation is reached. Most other types of wire are insulated with polyvinyl chloride or pproolcyeescshyldeonees unostingensanureexturnuisfioornm ptrhoicceksns.ess UofnliiknesuTleaftlioonn adriosupnedrsitohne cwioraet.ing,Itthisis atlhseomumolrtei-lparyoenrestoofpithneholTeesflobnecparuosceestsh.e cTohaetinognlyismaajosringdliesadlvaaynetragreathoferTetfhlaonn alsayearwiorfeaihnasrudleartormatiesritahlatisitapipsliseofdtovaenrd sthuebjeTcetflotno atborassoilovne. thiSsompertiombelsema theOvoeprerattheionyeaerfsf,iciPehnotelnyi.x hTashedecvoemlpoapneydowintss mseitxhocdosmplaenxd emaqcuhiipnmeesn,t teoachpeorfforwmhich very over asnldoultyhenfebeadsckthoen twhiere spforoolms thageaisnp.oolsProtdhurcotugihon thceontTienfuleosn suspension around the into an clock rom Monday morning until Thursday afternoon. Three-day (Nobody here wieseokvenedrsworaknedd,l"ongsayssumHmoerracveacCaotriboinns.)areIt'tshe forrulebenatefiPthsoensiuxch Wiasre tshmeaslel wtihraetsthies gcroomwpianngy paonldichye iisntetnodsscafyorsmtahlel.comCpoarnbyintoskayeseptphaecedemaannddgrfoowr to mpiecetturte.he deTmhaendh.eadaBcuhtesexapnadndpirnogblienmtso otthhatergoarewaisthisa dleafrgienibtuesliynensost airnethseomething he has every intention of avoiding, after experiencing them himself in AJtanounaerytoifme19t6h9e. busAtinetshsatemtpilmeoyetdhe35c0o.mpaTnhyatwaswasknobewfnoraes TahefrimraeldeWisrter,oyeadndit ebelseicdtersoniccoastuibn-gaswsiermebloifesa.ll ItySpMesw,astahemacjoomrpancyustwoamsera.lso a sub-contractor for 000847 Vermont Business, January, 1986 Pag6e starItt ahlils bowenganbusiinne1ss9.56 whHeins HionriatciealCoirnbcilninagottionoutwasoftothweardserhvaircdewaraendofdecbiedaetdingto asunpdplcioeuss,inbOuthmearfcraimeendincononvinictedalmhoismtoffrotmhetpherofbeigtisnntiong.be fTohuendbuisninwierses. wasParizo sihnodreteddipsrtoafnicteablaewayandfroitm gtrheew.presIetntwasPhoheonuisxedWiirnealolcaragteionmodern plant only a whicThhenThecrammael twhaes fimraek.ingAttheabosuutbastsheembslaimeestime IBM phased out the product for TherImnalDecweamrebheorusaeftwehricthheisfirtehetpheresceonmtpansyiter.esuTmheed obupseirnaetsisonwaisn arnenaunmsecdatPhheodenix aafnteewrtrthoem mtyhechoalsohegsical bird that burned itself on a furneral pyre and rose up smalIlt. wasTefatlonthidsispteirmseioandewilriebercaotateindge,cisoinolny waassmamlaldeftroackteieopn otfhewhbautsinheasdsbeen Tbohtehmaplr'osfitbaubsilneesasn,d wraesquicrheodsenfewtoembpelotyheeess.ole business of Phoenix because it was "We'"rWeitmhuc3h50happepoipelre dyooiun'gveitgotthi3s50wapyr.o"blems," Corbin says of the decision. the Iptriwnacsipaalgs.ood Tchheoicleargfeorwimraenycoremapsaonnise,s ntohtatjhusatd bteheenpecrosaotnianlg pmirneifaetruerneceswiroefs began chem, wteoredromporeoutprotfoitcaobnlceentarnadtediodnnoottherrequaisrpeectesxteofnsitvhee weimrpelobyueseintersaisnitnhga.t, for (Corbin says it takes a minimum of two years to properly train an operator.) worlEdvenwthouanleleydPhthoeenitxinywasTeftlhoenonilnysuolnaetedlefwti.resAmnudstsodocusbtuosmienresssfwriotmhalGlranovder the Zsle's one and only manufacturer Corb"iWne,'ll"hdoowevaenrytwheindgonw'et cahnavetothheelpphailcoussotpohmyerthdatevetlheopcuasptroomdeurcti,s" alswaayyssHorirgahcte. wWhea'tvecabneeanndincatnhisnotbusbeinedosnse.longWe'erneougihndetopenkdneonwtouVerrmwoinrteersi.s gooIfd wtihreey, pwueshkunsow 00 far we'll tell them to go someplace else." The question is -- where? LANGUAGE: ENGLISH UMI-ACC-NO: 8602610 LOAD-DATE: October 9, 1995 008:4% 133 0008E5 Jon IN THE UNITED STATES DISTRICT COU! FO TEE OTDC+1] PYBawsoheeron TWEINLNBAUNRT,EAJRALMETSENDNAAVNITD, TEERNWNIANNTJ,ADCKESLOLNA MARIE TENNANT, and SANDRKA. TENNANT, red Plaintiffs, v mSp imsmToEm | CIVIL ACTION NO. 699-0488 .1 DUPONT DE NEMOURS & CO, INC, Defendant. SECONDAMENDEDCOMPLAINT Now come plaintiffs Wilbur Earl Teanass, Erwin Jackson Teanaat, James David Teanaat, Della Marie Tennant and Sandra K. Tennant ("Plaintifi") and state as follows for their Second Amended Complaint agaiast defendant E.I. DuPont de Nemours & Co, Inc. ("DuPoat") herein NATOFUACRTIE ON I This is a civil action for declaratory, injunctive, and equitable relief, monetary damages, and response costs incurred and to be incurred by Plaiatifs or bodily injury and property damage to Plaintiffs and ther property arising from the acts and/or omissions ofDuPont during the ownership and/or operation ofDuPont's Dry Run Landllin Wood County, West Virgiai, defined herein as the "Site" under the authority of (i) the Comprehensive Environmental Response, Compeasation and Liability Act of 1980, as amended ("CERCLA"), 42 U.S.C. 1 9601 et seq; (i) (he Federal Declaratory Judgment Act, 28 U.S.C. 2201 ef seq; (i) the Resource Conservation andRecoveryAct of 1976, 5 amended (`RCRA"), 42 U.S.C. 6901 et seq. the Clean Water Act, 2s amended ("CWA"), 33 US.C. 1251 ef seq; (+) the West Virginia Hazardous Waste 0a0::n ManagementAct (the "Waste Act"), W Va. Code 2-1-1er seq. and (vi) princoifcpolmmeosn aw JURISDICTION AND VENUE 2 This Court has jurisdiction over this action pursuant to: 23 US.C. 1331, 1332 1367, 2201. and 2202, Sections 107 and 113of CERCLA, 42 US.C. 9607 and 9613, Section 7002(2) of RCRA, 42 U.S.C. 6972(a), and Section 505o(fCaWA), 33 US.C. 1365(a). 3. This Cours has pendant and ancillary/supplemental jurisdiction over Plaintiffs claims arising under state statutory and federal and state common law. 4 Venues proipntehirs District pursuant to 23 U S.C. 1391(b); Sections 107 and 113 of CERCLA, 42 U S.C. 9607 and 9613; Section 7002(a) of RCRA, 42 U S.C. 6972(a); and Section 05(c) of CWA, 33 U S.C. 1365(c), because the discharge, disposal and/or release of solid, toxic and/or hazardous wastes, substances, pollutants, and/or contaminants that gives rise to these claims occurred and/orisoccurring in this District, because the real property that is the subjectofthis actions located within this District, and because a substantial partofthe events or omissions giving tise to these claims occurred and continues to occur within this District PARTIES 5 PlaintiffWilbur Earl Tennant is an individual residing at Route 3, Box 17, Washington. Wood County, West Virginia 26181 6. Plaintiff Erwin Jackson Tennant is an individual residing at Route 3, Box 174. Washington, Wood County, West Virginia 26181 7 Plaintiff James David Temnant is an individual residing at Route 3. Box 372 Parkersburg, Wood County, West Virginia 26101 000: S$ Plaintiff Della Marie Tennant is an individual residing at Route 3. Box 372 Parkersburg, Wood County, West Virginia 26101 9 Plaindff Sandra K Tennant is an individual residing at Route 3. Box 17. Washington Wood County. West Virginia 26131. 10. Defendant E 1 DuPdeNoemnourts ("DuPont") isa Delaware corporation authorized to conduct business in the StateofWest Virginia and has a principal place of business at 1007 Market Steet, Wilmington, Delaware 19895 GENERAL ALLEGATIONS 11. Since approximately 1952, DuPonthas owned and/or operated a facility known as the. E1. DuPont Dry Run Landfill located adjacent to Route No. 68 in the Harris District of Wood County, West Virginia. near the town of Lubeck, which facility i referred to herein as the "Site" and identified generally for illustrative purposes only as the "Site" on Exhibit A to Plaintiffs First Amended Complaint 12. During DuPonts ownership and/or operation ofthe Site, DuPont has disposedof one or more solid, toxic, andor hazardous wastes, substances. pollutants, and/or contaminants at the Site. including but limited to, asbestos, fly ash, bottom ash, boiler ash, coal ash, filter cake sludges. polyamides, acrylics. polyacetal, polyvinyl butyral, polyethylene terephthalate, fluropolymers, paraffin wax, sludges from DuPont's Washington Works plan, Siter aids, construction dirt, paper, cardboard glass, scrap piping and metals, and railroad tes. 15. During DuPont's ownership and/or operation of the Site, DuPont has failed to compact wastes appropriately at the Site. 00925 14 During its ownership and/or operation of the Site, DuPont has failed to adequate control fugitive dust at the Site 15 During its ownership andor operation of the Site. DuPont has failed to maintain adequate slopes of its landfil surface areas at the Site 16. During its ownership and/or operation of the Site. DuPont has failed to properl: control stormwater runoff at the Site. 17. During its ownership andor operation at the Site. DuPont has failed to adequaieis control landfill leachate and runoff at the Site. 1S. During its ownership and/or operation of the Site, DuPont has failed to install and or maintain an appropriate leachate collection and/or treatment system at the Site 19 Duringits ownership and/or operationofthe Site, DuPont has failed to install and or `maintain appropriate catch basins at the Site. 20 During ts ownershipandor operationof the Site, DuPont has failed to install and or maintain appropriately lined sedimentation/settling ponds at the Site. 21 During ts ownership and/or operationofthe Site, DuPont has filed to install and of maintain appropriaterunoffleachate diversion ditches at the Site. 22 During its ownership andlor operationofthe Site, DuPont has failed to appropriatels close and/or retrofit surface impoundments at the Site 23 During ts ownership andior operation ofthe Site, DuPont has failed to submit timel: notice ofits violation of applicable surface and/or groundwater protection standards at the Site 24 During its ownership and/or operation of the Site. DuPont has failed to nous: appropriate goverment officals that i changed the natureof the waste DuPont disposed at the Sie 4 000.37 35 During its ownership and/or operation of the Site, DuPont has disposed of wastes including cerain sludges, without first ubtaining appropriate government approvals. 26 During its ownership andior operation at the Site, DuPont failed to close a drain valve for one of its leachate'sedimentation ponds resuiting in the discharge of pollutants into the environment, including the nearby Dry Run stream 27 Asaresultof DuPont ownership andor operationofthe Site, one or more solid toxic and/or hazardous wastes, substances, pollutants, and/or contaminants have been and continue to be disposed, discharged, and/or otherwise released into environmental media at the Site (the "Contaminants"), including surface and groundwaters at the Site, including the nearby Dry Run stream. 23 Ac all times relevant hereto, Plaintiffs collectively have owned, leased, and/or otherwise possessed several hundred acres of real property adjacent and/or contiguous to the Site which properties are collectively referred to herein as Plaintiffs' Properties" and are depicied generally for illustrative purposes only as "Plaintiffs' Properties" on Exhibit A to Plaintiffs' First Amended Complaint 20 Acall times relevant heceto, one or moorftehe Contaminants originating from the Site have entered and continue to enter one or more portionsofPlaintiffs' Properties through various pathways, including but not limited to the Dry Run stream, resulting in the contamination of environmental media, including but not limited to soils and surface and groundwaters, at Plaintifts Properties (the "Contamination"). 30. Several hundred ofPlaintiffs cattle have been and continue to be killed, injured. or otherwise adversely affected by the Contamination 00829 31 The Contamination has adversely impacted and continues to adversely impact flora and fauna at Plaintiffs Properties. and has impacted and continues to otherwise adversely impact the value of Plaintidfs Properties. 32 The Contamination has made and continues to make Plaintiffs physically ill or otherwise physically damaged, and has caused and continues to cause associated emotional and or mental stress, anxiety, and/or fearofcurrent and/or future illnesses. (CERCLA) 33. Plainifls incorporate herein the allegations contained in Paragraphs | through 32 of this Complaint as iffully restated herein. 35 Plaintiffs and DuPont are each "persons" wichin the meaning of Section 101(21) of CERCLA. 42 USC 960121) 35. The Site is and was at all times relevant hereto, a "facility" within the meaning of Section 10o1fC(ER9CL)A, 42 U S.C. 9601(9) 36. At all times relevant hereto, and at the time of disposal andor release and or threatened release at the Siteof one or more "hazardous substances," as that term is defined in Section 101(14) ofCERCLA, 42 US.C. 9601(14), DuPont owned andor possessed hazardous substances and/or materials containing hazardous substances and by contract, agreement. of otherwise arranged for the treatment and/or disposalofsuch hazardous substances and/or materials containing hazardous substances at the Site, and is, therefore, a liable party within the meaning of Section 107(2)(3) of CERCLA, 42 US.C. 9607(2)(3). 6 [DER 37 At all umes relevant hereto, and at the time of disposal andor release and or threatened release at the Site of one or more "hazardous substances," as that term is defined in Section 10114) of CERCLA. 42 U.S C 9601(14), DuPont is andor was at the timeofdisposal of such hazardous substances, an owner andor operatorofthe Site and is. therefore. a liable panty within the meaningofSection 107(a)(1) and/or (2) of CERCLA, 42 US . 9607(a)(1) andor (2) 38 Ac all times relevant hereto, and at the time of disposal and/or release and or threatened releaseof one or more "hazardous substances, as that term is defined in Section 101(14) OfCERCLA. 42 US.C. 9601(1), DuPont is and/or was a person who accepts or accepted one of more such hazardous substances for transport to the Site and is, therefore, a liable party within the meaning of Section 107(a)(4) of CERCLA. 42 US.C. 9607(2)(4). 39. Asa result of the actions of DuPont as referenced in Paragraphs | through 38 above. a "release" and/or "threatened release," as those terms are defined in Section 101(22) of CERCLA. 42US.C. 9601(22), of one or more hazardous substanceshasoccurred, is continuing to occur. and all relevant times hereto was occurring at, under, and/or from the Site. 30 Plainifis have incurredand will continue to incur costs to investigate and/or otherwise respond to the release and/or threatened release of hazardous substances at, under, and/or from the Site, within the meaning of Section 101(25) of CERCLA, 42 U.S.C. 9601(25). 41 Plain actions takenin response to the release and/or threatened releaseofone of more hazardous substances at, under, and/or from the Site and the costs incurred incident thereto were necessary and undertaken in a manner consistent with the National Contingency Plan set forth at40 CFR Part 300 7 CO0:2 42 Plains have satisfied any and al conditions precedent to the undertaking of response actions, the incurrenceofresponse costs, and 0 the recovery of sich costs from DuPont under CERCLA 43 Under Section 10o7fC(ER2CL)A. 42 US C 9607(a). DuPonits strictly liabl0e Plaintiffs, jointly and severally, for all response costs, including prejudgment interest, incurred and to be incurred by Plaintiffs in response to hazardous substances at, under, and/or from the Site 43 Under Section 113(9)of CERCLA. 42 US.C. 9613(0), Plainuitfs are enviled to contribution from DuPont for DuPont's equitable share of all liability, response costs, and damages incurred and to be incurred by Plaintiffs in response to hazardous substances at, under, and/or from the Site SECOND COUNT (RCRA) 45. Plainiiffs incorporate herein the allegations set forth in Paragraphs | through 4 ofthis Complaint as iffully restated herein. 46. Plaiuifs and DuPont are each "persons" within the meaning of Section 1004(15) of RCRA, 42US.C 6903(15). 47 DuPont is a past or present generator, past Of present transporter, and/or past of preseat ownerand/or operator ofa treatment, storage, and/or disposal facility, who has contributed andlor is contributing to the past and/or present handling, storage, treatment. transportation. and of disposal of"solid waste within the meaningof Section 1004(27) of RCRA, 42 U'S.C. 6903(271 andlor "hazardous waste"vithinthe meaningof Section 1004(5) of RCRA, 42 U'S.C. 6903(5). x. under, and/or from the Site, which may present an imminent and substantial endangerment to health s 009.2% or the environment. within the meaning of Section 7002(a)(1)(B) of RCRA, 42 USC 6972(a)(1)(B) 33 Asa direct and proximate result of DuPont' acts and/or omissions contributing to the past andor present handling, storage. treatment, transporiation. and/or disposal of solid and or hazardous waste a, under, and/or from the Site, which may present an imminent and substantial endangerment to health or the environment, DuPont is lisble for such endangerment under Section 7002(a)(1)(B) Of RCRA, 42 US C. 6972()(1)(B) 49. DuPont does not dispute that Plaintiffs have complied with the notice requirements Set forth in Section 7002(b)(2) of RCRA, 42 US C. 6972(b)(2), and at least ninety (90) days hase past between the date of such notice and the date of filing this Second Amended Complaint. 50 Plaimiffs have complied with all conditions precedent to bringing their claim against DuPont under Section 7002(a)(1)(B) of RCRA, 42 U S.C. 6972(a)(1)(B), and no action has been taken which could prevent the filing of this RCRA claim under Section 7002(5)(2) of RCRA. 42 USC. 697206)(2) SI. Plainiffs are entitled to an injunction against DuPont ordering DuPont to undertake andor pay for any and all investigations, studies. monitoring, response, removal, and remedial actions and/or any other activities and/or actions necessary and/or required to respond to, abate, remediate and/or otherwise address any environmental contamination a, under, and/or from the Site and of Plaintiffs' Properties that may present an imminent and substantial endangerment to health or tie environment, and ordering DuPont to take all such other actions as this Court may deem necessary pursuant to Section 7002(a)(1)(B) of RCRA. 42 U' S.C. 6972(a)(1)(B) 9 ean THIRDCOUNT (DECLARATORYJUDGMENT) 52 Plintifs incorporate herein the allegations set forth in Paragraphs | through 51 ofthis Complaint as if fully restated herein. 53 Anactual. substantial andjusticiable controversy existsbetween Plaintifs and DuPont regarding their respective rights and obligations for the response costs and/or damages that have been and will be incurred in connection with the release and/or threatened release of one or more hazardous subscances at. under, and/or from the Site. 54 Plaintiffs seek a declaratory judgment against DuPont under Section 113(g)(2) of CERCLA. 42 USC. 9613(g)(2), and the Federal Declaratory Judgment Act, 28 US.C. 2201. 2202, holding DuPont sricty liable, jointly and severally, for all and/or DuPont' equitable share of the response costs incurred and to be incurred by Plaintiffs that will be binding in any subsequent "action to recover further response costs or damages. 55. Pursuant to Section 113(g)(2) ofCERCLA, 42 USC. 9613(2)(2), 2nd 28 US C 2201, 2202, Plaintiffs are entitled to a declaration from this Court that DuPont is strictly liable. jointly and severally, to Plaintiffs for all and/or DuPones equitable shareof the response costs and damages incurred or to be incurred by Plaintiffs [EQURTHCOUNT (CLEANWATERACT) $6. Plaintiffs incorporate herein the allegations contained in Paragraphs | through 55 of this Complaint asoffully restated herein. 57. Plaindffs are each "citizens" within the meaning of Section 505(g) ofCWA. 33, US.C 1363(2). 10 00a: 53 DuPont is a "person" within the meaningofSection 502(5) of CWA. 33 USC 3 136205) 59 On April 14, 1998, the West Virginia Division of Environmental Protection ("WVDEP")renewed and reissued a National Pollutant Discharge Elimination System permit (Permit No. WN007(th6e "2Per4mit)'), to DuPont for water discharges from the Site through authority of Section 1342 of CWA, 33 U'S.C. 1342 60 Monthly monitoring reports submitted to WVDEP by DuPont for at least the months of May, July, and August. 1998 confirm that DuPont has discharged and continues to discharge waste from Outles 001 at the Site in amounts and concentrations that exceed applicable limits established under the Permit for atleast iron, manganese, aluminum, and total suspended solids, thereby violating atteast conditions Al, B.1, C.1. C3, C12, 0.1, F2,F.3,F4, G.7, and G.17 of the Permit 61 Monty monitoring reports submitted to WVDEP by DuPont for atleast the months of May, July, and November of 1998 confirm that DuPont has discharged and continues to discharge waste from the Site into the nearby Dry Run stream in amounts and concentrations that exceed applicable limits established under the Permit for at least aluminum and iron, thereby violating at least conditions C.1, C3, C12, D.1, F2,F.3, F4, G7. G3, and G.17ofthe Permit 62. Monthly monitoring reports submitted to WVDEP by DuPont for at leas the months of May, July, August, and November of 1998 confirm that DuPont is currently in violation of at least Paragraphs 1 and 3of the Compliance Order set forth on Page 4 of the April 14, 1998, Findings and Order issued by WVDEP to DuPont as a result of violations of the CWA and Permit standards and limitations referenced above (Findings and Order No. 4015) n COREY 63 DuPont' continuing and on-going violations referenced above constitute continuing and on-going violationsofat least Sections 301(a) and 405(a)of the CWA. 33 USC 1314(a 1345(2). and Sections 22-11-6, 2211-8, 22-11-16, and 22-11-13 of the West Virginia Water Pollution Control Act, W.Va. Code 22-11-1 ef seq. (collectively the "Law") 63 The Permit limits, Law, and compliance order provisions referenced above constitute "effluent standards or limications" within the meaningof Section S05(9)of the CWA, 33 S.C 13650) 65 By vine ofDuPont's violationsof the effluent standardsorlimitations referenced above, DuPont is in violation of "(4) an effluent standard or limitation under this chapter or (B) an order issued by the Administrator or a State with respect to such a standard or limitation" within the `meaning of Section 505(a)(1)ofthe CWA, 33 U S.C. 1365(a)(1) 66. DuPont does not dispute that Plaintiffs have complied with the notice requirements set forth in Section 05(b)(1)(A) of the CWA, 33, US.C. 1365(b)(1)(A), and at least sixty (60) days have passed between the date of such notice and the date of filing this Second Amended Complaint 67 Plainiffs have complied with all conditions precedent to bringing their claim against DuPont under Section 1363(a)(1)ofthe CWA, 33 US.C. 1365(a)(1), and no action has been taken which could prevent the filingofthis CWA claim under Section 505(b)(1)(B) of the CWA, 33 U'S C 1363(5)(1)(B) 63 Plainiffs are entitled to an injunction against DuPont ordering DuPont to comply with the effluent standards or limitations and compliance order referenced above, to pay appropriate civil penalties under Section 309(d)of the CWA, 33 USC. 1319(d), to pay all costs of litigation 12 eon" including reasonable attomey and expert witness fees) and to take all such other action as the Cour: may deem necessary, pursuant to Section SO3()(1)ofthe CWA, 33 US C. 1363(ai(1) WEST VIRGINIA HAZEAIREDTOHUSCOWUANSTTE MANAGEMENT ACT) 69 Plaindff incorporate herein the allegations contained in Paragraphs | through 67 of this Complaint as iffully restated herein 70. Plaintiffs and DuPont are each "persons" within the meaning of Section 22-13-31) of the Waste Act, W Va. Code 22-18-3(11) TL As a result of the acts andor omissions of DuPont as referenced in Paragraphs | through 70 above, DuPont has and continues to operate the Site in violation of applicable permit requirements set forth in Section 22-18-3 of the Waste Act, W.Va. Code 22-18-8. 72. As a result of the acts and/or omissions of DuPont as described in Paragraphs | through 71 above, Plaintiffs are entitled to bring a citizens suit against DuPont to obrain DuPont's compliance with applicable aw, pursuant to Section 22-18-19(a) of the Waste Act, W.Va. Code 2313-19(a). 75. Dupont does nor dispute that Plaintiffs have complied with the notice requirements set forth in Section 22-18-19(a)ofthe Waste Act, W Va. Code 22-18-19(a), and at least sixty (60) days have passed between the date of such notice and the date of filing this Second Amended Complaint. 74 Plaintiff have complied with all conditions precedent to bringing their claim against DuPont under Section 22-13-19(a) of the Waste Act, W.Va. Code 22+18-19(a), and no action has [H 000525 been taken which could prevent the flingofthis Waste Act claim under Section 32-18-1901 of the Waste Act, W Va Code 22-13-19(2) 75 Plainifs are entiled to an injunction against DuPont. ordering DuPont t0 comply "sit the requiremenstest forthin Section 22-188ofthe Waste Act. W.Va. Code 22-158. and ordering DuPont to take al such other action as this Court may deemed necessary, pursuant to Section 22-15 19(a) of the Waste Act, W Va, Code 22-18-19(2) SIXTHCOUNT 76 Plainifs incorporate herein the allegations contained in Paragraphs | through 7% of this Complaint as iffully restated herein 77 To the ent Plaintiffs have incurred damages and response costs and will continue to incur damages and response costs inthe future in response to the release and/or threatened release ofone or more solid, toxic, and/or hazardous wastes, substances pollutans, and/or contaminants at under, and/or rom Site, DuPont is liable, jointly and severally, to Plaintiffs for contribution pursuant to Plaintif rightof contribution arising under Federal and State common law and applicable statues (NEGLIGENCE) 78 Plaintiffs incorporate the allegations contained in Paragraphs| through 77of this Complaint asiffully restated herein. 79. In connection with ts ownership and/or operationofthe Site, DuPont has had and continues to have a duty of ordinary and reasonable care to operate and manage the Site in such + way 2s 0 not create & nuisance or situation causing any injury or damage to human health or the environment 14 00aL2T 30 DuPont breached its dutyofordinary and reasonable care by negligently operat and/or managing the Site andor conducting other operations and/or activities at the Site in such a manner as to cause, permit, and or allow the release and/or threatened releaseof solid, toxic. and or hazardous wastes. substances. pollutants. and/or contaminants at, under, andor from the Site $1 DuPonts negligent acts and/or omissions proximately caused and continue 1 proximately cause damage to Plaintiffs in the formofproperty damage and bodily injury, in addition to creating a situation harmul to human health and the environment, for which DuPont is liable EIGHTH COUNT (NEGLIGPEENRSCEE) 82. Plainiffs incorporate herein the allegations contained in Paragraphs | through 81 of this Complaint as if fully restated herein. $3. Byits acts and/or omissions resulting in the release and/or threatened release of one ormore solid, oxic,and/or hazardouswastes, substances, pollutants, and/or contaminants at. under. andlor from the Site, DuPont violated and continues to violate one or more applicable State and or Federal statutes, including but not limited to Sections 22+11-6, 22-118, 22-11-16, 22-11-18, 22:15 10, and 2218-8ofthe West Virginia Code, constituting negligence per se. 34. DuPont's violation of law proximately caused and continues to proximately cause damage to Plaintiffs in the formof property damage and bodily injury for which DuPont is lizble NINTH COUNT (NUISANCE) 85. Plains incorporate herein the allegations contained in Paragraphs | through $4 of this Complaint as if fully restaced herein. is 06529 86 DuPont's acts and/or omissions in operating and/or otherwise managing the Site caused and continue to cause a substantial and unreasonable interference with Plains use and enjoyment of Plaintiffs' Properties and has materially diminished and continues to diminish the value of Plaintiffs Properties $7. DuPont's substantial and unreasonable interference with the use and enjoyment of Plaintifs' Properties and continuing substantial and unreasonable interference with such use and enjoyment of Plaintiff' Properties constitutes a continuing private auisance 88 DuPont' creation and continuing creationof a continuing private nuisance proximately caused and continues to proximately cause damage to Plaintiffs in the form of property damage and bodily injury, including diminution in the value of Plaintiffs' Properties, for which DuPont is liable. TENTHCOUNT (TRESPASS) 89. Plainiffs incorporate herein the allegations contained in Paragraphs | through S8 of this Complaint as iffully restated herein. 90. DuPont acts andlor omissions resulting in the release and/or threatened release of one or more solid, toxic, and/or hazardous wastes, substances, pollutants, and/or contaminants at under. and/or trom the Site have resulted and continue to result in the release and/or threatened celeaseof one or more such solid, toxic, and/or hazardous wastes, substances, pollutants, andor contaminants at, under, onto, and/or into Plaintiffs' Properties. 91 The solid, toxic, and/or hazardous wastes, substances, pollutants, and/or contaminants present on Plaintiffs Properties originating from the Site were at all relevant times hereto. aad continue to be, the property of DuPont. 16 000s 92 The invasion and presence of DuPons solid. toxic, andor hazardous wastes. substances, pollutants, and/or contaminants at. under, onto, and/or into Plaintiffs' Properties was and continues to be without permission or authority from Plaintiffs or anyone who could grant such permission or authority 93 The presence and continuing presence of DuPont' solid. toxic, and/or hazardous wastes, substances, pollutants, and/or contaminants at Plaintiffs Properties constitutes a continuing trespass 94. DuPont past and continuing trespass upon Plaintidfs' Properties proximately caused and continues to proximately cause damage to Plaintis in the form of property damage and bodily injury, including diminution in the value of Plaintiffs' Properties, for which DuPont is liable. (PUNITIVE DAMAGES) 95. Plainiffs incorporate herein the allegations contained in paragraphs | through 94 of this Complaint as iffully restated herein. 96 DuPonts acts and/or omissions as described above were conducted with such malicious, wanton, willful, and/or reckless indifference to Plaindiffs rights and/or flagrant disregard for the safety and/or propertyof Plaintiffs that DuPont is lable for punitive damages. WHEREFORE, Plaintiffs hereby demand tha this Court A Entera judgment against DuPont, pursuant to Section 107of CERCLA, 42 US C 9607, that DuPonti strictly lable, jointly and severally, to Plaintiffs for all response costs and damages that Plaintiffs have incurred and will incur in connection with the release and/or threatened 7 conuen eiease of hazardous substances at, under, and/or from the Site in an amount according 1 the proof at rial, plus attorneys' fees (to the extent recoverable). costs. and prejudgment interest B In the alternative. enter a judgment against DuPont. pursuant to Section 113) of CERCLA, 42 U'S.C. 9613(t). that DuPont is siriclyliable to Plaintiffsfor DuPoncsfair. equitacle. and proportionate contribution for all response costs and damages that Plaintis have incurred and will incurin connection with the release and/or threatened release of hazardous substances at, under and/or from the Site in an amount according to the proof at trial, plus attorneys' fees (10 the extent recoverable) costs, and prejudgment interest; C. Ena dteclaeratrory judgment against DuPont, pursuant to Sections 107 and 113() of CERCLA, 42 U.S.C. 9607, 9613(g), and/or 23 US C. 2201, 2202 that DuPont is strictly liable, joinly and severally, to Plaintiffs for all response costs and damages that Plaintiffs have incurred and will incur in connection with the release and/or threatened release of hazardous substances ar, under, and/or from the Site in an amount according 10 the prooaft rial. plus attorne:s fees (to the extent recoverable) costs, and prejudgment interest; D. Inthe altemative, enter a declaratory judgment against DuPor, pursuant to Section 115(6) and () ofCERCLA, 42 U.S.C. 9613(9. (), and/or 23 U S.C. 2201, 2202 that DuPont is suictly liable to Plaintiffs for DuPont's fair, equitable, and proportionate contribution for all response costs and damages that Plaintiffs have incurred and will incur in connection with the release andlor threatened releaseofhazardous substances at, under, or from the Site in an amount according to the prooaft trial, plus attorneys' fees (to the extent recoverable), costs, and prejudgment interest E Eneraninjunction against DuPon. pursuant fo Section 7002(a)(1)(B) of RCRA. +2 USC. 6972(a)(1)(B), ordering DuPont to undertake and/or pay for any and all investigations. 13 eoosen studies. monitoring, response, removal, remedial, andor any other actions necessary aon fothders nc required to respond to, abate. remediate. and/or otherwise address any environmental contamination at. under. and'or from the Site and/or Plaintiffs Properties that may present an imminent and substantial endengerment to health or the environment, and ordering DuPont to pay all costs of litigation (including reasonable attorney and expert witness fees) and prejudgment interest. F Enter an injunction against DuPont, pursuant to Section S05(a)(1) of the CWA. 33 USC. 1365(a)(1), ordering DuPont to comply with the effluent standards or limitations and compliance orders that DuPont is violating, to pay appropriate civil penalties under Section 309) of the CWA, 33 US.C. 1319(c), and ordering DuPont to pay all costsoflitigation (including reasonable attorney and expert witness fees) and prejudgment interest, G. Enteran injunction against DuPont, pursuant to Section 22+18-15(a)of the Waste Act W.Va Code 22-18-15(a), ordering DuPont to comply with applicable provisions of Section 22-18 $ of the Waste Act, W.Va. Code 22-138, and ordering DuPont to pay all costsofliigaticn (including reasonable attorney and expert witness fees) and prejudgment interest H Enter a judgment against DuPont under Federal and/or State common law thit DuPont is liable to Plaintiffs in contribution for DuPont's fair, equitable, and proportionate share of al liability. response costs, and damages incurred and to be incurred in connection with an: environmental contamination at the Site; I Enterajudgment against DuPont that DuPont is liable to Plaintiffs for negligence in an amount to be determined a trial; J Entera judgment against DuPont that DuPont is liable to Plaintiffs for negligence per se in an amount to be determined at trial: 19 eRuEe K Enterajudgment agains: DuPont that DuPont is liable to Plaintiffs for nuisance in 40 amount to be determined at rial; L Emerajudgment agains: DuPont that DuPonti liable to Plaintiffs for trespass in an amount to be determined at trial; M Enter a judgment against DuPont that DuPont is liable to Plaintiffs for punitive damages in an amount to be determined at rial, and N. Eneajudgment agains: DuPoat for Plaintify costs, attorneys' fees, and interest and all such other and further relief as this Court may deem just and appropriate JURY DEMAND Plaintiffs hereby demand trial by jury on all issues so triable. TWEINLNBAUNRTE,AJRALMTEESNDNAAVNITD, TEERNWNIANNJT,ACDKESLOLNA MARIE TENNANT, and SANDRA K. TENNANT Larry A Winter Carey. Hill, Scott. Winter & Johnson PLLC P.O Box3884, Charleston, WV 25338 (304) 345-1234 Robert A. Blot J Steven Justice Ta, Stettinius & Hollister LLP 1300 Firstar Tower 425 Walnut Street Cincianati, OH. 45202-3957 (513) 381-2838 0 0po5eY CERTIFICATE OF SERVICE hereby certify thaat filed, date-stamped copyof the foregoing Second Amended Complaint, which was filed with the Court on October 21, 1999, was served upon the following parties by regular US. mail. postage prepaid, this 21" day ofOctober, 1999 `The Honorable Janet Reno Attorney General of the United States S111 Main Street Building 10 Street and Constiution Ave, N.W. Washington, D.C. 20530 Carol Browner, Administrator United States Environmental Protection Agency 401 M Street, SW. Washington, D.C. 20460 W. Michael McCabe, Regional Administrator United States Environmental Protection Agency, Region [11 1650 Arch Street Philadelphia, PA. 19103-2029 Michael Miano, Director WV Divisionof Environmental Protection 10 Melunkin Road Nitro, WV 25143 Eric M. James, Esq Paula Durst Gillis, Esq Spilman, Thomas & Battle P.O Box 273 Charleston, WV 25321 Larry A Winter 000%; SStEinEssWeheCaney Pr8iConrr rata [ FlR v Sp ew Gena seo CAREY. ILL. Sn C1O30T1TB.ae sWkIOnNeTCe EoRre&n JoHyso. CHARLESTON.PWOEBSoxT3V8IaRGINIA 25338 October 21, 1999 LicovoreeivOedCT- I25s2a5t wy. unTea ososes roiieen Ema smears chon vorn we fon Samuel L Kay. Clerk United States District Court PO Box 1526 Parkersburg, WV 26101 Re: Wilbur E. Tennant, etal. v. EI DuPontde Nemour&s Co. Inc. Civil Action No. 699-0438 Dear Mr Kay, civil action. Lenclose herewith a Second Amended Complaint for filing in the above-referenced Thank you very much for your assistance in this matter. [f you have any questions. please do not hesitate to contact me. Very truly yours, LAW sms Enclosure cc: The Honorable Janet Reno Carol Browner W Michael McCabe Michael Miano, Eric M. James, Esq Paula Durst Gills, Esq. Larry A. Winter oan TAFT, STETTINIUS & HOLLISTE.. LLP IPA, 513.381.2838 res oat Crate St hSotm August 18, 1999 RREEGTIUSRTNERREEDCEIMPATILRNEoQ.UESRT4E1D0003615 $S0t10a7tDuMutasororknyettAgdeeSnttrNeeemtours & Co., Inc. wilmington, DE 19898 RE ct E dS, Re: Notice Of Intent To Amend Complaint To Bring Citizens Suit Under Federal Clean Water Act In Connection With CVDoiurrtPgoinntIi'nasc:. DrT(ye5nDnR.aunntu,.Lvaan.edtfiCalli.lvilIv.nAcWBt.o1io.odnbCuoNoub.notnyts,:d3W9ee-s0Nt4e5m5ours & Dear statutory Agent: On behalf of our law firm's clients, Wilbur Earl Tennant (Route 3, Box 17, Washington, West Virginia 26181), Erwin Jackson Tennant (Route 3, Box 17A, Washington, West Virginia 26181), James David Tennant (Route 3, Box 372, Parkersburg, West Virginia 26101), Della Marie Tennant (Route 3, Box 372, Parkersburg, West Virginia 26101), Washington, West VainrdgiSnainadra261K8.1)Ten(ncaonltlec(tRiovuteely 3,theBox"Te17n,nants), E.I. DuPont de Nemours & Co., Inc. (*DuPont) is hereby notified that the Tennants intend to amend their Complaint currently pienndtihengSoaugtaihnesrtn DDuiPsotnrtictinoftheWesrtefVeirregnicneidaactotiborninign aFedcelraailm Court against Dupont, pursuant to Section 505 of the Federal Clean Water Act, as amended ("CWA"), 33 U.S.C. 1365. Section 50S(a) (1) of the CWA permits the Tennants to commence a civil action against "any person . . . who is alleged to be in violation of (A) an effluent standard or limitation under this chapter or (B) an order issued by the Administrator or State with respect to such a standard or limitation." 133 U.S.C. 1365(a) the CWA t(o1).incl"uEdfef,lueanmtongstoatnhdearrdtohringlsi,mit"aatipoenr"mitisordefcionnedditiuonnder thereof issued under Section 1342 of this title, which is in effect under this chapter (including requirement applicable by reason of section 1323 of this title)." Id. at 1365(f). eases SAutgautsuttor1y8, Ag1e9n9t9 Page 2 the stBaatseedofupoWensta Vriervgiienwiao'fsthDeiviisnifoonrmoaftioEnnvpirroovnimednetdaltoPdraotteectbyion t(h"eWVTDEeRn"a)ntisn hraevsepondseetertmoinaedFretehadtomDoufPonItnfoisrmcatuirornentAclty irenquest, pveiromliattiorneisofsueatd tloeasDtupotnhte fbyolWlVoDwEiPngonprAopvriislion1s4, of199t8h,e uNPnDdEeSr areustpheocrtitytoofdisScehcatrigoens 13f4r2omofDuptohnet'CsWADr(yPeRrumint LNaon.dfiWlVl007i6n24W4o)odwith County, West Virginia: 1. Mfoornthatlylmeoanstitotrheingmonrtehpsortofs Msauyb,miJtutleyd, toandWVADuEgPusbty, Du1P99o8n,t dciosncfhiarrmgethawtastDeuPofnrtomhaOsutldeitsch0a01rgeatd tahned DcuoPnotnitnueDsrytoRun Laapnpdlfiiclalbleinpearmmoiutntslimaintdscofnocrenattralteiaosnts itrohna,t meaxncgeaendese, aatlumlienausmt, caonnddittiotoanls suspended A.1, B.1, solids, thereby C.1, C.3, C.12, violating D.1, 7.2, F.3, F.4, G.7, and G.17 of Permit No. WV0076244. 2. Mfoorntahtlylmeoanstitotrheingmonrtehpsortofs Msauyb,miJtutleyd, toanWdVDNEoPvembbyerDuoPfont t1o398d,iscchoanrfgiermwatshtaet DfurPoomntthehasDuPdoinstchaDrrgyedRunandLacnodnftiilnlues cinotnocentthreatnieoanrsbythDarty eRuxnceesdtraepapmliicnabalmeoupnetrsmiatndlimits for catondlietasitonsaluC.m1i,numC.3a,ndC.i1r2o,n, D.t1h,erFe.b2y, viF.o3l,atiFn.4g, aGt.7l,east G.8, and G.17 of Permit No. WV0076244. informInataidodnitpiroond,ucetdhetoTednantaentsbyhaWvVeDEPdettheartmiDnuePdonftromisthceurrently in vsietolaftoirotnh oofn Patagelea4stofPtahreagArapprhisl 114,and19938,ofFtihnedinCgosmplainadncOerdeOrrder sitsasnudeadrdbsy WorVDElPimittoatDiuoPnosntraesferaenrceesdultaboofvevi(oFliantdiionngsofandtheOrCdeWrA No. 4a0l1s5o).ConsTthietuctoenticnounitnignuianngd ovino-lgaotiinognsviooflataitonlseasrtefeSercetnicoendshe30r1e(ian) aSnedcti4o05ns(a)22-o1f1-t6h,e C2W2A-,11-383, U.2S2.-C1.1-16, 13a1n1d(a2)2,-111-31485(ao)f, thaendWest Virginia Water Pollution Control Act, W.Va. Code 22-11-1 etseq. referAesnceidndiicnattheids abnoovtei,ce thaere cboansteidnuuipnogn antdhe oni-ngfooirnmgatviioonlatthiaotnshas WaVcDtEuRa'lslypubbeleinclpyr-oadvuacieldabtloedaftielesbymaWVnDyEPo.f tWhee mdoindthnloyt, fqiunadrtweirtlhyi,n atnodWUaDnEnuPalundmeonrittohreintgermrsepoofrtsPertmhiatt DNou.PonWtV00i7s62r4e4q.uireThdust,o stuhbemit eoates sAutgautsuttor18y, Ag1e9n9t5 Page 3 Tennants reserve their right to allege and assert additional violations of the CWA, if additional information is obtained from WVDEP, U.S. EPA, or any other source indicating additional CWA vTaiegonalnianatsnittosnDsu.iPnotnetnNdevientrotthhaeemleenasdbso,vteh-DeuirPreofneCtroemnpiclsaeidhnetrleibtciyugrnartoeitnoitnfliyetdpoentidhnaictnlgudtehe a referenced above. citizens suit claim against DuPont, pursuant to Section 505(a) (1) of the CWA, within sixty (60) days after issuance of this notice to obtain relief at least for DuPont`s violations of the CWA The following are receiving copies of this notice. 1. ACdamrionlisBtrroawtmoerr REGISTERED MAIL NO. R410009616 RETURN RECEIPT REQUESTED UniPtreodteScttaitoensAEgnevnciyronmental 4W0a1shiMngSttorne,et,DC5.H2.0460 : 2. RW.egiMoincahlaelAdmMicnCaibsetrator RREETGUIRSNTERREECDEIMPATILRENQOU.ESRT41E0D009617 United States Environmental 165P0rotAercchtioSntreAgeetncy, Region III Philadelphia, PA 19103-2029 3. MDiicrheacetlorMiano REGISTERED MAIL NO. R410009620 RETURNRECEIPT REQUESTED WesEtnviVriorngmiennitaalDivPirsoitoenctoifon 10 McJunkin Road Nitro, WV 25143 4. RegE.iIs.teDruepdonAtgendte Nfeomrours CT&ccoor.p,oraIntei.on System 7C0h7arlVeisrtgoinn,iaWVStre2e5t3,01East RREETGUIRSNTERREECDEIMPATTLRENQOU.ESRT4E1D0009621 earn Asutgautsuttor18y, Ag1e9n9t5 Page 4 5. Paula Durst Gillis, Esq REGISTERED MAIL NO. R410009622 SSppiillmmaann cThoonmcaesr & Battle, PLLC RETURNRECEIPTREQUESTED 230000. KBaonxawh2a73 Boulevard, East Charleston, WV 25321-0273 very ~t~ri/lyyous /\ , & ft / [= Ll Liert A.L8TTyok~ie" L #28 mdm cc: WEJairmlwebisunrJDaEacavrkilsdonTTeenTnnneaannnnttant DSealnldaraMXa.rieTenTneaanmtant . Larry A. Winter, Esq. . J. Stephen Justice, Esq. coat lt | oo AnD, Lim Taot oovees m Pe W522 Wo = > as acy 31, 3, 2000 rer wo - v `RETURN excazerREQURETER Owrt.ticweilolfiaWmat0.erBrRaezsaoouar,cesAccisg Chist DC1i2hv0a1irlseiGsortenoenon,fbriEAenvrviS2r5to3rn1em1eetntal Protection Attpacion: Iaduscrial srasch Re: WU/NPDES Permit Nusher KVOOTEAL Deaz wr. Brasson con pvoonowraa : Zinncdluossterdialis2atshaeti1l9l9.9 anaual report sumarizisg the operations of our Dry Run c2alyoumehaovne8a6n3y-42q7u1estions ox seed additional information, please Very truly yours, RSt.LFuaviiczocnnaesyntal Control Consultant Washington Wozks [Rza/rGHv--Lv ce: dSoftiaceG. ofsrHtaetveerc uw? Resources D1i30v4isGiooonseofRPuaaviRrooasdmescal sotection AFtatiernnteisosn,: WYIndu26s3t5r4ial Branch . whee EIDO76133 000s: CF008243 Bom arcuron Loreneseae aGosh hnEt ri denn pre a micas pero prepeeny egriere stve } eE e heaT ra th ren, ox fhe psennrSEe eoones pomeensEinienttheenB,eseaessionpe s en AA en E SieEm T een conmins EID076134 Coo: 3 1229CRYRUNLAVDEILL OPERATIONAL 8220RT Bain Works siAellanhdetwsasstue diisspo,sed of i the Dry Run Landfill rginaes rom E. I du Pout nd Company, Washisgton LandSillShipments. Asmamaofrthye 1999 lands shipments s atached. Surface andGroundwaterMonitoring A summary ofthe 1999 surface and groundwater monitoring activities is attached. LandsillOAppeprratoixoinm.Caotnesltyruc6.1taicornesaonfdeMsacihnatetnaconlcleeActcitoinsviyttySeummwmearreyconsucdiureindg 1999 at the andfil. Project work included consucion of: 26p7mr,ep0iar0a0ttieosnxq,uuar1rt,ed67fH0eDtlP(i6Ee.1sgesfoeexmteeson)fabornfaclzeheao,crhHawtDeenPccEohld,lre1ac6itniooaungnescyees/tts,eqm.u10aTroiuysaacriednlcmslqouudoaewrdeosyvuaebrgdgraeaoodieoewxivleea seotextle, aad 12-inch sol aye. 2= 33961,0043le0litinneeoaafrfo8fs-etoitfcohifdnoicmcehthedridapiemaremfteoetrrealtreepadecrhHfaoDtrePastEeeedppiHpcDeolPlleeEcatcpihoianptederlcaeaialnce.hcatieoncodlraeicni.on drain. + 1,6O0Dn9l0einlgeianurefvaercefteatf24o-fisinpcrhadpiadimtecthe.r comugatedmetalpipe culvert. Revegetation of 12 acresofdiswbed area. spproximAtneleyxi3st5ingfelatnodfslpidaepwadsiatlcshorreecopmisrneudctjesdt.sou ofthe andlarea,Theareawasregradedand hroughAoucthte cooreylseysst.lem2.t9oeemnilalobiloentgnraulclkontsroafnslpeoarcthaotfleewaecrheatGe gaenaersabfotypWtaehsdoehilnragndtftoilnlWeroermdkaisneodrinwseearvmimceenit 1999. seacheAd aupdatedtopographicmap ofth andland crosssection apshowiagtelandfillspacefilled s 2 eens, 3 EIDO761: 2 " DovRunLandfillRemainingCapasityCaloultions `Calculationof1999Gl NetWasteFillVolumeMethod: Waste vo=lu3m,e85h7autlreudckinl1o999ax:3d9.s7 yd3truckload(avg) = 153,123 153,000 y&3 Average netwaste compaction (dailycover allowance include)d estimataetd 80% for 1999: Taal 1999 ill volume = 153,000 x 80% = 122,400ya 122,400 ~ 122,000 | (eRxiasvtiingoecel#l1) Cbaepgaicnintiynrgeomfa1i9ni9n9g a he = somos Capacity used in 1999 = 2200058 Cbaepgaicniitnygroefma2i0n0in0gate = 6800038 Based on 122,000 yd3 per year se ill volume consumption: 688,000yd3 122,000 = 5.6voarsremainingieonexitingsell 009%: 9 EID076136 = ES Mueal Coal Ash GPlaapsesr,, MCiasrdcbeolaarndc,ouWsood NSoolniadssb,eMsetaols,lasulation P(PlPoaolslytysiaccmeWiaadlse,stP,easAlcyrcytlhiyclse,neTFelrueoprhoiptoallytmee,rs) Dinfl Toul 1999 DRYRUNLANDFILLSHIPMENTS SuNupmmbeernosf 1294 us ToTuolmWesight 18.604 "0765 1526 7.615 10 1260 3857 68233 TotPaloWuenidghst 37,207,060 81,529340 15230320 2490620 136,465,340 2 2 cogs END076137 23 Es 1999DRYRUNLANDFILLQUARTERLYLEACHATEANALYSIS REPORTSUMMARY DateSubmited. Report 017000009999 11400 T`SheicrodnQduQauratretrerLeLaecahcahtaetMeoMnointiotroirnigngReRpeoprotrt Fourth Quarer Leachate Monitoring Report DateSubmited. o1m00e199 14/00 Report `"STehcirodnQduQauratretrerPoPnodndUsUdnedredrrdarianiMnoMnointiotroirnigngReRpeoprotrt Fourth QuPaondrUndeerdrrain Monitoring Report DateSubmited. 04/1399 0170/0062/9999 01/0700 Report `FiSresctoQnudaQrutaerrteMronMiotnoirtionrginWgelWlelRlepRoerptort `TFhoiurrtdQhuQauratretrerMoMnoiatiotroirinngWgeWlelllReReppoorrtt DateSubmited Report 172100 SecondHalfStormwater Monitoring Report = No samples obtained for firsthalfstormwatermonitoringreportbecause ofack ofadequate rainfall. 9 3 dns EID076138 a ozs DateSubmitted avons ous asus asians 07115199 08/13/99 09/16/99 102089 108s 122009 ozo Repors JanuaryDischacge Monitoring Report FebruaryDischarge MonitoringReport Mace DischargeMosioringRepos Ape Discharge Monitoring Report MayDischarge MonitoringReport June Discharge Monitoring Report July Discharge Monitoring Report `August Discharge Monitoring Report September Discharge Mosioring Repo Octobe Discharge MostoringReport NovemberDischargeMonitoringReport Desembe DischargeMoitoisgReport ot oes ctaded wih errors ted sve No bess surveys performed din heyes bessofcxemely dey washer, 000: D 9 EID076139 + DRYRUN LAND/FISLLURFACE OUNDWAT12E90R ITEC R ANITL ORING GURMMNARYAFLC-1Y43*TWA MO RESULTS SA O F Sample Date: 072299 Sample Location. Well #6A wets Well #124 wen #128 well #13 We #134 EC:143Remit gL) 0096 0134 0081 54 36 0070 Well #14 25 well #15 0263 Sample Date: 122999 SampleLocaiion. EC:143 Remit(ug/L) Leachate 3 Outer 001 Steam Sampling Son No. 1 ose Sucam Sampling Soa No. 2 5 Property Lise 39 * FC-143 is ammonium perfuoroocianoate iosic srfctant All analyses performed by : L6a2n5caseerwLaboolrlaatnodrieiske 2NH P eaon:n 9 EIDO76140 2 ------------------ `CF008251 -% hike: | 55 Lio i EE : eo|EEe i <C ! ESerne | || S }i iHte:EREaEHEPAN { p4n23d3[J0e0z 1 Sol i ile IES) deh fiig2 aBgHssE2g|H1 i| t s dT E i+i gisil= i s 3 5 | go8% : J i = : Sz : cg = =, : W eC s >Z=J a E ST E 3= : -- EEEL w= 2 a9ao gs w =&=3 Ozn E=~ =z >= JF oO x = wZ 0 006831 EIDO76141 ET ci i g2 i iin 4 ae RLR/OVPLA 1995 ANNUAL LANDPILL REPORT HU/NPRESPERMIT NMRSR.WVQQIS244 (Letter, R.L. Ritchey to W.D. Brannon, dated 01/31/00) BCC: AM..A.V. BMraaldilneoyw,skiS,pilLmeagna,l,ThDo7m0a7s8 & Battie AWso.L mparzecsese,n,CimWNo-r2k7s 1az3u. m8: uiccie 3W.8]0. hRuagmesrey, or. W.. KB.asoespikeieng 5R. Lc.. KRoistlcshcehy GL. KW.. IKzleelsaenld//Jd.. 5.F.DMeedoere/33.05.02.05 moo.a7. Altman AWw.. eA.. Lcirvaenley wa. wa.raMgeenltsiak G. Woytouich I egonns EID076143 \WU/2N0P0O0EASNPNEURAMLITLANNUDMFBIELRL:RWEyP0O0R7T6244 (Letter, R. L. Ritchey to A. G. Tumer, WV-DEP, OWR dated 1/26/01) BCC: A.V. Malinowski, Legal, D7078 A. S. Hartten, BMP-27, 2160 M. L. Press, CH Works M. A. Bradley, Spilman, Thomas, & Battle Tum: PHJ.E..J.. BARouasgsmeesrrety,.JrJ.r. R0..CB.anKeorsilesech R. L. Ritchey - + J. F. Moore/33.05.02.05 In Tum G. W. Klesel J. S. DeBee - In Tum:0. F. Atman AA. Crane JWM...J.ME.MPeLanigvteeillnysk G. Woytowich } dswi2:107 EID114142 ECEIVE ' JAN 29 201 00052 gervex cory 50NOT REMove: a @ pens Frnes w 0 January 26, 2001 CERTIFIED MAIL RETURN RECEIPT REQUESTED Ms.AlynG.TumeCrhi,ef ~~ 2 Y02 787 /70 DOifvfiiscieoonof fWaEtnevrirRoensmoeunrtcaelsProtection C1h2a0r1leGsrteoenn,bWriVer 2St5r3e1e1t Attention: Industrial Branch Re: WV/NPDES Permit Number WV0076244 Dear Ms. Tumer: Enclosed is the 2000 annual report summarizing the operations of our Dry Run industrial landil, Ifyou have any questions or need additional information, please contact me at (304) 863-4271 - Sincerely, . SRr..LEnRviitrcohnemyental Control Consultant Washington Works ARtLtRa/cghwm.ednstsw | . cc: JOfofhincGe.ofBWraittveerc Resourc1e7s + D1i3v0i4siGonooofseEnRvuirnonRmoeandtal Protection . AFtatiernmtoinotn,: WInVdust2r6ia8l54Branch [T---- x eeout EID114143 Frise 2 1 certify under penalty of law that this document and al attachments were prepared under my direction or supervision in accordance with a system designed to assure that qualified personnel properly gather and evaluate the information submitted. Based on my inquiry of the person or persons who manage the system, or those persons directly responsible for gathering the information, the information submitted is, to the best of my knowledge and belief, true, accurate, and complete. | am aware that there are significant penalties for submitting false information, including the possibilty offine and imprisonment for knowing violations. RL RLichAey L 1126101 Sr. Environmental Control Consultant Washington Works 00057 EID114144 3 2000 DRY RUN LANDFILL OPERATIONAL REPORT Facility"AUllsetrhse waste disposed of in the Dry Run Landfill originates from E. |. DuPont, Washington Works and its auxiiaries. andfil Shipments "A summaryofthe 2000 landfill shipments is attached. Surface and Groundwater Monitoring "A summaofrtyhe 2000 surface and groundwater monitoring activites is attached. Landfil TOhpeeralteiaocnh,atCeoncosltlreuccttiiononsaysntdeMmacionntsetnraunccteedAcdtuirviintgy Summary 1988 remained in service throughout the entireyear of 2000, Almost 3.3 millongallonsof leachate were transported to Washington Works for treatment in 2000. and a tAopocgrrosasphsiecctmiaonpmofatpheshloanwdifnilg itnhdeicaaptpirngoxtihmeaptreolpaonsdfeidl feilneavlagtriaodnaintgthpelaennadreofattthaechyeeda.r 2000 `Dry Run Landfil Remaining Capacity Calculations Calculationof 2000 fill Net Waste Fill Volume Method: Waste v=ol4u,m1e47hatruulcekdliona2d0s00x:38.6 yd/truck load (avg.) = 160,074 ~ 160,000 yd* Average net waste compaction (daily cover allowance included) estimated at 80% for 2000: Total 2000 fil volume = 160,00x0 80% = 128,000 yd* Ravine#1 Capacity remaining at the (existing cell) beginningof2000 = esso00yd Capacity used in 2000 = 128000y Capacity remaining at the. beginning of 2001 = se0000yd Based on 128,000 yd" peryearnetfll volume consumption: 560,000 yd?/ 128,000 = 4,4 years remaining life on existing cell EIDI14145 : [TEES 4 Material Coal Ash Paper, Cardboard, Wood Glass, Miscellaneous Solids, Metal, Non-Asbestos Insulation Plastic Wastes (Polyamides, Acryiics, Polyacetal, PolyethyleneTerephthalate, Fiuoropolymers) Dirt, Construction Total 2000 DRY RUN LANDFILL SHIPMENTS NShuimpbmeerntosf 1347 TotaTloWnesight 19767:5 ToPtaoluWnedisght 39,535,000 1362 6178.78 12,357,560 1073 6339.32 12,678,640 365 6502.38 13,004,760 a1a7 38,787.98 77,575,960 EID114146 [SDE s 2000 DRY RUN LANDFILL QUARTERLY LEACHATE ANALYSIS REPORT SUMMARY Date Submitted Report 03/20/00 0772000 10/09/00 1/16/01 First Quarter Leachate Monitoring Report Second Quarter Leachate Monitoring Report `Third Quarter Leachate Monitoring Report Fourth Quarter Leachate Monitoring Report 2000 ORY RUN LANDFILL Date Submitted 04/05/00 07720100 10/09/00 116101 QUARTERLY POND UNDERDRAIN ANALYSIS REPORT SUMMARY. Report First Quarter Pond Underdrain Monitoring Report Second Quarter Pond Underdrain Monitoring Report Third Quarter Pond Underdrain Monitoring Report Fourth Quarter Pond Underdrain Monitoring Report 2000 DRY RUN LANDFILL QUARTERLY WELL MONITORING REPORT SUMMARY Date Submitted Report 04/12/00 07120100 102000 147101 First Quarter Monitoring Well Report Second Quarter Monitoring Well Report `Third Quarter Monitoring Well Report Fourth Quarter Monitoring Well Report 2000 DRY RUN LANDFILL SEMI-ANNUAL STORMWATER MONITORING REPORT SUMMARY. Date Submitted Report 7124100 1723001 First Half Stormwater Monitoring Report Second Half Stormwater Monitoring Report . eentny EID114147 5 2000 DRY RUN LANDFILL MONTHLY DISCHARGE MONITORING REPORT SUMMARY Date Submitted 02/03/00 Report January Discharge Monitoring Report 0313/00 February Discharge Monitoring Report 04/14/00 March Discharge Monitoring Report 05/16/00 April Discharge Monitoring Report 06/15/00 May Discharge Monitoring Report 07/17/00 June Discharge Monitoring Report 08/15/00 July Discharge Monitoring Report 09/18/00 10108100 11102100 August Discharge Monitoring Report `September Discharge Monitoring Report `October Discharge Monitoring Report - 12/15/00 otra November Discharge Monitoring Report December Discharge Monitoring Report 2000DRYRUN LANDFILL BENTHICSURVEYREPORTS 06/27/00 Benthic Macroinvertebrate Survey: May . 11/28/00 Benthic Macroinvertebrate Survey: August: 00-20 EID114148 ' DRY RUN LANDFILL 2000 'GROUNDWATER/SURFACE WATER MONITORING `SUMMARY OFFC.143* ANALYTICAL RESULTS `Sample Date: 07/19/00 `SampleLocation EC-143 Resutlugl Well #12 0.160 We #124 0.128 `Sample Date: 07/20/00 Well #6a 0212 Well #128 0.028 Well #13 8 Well #134 99 Well #14 01s `Well #15 0.763 `Sample Date: 10/3/00 Leachate . 27.4 . ) Outlet 001 315 - Stream Sampling Station No. 1 0.758 Steam Sampling Station No.2 27.6 Property Line 103 *FC-143 is ammonium perfluorooctancate ionic surfactant All analyses performed by: Lancaster Laboratories 2425 New Holland Pike PLaOncBaostxer1,24P2A5 17605-2425 - . e0082s : EID114149 Emmmedbeeeeeecbee dL I Sohg oo SS TUSSI 00 TT 968 eT EE Sle ! Iee 0 FEE I gSeoep | EE 98780 || feE ni N ey 885680 EE e E e EEE 94900 | | I eRT a 980 Sm 7Td7epe0 | EE 000 . AZARDOUS LANDFILL UN, WOOD COUNTY, W.va. VOLUME AVAILABLE = = + EID114150 | nr] | 1| rs ia ei] WASHINGTON WORKS : Ww ME77 AR 000uls - 0 o0 | > YnA & $ - AE -ggo FR-4 S22 o Zoes er 308 2 >|||| 2se&<42 Z<||| _5.=_% S=|| 255z%% gil eo wxil sd= 2 || WORK THIS DRAWING WITH: WWM 760 wWwm 677 WBPF 7474 N 255705 E138/16/7" WWM 789 JOE GASTON 2-29-00 weGRAPHIC SCAL:E w 1 NCH = 60 FEET PRELIMINARY EIDII4151 000527 = w = < z==z Zo 82wz DooOg % & a. 2 1 Orawing No. 135 000824 BA 101 FROFO FICE M EUIAEENT ~ Es emical in LAr upec. . .. | roun water not maIISTTE | a nea rea ox AAe TnCeEReEnO oe rto r vi Tveee vet Scaheememiarn fiosdainutrooussddvaone caoumoameedbyLuborcek-- ,PoUf L"ruToyPevDslof pchicbofeC4en nmoete te51 Wa"Tehoreyh: uWabsasbeenodvaoc0a.i27n hsndpeotnkineg wseter | SoivLnoFvwsulePeflviaeklsdspeo o0SrfeSarhlivseconshDeTrhuieceosassltebe|we i veteplbseewhnlodmaweoelas1ci0ncduoiemninrgofuondmn "cime,ecomawuhs s ad imsplni oa. id sCni onopu.c"yiIcocoimnoDasaudd,o,"TTahoederse1e2esttoaaaryyehYiicg lnukGeo sveessoirlee meor e ee,Th cing beHcaotwievCe.r,8srpweresiasicncfhaeniccoaml,mmuenaintiyngle croenncienviend is Pser ndS pgoA em SE alTtenaybyo.ncchoiln ingen atsonnnCrsstee Foi botl tyie.rce iTmeaosertemt chisopcernmrabteeonescoamdnpotuniedc.sksCtott,hecdrmallkerrsoe1ws8 iaolw veAsoe posmstaopann Talms sroCui.ez4airsnaGdsnkddngw)its:d1e ian,gWpci amovmeWe A5ses m wa ewi11lTwe Tootsnoora cineeCnnoge a he wSrh S. hll4eofoe,f3e,. aiTmnicrkneser3Cy0odormanatyAnwOkotwgwilySeirsn18 192tmuediessBannta0 orcxotpolTfsaAimhnegnaet,elfrhosxiecwchnesaptadioTLrAorvS!Woe pEf C3tt.,Wo-oao eekhcokootu oOsWnWr scotrAs. coampTuacnkoyronwsia1nl2d0hatocavters,D2uf0Pcconoatu'bsslpsueddeiiones airoesfoebsie cc ener nle`eRC1oervccoeoofSopuptaso.uugcarbSasaonwsseyb-uehEdeav.nvdedriaowdsn5oi5eo 4o4CwvKneeb,mepcaluosyees5IiMs: eaecTcdrotoc,ipnhyehoetm4i3 .en15dbPcOhA 1afchoeeorfe0.caaleer REE t""oWThoehnnteay3Mdpe"hcTishdseandlg1ojouhaosoeonlooofkohpefend"irffeorecnt tpcrhioediyuscel,y". Tohauchl iCcadonncceaortusoawriesyrteweerrakicdoeodm.gWmiesehiaiogfmitohen tWioarikchsna4m:1iactahle1PoSvD,. 1 ciomodCucoauntipwoeottntepy.eoppalleek'ossfoqnSuieom.nnssWveersea.FtWeedemalacoectk e Cacoo ntoonfptooedthaasai hin1g152 5wssnd 3 nt13 SeaytraehsNelrhocislo(sniomtsdiiornlnekrSpeneodiyope5+n SSohaesiatcedt1s o aieTd SsIt eSnpercaocualodnn,tmWeo'ivne,bnotswwei'1nvge3c102yooepkda chemiVcfalesrs m3M1s.,(woproce,fi,schpbpy pmrrayonAt0saiytcmeiuCan,tcrsondnltayen, pE e e el Ene hcSekaowanit,5iC84e0at0y8iGnaHclhRDphas.S eDrusPocrapsoempe loyerpBsorowvuhghe ffooo B rrm. n pl S--o--a fot""rTmoso4ca 0o0BipaycSoeewhdihisncaSanddan0p(baeCrpisexpaners C ughweA aaarecoeneIraaT kSes,bIpea" erTfT orms atSwte Tcomcehroenii0ondtltehveica4r0e alcacanpasisecwpllodyecs esxpsire Vi fox C4 0.01mln et ube oe 34 cb housStoimmee.bwoedgyhiceoduladvbereageefxoporskedi1a0sb(sooxrplieovenl, comamody SaCerm tmtnsfrssomgaopsdysnha3rs acfeocmttmawthhaeyrrek12 iieerlevaelyfo ,C'TshroatentcBsiuteerkiinngtwieV:ia wr "rough ccooo he tpn pues Tn ma Lp elocueprpr Jacksonaddeed yhat1heselaceocheguidalioaps aecDpuPeorc uSsani"dAarrnsssomguetpmadauiyfeBrheevntEPt4An,d0rawyemcrAoem.e(Caoumpslay wfimhadBkll inition ad * CODE EEPT : THi E8 mdidrilti o4S5 pRlan | i lich! 2 ES gJE E AE Er eR 2 5 hick { Alig Bi {2 RF Hol in RC HHHTidASL i SHLi mh ili fi gis s iil ii ts, ittah d it gi 5= hell ht 2 | 2 SL | peg 3113 pa Jt ELL aE ict d |ifli lHih Hi1th S |} g it i hh BE 2 is antl hin | an ll gle ' Tr 02/02/01 FRI 10:18 (TX. = | BN I) DuPont Haste ype ory January 25, 2001 0% Us SBI M. Aer, ie Oi.leEarvistonm"eaniyt.;MProtictivg iy HChOeNmicyS)irCeontN rolDigviesvio aepn.yon 40d Toxics S06 DLC Ain . Dear pr. ter A IInnfmoryP maJtuinS oenPr33ofiu2yl0e0pa0(gUslEeptItPer: hg, 5, Rasta Amo Dap HUBLUEY Us : wAoPuFlOd,v4olSuerniteasroyf biog submi n eon Samples wars ntSauykrgev,niPleilniilnHicoeroofoytuonrgyereP(oAPngFtQi,nyCgEAxSep#xo3ps8eu2r5le.54. TThoreseoskuelrtss owfitthe blood 4 Summary serym 1 of pe "sultEs Uwh2e0n00nefr,omSeWcoarmkeerAshautnlugbtlhe,atDuPont Yeu HSe are mp poC yh numa op this year Ty W Samples CT Mima tConcentrat Maxim 's"esults S 200l0 No m72 rI 20 l0o.p07 ion , TT i em Concentration TT Mean i Concentration te ihe following "ONC thi abr T ii e Tos 1o.3m3; 7 8 PEmv.e 2sxaADmioplnseousnr,ge tpihe jfroojn wa ith poteng One Pica ji, Sreater t Cols Jo TRS 8 gives upoearmy mai a? EUjyS fIAPN TFO etxhipeuiguCqraeg,1ehiogr 4p0a0 gsshloeuvladhtihned5a.0e = OF 1.16 ppm, = Some m SORCNEICN of 3 5 porn "0d 4 mpoeracnsscfotnocmentghreasgeyy z z APFO lMevPellosyienesthinso,81FUOUDROEFLpYeuwpolrking e uigy APEO orovideq p i = EIDI14198 He Consistently Tess han iggy Samples. 2 ppm, 000535 ee DJra.nuCahrayrl2e5s, 2001 M. Auer "BlSveomaoandsa saenmrtousmngwAitPwhoFrpOkoetcreosnnticiaenlnatAsrsaPitFginoOmneesnxetpseosmwusirett.hbeDuaefutnocvtairoinanocfefsenigtlheonfgeumoey in luenegtsh omfasyerbveicienofflutehnecevdolruontteoenrlygrboyupe,xposuproetepnottieanltiAalPFbuOt egx1poyosbuyrea.avvereargaege fOAlvddideivrteiadotnVaaollhugarmsoaburenyednwUalEtoceParteadnP.ldesTauhsr:efsaepcehaidwdacitteiro6n:maelradesautraeamreentrespohratveed boegenPargeepsorSteadndan6dosfoume Infoormramtaitoin,on HE Ss copy wid 4 copfyeoscosntiutniong,ConifidenfoteialrBsusnes Fp F. Pincliot at0(3d02h)9s99-th4e07i4oonrssea-mtaoinl catRoonP baeirntei dE inc thisGdh uoscgudmo uepnotn,tnpolrenasore cmoentaatc(t3R02o.b3e6r6t. Attachments Vers tnuly yours, Ll eens Gerald L. Director, Kennedf Applied Toxicology und Health C0050 EID114199 > a oO . Oo --Oo ot = -- A RdetvuinsteadesfamCnEaPr.y 2A00mma Peetluoeonctamare VoluAntmamroynUisuemanPderEfxlpuoosruorocetaInnofaotrema(tAiPonFOP)rofile (revised January 2001) revisionealndalortmiodoifnicucioonined in is dent bid slaty and my be syct a CONFIDENTIAL BUSINESS INFORMATION REDACTED L CHEMICAL IDENTIFICATION CChAeSmiNcaulheNarme: ANmmoEnium Perfluorooctnoate mw COMPANY IDENTIFICATION Company Name: Site Locations: E. 1. du Pont de Nemours andCompany Site where APFO is used is 4 resction aid RWoausthein8g9t2on Works Washingion. WV 26131 wSietepsrwohceesrseedAPFO containing products made at Washington Word. Parlin Plant . PCahreleins,eqNuJak0e88R5o9ad SSp3r01uanJecsetePrlsaonn: Davis fy Richmond. Va 25234 Site which disposes of waste containing APFO: RCehe.am1b3e0rs Works g~ Deepwater, NJ 08023 H Contidential Business toformaion Kedscted Caan. EIDI14201 ReascesfaCnEnRy, 2N001ini Pesunontanate Technical Contact. Robert Pinchot (302) 999-3074 CDhuePsotnntutFRluuonroPplraozdaucts CBelntgre7B1o1u2l2e1va0rd Wilmington, DE 19805-0711 II. DUPONT AND CUSTOMER ACTIVITIES Narrative Description of APFQ Use The block diagram on the back page titled "DuPont US APFO Balance descrihes te WDwauisdPhoinntgisoenisWsAorPkFisO nfuosramareTkEaicntigGonPpTiFdEiunnetdhne,cop-rapTdohileeycmptreoorncseoscfsopnousltiyislteiszeodrfopfoelDyumnpontts tong p15 5 "{aindinotthheerrecaoc-timoon,nomersifdered in in ances media twih 3 smith urnereriaztingof TAFPEES #aFquoudlelooAuwPsiFndiOgsptoehrercspiooonnlc.yemnetTrrihazteaetddriio(enrdesmptoeopvl.iynmteghrespcooomnletyamoifenrsthvdeiesrApyPelFriOsti)lo,en,isitfaebaiintylh,iezreAddPraiFneOdd tsoolrdeamsovane witer 1oT0fhfaesiirAtoePriFnwOaatnreerimnacotivnteehrdeatWfoarrso,hmciatnphgtetuoprnoedlWyaomnerdrkissenrtetcoovaenreofdfsfiotre riencdyucslter,iaclaplatnudr#eidl.anadndd/eosrtreomypeirr:ic StThphereuUasSntacbueinldPilzoaeundttspfioodlreytmthheeerpUrdSio)sdpuecfrotsriioaonnvsaorfaisTeeteysfoollfdounbsyefsi,DbueiPrnsotneamtnadltloPyiTntFdeuEasntscrtoieaarltreecddusstytoaottmheersDu(bbootnht i intemally transferred to the DuPont Parlin Plant for the production of hetie fibers, or Teflon Finishes. CgAehnasemmrabaletlredsamaWotourWnkatss.hoifnTnghotinos-nhmaaWztoaerrrdikaoslus1isswtearssetathteeerdpeoirlnmyiamteewrda.sitwneattweharet,eCrhAatPrmebEaetrmaesnndtWoofrtachkielsritwayadadttietrDiadvbesont's or captured on carbon and landfilled in u secure landfill ischuree {Th0eMionstteronfalthperopcreosdsucatt,t4he"sDiuntPeornintg"Spsrtueapncine destroyed by the following reaction: Plant which to produce the APFO cToenftlaoinnedfiibnertsheipnvrooldvuecst is 3 z : DS1uuu4PdoineKtdrutbsnycteH,rinDgl.hC.RTeepRmoorpete..ra"tTuhreermGaals-Dpehcaosmepo'sFiNtiMoRn.of AC3NFeuwvcAulntaertneadtiSvuesttsotTanhtesrmaanldGrRealvaitmeedrMiacteArnitaylusts'. Confident Business Information Redacted Coa.ol ID114202 Pug RYoeluimtdacLymUiaIrPs, 2N00oman Pertlusronciamate CE{CFCOONH, >CFuCF CEH + CO, +NH, sPomasrll}taemcrotouiocnnetsgosofeedrsesi1i0dDcuuaolPmopAnlPteF'tOsi.oSnprT4uhse3ns5ce0epCprolndaudnctd0.so2 casrenroetsigdeetncseinttiemree.d A small and hus amountof commun compressor packing materials. used for industrial pump. valve and aoTnphdeefppairtgoomcneensotsfs.ffolrTurhmaoekpsiomnlagylmlTeoarrmldooiusnnpterofsifinoiAnssPheFwsiOtathetmohiteshesDriuoaPndosdnitttoiPvaersliinncPluldainnginsvoollvveenstsa.blbeinnddeirnsg dPaerssotcereosysgieendngcarttahtceoendAtPdruaFcrOtinfgaaccpciroloirdtdeuiscntgwhc1 hearnegetohveemras.terSioamie odfritehdewaafttletureomrfporeporomalttyuhmriesersfda3ciis3lpi3etr0ys+iisosndnuees to ths reaction aon: This dried material 1s {tThaeinseafionSapolerartoi0osnss)copnsrivsiostcaoefetobovsmearttshepedtrassypertLa4h50yaitnagipssoefitrhoieatirores cracpottahutirtneg.appElmyistsheiopnsrooftAPoFraGSfirboinr,, 15sheenhtypi1c8a0llyatseirnteevrieldinugt {he APFO from the substrat in nai temperatures sion. Pilidtoank upproaching S00F fiiltaerpspalneds lbaoncdoftiymeaq rorae resulting in the semana) ot e and subsequent destruction according to fhe reaction soore "ossCmuatsltloamnpeuprlmsibceaorftdoiifosnasppepirlnsivicooantlivpaoernosd"us[citntseruisneg"thsetempatwehreiarle ftohre aAvPaFriOetiysodfesptprloiyceadt.ionTsh.ereHoswueevser eedmiissspseirostniso.nopTrhoeEdruAectMasrEetSoaltseoomptesrmaFatleulreendsumthbsaeatrvaoliflnoapptlhiecaAtionP ws1h|e0rsFeubtlhO eimceusrteosmueirinhgea1tsat1ihewehere These applications include indusirial packings, 1 Sh and APF staying industrial (les iththe fabrics produ 1V. SUTE RELEASE AND TRANSFER INFORMATION FOR TRI CHEMICALS Not applicuble- APFO is not listed on the TRI z V. SITE REAL NDTE RANSA FERS INFOE RMATION FOR NON-TRI CHEMICALS A. Onsite Air Releases C [FugitivT e |I WashNiengm gltuosinvlWeorw ks T Para lin| Sos ruance|TaChmambeerWsorks -- Stack (PointSource) | 24000 OO 01 0 0 oo Confidential Business Infacmation Redacted EIDI14203 0095. Page t RYeovliusnetdaeLsaUnEaPr.y 2A00m1monium Perflusromtanosie Comments fAiumriteemdismseiaosnusraermeeensttsimoaftsepdecuisfiincgpeonignitnseoeurricnegsccaolcnudluacttieodnsuinntdhejupdasgtements and B. Onsite Water Releases LPT oint Source Wahin5m5o0E0ns0Wtiomraktsed|ToPt3aar0ll0inA|nnual SRo1real5aecea0s7es (165.1999) hamb1e8r.s50W0orks 1 Comments WaEteIr eSmissUionEs aSre esOtFimSaPtEeCdIuEsi"nigteengsinCeeoritngtcealculatthieopnsnand fudgemente nt. RWiaivsehrianfgrtoomntShWetoDrouknPsoyenmteivsWisaisohniTsonrogctcounrHWAfo)orrdkaapsyprPslo.axnitmRaweteiercleeysms3os5d0oefldaeAydPs/uEvsOeinw0ghittlhheee tOheo EEPxrPocAbealbOisflpfirisectaeidcosfDhiePleoutltlimuootndieoMln.odPreAe!vPe(FnPOtiDorMnelaeBanesrdeaTdoVaxeriracssifo)ornu1n49d.09a6BcewotenarsetJruuinsceeted1d1i,nMi1bc9or0to6hs,orU'ts2. HmoAdPeFlOinNg wexoeurlcdisbees.e"xTceheedePdDaMboiuntdi5c0at%edofthtahteAtPimFeOducroinncgentthreatyieaorn.s oAfP1F.O0 ducronicnegnttrhaetiyoenasroafndin 1t0heugrivAePrFwOo/uIldsheoxuctee2d.20%.1ofwgthAePtFiOm/eldu9r0i6ngofthtehevetrime MAivcerroasgoefatnnuEaxlcelAPsFprOeacdosnhceeenttrwaattiso0n.s42in3 the tg OAhPiFoO/RLi.verMocdaleclueldatAedFbPyOusing a fhclioognwhcsoe,nftrreastp0i.e9oc6tn5isuvegilnyA.tPheFAOvr/eivrLearignreaSnOeghpeitdeomfRbrieovrme,r4wfhllioowcwhsofcaon0rd.r1ev9so9plouungmdeAtdoPaEhtiOagIchaLlacinnudlMalatoerwdchrfirvtoeomra ostfhpertehUaeSdsWhaGeessohtlionmgogidtceoalnl.WSTuohrrevkesByelPwllaeavsni.lcloelTlhDeicsatemrdiviesartoftnlhoetwhBeedlOaltheaivoi1llRteihveDecarlmo1s3easnmtdilleuossceadtdoiwoinnnstthreear downstream from the plant where this type of information is available iInmm1e9d9i9a.te4ldyridnokwinnsgtwraetaemr osnamtphleeOohbitoaiRnievderfrformomGEDupPloanstticWs,asWhaisnhgitnognto"norWkYs. z Z showed0.552ug/} APFO. 3 R+eRporBteErMt,SE"M0o5d4e.l00i.ng Releases of Annona Periluormoctanoe into ihe Ohio River", DuPont ferns! EIDI114204 Confidential Business formation Redacted 0095.5 Faget KSaelviiitnacLyanuGaIrPy,2A01on Declan amass RLIinuvbaeedrd,cikcsihPoounbw,leisdcam0Sp.el8r4evgsi/cloe,btD0ai-is4tnr4eiudcgti,/nduJonawdnnu0sa.ir3cy1e52a0mu0go0/flfWrAaoPsmFhOit.hnrgeteSoudnbisfWeeoqrureenktnstwoenlltsheatOthye April. May. 007ugn and Auge 2000. showed a masimum of 0.59 ug/l and samples 1 3 minima of C. On-Site Land Releases sCEonhugarimcnbeeseerriisnntgWhoecrapklacssutltaertesiattoisnmsaAtuPenFdthOjatucdoagnpetpmareionnxitinsmgaatwneadlsytlei3mi0int%eadowfmaestahteseuwAraPteemFreOnttrisneaotthfmeesnptecsiyfisccem Twhaessteewlaatnedr treated releases iasraedessotribmeadteodn (0 to a he carbon 8.000 Imed4ia19t0h0at is landfilled on site. PridorriolpleraatpiaonrsthabvyetrheesWulatsehdiinngimoeansuWroarbklse iAnPWFesOtcoVnicregniter,atioAntsLoitnontth:reeans J32W4i0akcge/lw.alwtierthmeaansauvreermaegnetosf i1n 3199929 .andGr2o0u00ndywtadtrearngmeeafsruormem2e.n2t3s0t9akteon during : ule te find average of 2537ug/l. at Lett tdtid sage At the "local landfill", orm 60.331 0 the groundwater 17300811, with concentrations an range from samples at 0.046ug/l the "local to 39pg/l with landfill" range an average of from 0.54! $.S3ug/l. 0 87/1, Surface with an water average of a1n8d.5suug/rlf.aceAtwaDtrery,RwuinthlatnhdeSimlla,xtihemruemarceonlciemnitterdatmieonasiunrgemreonutnsdowfagtroeofrun1d5wuagt/elrand Ot1fh9e9sm2u.arfxsaaicmempuwlaemtsecrionnwtceherenetr"tauatpkipeoennr"aiannndtdhseh"olpoewrwemedirt"ctoerndcoeonnusttfraanlteliaoronfDse2ay0s0Ruhgii/gnlh.LasaTnn1d61im9g9im0l,e*..soacmIpsnlses 22001 and landfill have 2si3nc0e0s,horwesnpelctoiwveerlyc.oncSeanmtrpalteisonst.aken tn these locations at Dry Run In 1999, 4 RCRA Facility Investigation as completed for Washington Works ZarnoduwnadswastuebrmictoniceednttoraEtPioAnsReofgiAoPn F[1O1 iant JWuanse.hi1n9g9t9"o.n WTohreksr,eport contains data on tMecTahhnesiqvuoaefl,idttihhteeyLhoafntdnaeiosfelcio1uc9sat9toni0odnaysn,asltnyhdseessspaecmcapiflniencaumsboiettvoyerriicfoningetdelowolcaiaqteuiaotlnhtseyaesntduhreiascnacusescspdereoocarevdaauinrlaealsby.sliesa,unpdhotneerrseeoqrmumiepnsitte.the 23 a?Rcecpuorarctywoafshseubemsiutlttesda0re Mnaoriknn.owT.nKotsch. Remedial Progen Manager, EPA Region II, Philadelphia Connffdeindteinaltial BusBuisnens essTIuntformation Redaeted Cons.iSyplines Paget VRuelvuinvtearLyamUuEaIrPy. 2\00n1musnium Perflusenctanoate D Teansfers 0 Off-site Locations Washingion Works: _-- 1incineration | Wastewater treatment [Underground injection 1 OHtahzearrdloanudsfiWllaste Landfill Recycle or recovery ] VI. ONSITE WORKPLACE EXPOSURE Teanste(rlsb, 909) 16000 13400 --} 0 ! 2600 0 25000 | A. Information on the Number of Employees Potentially Exposed 2T0h0e0tdbuireisngbetlhoeiwr dneosrcmrailbewiohreknaucmibveirieosf workers for each that may be of the three exposed to sites where APFO APFO in is year ter [Rr ouno sDaay --TT ----NuWwashhiinnggltoonaWWooDrrakkyssslor . <033 i<0 10-100 ; 1100-350 15230 T I [0251 i Lg) 1 --7 m2 i7: > - = -- -- Routine workeractivities that have potentialfor exposure. % Handling Handling raw raw material APFO dispersions containing APFO > MPaoilnytmeenradnrcyeeorfoppeorlaytmieornizaantdiomnairnetaectniaonncesystems ~~"POapcekroautitonofaPndTFmEaainndtecon-apnuolcefmeArPdFiOspreercsoivoenrypryodsutcetmss * Transtemetdo Cuamibers Works Fi (sc esion 8 snd C shoves Confidential Business information Redacted COO5.15 EID114206 Pages LReovliuvteadcfyaCmEaPr,y 2A00m1 ani Peelluornoctamste FoursiDay i<3 [<0 ! 0.25.1 18 I 1 8 Partin Plan 710-100 Dayle (100-350 I I i 8 1 Routine worker activities that have potential for exposure: -------------- 550 I 1 [ ji > OHpaenrdaltiinognoafnPdTmFaEinatnednaCnoc-epooflbylmeenrdidnisgpefracsiilointiepsroducts > Puckoutoffinished product hNhoetaresethtahteAaAtPPnEFoOtaitcmhoeiulsisdutsshiueibtmlyia.mtee.riAalTllhheeaxanptdorlseeu.deeahtpeottrheeentPiisaarllliiinsePhplroaotneutngtahtiaaslnkfeolreevxatpeodsutreemp1esrature . ehoamndtliinnigagof<t0he2p5o7lymAePrPdOispersion materials. all of which contain <i1n %conAtPacFtOduwriitnhgmost i Hours/Day | <10 [035 7025.1 T Spruance Plant Daysiir _ -- T 10-160 1100-350 5330 <i | fs > : i S I T I -- Routine worker activities that have potential for exposure: > 7 OHpaenrdaltiinognoafnPdTmFaEinatnednaCnoc-epooflfyimbeerr dciosapteirnsgiofanciplriotideuscts > # Operation Packaging aonfdnomna-isnitnetnearendceproofdsuicnttering rolls <N0ot.e9%thAatPFthOe,PwTiFtEh amnodstcoc-onptoaliynmienrg daipsppreorxsiimoantperloydu0c3ts%usAePdFOat, the Spruance site contain B. Information on the Exposure Levels of Washington Works Employees hSiynitgneicreemnemedoidsaattteaosfiastnchdeonppcrreooncdteurscasttisendgisadtdootnnheaetiunsttetW.haesTUhhiSengwltiitomhnitAWedPorFmkeOsa,saunDrduePAmoePnntFt'Oss coaofinratbiaorirbnnoiernnigendAusPtrFial 3 z cmouncchentlroawteironlsevaetlsth(emoostthleyr sniotne-sdwetheecrieabAleP)FlOevceolnstoafinAiPnFgOp.rodTuhcetsdaartea uinsetdhehatavbelesbheolwOonw 2 : Confidential Business Information Redacted ~~ | EIDI14207 CO0%.17 Page" RVeavliusnetdaeFyaGnEaIaPr,y 2A00m1onivin Perflaoranctannste tareetlaecctoimnboinintaotriionng odfonceheomviecralthoepelarsatto3ryaenardsmaatiWnatesnhainncgetownorWkoerrksp.ers"o(nhaelsasmapmplleersesults Year| Sample |_| Type 11999 [Paral [110999877]| (smhoisttely, 1996 6:8 1995 | hours) | Fol Samples | __100 10 [33 | Minimum Maximum | Mean| Standard | | Concentration || Cm Concentration || (inpbj | Deviation | <0.01 053 [0061] 0151 | <00l 24 01037 0.145 jo46| 047 | 0069 | 0063 Partial shift air samples that has been pretreated awriethtaskoedniautmthheydrraotxeiodfe/2e0t0hymlLe/nemignlyucsoiln/mgeathTaenonla.x collection be The APFO is desorbed from the thes using methanulic hydrogen chloride. derivatizing reagent, converting the APFO (0 its methyl ester. which Alter also serves as a workup, the methyl aster is quantified using 3 35 CAroMALoZrph The mths!ester of pertluorudecanois acid 1s equipped with un electron capture detector. used 4 an internal standard. and at fest + three calibration samples Precision is estimated to are prepared (0 cover be +/- 10% relative the concentration range of interest. o`Tnhleydaatvaeraybofveew sshamopwlaevsearabgoevse ctohinesiTsLtVe.ntlyWhbeerleowretshueltAsGarCeHaIboTvLeVoronfear0.t0o1mtgh/emT',LVw,iththe events investigated and corrective action (additional personal protective equipment or engineering controls) (0 reduce the exposure levels is undertaken. Older data from the 1980's show higher levels of exposure. In the early 1990's. Washington Works switched from receiving the APFO as a powder 10 receiving it 4s an aqueous solution. This change was done to reduce the potential for exposure during handling of the dry powder. lu should be noted that in the 1997 time period. the site was starting up new APFO recovers facilities. facilities Operating and maintenance difficulties sssociated may have contributed ( the higher levels of APFO with the start-up of these in the personal samples during that yea. Task specific monitoring data and wipe monitoring data exist. However, these data are not indicativeof employee exposure and are not presented here. These samples are takers 0 identity areas where additional exposure controls may be necessary. Engineering controls ( reduce exposure Zonsist of the follow ing: > Reaction systems are closed systems with continuous ambient monitoring for Vmeonntiolmaetironcosnycsetntermastairoensstalled hereairborne concenteations are significant 32 The polymer dryers operate under negative pressure ( contain APFO and z other materials. > Recovery systems are in place to reduce airborne emissions = 7phe moles ee billion. 0.56mpb ts equivalent 0 the ACGIH TLVof 0 0lmy/m' Content Dniness Information Redacted (fp ED114208 Pages VReovliusnetdarJyanUEaLrPy, 3A00m1uonium Peefluoranctanosts Person protective equipment that workers regularly wear consist of he following > * SpIramofpdeeutrcytvsis.ohuosesglaonvdessiwdeh-esnhiehladndslaitnegtyAgPlaFsOsessoilnutaillonasreoars.aqueous dispersion ~ oCfhsepmliacsahlesporfoteAcPtiFvOe ccoovnetraailnlisnagnsdolguotgigolnessisorprfeasceents.hields when the possibilicy hAiarvleinheigrhesepxirpaotsourrseorpoctaernttriaild.ge respirators where monitoring has shown to AMvatelauWseausrinheimansegsntetsossnionWfgobrelkxopsoo,dsbuflrloeuoo0rdisdAeePrlFueOvme.llsevAhealsvseuomfbmeAaePrnyFtoOafkehrneasvpuerlitboseroetnfo me1em9ap8sl1u,orybeeudetssairwneictoehf1il9di8emn1itted iAnPtFheOteabxlpeosbuerleow.poteDnuteialtothseign1i9f9i5c.an1t9j8o9b-0a0s,si1g9n5m5e,natndmo1v9e84mevnotludnutereirngstchmipslpienrgioedveonftisric. OtfFoirAmee.PmFapnlOaolyyiesniebssloofiotndclrsuedereudnomifncddatahnisteabe1a9rc9eo5mdpisfanfripceuldlit..ngTThdheaeteadntasitoraethidanatttchaeosmteptaabolrfeisbbolenolsoodwofcpofrneicloearnt1it0vrea1ti9e9v8elysre* available upon request ions is I Year 7! #of Samples T Minimem Concentiation tppm) | Maximum Concentration | | Mean Concentration 1995 1989-90 75 ; 23 012 04 1 (om) 45 | (pom) LST i 85 30s TP o1s98s5 o | 591 or 00..0067% 18" 243 owTe ss saTTmhhpiilssesiinndwdieivrviiedduutaaalklecnwo.anssiTswhtoiesrnkelimynpghlaoisyneaasejodItthheaahntighAhaPessFtAOlPcaFxnOpdoescuxonpnecoepsnoteireapntutitaoelnniaoasflsAiagBtntFhmOentstiiinmncee1oA9f9Pt1FheOsInaspm1op9cli9ef5icsis 2% mployee"s blood seeunt level was 4 Sppm Confidential Business Information Redacted EIDI14209 ODED Pages i Po : =g ei ed i | i Hn3 & |phIe ! > { 5g :_f S Hi] fo = iP -- a 3 y TiBi0id0i] Be2y |i|szi e331B 3. a:s : t Z i Boe reed i 3d. liz EID114210 vous