Document NG5Jzep7o70LvV7BVE1B8Nq0V

AR226- 1413 A 000003  Tennant Farm Herd Health lavestigation ariel rik Carle Team Repo. R- STANL. * . LJ . ' ' Swat Tennant Farm Herd Health Investigation 7 0 . ? ? Cattle Team Report . . ['] ps [3 ? 3 = ); gx ' Z 3&8 * =x 52m5 @ ' ~= * ' EPA/DuPontCale Team DDrr.. LPiesrarLA.y.DHaavbise-cHkeelrler + DDrr.. PReotbeeGrr.Jt.MMouinsasnon DDrr.. GRorbeegrtP. HS. ykPoepspenga. Decembe23r. 1999 > : : > > -- cows 000004 RG5000885 -- Tennant Form Herd Health Investigation TABLE OF CONTENTS Carte Team Repory po aa [26 E [INTT RODUCTION el e + t i | P [ee--de|sl Pewee Pree p 1; + taggers Pema 1%] afmentee 11 \'. [p aoe w ] e sr s ------------ --t -- --------------e -- | [1|i1 z] E y ) Pe "April1999 sitee vnissit datre. ee 113] m] [16] -- physsgicieanlpcerxeoagmnmiannmactyoiosnnaotouffsccaatitlee (47m 7/99) is \ bod condition scores. inh 6] ' ' 1 --cunical signs. meee -- sq) | ! ' ee [4] F ' Fre ame bree = 15] . eens ' |EEE | [19] 2 ' ee : ' I pe . --1 ey 1 i --|X| > . 2 > -- AN : -- 000005 Eotstes RGS000886 . Towa rn ign ST 2 a .. EE ------------------------ TABLE OF CONTENTS (continued) TY , ms] [50.| DISCUSSION (continued) I ' a -- ::'3 [t -- -- Femear" 1 -- 3 [P b ge TT"er erGop t Tm Proie ermvas] | '' ' FET eE -- CFeosmr top-- ee s------e -- ------|--"--| 33 : [ 3 mee .. PbE om --femmev srrs----s ------ ------ * [ |TTaabbll ee '2: TIonddiivviidusallAAnviimamlDaDaattlaa:: CHleimniactaollSoiggynseryon. poner) |I i6c| : |] Table 4: ba Arial Data Hematology (leukon), and Special ' ' F FITF Table IdnidviudsuatlAAnriimaalDDaoa CSiefrCsornodmlFiecsoaylgExayr ' -- Table TeFnarmnGraimanndFtay_Notrvonal Analyss |1 .2 : AppFeondiAx AbbroevaiuiedFCoriueuloFmteV oemr(oi oft0Cnaaa nDlAeeTS: erRaAmSgeMeiUmnObeeTrsT ,>3 AA genaC_ DR rFy RunoSafee Plan Seg ynoeSt Tps St T 3 25 [| ArpmeindiEn:DiHeerdAHmealithsHiCstoormyp(ArprSilt8i. n19e99siontmeiroviieown) 1[110006]] :. s > 3 i. 000006 sosoEIooDa1r5ss16e8?: ---------------------- :' P-evan F- am jon ean _-- de Team R| epor i" MARY Toe ;tionof posstioionrvwate of| ion a : = cu or asfi ass dons pein : o a ik dm = bi wlie gati s we oone | 5 - vouattlg iionoyH:e CE : ommer on r 5 an:it of ' ' vMe all os sucay dat:un witl loe r s:a : F-am on : - Aa;oen(see..sou= isttmh e|m= ctaimnpgsrieo n;t,:| in dat= eg.A.cpleil f m laliecscuss elen abor einan.laiS"oeimitoshEiavteleitfxeeepstei narwsneeoysorsWyd=Aauy on : =i- = . bloo : eg ' :Eesusl= rtioDiT8oltiatbo soi rere rE Toerea port fon e ipohyn| e = ttle: = E | ? keTr fhae fants ma ec in= keye) -m o == miiimnal - Isdur sumsmitewitthal and a e \ee-alnrinl;tolis) nriing n -,cent | :: See ons of SoyuoE sloyyidE ep: orteSaoipo of rlsbseAroincsa tEezS eny=-euiE - :aE = r: f thi= =e aymnniteaar led or oni pi a Ex=> cla = ia f= dos: lroingeidonsalysis, ine osSeeirpseeolede re ly hi : a aniomfa:lsl.ata,ti= on 3 ivei i : idgenf:si,, and She -opper a pe . foysomm p Shot dvi nn da s= ercuart --fe-- f1doeuifreistvteeindt wiition liecnt `enrnsar ty (fSewseonia ilime: o xnieciisitty cy = on ec on C: CogE - : daE lly =waws" l Moet, rEet ye 5. SOF dle same : : . Sa = - aplos iow iirrcordentcaent ain a delopfha;rm. | nebe em oanestiper =petop sro T mas e lequz Hutto. } stant- im be ni, ori - . ars bleatiin. m2 i and Wo - ~ grams. or appe: rfiepi osobFe: am:ivonn-- opie RPI vnated histo -| -= . ;- =i s ibs a oo 0000!07 a _ teoomen 0088s --_---------- , enna arm Hrd Heh esigion Cotten : Lt Signatures :. ' > . L. hos safafe oy@ becker, MD, Dipl. ACVP De ' ? -- ? -J 2 J30/9% ? isa i Davis-Heller, DVM Date ' ' Re A Teer lass * Peter G. Moisan, DVM, Dipl. ACVP, ABVP Date ? >'? LRoAberIt].T-MYotioMn,uVItD o, yh2e /ee o * Sh /-3-00 obert H. PopDp VM,ePhDn, Dg ipla .AB,VT Date. ? rl4sA.iA D,Dipr l. ACVs F. ABT 2F23r-9a9 * * * * . . s . I amvss 000008 RGS000889 . , 20 INTRODUCTION . ? 3.0 METHODS ' ' ? health management, toxicology, pathology. and wildlife discases. Representatives of the ' ' Members :: ' : Thwamom 1] Square. PA. ~ Bolton Center. Kennet Square. a ' At the frst meeting `Scientific Leader of (i.., the cattle team chairman) an (March 9. 1999), Perry Habecker was Greg Sykes was elected Coordinator. elected The . : : otoi eer 1d o Tenn Fr Hed Hest oesigion Cate Team Reon .: .' cKeRehienicesddmi,ainnDornn.dSCcrGohooarud)piC.naaatporniewe(edErePde.Ai,nTsRhteirgusicto"esndeIr0icnogam.nmdcuRonaimpcmahitSeeh"w]tijh nhDctulthuPedoendtr"sesrCin,gSe oinCgcarsopeamrm, iSttahsl,- 9 `SiplecialijtoirenseC(hUeSmFiWcaSl)s,tMoxairckoloSgpirsetn)ger (EPA-OERR), and Rudy Valentine (DuPont ' - 312. Carle Team Meetings ' hecate eam met formally on fou occasions, including the Tennant Farm sie visi e Cate Team Meetings e > F New Ds olo ConsKemnusamera_------ ..' Tore Pavone W ?33 3 1Eadiibr onn saebvce. reakleirn.-pMAearnssoonand,isPcCouspispieoern.troaonksdpSlyhackeeosatebNeebtwweeBlnolMtpaorncrChen1tn9e9re9baecntdwectehneiand 3 soul eto for pat and 60p discussions and information sharing. . * 32. Animal Data 322.11.. ViVdiedoetoatapes ?3 T Tpwloihveia daesotcaepenesp stwwelearnedfie slulpsaupprlliaeid.es d0Aobthohuegshcotauhel,teheoteatapmeabsyewtedhree,sdceardiMin.gncdaominmcTilueed.eimnEataeocrnihaholifsfrahomm : me appeared thal these apes were all produced between 1995 and 1997. Tennant Farm Videotapes :: : : =] eLlr Tennant Farm: New gEngland. =RE Wood County. WVa - a hen . :: Beotholf heee ep.ess wer vielwofe6d.hid n heiT entrye c.wboayghmr efee cnmatgeeoconandomulymye0 n2 id. hems onth enlotl pree senr t). Atotalof60: tes thatwirenotan2i:mal related (2. owa at f s: H Fenneernvferroted erotm tohesitlapese. dThiseablee doesenmt nolutdeemfahney avsearironsnaindal .: , a _a oo [-- 000010 Res000891 \ Tennant Fs Herd Health Investigation Cane Team Report ' )) vbeerripnrpceotmaptiloentse,omraedroenbcyoyutsh.e narmator in the tapeess. which the team members considered to y EER Em ) 32.2. Diagnostic Pathology Reports ), ToCwormoiEpseaiteoh.onlooBgfoydtreheawpdeoarrnsei(miaAsslpuspeeodnrbdtyiixssstBuae)tsewfaernroiemmastluhpedpilTaiegenndnosaotnittchFelaarcbmao.trlaetTothrieeesasemibrneyrpeotsrhtpesosnwtseeeerre1i0ngthe .) reviewed by the cattle team. ' ) AMatyhir2d8E,pma1te9hl9o,l(otg8hya3tr7eitpaowrnotuJ(ulAndpepbee10n,idni1fx9o9r9Bm.)atwTiavhseetpcoraohtdaeuvceceaodmtsmouxibitsceeoqeluoedgneytcisfdcoerdeth,cnatcolnaemtcitesvesetuiessnagcfrroiofnimce ) ) nCooewnsoirtdheatrtweohdaotdlobdfereresichnoewtnshe.ed waMoerf.setwTcemononndnaittnhitosnw.caarslHiacers.kcehTdohstieostsaeonlseiacmctarloifnwiecaeosfceotuwwtoh#aon3fti7z,hee7d -bcyaytetgaluerntsohhltodthrebedy ' : Spirre.seTnecnenaonftDor.n Dtahveifs-aHremlloenr.JTuinsesu10e,s 1w9e9r9e. cMorl.leTcetendna(nDrt. pDearvfiosr-mHeeldltehre) dissection for in the ) histopathology and analytical toxicology. Individual Animal Pathology Reports SEDa10t.e1957 |AA"nimDaelpDarsmeeanetDoifaAggnrocsueurLei,bRreaytnoolrsbyu.rg.Ohio O_| (4977.97) ' . arch TS 1997 AmmVaecHheaarhhs DMiesdgicnionset,e MLiacbohriagtaonry.StCeollcg of | Unions. Lonsing M1 | iiss7ssu9uee2&ss57c9-y1eaa)r.rodld Folin Halse cow con oasis Toy 7995 Ciboarsvoorynosf.LaregewAnBiamtaolnPCoambeor,loUngovydersitoyf|Tes1i9UPS9ye0a2r7029: UcPo9w901437) ? Penmyvonia, Kennet Square. PA ? 3.23. April 1999 Site Visit Data "aITnnhvdees8ct.aitg1tal9te9i9tonei.anmoBvreidfseoirrteetdopctroholecleTeecedtnindnaagntattoaFtnahdermbsiioatlenodoggicianlacdaAjlparcsiealnmt7psahmlDpl ,ersya rRbeurleenvfalnsatanfdtfeiotlylthmseeiteheteirodnnghAevparalistlhh7eld TevtiheewePda.rkeTrhsebu6rgcaHtotlleidtaeyamInmnedmubreirnsg,wh2iocfhthtehestDcreryinRgucnoSmamfiettlyePelamnem(bAeprpesnd(CiaxspCa)r,was , Horne) and 2 USFWS employees were present. 5 ; April 2.1999 "gTrhaedic2nagtt,leantdeaimmehravdikeawplMarn.nedTetnoniannsptpeesocnt tthhee fafatneranonodnaodfjiaWceendtnleasnddfaiyll,Apvriielw7.tyhe Hhoerwdever, : 5 - __ oo 000011 Estes RGS000892 --_-- -- :' T-ermaFn amHerd Heath aves : ohoyy ndass . . - ST vee pivots osx pe fous ater, fe Suis ours. ma Traian == Ee on rane im Gi oEeh= HmvEaL i:nEtoooizm=nE ant:aE nE d:| ' dmeviim sacleddnsee reavterisMinbenIpce fluols peesy daS teSeyncrs Tir itE AonE soaTiwEsio aR e, ' m heale EE wprue ormaltiesi , gradi i plot an | -= Fs= ahe= n= t:e aE sane e S ra e iage)e n eora la '' :S ia e ifhs ts npn:a = in a = *+ pfe uninti wesda ly To hive orpu )EE raj - \ i imal 52 ecdiulyphot oe 2)in.d draine hin -TE ermoi id i. - . Only cov = as a= wd CL I~ iE ep -| ag | * on red a= onpihmoeatlonona'lsphsoutfosppfpliasof . fi onndAsi pteeer $S 55oma: ve= h oei i a= oom pe, : ot hywiibisl Earrr Coe .: - TH att e gme _ = - F = -- | cormapsed pinisecticide | | : rei no = ear = ty w;re - Al oughtE e ce ae one. C ih pent -- HAA L ori. animalsuffhiceieinmt) ios Sci Auhar) iaasnad - " . NiiegBhaoteandn ohnat here was ro | rr 5 3 Enistoso 000012 5000893 . Tennant arn, Herd Hosts iesigaion Catle Team Report . 'v bAlylDarn.iHmaablebcikoelro.gicBallosoadmpslaemspl(ebslowoedreansdubfjeeccetse)dwteorehetmaakteonlobgayc,k steorNuemwchBeomlitstozny,Ceanntder serology. Randomly selected fecal samples were subjected o fecal flotation ' The following 4 clinical pathology parameters were evaluated: .. (koHemratT oelogyCoT nd em co-- on]T hemT oew | * C measecorumsolaro volume m | 1--p"reldp celddsvsibutoonwwthhe1|] , Temes ere Ed ng ed 8 . aE = Serum Chemistry * oma shnosera a my i -- ' [umc n ope Tome E "obi I ---- -- -- .. proms Te Ceaa mes rroomm blooRd pnasda adeeud-- 3rfromTTEoDlTTpArotvubiesGaasver 1) . Serology , cosets porsisbecatos lov 3 161 *.. ue tongue sciea C3 pT = T cropte sv, (3077--T S7--00--71 Immoatisuon es . . Apr8,i19l99 '' "ETahnreeTemnenmanb:erasndofrtehceorcdaetddeitseraemco(Dlrlsc.tiMooniosfant,heMu1n9s9o8n1,99a9ndheDradvihss-lHetlhleirs)tomreyt with Mr. (Appendix E). - wDDruser.ienCganstphtaohreseaTnetdnwnoHaotnirtpnsb.eagrhanevaetnedalaltmhoemfeDtmhrebyecRartustnlewletarenedafmialblml.eeim0nbcelcruedsitnahgedarciodvniinnvegecttwoiiuntrghoifpntahsthteeesplra.nodpfeirltly . * 0 i oo __ eoistenn 000013 RGS000894 --- ------E-- , Tenant Fam Hrd Hl Ivesigaion Carle Tam Report )' , abdejiancgenutticlirzeeedkas, nteheigthibmoerionfghceaseiegvaizsiitng, and wildlife. The landfill wasopen and )) ) `reWuhitllieenognoswtimheteere,eotnrhceeo.clciacpftctatlsueend(atd.(ea3ataenmssdammrmapaalndngeee-vdbgmeaafnldreeero)amlsft2rro9uobcsm8teubrroaevsla.et1s2i/oiC9no8sr)herefebsrgaaoamrmmdpciloneymgasprtoldhef.etteeMh,nrrve.mieirTlxoeanernmdgneefanretneo,dug.nadavned 1 `mineral supplement he had purchased. H' ) DAe"ippaoltamnnteanbitloloofagnAiacglayrlscisusalmbupyrletehsTea(Fbvolrieaegd7e.hTaeTyshtoeirsngeedLsaaatbmaoprwlaeetrsoerayunsodefgdtrihaneinaNnosraEtmxphcleCela)rsowplrrieneaadssuhbejeetcted DE (NCP v 31) fom Come University to evaluat the dits in two cow models ' finder two feedingsituations (Appendix F, models 1-4). )) "The following nutional parameters were evaluated: ''7; e e Hay ianmdeGrrain Analysis e T waogmagn | ; er ow ' i cau: y m we em] , phosphorus selenium_ )s sodwm_ ,, 324. Miscelancous Data )' , ODurring thCeCostaiotpeaitswitfhatithnerAvepeririled.arrMara.nmyiTgefhnutntuabrneetrsewilagesvsaanostfkodeidsteohaesineroaipsfrsyoebsDlsrem.mesLnitisnaoDhfaistvhiheserhHde.ealltlThehrsetaottreuasm ! ofthe Tennant herd )y eBoeteewesenseAeyprqeiulMein.atnTdetnoDnenacontetimfbbyrieonrugg2Dh3rt,.t1Chc9a9as9pl.afMrrto.ofTaDern.nenDawanbvtiocsmoHncesalullflwteeh'ditcclihicnwieacsw(iAbtphroimDlr.w21i,Dtha1v9&i99s). ')4 DOrr. MDaavyis2-6H.el1l9e9r9,exDarm.DianveidsthHeelclaelrf aenxdammiandeedacdoiawgn#o3s0isf.or Mar.huTmepnnuanndetrletfhtewriitghhtthe calf. mandible. \ ) \ .V n ) Vv. oo eotsten 000014 65000895 ---------------- ------ i -- Teno Fr Hrd Heal Investigation Carle Tem Report 325. Wiliife EEPeA avndaDruiPoent beaytchethosssrpeoosnitsnoigrnefgidecleodnsmvmoiifrtoMtnrem..enTteTaahlneasntdca'utsdaicianttchelatu.dieTndchlienusdetehdreestephorrettproawrpetpsri,enagsouipfplicd ee tena mammal pathology, wre evaluated by the calle team. `Small Mammal Studies procs SThRoora meGreETWaorshnpEgilnonarWoooDdnyCoRoensupLonWseeis||| TTaabHNblielase13o:0w.pDuRaecValelSgusymfomofary. Sl S59e8 deerrs T Choa Psoi E RS Grier Woodard | Mammal esigaion TDThhRe ScanttehteeaDmraywsaRssunoascaoreoma.fadHtheoewaeWwveaersrenVooifrggpeiepnriiooardsDiecwpedareeresmaervenapitrloobdflueNcatiwornalsuRrevseoyusrccoensd(ucWtVed by 4.0 RESULTS : a1 Cale 411 Videotapes (Table 1) .r, TT wo vide eOooetaTpeasihaoterfyteseeepvrrecereasanlepnerhteoetsudee.ransdtmedespudirccaintitiigtnonhgneonswvuieidmrseeelorctroaoepumvesimse.elwnees.dTi.ohanest.FhoperTrrtehdyseehcneiataneldetdihviispndcruTeoanalbcblslseecamens|ndeis20t(ihce. )! ) iden t if |. ied in these Kets videos were summarized as follows: aCnoyrnceaatel,eeTsh.essearwseraendalopcaoncsiied,eraed wteolbleamabnliepfheasstoasptaisoaonnfs, were : . e TeOve eelfaecfntaicvieenlflfeycyt(icMoouumssechoaelrawaueotrcieomnncjaounlsnsic)sitpverintotbswlicetamhusotebhdseebdryivaebgdancoitsneirtsihaosfsescevhviedareseosM"oparinendskeetlhyleea" .\ Oeee ace ics"Afieeecdtiendgyaoutnhge amneddiaadlulctanctahtues owfeeraecohbesyeervaenddtoonhatvhee l2a.c3i(m0a.l23-50 ,' ) BSoecmreetaionan.asFocignauufrensatn1idaientrds2d.aamre,Fipergsiopnetest3if(rvvoeimld.evoitdBaeopotetha#po2e)f#td2eh,meoisnlslautisrraaattleissngwatnehrceeafrbalclyeiefnldnytfarlom \ corneal ulcer on the left eyeof a calf; faceflies are seen by the lower eyelid. \ ' )' Ym -- 000015 w EID151693 RG5000896 5. Coronitis: Alopecia and erythema above the coronary band may be seen with mycotoxicosi, or other condition. An individual cow that was slobbering, losing cud, f oo conn} 000016 " if RGS000897 Tennant Fam Herd Heshth Investigation Cale Team Report 4.1.2. Diagnostic Pathology Reports (Appendix B) Oofnlsyomfeoutrypoef. MrT.heTemnonsatntsi'gnciaftitclaenwtefriendsiunbgmwitatsedmofdoerrpaotset-tomomratrekmeddicagonpopsetricdeefviacliueantciyonin hwaesthfroeremaclolwysneacnraolpysizeedd.foTrhhiesa6v-ymmoenttalhs.oldKebrulalticiaslfwaapspaorbesnetlryveddieindtfhreoomnlwyinatneirmal that aunrtvraetaiteodni(n1t.e.s.tinneaglactoicvceideinoesirsg.y bTahleasneceroerpoprrtotaerien-ienncelrugdyedmailnnAutpcpietnidoni)xcBo;mpsluimcmaatrediebsy. are presented below: aL.aboratoDreya,dO6hmioonDtehpaorltdmebunltlocfalAfgsriucbumlitluireed, 0RetyhneolAdnsibmuarlg,DOisHcaosen 2D/i2a7g/n9o7s:tiLcaboratory report dated 3-10-97 (Appendix B) History: Gross diagnosis Histopathologic diagnosis: mon`mtohntho;ldrebcuelilvceadlfn;ounmdeedricwaetiigohnt:; cdoimaetahleaopfaocriotniees; Emacdiieadt.ion with serous atrophy of at IEnnetseiriincaclocpcairdaisoistiissm (wichuriasis) Keraits, moderate, chronic, focally extensive Db.iagnosTtiiscsLuaebsorfartoomrya.dC-yoelalregoeldofVHoeltsetreiinnacroywMesduibcmiintet,edMitochthiegaAnniSmtaatle HUenailvterhsity, Lansing MI on 3/4/97. Laboratory report dated 3-12-97 (Appendix B) History 4-ye`aorwnoelrd;Hioslssuteesinsucbomwitdtieeddby2-E18P-A97; dissected by. Heavy metal screen Coppfeerredenfciecireanncgye)inalinvderk(i1d.n9eyp(p2m.37vs.pp2m5-1v55.04 - 6 Manpgapnmerseefewraesncmearragnignea)l.ly low in lier, cadmium No wheaasvsylimgehttallysifncoruenadseidn uinritnhee(koirdinnecy.fluoride was 6.6 ug/mireference range: (oxic if = 14 pg/mL] cD.iagnosTtiiscsLuaebsorfartoomrya.9-CyoelalregoeldofHoVlestteeriinnacroywMesduibmciitntee,dMtiochthiegaAnniSmtaatle HUenailvterhsity. Lansing Ml on 3/4/97; Laboratory report dated 3-12:97 (Appendix B) History: 9-ye`aorwonledrHioslssuieesinsucbomwi;tideidedby3-E2-P9A7; dissected by " a oo E1519 000017 RGS000898 ---------------------------------------- ' Tennant Farm Herd Hesth Investigation Cole Team Report ' ' ) Histopathologic diagnosis: (onlaynhdeafrre,clzievfetr,haawnadrtKiifdacnte)ys submitted: autolysis \ Myocardial sarcocysts ) Heavy metal screen `Coprpeefrerdeenfciecireanncgye)inalnidvekri(d2n.e0y3 (p2p.3m3vps.pm25v-s1.540 6 : Mangpapnmesreefewraesncmearragnignea)l.ly low in liver iron was '' elevated in the liver; cadmium was slightly increased inthe kidney. ' ! Urin5e.5h5eauvgyimmierteaflserwcenrceenroarngmea:l o(uxriicnieffl=uo1r4idge/wmaLs) : Clinical pathology: No significant findings Td.ennantT)isssuubemsitftreodmtoa t7h-eyeLaarboolrdatroerdycoofwLa(reguetAhnainmiazloenPdat6h/1o0l/o9g9yaanndd dTiosxsieccotleodgbyy. Mr. : , 6Sc2h7o/o9l9:ofLaVbeotreartionraryyrMeepodritcidnaete,dU7n-iv5e-r9s9i(tyApopfePnedninxsyBl)vania, Kennett Square, PA on History 7-yeoawrneorl:d rteidsscuoesw;suebumtihtatneidzebdy6D-r1.0-D9a9v:isd-iHseslelcetred by Histopathologic diagnosis: Entearbisccelsessieosn;siontfemstiinnialmaclocsciigdniiofsiicsa;ncmeyo(cfaorrdeisatlomach sarcoeysts). Heavy metal screen: Coppreefrerdeenfciecireanncgey).i liver (1.71 ppm vs. 25-150 4.13. April 1999 Site Visit Data a. Herd History (Appendix E) "iTnhteerhveiredw hoinstoArpyril(A8p,pe19n9d9i.x E) A wwraitstebnasreedcoornd Mr. Tennant's of herd health wreacsolcloencstpiioncsuoduusrliyngabtsheent vMeutcerhinoafrythciasrceaonrbceonasuurlitbauttieodn twoitthhealnacakniomfaolutnsutirdietiionntisetr.venMtiionni.maTlhemreediicsantoiornescohradveof Ebexecneputsfeodrotnhethfeeswe aanniimmaallss,naonteddthinertehihsasdobceuemnennot u(sseeeoDfivaagcncoisnteiscoPfamthoodleorgny dReewpoorrtmse.rs ahbeorvdem)a,nnaogdeimaegnnotsthiacslnaobtorcahtaonrgyetdesstisnwceertehedoinnsetaolnlatdieoandofantihmeallsan.dfTilhl level of catlle ~ 000018 15 ED1s169 reso00899 1 "Tennant Farm Herd Health lavestigation Cattle Team Report . .. b. Physical Examination (Table 2) . Age. Pregnancy Status ' On April 7. 1999, the cate team examined 41 animals, including 38 adult cows, 2 adult [J0 ` bBrueelloesl,rde2rntdhthaan1 taduylyeeatarrsss.t.eerTTh(oTirasebniltsey-2s)h.eevreEdnsot(fi2m1aa/gt3ee8dd) ccaagotewess;fwo3er2rtoehfeptrahedegunl3at8nctc.oowwssrwaenrgeedsftriommat4edtoto . Body Condition Scores h'd iBvoedryagceonsdciotrieonwassco3r.e5s((3B=tChSi)n,we4=rbeorbdaesreldinoen,a571-9i sccaolnes.iSdceorreedsorpatnigmeudm)from 2 to7; the '' ClinicalSigns '' CnHhalriuocsnoiiacotnmaacbydnoeir.mtahltwietwriaeessilwnaetnercreperdeevtaiendddenaestmpaitnbis9ecdeo.sfsteMhseaom4r1maactcrtuyem.ugllaaOtnnidoenlasunmoipfsm.afcliobnhrsoauidssatcneonnetnpeiwcditetirhvmeal '. (fsatcanre)crtoississu.e. Rectal examination of one cow suggested the presence: of intra-abdominal . e Clinical Pathology (Tables 3-6; Graph 1) ' Hematologs ' Earnyitmharlosnwe(Traebcloen3s):ideRreedd abnleomoidc.cell indices were generally in the low-normal range. No LDiefufkeroennt(iTaalbeleel4)c.ounTthseetroaelcwohnistiedebrleododincveallicdoduunets0wetrhee 3w6ithhoiunrtdheelnaoyrbmeavlwreaennge. collection and testing Clinical chemistry (Table 5) WwMihotishcthmcilwleadcstdrouelhnyystdeeraasvtaoilonunde.bslywSeiwrnaceremitn.hteahnecdahlhiaegdhw-nenoorreamcpacelen(sn0etsdoldgwuharitileyn,gecltlehivenaidtcaeaydllirdgaehnhtgyedh,roacutorinsosniosfwiAeapnsrtinlot7. Unexpected. Dehydration also the most likely explanation forth elevated creatinine in 4041 caule CdMioanstgteno((s24i71s//44o11f))dohefhteyhdgerlaoctbaiuotlnien(hofatradalcetplireoovntaewtiaensd =teoltgealvloabpturelodienwihnfi,alcwethitiohcneh+aalalbsluobmucimonirfnerlafarcattcistoinohniw)g.ahslyIwniwtailhtlihna the reference range. _ 000019 Entstesr RGS000900 ' Tennan Farm Herd Heli nvestgation Cale Tem Report ' Gamma glotamyliansferase (GGT), a sensitive indicatnoer okifnaacsiev(eCKv)e,radniisnedaiscea,twoarsof +) ) cotlonsTiosetenrtmv eltyywoaxia it,hiwn(aAtsiShnTea)l3ns.3oo/ra4nm1loaorclsamtartsleleefn.eisnriTetraniilcvseeomfriaintndghgiheect.actbaoeCrerfeo.raftolHimiovlwereeuvakenordc,ymtauesspdcailrsetoadlteeugieonne,ratthieonr,eswulatsof ' the 36 hour interval between blood collection and testing. ' ' Soecialchemise '') Pmrolacge teinp:otPalcttahisenmtaoepvsrieonlgafco1trsibcnoarltaetveoelrosyn((fTDearsb.clNueec4a-lraenSedcphGairsctakup,rheUn1()fiovwreerArspeitrsyi)gonfwiafTisecnan1ne7ts1ly.s6edee)p.reasnsed. )) T icroegramasSmfepioltneers(1(w7na1gsf./e6ms1Lcn1)u0ge./(1mi(eLsn..igmirlmeIafnLteecraodennndtbcrye3a6semt/xe,4ga1aonntoafa=mvtie1hnr7eea1T.gte6eanrnptngrraao/ntlmetaLca)ctd.aiunmlTilehenvweieeslartvfereorabatecgliaewootawonesf)ttohhen1e034.18 ! ' homphydoetianffercotmedDr. Schick). ToEoOeLtTdiSeas jtoaDra,ndSe2h4r/i4c1k.otfhethse fTcihanindsienagvwseerwraeegrebeewhlaiosgwhsltihyimssiultpaepfoterortetinhvceeeoTfeevneennladn(ot1p0hh5ey.rt8denatgvo/exmirLca.igt)ey in ' the Tennant herd ' ' CCooppppeerr:asBsalyoowdascobpepleorwltehveellsiwmeiroefidnettehcetidoenf.icient range for 26of 41 animals: one ' Selenium: Blood selenium levels were normal for 41 of 41 cattle. ' ' BPeepsinogeena: assPeepesriasnagoesg.ean.Thiaensble1o0docadocwaesns.zupypoppmnooeertsieenddeirtchaaetnocdroononcflepuabsurilalo.snichAladltavmsaablogumeeass1w0aeltrheoestweirtthaigniatshies as not a problem in adult caule in this herd ' Serology (Table 6) BJLoYn(eBo(vMisnceabLaeeurkeermiiuamVpiarruast)uberculosis angen) 11114poposspoisiitvivee oa . BBBruDDcel(MliBacorvoipnleatVeirAusssDaiyar(rvhieraemainatidgeetne)ction) 021a81 positive 041 . . BLLelHpuTieDotsotpnaipgreuae2in(tEeprirzoogoatnisc(H5esmuobrvtahriaegtiicesD)isease of deer) 32//4112 ppoossiittiivvee . Nmoenesoaf .tthehmsieegsrhoetlordgiyseeavesaelsur.eessiTsdhuuaeglgdevisastccecodivneaarthyieoornfd-ttwweiodsepiopnsrtopibulvreecmhE.asHePDdoseainriivsmealwtsaeosrsevnfaiotdruerBnaclVeDthaantd .. ht disease has been inthe local deer population. . . Iu .. - cei ~ 000020 EID151698 Re8000901 ' :' Te -- ---- Heath lo-- cate : solo Parasitology : Rp oun g on (Tabi ro " our nigtuede aneesoling coul }vocate ~ noder ' ofoocy rs na arin iIp=oesne= Tz7hz:= H da P G:rain r As ysis Drsoir ehderd HE 2 During y and De on = nalysii s(e T:fo fom - 1f/8o/99)- , Mre . arEeY= ~ ad, : liSf bigt lley)s gweursectolylceeicietnedmdg De Intii e Thsis f fo= nSE . poor. hTeoofitber level of DDuuii rinng ths e si8t p"eaney imporan joulien Fe EE -- Soheuevaip on. e le: igh and rage an iber Br BH wereal s. canbe rymatt --_-- weof ty5 cr-ES5 = mAicenodnstig ng t Tenn: was ds Si yzed. ompnumeei d ren ursam) ple of Is (rate per d,des; pose7d% o = - - * SET eoAnExEc> el sf nd takenar anailyds ps Easolimn. mp Cornell - = ' is sngbe ose a Foe ve dis. Ubio ee fg fis iRres2 a = . wom . prestaig wt :ey . . bfaulasnpcnggiioalscomonpf tsh epe:i Emen)E .sor undsn ie?Fgh=ToeE i o= e = | ier Taavn pprodre prodcion 3 r2sii 4steyncieysttheBr ii cor (omPohonnia oosh asw7 te ogutds5 soE ls}fE sA a= iHEt= a e ] :in s SsimSa-memgigaiatmidivvrrieeeyeq.prueeridvrrregeryyy?pbprsreegggarwinacmenat(8xcion ofr ing )- 3)inthe ar bn utr=ti n: Lo -Eo eauitement) Ter tosseat . . 00021 po01 n .00502 : Teanans Farm Herd Health Investigation Cae Team Report '! "teThbheeedbiieossd,ywecTrohenedcioitnmispoiandcestrceoodrfetoshe(hBpaCovSoeSrc)qhuorafotlnihitceyehffeofrredactgwseeowrenelltchoainsfseifrsatrtemhnetacnwodiwtsshubtrhseeetuqerunneen(rtgycanddceerqfigucayitteof ) , pasture. ' 42. Miscellaneous Data ;' FSrooslepleocswtiendaghstnihiceck ia(nAtipmrvaiil)s.it2,1,MMrr1..99TT9e)en.nnnaaDnnrt.tDbcarovonuisgsuhlHtteeladlcewairltfehwxiDatrm,hiDnae"vdciltsoh-ueHdceyalleefyten"rdetgodareDdrt.ienrDgmaiavneid. that ') ) Bwheichmweassnoeatshiilnygwwirpoendgawwiatyh. the eye, except foa slight mucoid exudate on the comes '' mOanndMibalye.26,Th1e99l9e.siDor.n wDaavsiass-pHeilrlearde(xpaums)inaendd scuobwse#q3u0enftolryalalnucmedp.under the right ' 43. Wildiife ' ' 43.0. Videotapes (Table 1) ' ' "n(Tehneece20h#4ew9ri)el,dldoiiffenncooatsdeiaaspgppneroaesrstie(cntbveaedluaienn.ythcTeohnvesisidesetowetenarcpeyesailnwletcrhoenssapileldcedireeesad,dtlaooncbdae,tieioxnncc,iedopertnitfamolridnoengaetohcfsatshee ' .' a SSeaymsweheIianchhfiaccp.hrehsweeosnuteeldddewbaietthhfsohauepnmpdoeriarnrhaeadhgteeoablfterhoymmoetschotesycnsoontstserimis.ltsenTmthaweyiithnhadvitvheieddriuaealdndfdoermaodmwdieepliieizrfo(oectaisce *. HfeinmhdriitenhgdaohgefiessccoPedmieisneEalsHoecDa(lEsdHeerDeo)rp.o(spiTethrisivosendacilaatcgoenmomsiinusntihwceoaTutelindonnca:onrtDrreh.esrpCdor.nudmwitothDtr.heSkykneosw)naenxdisttheence T4r3we2o.tepaSpnamtahdolllomgiiMsctaes)mrcmeavapitleuwrDeeaddttoahne tlhieveTreannnCdarnketcikdp,areWoyaphesirhsyitnoilgnoog1ny9,9f7Wroo(moU4dS5ECPsomAuanlEtlnyv,rioWrdeoensntmtseVn(itvraoglliensi.a; * FRAeoisrpmeoen3sG0e1e. TseeNvaoermalledsraianotonsmraeclphioarertas:ctwDeerrriyestRiiucdenonftihfeipead.tontoonxiecwiteyreorconnespihdreotroexdiscuitgygewsetriveeeovfidteonxtic teratogenesis. The 1998 small mammal trapping (URS Greiner Woodward Clyde study, December 3. dmice). 1998) observed nogross abnormalities in the capturedanimals (voles, shrews. an 433. Deer Studies ThhoeaucsagttthleVttihereagtmienwasamDsreempvaaidreemweeadnwtasrooemfeoNfaottfuhterhapeledrRaietosadoisuchredcceetessr(frWrepoYrmoDtduhNcsRte)ioSnitnusdtuiheresv,eDynesoycrRoeunpdnourtcasrteewaderbey Ld available. One team member (Sykes) had a telephone conversation with Dr. Crum of the . 9 2 - - - 000022 ED151700 RGS000903 } enmant Form Herd Heth nesization Cate Team Repon WaddYitDioNnaRl rinefgoarrmdaitnigodne.erFrheormdthheiaslctohnvienrtshaetiDorny. Riuwnasartehaeicnatotlertead0ma'cesquuirnrdeerssotamneding that - eevpiizdoeonotvcieecrophfoepmluoolrwarthfieaorgntii;lcitydirsaetaessein(EyHoDu)nghadsoebseewnasdipargonboasbeldy caltitnriicbaultlayblaendto deer bovinSeervoilrougsidciaalrlryhienad(eBaVdD)anhdascapbteuerneddidaegern,osreedspseecrtoilvoegliyc;ally in deer not far from Dry Run: Irnepaodrdtietdiobne.ttwheetnea1m98h0asanldea1r9ne8d9 t[hSaotuotuhetabsrteearkns CoofoEpHeIraDtiinveWeWsiltdVliirfgeinDiisadeaescerSwteurdey Publication, Field Manus of Wildife Diseases in the Southeastern U.S., 2nd ed. Spoipnucleatthieornewwaassnnootecvoindseindcereeodf1a0nbEe HaDconotrrBibVutDinogutfbacrteoarkiinnththeecTaetnenahnetrdhehreda,ltthhe deer Porrobalneymso.f tAhlesdoi,sethaesreeewntaistiensoiedveindtiefniceed tinhathteheTednenearnhterhedrdw.asa useful sentinel species 50 DISCUSSION "The six veterinarians comprising the cate eam agreed tht there was conclusive efhovixsiitdcoiertniycc.aelptdihanatktsetysheue,bTsmteaanlnnntuaitnarttiethiteohrnadt. waansd thes ecsouffpofpueerrricnodgnefdfiirctioiemonncfsyo.curanTmhareejaocdrliildnyiiscaeaclac,soeluaenbntotrifattiooersty:h.eenachndrdoopnhiycte herd health problems on the Tennant farm. Endophyte toxicity ATecsccouredhinagy [i0n tthhee hwiisnttoerryaancdqupiarsetduroentAhpartialpp8.ro1a9c9h9e,sth1e0h0e%rdKhYa3s1befeenscfueeddaurdiintg otfheKY31 <Tuhmemcelri.nicaTlhesriegnhsaisnbteheenTe1n0nsaunptplheemredntthaalt hpaisgthulryesourggoetshterenfdoroapgheytfeedtotoxitchietsye(afneismcaules. myeotoricosis) include: + sthweelclrienegkadnudripnaginhoatt twheeatchoerro(nFairgyubraensd5-(8c)o;ronitis) and above, with cattle that stand in + ppoaotrchsyhteadildianlgoopfewciiantwietrhclooastsso(fFiagilursewi4)t;ch: pboitohr coofnucnedpetrisoinzeadndcaclavlevsi;ng rates: * Rumerous vague discases suggestive of immunedysfunction: _ . * ew 000023 RE5000000H900H4 = EE NO . Teanan Fam Herd Hest ovesigaion Carle Team Report .. Other clinical signs that are consistentwith endophyte toxicity include: ' + fat necrosis. presumptive, as diagnosed by rectal palpation in cow #15; , + concomitant presenceof copper deficiency: ' ++ pgeannetrianlg fianicluorwe o#f45t,hescugagteesttiovethorifveh.yperthermia; [ ' eVnasdoocpohnystterifcutnigounsi assseoecniaatseda wreistuhltfoesfciunegemsytciootnooxifcaosniusmibseArcorfeemrgoontiulimkecoaelknaolpohiidsa.luTmhe which producesperloline,perlolidine, N-acetyl loine, and N-formyl loline (Stuedemann, :" aetcalq.u,iri1n9g85t).he hTihgehseestaclkoanlcoeindtsraatcicounmsulatattheeignrtehaetefsetsmcauteugrriatsysosfctehdedgurrasisn.g gArdodwitthi,onally, ) the alkaloids may be found in stored hay '' pTrhoedcuocreodnibtyisepnrdoobplheymteobisoexrivcetdy iinn tthhee "vfiedsecouteapfeosot("Fisgyunrdersom5ea.ndS6i)gnwsaosftfyepisccaule of that foot ' generally start with reduced weight gai, or [ossofweight, ough hair coat, arched back, ' athneddseowrcenleaswssinanodnehooorvbeosthanrdeairs lgiemnbesr.allHyyapcceomrpeaonmifeitdhaebycosroomnearsywbelalnidngoc(cHuermskbeent,wecten ' al. 1984). Arching of the back was reported by the owner in the videotapes as ) "hunched" and "humped" posture in some catle !) Pdiescsiipphaetrealhevaatsodcuornisntgrihcottiowneaftrheorm.thTehsiesvpashoeancotmiveenoalnkailsokidnsowrensualsts"isnudmemcerreassleudmapb"ility to )\ (sOusgbgoersntei.veeotfal.the1s99u2m).merThselupmapntsiynngdarnodmed.rooling by a red cow (#45) in videotape #2 was '. 1h:as ablisrothboefenunddoecrusmizeendtecdal(vBeosltt.ocdtaamls. i1n9g86e)s.tinTghiasdimeatyhibgeh biyn eanmdoepchhyatnei-isnmfessitmeidlarfetsocue . tbhleovoadsovceosnsseltsrimcatiyonrcesauulsteidn dbeycrtehaeseerdgocti-rlciukleatailoknal0oidtsh.e gVraoswoiconngstfertiucs.tioTnohfetehffeecuttehraisne bpeuepns dforcoummfeenmtaeldesinfemditcheetmhaattewriearledeuxrpionsgegdesttoatthieonenwdeorpehaytleigdhuterrinbgirgtehstwaetiiognh., wMeoruese delayed in post-partum development, and grew slower than control mice (Varney, ct a. 1991) oEfvtihdeentcaiel tshwaittecnhdiosplhayrtgeeltyoxainceictdyotianlf,efsrcuoemgvreatzeirnignacraytlplreacmtaityiobneerrsesthpaotnshiabvlee efxopretrhieenlocses wvaistohcosinmsitlraircltyioanffreecstueltd icanttdlre.y gTahnegrmeonsetosfetvheeretaifloarnmdsodfigietnsdo(pRahdyotset-iitn,dutceald. 1994; Hemken, etal.. 1983) Rinecprreomdeuncttailvleyedfefpercetsssferdocmotnhceepitnigoenstrioanteofinencdaotpehygtrea-ziinnfgesitnefdecfteesdcupeasitnucrleud(ePaterson, et aplo.ten1t99i5a)l.ly lInaythea Tmaejnoarnrtolheeridn,tthheeugnraaczcienpgtaobflpeacstounrceespwiiotnh r1at0e.0%AKpYo3o1r cfoensccueeptcioounldrate 000024 2 eoisizoz 65000905 \ :,) T- ---- Heath mestp-- EE 3 ys ot ere :: hbeeretecsinos oro , = = ty. y. a cont ooneofall thr eh ==SHhertEt ri :-: = phaeoorgrowEth oaf heibinatiorr m--,-be - 0 inn g-- es- tioe n= r = == l ' ' of:mdppoooorrE gororvs r tey mapypoosCtoinond j a ? Er mSoinogatthheebrpoordceosn St = er = ' Enpr pituitpahryyte giceffects lsinliophy= gte eona i rib= =eti e. et here ges ha = ese. ' ? ndoy Eonilai fant - i uminto, i _ . = - y | 9020 en - ? papipasrpenptarelnt lcuisorkfesporonnye,NiMetaogaignostos nZize=eEr=: E } Shp bios eI nldoopphyte7). IIndirSaetcito;gn a se aker. hsromts oe i = a as : tA e - ' ' in epreredn a" operbpy she intfheoscetendotfJopk hyte-infei a r h e a ti = =. recordeSd uprpesesee d eonree r pr veld s itinA aniirmaltsaE lglrafoezinoebgssonSionti= ' ? 1999). necros a t. Coy peri levels. ? DFautsuiraisines os five ntifi :=EE2 esCtooie==iC SE t m i Er ilx ih ix . ei r aseeons | ' iiT T gh ,inSA No-n fmormm efrooraessoetiennsiis urieL s oE fm:a E E a" pe = 2 : FE re tant dophys!terol(Sttue1ded N-aaccetylIc end " crinfected pe we C =Eon= eE i = io '' | Pinkese wrwvitsse0i00osE n prei e m oa kinta sbsiit goo ieen ao- fpr\coe gbslteamkiennornt}he. ' Jietles ebistory rpmsei Hag ge cat ledurinngetth HE osken p ' aS utaumnaSli iar haiinng e nti n ng ohasohraLinE fe:statE i 8 x-- )nfedinkese. Control rn ' 000025 --eon51703 we 5000906 \ ,2:. - ---- ier esti In cigsion oE re E mec ton prvi be :: : coil secondly pe the. le. Insec vd aby| insectici in pnot ofre ie : vis betwe fective , -- ogre = 5 everceptiible ncati tle 1 ons ni eco= nse eolonshTEErr-- - -- " ? Seevseetre tcealte int video ations en x: 2A : Ma- lnuiiion res was TEkalypdueTeo the kgeo= APEeRs s Sn sidered 0 MS aloo a" i enifican iy esrpgeyinshitlems erd. ~ The 0: hthe c f= ombcootnsyidepoesEgosnves Oi f requi on E: i emnoviiroi nmecflife sy ccrycclee ofa ha e ee Dn ivaro y i ={Apa 7n5d9)5 1w= ee coCn = o -: ---------- in es f the feed wtrition ong pe pe He sitsoL f Af sro i os EE Rona hatfolloywaendgh r s L] Copperdef iencyanalysis. AsiSndo i co ficienc) ot - Labeery ofMi ic= . a Ss~ enren .: 191997a 7.copen s ohppeeerAndis eA miaaTteu:R sHEE ery SEEh . Aa Dosey xicolog: yearold brecf in. I1n cowby1999. A" copy a on = EE z i Br = = - 9 Ln Tey of the Jovher horrenc2e0 lai rae U r :d Lpctv=o cen peffraom sopeehonfme"Sa i roy r iE ; . . C linic mCoine s gorrarigeyys piirnrvooidnneo0th:e eowns,,and ind a r o ifoi el = .: iimfwmonmonuersnxeehdmeecfeaaeserhs.W sDteednefPcaeyyndA oirseawsee,lcd" oa cniti icnn gi :abr 1i9Eo p9sEm a i de on= ree E-- sE poErnis- 5 : depend oFdaahyLe, netal, 1997p) era =" . . 000026 5170s Resoj009a07l ' Tena: nFarm Heeed Heatthh Inesigaior e .ale Team Rero ' * m i m oe d on ienci clracd oneome h ni c siA mit p ies dwuipasrtiaoens a" . ' ' t al eIb er p fdooncts pyofan) 7csupppleletmienta " pa enhe eion ihe ea c i do e s ' dr eSAr.heigh pe ) yeefae da a ienn c;ys . oapHnp rad hoehhoyofdhohsDrtieednaadtees . . Torainloaios.lesHoo ii * , BBaassseepdonuron es auodndftsBeueCportbiyilteeaDnirnywoRnupCrieneoohro5usofsron ierBhons ip rom caienvtanrofuosi 0 * [RSrweraorwe evauon aA rine ooorA ahubanidee eeraflgounnn= mafSieeInivveer2sc4itteiydhugtwiihhreea idoomdsfiie Is a t a" BbooonnaC S iYmio w 0 s Sh htc r gcr3S= agannlcsowei Ur nSiaationip easnwdbBoodlne(oaCrl sp Sie n firneesuteso. ' SiE ainioanhvEa imureori--dievweocaeie oSiiryfe E ceopeynaoA sn55:w5Npee sUiYiS op3o3ybe lnee gorrceArng smniehoSE Ih sidneieo a twhe iBee conrespndical n. anRdoene isghtivboaRsni)ot e odec epohsieatrsnte * . hespTi Ey rie wie fusrceoometBanaegsconsidere 4o1i0oe0y efaulnt Cp nl e dupon e ' bails skghoSoomo miioSsinia npr Maro h r r uoromenin FHowe evFeijon n eeieopsoc a s g re o (omreto mpun E an vs E patis= n Sno e gt erbone wie .s 64 REC0M:MEN DATISONS m " o on fr e s i ate eam, etic ne eo :. Fpih ngliryne.mir ie tet~ Smesigatony c --upthe . ioprso tel r am ow pr . . . ~ . a its?170 0I RG S00 oo Tenant Farm Herd Heslh Investigation Caule Team Report `udEirneditonpbghyyamilleixtsioexnaisgcotnihste,y:hthaWeyiiatmnhmdeddpiaiestatatoreryegfowoairltaghweoeituhtlahdtercbonenotfnao-ircntnshdenoepdahirlylutytei1oin0nfo0ef%sttKheedYe3fen1sdcofupeehscyourtee,anifonetdthheer Giiintfffheesrtheeindgthhfeaoryrqaaugnaeldistopyuarscftoeur.raegeAt.o sSAh0onr%ta-octrceerlpmetsagsobolafeltlwhoeonugdli-cdtte,brepmrtipomlararenidlwuyocueblytdhsebuepcoptnloteermneetpnoltaficneegnthdtohepfhdeyistecteu:e > Spagsatiunrewiatnhdthheaygofailelodsf wdiiltuhti2ngnotnh-deinedtoaprhyyteen-diopnhfyetseedcfoonrsaugmeptciroonp.ofCcrrooppsmoavneargteimmee.nt Should be attempted under the supervision of specialists in forage and grazing ., `management. '. P``ipaontsktieesmy,peft:erdoPmbryecavarenrnitaeirpopcnratootaflcephtiotnhksaeutyslceiem(piktteisrbalttehoeccoasntpjeru.enacdtEiofvffiettcihtseii)vneifnefctlhyteicooiunmtsmoreordlg,iaatnthiersomfuu,gthuMroterhaesxhuoesulelldoafbe . : eifnfseeccttiivceidceoinmtprrolegmneattheoddctahrattagsshoourldsobmeeportachteircperdodvuerninmgetthheodw,airsmpemrohnatphss.theThmoest . . Idlneosnvegec-tlitocepirmdmee.nalptapdorefonainccshaercttthaiagctsimdseahoyrueslbidestbeaemnrpcoletoabytyeedtdheiesvletorhcyealbyrfeeaaceredfiinlnygorpfdooeprurlcoataiceoinr.tchuaAmtvnheanavdtedtidhtaeiroknaflaces. *. tBJhiygehStceaoltftelctethiemnagsyufnoprridseavmreiknn-tifmaoivczeeerddt.claetsHeioo,wnestvhoeefrck.oemrweahtaiollceodnmajimunanicgmteiizvtiihtnatsg,itsthhceeadulasomsesdaogbfeycotohnedthiuetlitcoronavmifeoraloesmt of '| TSeevgearredifesysoifnfetshteatyipoenos fwilclantoet ibetahveohiedredd,biynssecclteicctiidneglfyorrfeapceelcaonltosrshinouclatdtlbe.e uTsheudsevery : year. . MSpaelcniuatlriisttionn:beRefatciaottnlse annudtprasit.ureInnutthreitTieonnnsahnotulhderbde, ptlhaernenewdaswietvhitdheencaessoifstgarnocsesofa . pFPrhooomtsempihono-nreuntseo,rmgayanndmyamlbanuegtenrfeishtieiorundm.s)aasnnudwtreislthliooaun.sldcoTanrlcsaeocrebnesmiaandbedorruaetlssameandcd.rvoIimntiatnmheeirnadledev(feiclcaoilpecnmicueimne.ts oafrea a`mtiinoenraflorantdhismahcerrdo,mipnaerrtiacluldaerfiactieennctiieosn, should be paid by the nutritionist tothe local trace . `"iCeosapsipensrugspdfeerfciotcmeidetnchcleyi:dniiectCaloolpfypcaenraduics oainntfrmiaracmeneymdianbreieroaacslhoetfmhiatcthaeilsNlocyrruitcnhitaAhlmeteToreitnchnaea.hnetaAlshtehrcdoo.pfptcheaertpdereofyvieictsiieisonncy . oPuftaithiiognihscto,pspheorultdrabcee mapirnieorrailtysuypepalrermoeunntd,. agTahiinsuinsdeesrpetchiealsluypecrrvitiisciaolncoofnsaidbeerifncgattthlee prevalence of endophyte-infested fescue on the Tennant farm. . 2 - - -- 000028 __ eoisios RGS000909 A-------------------------------------- ) Tennant Farm Herd Hest Investigation Cate Team Report ' 70 CONCLUSION TShuetrfeeiwnagsfcroonmclfuosuivmeaejvoirddeinsceeastehantttiheisT.ensnoamnet ocfawehihcehrdwewraes,poatnedntcioanlltyiniunetesrfroelbaet.ed: ' eCnodnooirpthaiyoatnnesttoirxeaaiedcidiltybyya(cftcehoesuccnulteinmfioycraclotthaeonxcdihclroaosbnioisrca)t,hoperriydnkfheieynadeli,tnhgmsap,lrnaounbtdrliehtmiissotnoo,rniactnahdle dcTaoetpnapn,eatrnhtdsefefaicrfimoeu.nrcy. "ATTuehtreemihateilrodnpahirenaaaslidttehequicnaovtneetsrtvoielgtaeptrriioongnarrrayemvcsearadeli,eddanndodetfliaacpcipkeenoacfrieofslyihncaohvneetrodal.msuabnTsahtagenetlmiaeac)nktio,mfpivanaccctlcuiodnnianttghiiopsnooarnd ' relatively isolated herd eDveisdpietnecaenofextohxaiucsittiyvaessroecviiaetwedofwihtishtocrhiecmalicaanldccoonnttaemminpaotriaornyohfertdhedaetnav,irthoenrmeenwta.s no ' 80 REFERENCES ?> Endophyte Toxicity References 1. oBonltcalDfJb,irBtoh nweJdi:ghEtf,fmecitlsk iyniepldr.egannadntcablefegfrhoewitfhe.rsJ gArnaizminSgcifu6n3g(uss-uipnpfle)c2t9e7d.ta1l9l86f.escue 2. DNeeonrnsipshoSdBi.unAtllecnoeVnGo,phSiaakleurm_KoEn. cFoopnpteernotcoJnPc,enAtyraatdioJnYMin, tBalrlowfenscCueP.: JInfAlnuienmceScoif ? 76:2687-2693, 1998. ?> 3. H58e:m1k08e11n-1R0W1.6.J1a9c8k>1son JA, Boling JA: Toxic factors in tall fescue. J Anim Sci + HCounrcleenytWraLt.ionCsonaveayfyfeEcMt.edLbeuyngt2alK.feHsceumekseunmRmWe:r tBooxvicionseispraonladcttienm.peTrSatHu.rTe.4 JanAdniT3m .. : Sci $1:374-379. 1980. 5. OTusnbgoursn-einTfGec,ieSdchamniddtfuSnPgu,s-MfarrcpelefeDscNu,e RaanbdeerCgHo,taSmtienenesttarratrJaRt:eoEnffescetleocftecdonsuming ) p7h0y:s2i5o0l1o-g2i5c0a9l.va1r9i9a2bles ofcatle in environmentally controlled conditions. | Anim Sci : 6. {oPaxtiecrossoins oJ.n FboerecfhcearitoeCp,rodLuacrtsivointyB..JSAanmifmorSdciM7,3:8K8e9r-l8e9y8,M:19T95h.e effects of fescue . 7. CRaadnoosbtstcsieOinM,, cBllaoviobdacDieCr.a,GaiynsecCtCs:, aDnidscaasmemsalcsa,usedIn:byVettoexirnisnariyn pMleadnitcs,inef:ungiA, . 2 . -- I 000029 _____ EID151707 RG5000910 . ,' Teanan Far Herd Health Ivesigaion CaleTam Resort ' .3 tOeMx,tboBolkooodfDthCe GdiasyeaCsCes. oedfitcoartsi.le,Basihleiepr,e Tpiignsd.alg,oaPthsi,laadnedlphhoirase1s5,328-"16e1d.1,, R1a9d9os4tits. ' s . eERvinacldeuoaRtLpi.honBylrtooedfegeechftuetsmcDuoJer.,sSVceihtumrmIiumgnmGeuGn,reISsmwpmoeuncnskoeespraitWnhSoc,laF5to9ne:t2eg8ar5oa-zt2i9Jn1Pg,, e1A9nl9dl7oe.pnhVyGt-,inAfkeecrtseRdMo:r . . 5. SMaokneorcytKeE.. iAlmlmeunneVGc.ellKalrneistpsoknyseJ, aTnhdatcchoeprpeCrD,staStwuseckienr,beeJrf. WsiSc,ersFotnhteunogtr.azJeP:d endopphyte-infected fall fescue. J Anim Sei 76:2694-2700, 1996. . 10. SbcohvuilntezeseArEu,m RboihorcbhaecmhistBrWy, endophyteinfected tall fescue. pFrroifibloeusrgasHsAoc,iaWtaeldlewritIhC.prOollivoenrgeJdW:conAlstuemrpattiioonns Vet Human Toxicol 41:133-139, 1999. oinf . 11. S`AtBv:edAsesmoacninatJiAo.n oRfumblsoeoyd TcSh,olBeostnrdolJ,wWiithlkoicncsuornreSnRc,e BoufsfhatLnPe,crWoislisliianmcsoDwJs. aCnadudtllel fescue summer toxicosis in stcrs. Am J Vet Res 46:1990-1995, 1985. ? 12. eVnadmopehyyteD:R,effVeactmeoyn cLoAn.genZiatvalosdePvMe.lopWmiegnltesawnodrtphupMDgr,owStihegienl mMicRe:. JTaDllairfyescSucei 74:460-466, 1991 * Malnutrition References ' .. 13. CRliicne NLEo:rthThAemeefrfe-ctsFooofdnAuniiimtoPnroacntr7e1pr-o2d6u.ct1i9v9e1 pecforinmbeaefncactee. Vet . Copper Deficiency References 3 . 14. dAerftihciinegnicoyn leukocyte noJunDm.beaCrcose,r-aphahnadLsRel,y mpBprlohetocechiynateFc:opnrcToehlneitfreaertfaifteoicnotsn, oifnsu`pbmeeorelofxyibhddeeiefneudrmiss-miiunntodcauuscleeadtaecdctoipvwpippiteetyrrh. . bovine herpesvirus-1. } Anim Sci74:211-217, 1996. Ld 15. hDeairfgerast.z JDAA,VMGaAr2r1y5F:B1,8C2l8a-r1k83G2B:. 1S9e99rum copper concentrations inbeef cows and .3 16. NDeeontihsphSBo,diAulmlencoVeGn,oSpahkieralKouEn, FcoonptpeenrotcoJnPc,enAtyraadtiJonYMi,n BtarllowfenscCueP.: IJnfAlnuienmceScoif . 76:2687-2693, 1998. . . . . ___ EID151708 - 000030 RGS000911 Pe ' . fonction and response of calves 10 a respiratory discase challenge. J Anim Sci 19, Magda: Fsorcarbons. In: Toxicology, I ed, Marquart H, Safe SG. [J McClellan R and Welsch F, editors.. Academic Press, Sun Diego, 659-662. 1999. o o o * > * > . . > : . * . woods meme EE ) 9] Tennant Farm Herd Heat vestigation ---------- CaeTeam Report * 9.0 GRAPHS * Graph 1: IntHieevapimad'rusianlviizCsieatdttboeltoPhoedlTseaanmnpaPlnretoslfatcaatrkimennfw(erAropemelan47a1,lya1dz99ue9ld)t.fcoartttlheedeunridnogphthyetecattle . rteesfproennscievemehaornmsofnoer,epnrdoolapchtyint.e-Gfrreap(h17i1l.l6usntrga/temsLt)heanldabeonrdatooprhyy'ste eVeanelduonephsfyotre(-t1hi0en5f.T8eesnntngead/nmrtLe)fheerArepdnrci(el1.1p0aT.s1htuernsege./rmeTLshu)eltwsaavwseersraiegmeihlipagrlhal1s0ymtsahuepprpoolratcitvien of h{Teesdtiianggnolsabiosraotforeyn:doDprh.ytNeeimlySccohtroixcikc,oUsniisveirnstihteyToefanTeannntehsesrede.) [4 * * ? ? . . * 3 ' . > . ~ - oo 000032 Eoist710 RGS000913 : i --_-- v ' ' 0 fg . 1] PR . = css : -- 2 :. " :: . "2 .: : . : ' : ls# " :. g2 : * 8 ? 33 : 3$ * h h + 23 ..: <3 hi :: :|< :. 33 H : .:. i. " : tle `ol " e . . . . " :. "le< . EEE . oem-------------- - (1w/Bu) unseroid . * ... oo oo eon 000033 RGS000914 ------ Teams Form Heed Hest Ivesigation Cate Team Report 100 FIGURES FigurFresac1:ebfFllayece(foMlnuisetshceaoTnaeutnthnueamhnneatalfdiasor)fm.iacnafIelnslt.aadtdiiotniownastoctohnesicdoensrteadnttohbaeraasmsamejnot dbiysease CBlei.nicalcbalifndhaodn stehveerveidbeioltataepreal(pkheortatoowcoansjutnackteinviftrisomaTnednanpapnetarveidde1o0tbapee ") FigurbFeiil2a:teFcraaoclwefklweiraeasstotochnoenjtduhanecmhiieovafidtotshf.e ca(acplohfwoi.tnofwigausreta1.keLnikfreohmerTceanlnf.ansthveihdaedotsaepvee#r2e) FigurFUeaece3reafLtteoifcstonaejryaeenacovteifacvitctoairleffswouirctthhhaeascbaMecoftrleaersisaelalnladagecbnotevsinso.af pCcieonntkmreayelecoopranceiatly opacities h{aakyenprforgormesTsentonadnitffvusiedecootranpeeal#2u).lceration and clinical blindness. (photo was FiguoTrh4nee:evDiedTleahoyiuepdseasschlpeirdnedisicennagtleodifgmtnhueloifwptielnneteacrsasctoocesitawatientdhawbdieetelhfayeecnoddwo.sphheydtdeintgooxficiwtiynatserwell CO hauitional deficiencies. (photo was take from Teanant videotape #2) FigurTSehe5ne: oAlfleesoipnoedncoiwpaahsainpedretesorexynicttihtieynmsaaenvadebrioasvlgecetnaherereacloilrnyotnrheaefrevyrirdbeeedontodap(e3csso.r"ofne1is0tcssu)e.a fcooomt.mon {photo was taken from Tennant videotape #2) i FigurTeov6e: eAxlaomppeclieaoanfd"efersyctuehefmoaota"biosvseitmhielacotrootnharaypbreasncdat(ecdorioniftisg)ure . (photo : was ake from Teanant videotape #2). | : FigurTCerat7ut:lneuTshiunraetlehepcrsaeudrimelmeescrtt.ainondTihfnigosisbntetahhnaedvicinrogercikin.swkantoewrnwatosbdeesacsrsiobceidatfeodr wthiethTennant some lffor both coronits ("fescue |. eTnodoorphayntde htyoxpiecritthyearmitap(r"ovsiudmemser fescue"). (photo was taken from Tennant \ videotape #2). \ ,, Figurrlee8edeTswwoiortbhcecadonrfeoonristftsia.gnudriAenlg7t.hisontuaagnphduidnndogni-cisnpewcaitfeirc,praopvrieddeislescotmioencflionihcials rbeelhieafvitoor ith fescue foot. (photo was taken from Tennant videotape fo oriated w ) ) ) ) h\ 3| \ ` : -- o03E 00003 Eos RGS000915 ) ' Ss os ) Ls E fe NECRe di Pe LO pr ' nd jie 2 el 4 y' wzor 7. Fy eEnt" ': &e ". r r=. tde:lh,e ') >B,EAN. i poy > ke Poe ReaEA 1 oe A 23 B )' ? ey 3 # a ' 7 d isi ' [Sa 'y BE ARGFigHur1e )> ? 2 '' ) ) L:. Ineo s eae aT Ph Sane 4| ~~ >1 ' ie a Li ' Ea ler ) ra Ek . ox ) 8 . pr Te on ol ' ', 3 ' Eos * 0035 ; bore ms. y " > ne-y s 4 = A > E.. ' 4 " [} 4 2 := ' EN i mgm ' rEyr Ceayn = a: 2 oH 1 ' i Figure 3 ' :' a= . a Be aul ad gos po pe > :, EOLR ' o-s . Ez ' geri . ' - ) =. isi 7 ?s og To Figur:e 4 . es )036 ; ' ,* as. . =~ I dr aR l z } . ESg TS ') SPRfrRaCy.E..T, E Sr v = S '' pw PR > Jem y> 4 -- : . iEE 3 : = 3 3 _ > y )) ij EER 5 Ea > 5 1 \ Te - i ' CC PR Wi i] y: rT F pes = cA ) ry - a. SR FZ . x > "ad ' aT 3 ' Fo A ) -~ of : ou r ') 3 ) ' DISS 0037 200018 : oc i ' 3 br cay '' 3 = ee SE fd ABln3 s Lea 5 ES 4 Ti ys = i oy a 20 8 2 iFE 3 ATE ' 2h ooin > 2 Lg ROSE T WO pag = 2 EoCET o Pe a SE Ty== 3 i a ' z ER ERE 8 . E ERSTL - : Ca TE iEs EE iC] ET a . dna SW eT Ep in ~~ ey ATs x ) 2 EEE EE GARE | A1 :: 'y 3 ------------ 0055 . o__ eons 2 . Tena Par He Hoss vestigtion 11.0 TABLES 3 Table 1: ReviewofTennant Farm Videsapes Cate Tam Repos `Table 2: Individual Animal Data: Clinical Signs : Table 3: Individual Animal Dts: Hematology (erythron, platelets Table 4 Individual Animal Dts: Hematology (ukon), and Special Chemiscy : Table: Individual Animal Dts: Clinical Chemisiry Table Inividual Animal Dats: Serology and Fecal Exam : Table 7: Tennant Fam Grin and Hay: Nucional Analysis ' ' ' ' , ' 2 '. 000030 =esE0I0D1059127107_ I ` Tennant Farm Herd Hest Investigation Cate Team Report 3 Tabl1e:ReviewofTennantFarm Videotapes . `Tape #1 (cases | - 18): Tennant Farm: New England, Wood Co., WVa - . January &February, 1997 `CowA,nHiemraelfso)rd | + neck:alopecia,scaling,| = probable ice, . + descars i"hbumepeddwp, | + o"nhtuamppee.d-up"difficult toappreciate 3 [FE T + (e snowinga) T comeal sca,probablysecondary , + po(sssniobwilnegd)iscoloration |+ pinkeye. not clearfromtape. ' + o(fsnhoawirin(gn)ot clear), . Cow.Hereford [++ dthien.scarspioobrteeetdh,| edryethicn, pfroroobdaecbolnyasduumcspttoieonadnd : + (snowing) mastication problem, although teeth + naogteuseenn onkvicndaeou,soeowfponssi;ble : teethproblem unknown Cow, Hereford |+ possible hunchedback| + notclearfrom tape. + _ ((nsontocwlienagr)), ' Cow Gam) [+ alopeticlsiwiatc.h. | + tail hairlossdifferential agnosis + (snowing) would include mechanical, ice. fescue toxicosis, and selenium 7[ Cow alopecia il switch, | + ttaoixlichoasiirsl.ossdifferentialdiagnosis : + (snowing) | wouldincludemechanical,lice, fescue toxicosis, and selenium B[ Ca back [+ dead Gaed 3997) | | hotooxviceossisa. le Fonger han normal ' | osnvoewr,grownhooves, |. cbuotlndotcuanustuaal,r(poastcmotrtsem"), ++ blbucikilbraloewtnnstoeepeatrchi,taiels, | +|. teeth normal, fecal mucous normafor stagnant 3` ++ nmecuropcsyo:onnfueocoetssh,er | feincreectusm, neclracok opffastsyero:us ' + lestsaitoedn:s.haddiarrhea atroopfhfayt: emaciation, probably due (0starvation ` 'v Tabl1e:ReviewofTennant FarmVideotapes 37 +3 oo Eos 000040 RGS000921 0 a Tennant Farm Herd Heath Investigation Cae Team Report . Table 1 (continued): Review of Tennant Farm Videotapes. 0 cc is . Tape #1 (cases 1 - 18): Tennant Farm: New England, Wood Co., WVa - . January &February, 1997 Cabllfa,ckiwhite | ++ nedciakh:ealao,pecia, ~+~ pcraoubsaeoblfedliacret,hea unknown, face + olpsceoitriecasomesal + probablecomealscar (hard to ell). . Cow,Hereford [+ cthoimne,alopacity, + tcoopmienakleoypea,cilyprobablysecondary + above hooves:alopecia| + differentia diagnosisof hoo! and hyperemia, lesions include mechanical + diarrhea dmoiest rdermmafteaistcitsuedtiuoexit(c0oisuinssk,nao,nwdn | + cuanuksneoowfn,iaraendthhienniang i Teck: alopecia probable Tee. .. T3| Cow. red T Sifoobnbgerrionugn,d.losing cud | + sdlioabgbneorsiinsg/ianrcilnuadteisnghadridffwearreentaianld . + uirlinsawtiintgc,h alopecia Tcihkoelliynedsuteertaosienidnhiivbiitidoucnoa(lwless affected). ? + alinocpleucdieasdmifefcehraennitciaalld,ilaigcen,oasnids * 14|Cow. red eck: alopecia, "nefceks:cueporrobsaeblleeniliucme.toxicosis. tail switch: short hair | + tail hairdifferential diagnosis . ifnecslcuudeeosrmseeclheanniiucmalt,oxliiccoes,isa.nd . [= 038 chewingbehavior | + mot clear fromtape. . 17|Cow, Hereford| possible hunched back | - notclferomatarpe: differential ddiisaegansoesi(strianucmlautdiecs hardware. . reticulopericardits). . . Table1: Review ofTenFanrmVaidenotaptes 36 > .. _ Enis 000041 RGS000922  .' Teanan Farm Herd Health Investigation CateTeam Report * Table I (continued): Review of Tennant Farm Videotapes } [SeatE s s[p|eeweiCmonmer| : Tape #1 (cases 1 ~ 18): Tennant Farm: New England, Wood Co., WVa - January &February, 1997 18 Co(w,sreaadsm#1e3)| cdeoamdeailn obpaamc,ity, siusbtmhiitsttehdet9oyMeiacrh-iogladn?c)o,w + necropsy: noother | comeal opacitymaybepostmortem lesions. + naretcirfoacpts,y:serousatrophyoffar, : ic moreso ainutteosltyisniess,,pisneeurdloombeullaarnoesmipshoyfsema * Soot: oma os eth : | + large gallbladdersuggestsperiodof causeofdeath unknown. 1 [Ld . [d . . . . . . .. Table 1: RevofiTeennawnt Farm Videotapes 39 . . _ E0151720 = 000042 RGS000923 ; ,) Tenant Farm Hed Heth estigin Cate Team Repo * . ' Table 1 (continued): Review of Tennant Farm Videotapes ' Tape #2 (cases 19-60): Dry Run Harris PC. Wood Co. - Off North Fork of ' Lee Creek, New England, WVA Presentation Disgnosis/Comments ',' mGullviepsl,e Teo ovaryigng weereesome | oy p prkerae, bwi laaoy ith coud andlor |+ harcon shedding and coloring ''' +D`Nbeylpeprhioabrloetspmassymu,mmer), | pprroobblaebml.y due to a nutritional ' choleoardeeddoatnsor Nght .' Fh Geka Tpaossiblle. deal meFag Sevll mal| helen Ten eal iFaa g : ope [ee ede ' El(reaccoon?) T "Comeal opacity possible. = comeal scar secon0dpiankreyye. ' ' {car cpaosmoebllehopeaacidtiies,or | [++ hceoamdenttltsmcoatr cseeaconodnarypeprkeye. wTLhccloeemare) Spa, pg pre rrrepmey .' ar Cdoemaedat(1omptoyn.oid. [+ cSaeoofodmeoatshewrmksnyown.pike ' -__(buming carcass) py . 27 [car comeal opacities, = flyprowibthlseceondmary fly problem pinkeye. : + oy incideadthe:nn oditaga noslis .: ol l O * .. Tale1: ReviewofTenmnFam Vides vo . . 000043 RosE0I0D1059127241 . . Tennant Fam Herd Heath Investigation Carle Team Repon Taabblele I1 (continued): Reevvieiwew ooff TeTennant FarmFarm ViVdiedoetoatpaep:es PE ee `Tape #2 (cases 19-60): Dry Run Harris PC. Wood Co. -Off North Fork of Leee CrCerekek,, NewNew EngElnagnladn,d, WVA Cow ++ wdoeamd, incisors, + dceaautshe oufnkdinaorwrnh,ea,emaciationand . ++ emdaicaritahteae,d, sunkeneyes| + rweolamtedi, ncmaiybseagoeorrfesed (dehydrated),serous | + lungemphwyassageonamlaand + eaatemrgopopehynhpayhlysoeolfmufanfg.afat (hheearrt), insignifiicant . Crrow iincnidecntail dental possible. death:death: nodiagnosis possible. multiple Cow comealopacity, comealseasecontdo painkreyye, . thin + diaogftnhecoavseoifthsin conditionnotpossible. 3 + dying incpiosdseinbltea.ldeath: no diagnosis a. Crayfish [=] incpiosdseinbltea.l death: nodiagnosis [3 [Seamander] + dead + incidental death: nodiagnosis. 2 T= | dead | __inpcoissdiebnlet,aldeath nodiagnosis : possible. ye casa + big hocks be congenitalcontracted tendons. :P[Bm eE ae E ] a meee e possible. ) Fr[om]eppoossssiisbbllee.. ses] 5 * * "Tabl1e: Review ofTennant Farm Videotapes #" s, -- --. 000044 id RGS5000925 ' ' Table 1 (continued): Review of Tennant Farm Videotapes `Tape #2 (cases 19-60): Dry Run Harris PC. Wood Co. - Off North Fork of Lee Creek, New England, WVA P PETEreee e=ee + _ diagnosis uncertain. [Dear Skeleton incidental death vo diagnos o possible. PE ? wll Rabbit =+ (EHD). rE incidental death: nodiagnosis ees . to unknown, s s . . ED151723 -- EE -------------------- ee-- e -- . ' ' Tennant arm Herd Health Investigation Cae Team Report . ' Table 1 (continued): Review of Tennant Farm Videotapes Tape #2 (cases 19-60): Dry Run Harris PC. Wood Co. - Off North Fork of Lee Creek, New England, WVA ER 0 ii Animals o . Cows, multiple | + paobsosvieblhyooevreyst:heamlao.pecia, | + hmeocohfadniifcfearlendteiramlatdiitaigsn,osfiessciunecludes. + poor shedding of coat | toxicosis, and moist dermarics due in some animals + tpooournkhnaoirwnco,at shedding suggests . mnuytceoittoixoincaolspirs.oblem or fescue o [Toe [ower] edemhenes 60 | Cows. heifers. [+ him definitive Giagnosis not possible multiple + delayed shedding | dferfoimciteanpce - probably a nutritional > C11 1 1] Niodteeo.spTehsi"s anblaetoexrclbuudteswrmeancoof tnheCHsATbiEyAtdlhseiCganrsteaetndadpath10obloegiicnaalcccuornatdei.ioFnosrhCatxwearemprhpeopteoas,emd ibydtneot Saree with he arrtor'saserion that blackened eth or patchy melanois were abnormal Alo numerous - `isnpcelcuudleadtinve csommbelnets regarding normal organs. during the dissections shown in the videotapes, were not > . . > . . > . . "Table1: RevofiTenenawnt Farm Videotapes 43 > * o E0151726 00046 RGS000927 SE ' %: eo 3 . s * 3 H :. ry :. eoos ii: i s> s sZ * .* -- - Is <r] EEEEEEE:E BE HE | 1 z |! | | 3 =E [HH|H | |1H HH : 2: PB I| |i | VRIEEAR H:lH: L | IF E R BEE LELs E3 NH iif iHlE i]3 1LR0RE5CREiD 23 | iIiied egg [5 IERER8E|||RRBfEEedEEAs-|R|RE|[RBEe REei2Eyl 2(2 : &: SEE 13 IE [FEoedl,BTece3l d12 | | EEE (EE F 385EE. |[5(E8e 15(1EE3R3E ET EEE] 232g HEREE :: Be Ol EE FRR rigelmangeries ie I : H | EadaaaagaslagT| dTadaTsd 3 ifi H R5E7R5E/E37E2E3E7EelEeEelEseRs dEwDeleEwEuREg SH sede EEE EEEEEEEE R3l [ + ssn + E-- | z " a. 000047 sores rasocosze . ' Ld * LJ oi *3 ' .. . . . . . .. .. . . . *5 eo sf *o 3 i3: .i . 0EF] ., --_---- N i >2 :2 P :H :: HH :M RRR EERE F 1 E| ]1 VL ER 1| =EE:] N 1]] 8g8igl || [TIaTaEd R] ! EEERE PLL EES| % fe iH3 | E23 ilHaeals I 25883 EFEEEEEN gEaEuEEsIsIE& |Bss(gas 3 i [EEE EERREEE EEE %s |toIEy |LEEE R JFERRE aEEE ER : Elles EN HR eHeE Eo iil : :: oEo E l [San] ClEaerielro eleend ieaelRenI| EEE2]58 3 i Te TT TeEes : iHH U|lIlBaEssald s ols e) 1H5i5d8-888y2 3 CHEM ESE E ReS 25EE 33 (ZE ggeE e HenE sEE2 TSiHH 3 4o i 4 ilie HE S3EEl 3% r2las [E53 E23522%3 34:8 ; SEER | [R[E[R[R[R[E[ER [=#sl<]z]5z2|28 E El |] TE 8 i 4s -- 000048 Ros000929 . . . i Ife LY HH 2 [EN HE $1 Ql] ee eed eas .EN::ME ec i* : fa - { da <i i Bi :* :1 Sf ells: ee A n : ! EE a ed : i 1 En a a Ee Jn EER PI IR ' SE HAR a] SHB =I] EEEEEEE Bl 2 $b lll [TITTY . w ED1s1727 = 000045 'RGS000930 Re ;1 TTT | i H | ey > i 1 1 a: [oa 5 fea : A prasad | Fl : - H i ARe E ae nea saE a Qe 33 ro EE Wiis ~ [pr 548 = EH alal|=(a]=|=]2]= | 3 al 2]5=| 154 253 . -- s wiih. 000050 i.2 3 41 EID151728  . *i 3 OL 2 lg. EE| EECE 3 ES men I sis EAmEi || | 3 a: e : | PE iN s. 3iFH: RM IEIRi EeEnec AaRRTs EagEn:Raa aHaallteis:eld k TET c:z HB E:R FBEESEEYEESEaTIcE15ennRgEil ERso 2 iH :a BM 3RE sA ARR REE Ts) Es[aste | fs i ge < Chr Hl ul) ii 3s i&H a : [1 F5gEiaRlRsiEnsvg BleElNaEslallsialel=|elalzElA=]el :i CEHEE i:lo is sAizRiaRlaollallemllataslocailnalaollaloem2lael]) S . E 3iTHC3 E|: 3431 888 Pie sSs 3 32: 7 zg loCRELeelE ee i lha UN] 1; + }! a|2i5ls|alziz] | 35als] 2) 21 Rl nid si S SlL: LAA ss Si Ile m =e eae ial 3 s eo l Hii : : [| | il TTT . | i3 48 - enieirzs 000051 RGS000932 --EE---------------------------------------------- , * -- ti Mle EEE * 8 i= 23 LE] . AEN 4 3, = $0 AN hd :i PH ERPE 8: 3 s . . zB z3 B pB:2aseelnolein 1 a n fpenRteAENRESgg ee La . : PRA EE & gd HEB: <sl5z50850(2 ele] 2l=I5z2m gE 24 ERE FS J IE-NANESE| NNE1 EENEEE$N3HE2 EFS3 2EE3E : SRC CERT 8 fn i . Fa: PY PBREREEREERE REA RER RARAAERTRfEEe ts 5 EEA LL E5338; 33 (I CINEECECCECERCHOeioiOHNN * : * ss s =:i > I [3 $s 3 ss 3i i Pees: of 2i p SEEL: F elllE sslelR els FseR liE TS seg2a T i CHE: FERA IA EAA L R RdEEEt ELsEREY 35 7I 1583543 :3EREH" ESEM B1EES 233 gPleligaiisftdassfiEoiiselind SPP Bikaity EBi: 7 H siii isen 3l EH SHH [=| s/=]=[[7] 5 Titisshid 2 il 32585333 s <a a 232324 a . . .. - 000052 " eter RGS000933  ene . . .. E y EP I ee 3 1 : IM . : rr rT acs e2 3s HE LL i; } 3 ol $2 Bl. ol lel elelel-ol elo]lel alalelellao]lta<l|e<l|u! : (Bean > E:S -illHoseHtel ElReR s E AaenRasaAesls seaeEaee > S l 2 lea o n eslneSee =aelee . a : HBi--e --snr E T E " eaTeone n 1T =] T 1 : : ER a S..s . i: pPH ERNeo cTLRiE- ElEeAso TcEleRo fo esr 2s7 5l8e5s eo F ORE:SN.H i: O2A2J epg ae molmga s*. t: 3SBHE: |aBiE:TEEE 1 B58EE5lS<lelEgs s/ RR88ss sl52 5s5l9a3gss i LfI 2 Z: i. EER1E EE EErEEEE AEE bE <2H] || 1 "TT LLL *. . - -- 000053 i3 2i 5 eoterst Ros000534 o Emir . . . * AEO dalePEE 4 de || sg BH =i5 ls] cle 2 so Hie : 2: MRe AREn R Ra RR i JR 2 5 R ; E 3 6 > len EERE EEass 2] PTR :g B T l[e~Tz 171%) e 1lseIE ko 121] oi Clg EE > 3 7 im ee 522% . . : ER B Liiclih5 2 slelelsls = slolele slswelefielsl3L3E2 s. o 3: iH e Ee CeeE leAeREE Pri 3 Sle PEER LI EH E i i835 si Jlrs osti E PR L a *3 Ml: : Bl 3 > iHH :: [=e afi LLET2E5E3 . 2 000054 ; 3 3 5 ors 'RGS000935 EE * , . . . . oi o+ di :o o. [] [1TT 3 TT | :: B HEEE] :" 2A. ) M0 :8 1 ] ] . . : g HE if . ceHr erd i e FF fede . AE: :R |USdAdsNIaAnaNeErNdT Ads EprI HaHnner . FB: CIRCEECEEEEEEEEEE EEEEEEERE .. FH5: AHM T ddL sdesdsdTrHTesTHdrdidneI1 rN]ddanie : H FE CATA :. c I: BHHd E: sHeeEd cEidedsT eHqEaArRecndzesades * 3 3 3= ] | 88 1 g| PB i Hida ss 3 E | SHE| [Aa allel 2 TTI . .. - -- _ _ N Py Em1s1733 000055 RGS000936 ----E--E-------------------------------------------------------- ) ' * ' . Pi CITI '' 5 oo ] '3 P:E BUTT . : n it s EH H g i 0 ::5 HPEa. [EEEERitERREERRE|T g| . 5#154%32 :I i |i ' : NA I CITT EEE Poi eee En CEP |A & T I i118 3: . tc - 3 558 : iTHH i EsEaELdEdEdEdEEdEdEdEEaEdLdEdD d#;a1ai2dE . a TTT : $23 * : gqareanaanaangY is * 3 i i T TT 5 35% vB ited o | i | ob EL [FRR [a SE b. EH "gl[als[=[R{=( SEEAEN 1i5f% Hi bE R R i13528 [===] EEER 2iE:88228 . . .: Co a 000056 :z :3 53 cores ras000537 -- ' ----E-- E eeee eee e--e \ 3 . a VE od 2 a . . a a : . HE TTT TTTTTT 1 * < : EN ol fold 1 g! vo: [BEC : ET Fl : : HE 5E . z:3 EBE o.ESS|C R05 Elg|F g lT el[|E HE[5 E# & = IEEE EREENE HH iLl]EE 3 . F 3 CBN EB Ne EO EEe EEEeECEE7 E [ T: E- E Balolzi(z . INET EANNARNN WR . t EREICENIEEEEEsAscEE fd . a | | 3882 ST i IT TT eth 2ti:3 e E[Ee| e =|#32= 8 Bes i x| HEH | EH| Eg 1522135 iid = 2 2 $333 2 NMN E JK:NERE. EsEriE0rdCiEE0[2 st d5 n 10 fJBielEiiEn f Td "HESS ERE 585052 EEN 3 . - 5% .. ee -- -- _ 000057 EID151735 'RGS000938 a ." Tee Fam tt ts sign -- [TE - 12.0 APPENDICES . Appendix B: Diagnostic Paihlogy Repors Appendix A: Abbreviated Curriculum Vitae of Cattle Team Members . Ohio Department of Agriculture: #4977-97 < Michigan Asis Helis Diagnose Laboratory: #1792571 . University ofPennsylvania Laboratory ofLge Anil aol `and Toxicology: #UP9902702, #9901437 : AppendiCx: DryRun SafetyPlan . Appendix D: Figures 1-42: Photographs of the 42 adult caule; 2: Figures 4r3.66n: Miscllanous hoographsofhe Tennant Farm 2 AppendE Hed Hest History (April, 199 nerve) a : Appppeerndix: Dict Ansys: Computer\pr Sofware Modeling a . 2 o . . - .. o> * - - - fat ~ 000058 55 Epis RGS000939 E -- E ' .' Tennant Fam Herd Hest Investigation Cale Team Report . Appendix A: Abbreviated CurriNculum Vitae of the Cattle Team Members . DNeagrmeee:s. Dr. Perry L. Habecker Cenificaions: VMD. Diplomie ACVP . Emplplooyyment. ChiefoP.faLFaermg.e SAcnhimoaolofPaVtehtoleorgiyn.aryLMaedibcinoe,orfNPeaawtBthoollotoogrnyaCnyedntTros.icolKogey.nnetUnSiquvi.re. . * Education: JUnuinvterasiCtoylloefgPeen(nBsSy.lv1a9n7ia2.-15S7c6h)ool ofVeterinary Medicine (VMI 1969-1973) Universi of Peansy ania. Schol of Veterinary Medicine resident, 1989. 1992) . Afliaions: AmericanCollege of VeterinaryPathologists . APmenenrsiyclavnanAisasVoectaetriionnaroyf MVeedteircianlarAyssLoacibaotrioonry Disgnosicians . DNeasmeees: Dr. LisaDavis-Heller - CEemrpulfocyamieonnts.. DPrVivMate Practitioner. St. Mary's Veterinary Cini. Si. Mary's, WV. Eucaon: OOhhiioo Siastee UUnriinveresriscyy Collegeof Veterinary Medicine (DVM. 1979-1983) > Affiliations: WArmeiesoriVVceiatrnegriVmneatarerVyeitnMeaerrdiyhneaMsrelydiAMcseasdloiccAaastlsioAcosinsaotciioantion -- . HIHonoltelrriaVuVoen)etVeertteerionSaorcyieAycupuncture Secicly . .. TCTT DNegaremese Ceniticaons. DDrVMP. eDiwplGoMmaoACsVPm. special DiplABoVP(mocadstmael speci bee ' ' Employment Educaion. CVleevLrealbnaonradatSoPrsya.tiNoClooormgmsuCnaairnotdlyiFnCaeodllDengveeesApuSg.asonr5,o7ft4RA)lmglriiencsunuArntei.maRlaiDeiisgch.aseNCD.iagnostic \ ' EUEnauntrTsTeeinntnnyeeosssfseeTeeeaSStnuateteseUUenn.ivveCerorslsilitetygye((oMBfSS,,VeMMtiieccrrrioonbbaiirooyllooMggeyyd..ic1i19n97e758)()DVM, 1981) ` ' Afilisions: MKAiamcnehsniacgsaaSnnaStBesoyUendiUvonefirsvVieettryesr(yiRne(asRreeysairPdcrehan.ct,iVieVotenetrceirrnsianrayrPyaPoaltohglyo.gy.191995915)098 . . `AAAmmmeeerrriiicccaaannn ACAsslssloogcciieaattooofnnVeootffeSBrwionivainrneyePPPrucahiiliiooognnisetsrsss : `AmAecraiecmasn oVfeVeeienrairnyarMyedCiocnasluAlstscscaton `American Association of Veteinry Laboratory Disgnostcians Appendix A: Abbreviated Curriculum Vitae of Cale Tem Members 000059 ES E1677 RGS000940 I---- ree es ) " Teanar Farm Herd Hel Ivestsstion Cotte Team Repent o .o* CorifDaNesgatromenesss.:. Dr. RobertJ. Munson YD Employment Education: DFiiceklSidcnIhsooomnl CoefoVgsesrtio(ei55n.ge1Mfa9io6e3odA1i9innn6ae7,,)lKeHnnetl S3qnudarPter,oPduAchivi. Uri. ofPn e.s Affisions: UnAAvmmeeerrsriicetannyVoAfcceeuairntyollMvecnSdiiaooaSlcehnAovoclorcofaiiyeonntery Medicine (VMD 1969-1973) `AmericanDaySeen Arson o . * CorifDiNecagarmosens:s. _Dr. Robert Hl. Poppenga DVM. PAD.Diploma, ABVT Employment Education: WCeisetS.cThooxoiilcnaofiloVsgyUe,nLnaibvoarearMteo(driiycolifnaegP,aetNlhelswoigBynoscnoed.nTpCorxoieicvrot,lomKgeyed.iacUeinntie,.Sa1o9af7re1,1n5Pn7A4) * AaSissons: UCAIameEnriecaynSVofeMIeinn,a.CMCleodilieecoAfvVsseeorecisrniaornyMeeine (4VDM..11995725185778) APAemrrenreiyciaavnanRioVdeAecaedamnyroafryeMtCehdiniacalTAoxsiococCltoigoyomn pt Toh :" SSSmoeceiaaeetyoyonoocfffATTEsnooovewwitcrcalolnyoomorneypnotafFlaVTveotlxeiorcpiontlsosygyLsabnodrCshoermyiDsitgrygnation: ' CerifcDNaeaigoimneess.,. Dr GrePg_ Sykes MD, Diplomaie ACVP. Diglorste ABT EmpB'lauocyamieonnt: CPoaronellolgnUtend.eSsriaetrtyy:yA(sbsoofsslmo5heepnaDt,ucDPeuocponCenot,t).P1h9Sa6ir5nme1s9cR7se1tseiasrlcshCCoempna,nyNe(wwahrokl.lyDE. Saionns., EUnAnmanerssyeofVreeneryrlCMvaaodniscSllchAoesoloocvgfmeeotniecekeoyeMesdicinie (YlW (91771.51-957565 .. CAImerEicanemDrearasioasnnsCFo)lCeogoAelucisncideofomayVfoefoPtiaoltAdonPespncleomgenitsof Veena Pathol . RoAyalmMiecrBoorscwospioicfcTSoonraeiolnoy i .. A `Ameria can Asoc sfoWciahti ioenoVfLo eatboerranatonrsy Animal Science: ' ' . :. AppeniAn Abbreviated Curiculm Vofi Clea Team Mens 57 '. ~ oo ) Enis 000060 RG8000941 a a * REPORT OF LABORATORY EXAMINATION un mez ior or sosw A7.N0.IMBAoLxH3E0A0L7T6H DIAGNOSTIC LABORATORY LPahoinneg,(51M7I1, 346839-033275 Ny Rfworosiksiownecsoadelshe1 TepereadTMs ay/eii . NPORITVFIOLERGEPDUBILNIFCOARTMIAOTNION PacoholoSgellagsi:n weod Client accoune: 250905 Climic: . cT"ai1saoaanha,asmnsaosnr.tso3 ziomG PGR PA 19207 WISTORY : UoMyeaieanatryy.aiscc?sacCtltolfinezditcwohaeeolicghohasetiirgnfdsoacvoresimt.n,c(louNlvdeoeecrsstbo1lp5oa0fecykohauaftsiierndodfiintneg3e0stt0h)hei,nhtcapalviauletd,cehddyiGepvhadeacreiognvrryeo,vrleohstbshleoaafcpnkadtshte eKietonelroar.aciColsiniocfalthesigmuueioaanld mneocrrespeytndinpdoisnsgisbleversebodcermsaclriilbieedsinia the vLeiSdeeyoertaa-poec1owaw.hci(ocMvhDLv(aMs1D7L3s3u5b17m73i3-t11t5)e7d1w3wh)iitchhVhitdhciehsdtdiiosnesdu3ee/sn.18/39/7T2i/sa3s7nudevseCriesfsrsoemsaf4r-om . tei anire to an emviremmencal coscastnant is suspected. . Pseinea.: Niwot3sTsNaien: 28 ASsiex: bTyhou . LABORATORY FIIOINGS . TOKICOLOGY AESOLTS AND COMANTS sexe, Liver Test: TISSUR MINERAL AALYSIS (values iap=pm) s. BCVoo((<f1(.So0m0eie e)) mvbpael((<0wa.10om0 ))) CWmaCliES)1a7 )) wcmmuli1ia.9s0 m)) .. AlX s (e<n 0.m500 }1 SCre(i<d0.e2s00 3) mCaa0s230 )1 Kogw(<2n0e0 > . Tess Ccaompmpeenrc ia Seren and dwiistchoilnodreaftiicoinenotf haanigre.. MaCnogpapneersedefisicimeanrcgyiscaalulsyeslova.cutOesher - Coote Calason63/c0o7n/c5e7ntrations ave vithin expected ranges . [3 58 - 5015 A AT~oReAvAoTTIEVSEApApCTmIoONNARLGTUEASLTFRFEOSRTTUSNTY STITUTION cori 000061 RGS000942 eee rion mer aor sy Case amber: 1792871 seRcnan: Kom * Test: TISSUR MINGRAL AOLYSIS (values in ppa) * CB ot(<0im0)) FBeCl t02sm)) eWal( e 2m6s)) M(o2 leas ) Mo (03) oP (330) zm (19.8) sia .o APo ((oossoo)) Cser ((<ea3lo000 x Cae )) oTcal(aosmo)) hwga (atcsoe o Teac cCoopmpaenrc:is belo noraal range (4-6 pra) and cadaium ie above mommal range (0.5 ppm) : a "53/07/57 . svscnan: cum . Teat: TISSUE MINSRAL AGUISIS (valuesiappm) 2 MBCeo (((<20al.os09007))) BBFPaell(70033563%32))) czMaaalll 4040.36m% ))1 sc(mul<(<ol.0ossi0so ) APe (20025)) Csre t(<a0.n300 ene )) cTd a(0s0500 1) omme a (<e0)) o o Tose NCoommheenatv:y metal found in the urine at the reported detection limite a 03/07/97 o BoEh Livers and kidneys had low copper. This is che major finding so o 30fart.o 3R0e0pogrptae;d sagasiua, 100 accdooeppq2eu0ra0,tpep3a5l;itvmoearn1gm5ai0nnepesrpsa;,l i3rr.ao5nmg,feso454f.o0rCoyca2o0tm0tlpmeocela;ryeb:decmaml,cium 9s.o1d4ium0, 610.400 tpopm1;30p0hopsrap;hor4unsd, po1t5a0s0siu6m,41012000ppac;o i33n0c0, p2p5. to 200 ppm; Troexpiocratnetd osuctreeinn abysGpl/eMseoantaclheTaLpievretr vihseninavpariolgarbelses. and vill be Nucricional exaainacion: Urine luoride concentration vas 6.6 ug/al. .. RBarieae.d: WiHoL3STRMeImNe: 3/2 ASgeex:: %Fy oows . . .. 59 . errr ae DSERENDCTES ADDITONALTESTES oe. some 000062 RGS000943 : - 3: A sheeCS n LsenSoem , wysony on ir, Sp * Tiver, there vas advanced postmorian autolysis with freete/thav : e * ound, clear, intracytoplasmic vacuoles, indicating mild, diffuse :L :: A woC L re stn E y * significance of this finding is unknown, and it may be & postmortes . Tas: TISSUE MINERAL ANALYSIS (valuesinppm) . 3 (amo) miei) lama) ano . As (0500) Ce l<0.200 ) cd( 013 ) Hg (<0 : SSEEE ee sim sh o Copper is vithin deficient ange. The folloviag elesent(s) is/are wR 03/07/37 $m no . soscnm: wor Mo( 0.388 ) BP (180 ) za( 26.5 ) Sb(<00 :: eedRE-- RR errwom . "0 crn 000063 RGS000944  rn mex sor 5 a Cane maber: 1793371 someon: Kan Tec: GENERAL MINERAL NOUYSIS (values in ppm) NBCo oolloloimna)J0 B m Ballm 3n3) 7)) zcwmpaoltaimmmeee))) msoui(mm7isa) APe a(lGooso)) xn sCxe ((a<doa)1 TCaal<kdecs J) umgl(0@0a : r---- esc: PLOID KINERAL NALYSIS (values ia ppm) ? CBoColo2s7oo0)) mveaf(o0z3s3)) cwgal( i13h)) womu((<<0o.l0emm0e ) 2 MBAio o((0ls10oe0p))) ScPpex ((( eo13e1do)1} cmoaa((<aacalnoasnm)0) ms g (i <ios 0 ) md Bi) x vee BEoatsh. JiRveeprosrteadndadkeiqdunaetyes hlaidverlomwincoeprpaelr.FaTnhgiess ifnortchaettmlaejoracef:indcianlgciusom a531a01g4m5e5ntio2u0n61,.4701p3;0pracc;oappp3eh0ro0.sppho1oe5r;vteao,an1g51a05n0e0pspsa,:0 34i.1r5o0n0,tpor4a54;.t0ospion3ee0,;0 pm25oormtyoba2m00m,ppm; "otium, 600 to 1300 pre; and potassiea, 1306 vo 3300 Ppa o bTeoxirceapnotrtesdczeiennabyspGpCl/eMmSeaotneltheTeploirvterwhiesnianvpariolgsrieess and results will . jNuetreitional examination: Urine fluoride concentration vas 5.55 pres----- o CLINIACSoAeLnruomPmAacTlhHieOtmLiiOesGstYryinpcrloufdieldesvlaisghtrluyn oluowassoadmipulmecomnmcietnttraadtiofnrom(1c3o7v.683. Tat1ioLs(a4r;eferreefnecreencfeangfeang=s13=3-2154.51)5.), slioivghesleyrumlovalbsuomdiinumcotomcpeoattarsastiiuomn Sg(oi2tc.9ablul9/ibdni1l;ifraucrbeiifoner(e0(n.6c8.e14; 8r3ar/nedgf1ee;re=ncce3e.f5e-rr5aa.nn0cg)ee, r=asn1lgi.eg0h1t3l3y03.l)3o),w, asllsbilugimngiehnltyltysolevaced Celaelvcaituendcocnrceeanttinrianteion(1,(76.95/#d3L/;dl;rerfeefreernecneceTanTgaenge< 0.67..19..31)0,.7)l;ov Sl1i3g0h4t-l7y0l.o7w. sosribiigtnoellydeehlyedvraotgeednasseeruamctiixvonitycon(c0e.6ntUrLa;tiorenfe(r1e38ncueg/rdainsge CCeeffeatreennccee rraannggee =+ 4200-61-303)0.2and SLiGhELY Low oemeraticy (183 Sowa: : " .. MSU 1S AN A7SDFBIRUMOATTEISVEADACDTMIOONWAELGTUEASLTORPEPOSRTTUSNITY STITUTION eoisi7ez "000064 RGS000945 SE "" " oo s* S . ] 3 -- wr sor su - Cate mada: 1793572 2 nosigmiicant pachsiogic findings. B(eToxicolhoseinc Saneallyeseswaexeain dhprogesam42dd +esuupplremenntsa fares 1a $7750 310 pom. "thahgh Tevet an5.5 te boon mem, masini 4 . leveplJsroenacs5h. 1e4ia.0cncg-ar1a2e0n.0 ppa.] 10 FS 42d the voxic an 3ssa7s :: su . F] ? ? .? . 0 ' ' . 3* o ' MSU15ANARATERCTRSUAL OreaReTay mestrumon Eo151743 000065 Ros000946 ' 0 `eo .: : pons same Gaim QNIC noe 0. : saa 1783IRNIIN--22223300-747 AnimalDisease Diagr= Lr! "ratory RAOovporerrerssidoantse: C438a17s01e98,77A5n6i 0 0474138 omvtmer: Or. Ss Gane . OR2a3sn8eDtEbeadpasarirsu,nmOannotf 3Ag0i0o8uture TaxiTnveen0 sSuusssnsainoyn TPaekeon:n: 3a3s0t9o7n . ' BELPRE, OH 48714 BoE Species Animale Tects : Completed . ---- ++ADDENDEDREPORT ** * ? PANAITMAHLO10L: O1: GeYssreomveen,seBmoevino, Mm isem d Brm ad Beat 1m. remem =e. Sule: Dest Ariat 2 NECROPSY & WSTOPATHOLOGY 237-87M11:24e > Necrapay ` etary (pmo - . .. dran,nsseaaterkvtceovWoestennwaaarrvsbeSrhian<ag4r.eahdaTnhsas aalvbleaiwauunddodairrsersoiaagrdhsn.adndhhessthrdonis h1s : Gone araminin: ThYe miaTlee aevleeaptc. porrusensetaeed dotefndr. aoTrheseecassrnacntasas ,wEeteteh TrscartBTwhyoeeatuptrieiseronntsisnyahte ac poor. .*. oEecuemn n. aHary,eP vBsutvnatengsraisnorwsaeesdoproaercaendtein theoefo.resMtomdacha. i nn Formed fees balls were p. sent in .. Merphalegc dagnasis: : ETmracitandanswaitvhisnwavcehsoeresahf : Commentes . pToleocutifiwvae ieniinvai0e uxbrguaieynefdoooanrktwoitoian1otpnoiatlartrbaittm.,eiDHugoryip,ngioiovw2l0iegnnrsiinw,pemseotrnhairsshpeepsneaddhsebr hGen. main 1 oy wnddhiaralfos serosa ou bona 3 eeneetrewtaeestrhbwserered thne frteee eand rmp,ccarhprmsntoibntst v8ed the N - . .2 _ "9 Eois17es . 000066 65000947 . .o ... - : : . . 2 .. . . .. .. .o .. - o | ., Fron + sere Im LC hocio. a ime ror Apvremiasnont:n497d707A + s Veria:e ow.CvdB a W. Jr. Oue r: Cie, Kee n oris ops2SONo N.AGRrGePvEieYun&yWpAoTrOPmAiTHrOLaOGatYe.37Wa-t4a7p1a1th:l2e4gsi,Caontcoveedr wd ili sxarinations wa emoenpegoagk.ssLeirarisashesaevad bovhe BOaFraavesmepsohetrssboa ee oft so, VhPaniteaeoiagrriyymeSe,abcaDtooVgMitP20, Girma, ACYP . Fitcpaasge sumosian: Satmmaonneesofmfaaan rremorn, catarhsbaatcorne,otbnresofoemaome,riknteag.S,oaHrvnegSrhotcnrodio,s,Meewsa,ordebrree.,seaondvegenep.rrueonnndasmeir. ramn5eo0t0te1 a$C0imanarsoreriseodgnaaralasr,tewni.CeorPpaisshbaacbesnhosanoomrascISaceisrnSwohaornscoan,mnWdpiktoiteeho rate,:Tahoaraaetv:sittsoaeesadvmvaariamssneodsoroiairdeebyBssstraeapnadeoppeaaiiet.esToFesrvoeetreosohtomp sheedd E-- riioge dig"ress frtse ee, ~~ Shai Grimes OVM, 0, item. ACP Pr wroe VFeatienreilnoagryy SPaetheolnogist he Hatopatnaage namin: AETorahcsusncteAiaoinreosfetoFey+mwbierrarhsdaswrainia.&nooTerheehvaofechSyadsiossctohsnadsnoerkaeirirnokofleaermehsetstsaeaanraeh 4st4uind Shraeeraamgheonof,fnBroaacsdkeswtinnsrpmaawmeoanrairnetsawreossdorkdaanrrdgeeienrgopePddrarraiteTehtaselravedToPAhe foorvmeteoorgf [I -- Modarte. hve,foosy exami frog Kars VSheiarGarimePsu,ieOlVoAg.at$0,Oloms,ACVP Pathology Section . e of 000067 ED151745 RG3000948 =EE. ' % nz sme sint | moe Sis - AA rm: 44747 vm vetAhveoEtoa.m0r mm Surtotpe es ' ea RoraoN 2747E1ar36 : J 9: Hv ona et im entser nd wp ermone y-- MICe R-- OBI-- OLOG-- Y -- e e A e ---- anon cre Sava Resuha: Negative ? DIAGNOSTIC VIROLOGYsmeee P ' E --_-- econo av : ro a :: Se --_-- excaronvas ares Revue: Negathe. Sm steemeeeeeeeeeemoes eee. ---- :: rJnoommessona. swvrnamseats : p- J v y y 33 @ . ; . Tear ---------------------------- 5 000068 RGS000949 -- ' ' mereeee -= . . FROM: BELPHE ANIMRL CLINIC POE10. : 614 @ 1750 - LY . Avosanion: 407747 Vemuri: Aloway. Code Wr. Own: Comer, Kevin Tg . FINAL DIAGNOSIS & COMMENTS 3-4-971:405 (Cantounds . .. . PATHOLOGYss me o em en mes cs mee m. es vet. RNMA0:L1:(not eeded,bovine,MadBroodbeet amele:DeadArka - o FINAL OAGNORIS & COMMENTS 3487181405 2 KEQCurroAoarGgiNmhOiaS.oIanSS.a.rtereae . KTeoeenitiao . : CFooifmnmrauiniee;ercocehdeaptaeMastecpoembearegs,aTxuomienartosn osfhtoroevde euhreowsilbrwaspocbmomae y et . recite wit ba reported in an addendum. - :rip of . . . VP`eSithiuarisionGqariyymSPeeu,isniDeolnVogMatPAO. Bigamac, ACVP. - o .. Addaandnyim: . . m2P1iaisehie inatgcena1ar0 ,theiinirarrtsoeapsaeCtdahcrateoalgsaicrshdeersvccurr1ipsaiannrdaafushreto.rayVns.SeveLeniioennrsooisnohhfoemreaerydeavbwaertmemnds* hnee :.. 81472u%n6WuascruosaulS.nugTaghfeesthtlisvberoaafiatnhtgeas1nedars0soo0ac0ina0tIwevdowu%nhAdhaiUmhuam.eShbveuentnw&eeWtdaouwumtretSivMeeemritrunrieyd1s boaontshaewntretshwoeuld haaread i hin cas. Mamaver, Borers may Secu wh ding aubeeoons town peter. .> . PVShehitenoeliiaoGgcryyaSPea,caiOvaVneA,dPRO,Digormms, ACVE > . . . s. 1] . 8 . * : a N, Ese 000069 RrGS000950 7 - .', FfEoRN) NtELcWUBmh OULITm IONRCIem EIrNbNTEDnm RL pscsstioenNtooeUPwsn .: Or fBr EATYowomse sin Snes y rn Adres . Dry Rualavestigation Team CCTueuCInootnEa.n:NFaoe0yLmitHabckeer 0 : Fea a + Ld * *- *s Sbpeocttr: Bove SPraodtuction type: Meds mDatweabtained:4 ORRseterOencleLeab Oita . a min rr 2' OO : HIiStTOdRcYoSUpMiMeARrYL: ol x 10.19, Taoer (KDOENDUA ues frig ? DiaGosS: ' Enteric lesions of minimal significance ' 3 croe tme mentn s:c go imits n opttmrons ii, AB hci erm ?: ?; LAGBETOORPAATTIOELRDYOYFBIoNDRIANGTSO:N Jimi 1) Hea2rpitece,s: deMinianfaole,lymphocytic myocarditis: focal _--Swcoyst '' ' TlE eo:esmacemtr er, lsoifscdi pri ': [ei ier, bi rpeamivart ca t } soma pent. Hecker 30 QO ' ' ''', So 000070" IZ eos xasoo0sss . : cm, NEW BOLTON CENTER FINAL REPORT iAJ (eSoasm:J L TUounesioi eyvoofePv ernryglsvA ae niis,tn Ner yw a Boly tonCeinter eAcesionoVeenDrNLoN iua:DuU is tePr yyy 363, Sect Rend Suber. Dr. eryaeser . PKehaonneett(S6q1u0ar4e1,-P5A80019F34a8t 610) 3258110 .* Report Address: pry Run Investigation DCCRaoaseeCSmTrouaocstkinvtg0#:1:99T7Ro5x9oicb9oltTogAyP)oe ms 21 , DVM,PHD BSrpeeci:es: Bovine Production type: Bel `Date obtained: Reerence Lab: SF Mody mw 4 OF Okwenle OUsksown nwain,_ 07 Se Fe ------ ---------------------------------------------- ?? HISTORY SUMMARY: : ts scopic foDr LisaHl nn 10,199, Tio se hed slog Ge 0277) > DIAGNOSIS: ? Copperdeficiency ThiCeOcMelMldoEriNnmgTsbSov:inceerler eeiasannes inbetsseleddbor hAe pCaCcincoonhcenmlihsansalgsecm,otnyn,ieni1dseprss. Tmhels im erat oud Ae po wt Fump 9m ets btof ils ' pMioserrost seDeficri-ent Me-- NSeoueom ' CioCMobroalmtp <p0rT.r0ia0c5eppdpm 0005100017 pen w 0aSo0o2ra0s1o02o0m0m08paa5mppm )) SVrieoawoe <100m ovmoigm 1500300 oiwospe o0umoetds0ommne } pm Soma Sowa Homma ` anes bindforPol MineLevel inAHnioss . ) LABORATORY FINDINGS: )y TSOaXmIiCOLOGYRESULTmSd:idey ) ee Complete Messen .s Liver Kidacy nae cos <os0 ' y 8 >, Essie 000071 RGS000952 EE ---- . :* E7 D= NEW BOLTON CENTER Univesityof FenNetwBoonConntr FIAcesNAL REPORT . % Op: LTiFoosckoologuy Crean tisong i es DornLNiion:dUPttIe) py:eH 2 3 KFernonmeett(S6qu4ar.e5,3PA0019F3u4k8: G10 25310 ter DrFey Mibeker > . CGNaernminm c<Goraoo occsotsmw 3 pyTaabn G0Dmn LS< oiwe . CGiutra aSo4no ooGus oMrain o11p 5ws s Mopienn 102 pre > Spseam 0o2i3% owox . : MsVaaape"ieen ScGoRnm L<foooom 3 Alm res we pid pi ewe eg bs 2 Satinom . riceanita ening . Samp thei ' Ta upc Chie Savy GEMS '' NBoowitcaoanpondxsswarie dseddTiNnEesseros onadpieeodv ioscnri FEC rp hemi : [I --- ) Tes Fronts '' Frit adein hcebiiedbonelele 1008pm pred on dy on us ', Rr Poneman DVM FED \ \ ` ) ) ) \ \' 6 000072 Eois17s0 R8000953 3 o" Tenn Far Hed Heth vesigion Cute Team Repo . Dey RunSafety Plan 1 Phyinsjuriyfrcomaeale 1+ The teamwill follow th dictionofthe 3 mast | experienced cattle handlers (Bob M., Lisa, and Pete). Mr. Tennant and his brother will help with the handling. 2 {! |{+ oRefcttahe cpaatltlpeai(noontsew:ialdldbeedpdeurrinfg o4/7ro/9nm9yesbadfyety meeting). | | [7 vee ! 1+ Ni membersofthe cat cam willberesponsivefo | || || eaitrepyerofsoantaelrpsaefrestoy.nnheel sinfthte oafnitmhaeltheaanmc,lianngd hreea. | |: fa tAollspberisobnystihnestehesaaneimparla-cthiacnedsl.ing areawilbe expected | r.y :y |" Physical Ce wxamirneestdraTiontaddeevqiucaecsy(cboerfroarle,hweeae.dgate, haters)will . ' ; TR + TT Ciinhdeimmviiecduamall rceslotrefaienitfc(nee.oge.desdeedamtivewse)swparbieenulsedlon @ devioes (e.g. knives, hanodflvetierninagry tools. Necrosis,phlcbotomies. | |ii needles) + cDairstpaogasgaibnw lge, ahnadrspm im(il3a.r pblardeso, ecweid ldbweiucli olrnodeupecletasecded ||| * || | BorlenGuenenr. nin iam e_n | $ [| 3 Biotogcear ~The andcbuotes ewahenwiworbkeinagppwriotprhith Iedsrteoscske.d Goverals || s i + Saouphs wiater. scrubbuh, and paper iowels wilbe | |i ++ RLecatarl soiweevneswwiillloebewusdedFfrorreectaplprapeatisones.n || . | + a(Fbaecrvhieseiocosntsiedyeroefdthaepparroep,ri.single we" collection }| : denees will be vied) | -. || a if dciltinoicnalssibgonosgwiaerrnansta,fettyhecmaelsesetseam may implement | : [C| 3hemica icy 117 5 FCorimnacoloinmwoeeiflwnibetetchrwfoeopordymad5liiansnsperesseArvlatpieversGounnngwiellhelavoid | : Toowit:oPyrhewmielse. rreveiv:edllnlwesmembeeresdofhned stedcaoamnofehyeevairnttaonaUMi.9Teonea' Farm :- ||e o Paes e moo eE nov : CEoe 5tASSoEi n eSseisnotot yvteenykPetr Mol, Bb |__Munson, Bob Poppenga.andGreg Sykes. `AppendiCx: Dry Run Safety Plan 000073 70 enters Ro8000954 v . Tennant Farm Herd Heath Invesigaion Carle Team Report 3 Photo Photograph Legend # T-al Cattntlheuem1ab-nei4rm1a(.lrpelnsapcueemcdbtefivroellionyw.TianbEglaeecxh|amopihfnotathtoiisnoenup)moboref.rtchorcroewsp,obnudlsltoor tsheeeearrantdag 2 Cow 42: The individual ow which escaped the run and was therefore nt 5 Liveccsaltruoetcksagigwneecdroeroarhlee.xdamTiihnnteehdi4.s2caodmlltcfaoresev(e3r9alchoourw2s bpsuil,ol,01 esxiaemi)naatnidon12in * as Cowih2e5l:tCaofmteersnloosncaorf Apri 7, 1999 ? 4iss `GCooww ##2360: CCoornmeael popiactityy : aas Coonw ##4307:: CoCommael socpaarcity a Cow #22: Mass (12cm dimer). prscapola,subutancous. neck, right *. 50 5 CCoowwBr##o22w22n::-rMSecaadnluplaeilldpeuxcnpoclntotruearntetisaonndrdoaifdnrceaydis.ntiacgecoafvmeasrsevdeuarleidngaelxaarmgienamtaisosn.of red * hi within the cys. Disgnosis was "epidermal inclusion cy" of :?? 2 Cowosfpo3nno1tapnaTetoohnuolgsouogeriicwgaiiltnhswigshnpiiocfrihtcyawnmaceesl.aonfMonseoil.asingoTnhsiifssicowafnaecspeiatdnoernhmecarilddhieseasaulletshn. d3i5ng seen her, i normal * 53 Cowmo#st18:likSelsybneanaynglainceds.lump adjacent to teat. This was considered to ss DeeScdjaarcaenstsoprnopTeerntnyantpropery. One oftree deer carcassesobservebyd * VpiirlTe3o.n1a9n9t9.anAdlDlr.thSeyekae.ppweitahrin150h0avfeecdtoifdtihn tTheenpnsatntfebwarmnoontnhs. : 56 Tenant born and bamyyardard adjdyacent o the corral where the cate . 5 Grs"iTenngnapnatsbuaremslong the Drs Run Creek between he andl sit and the : 58 GrazTienagnapnatstburaemsho the Dry Run Creek been the andl sic and the 5 GWroorupionfcis1o6rcsoowfaskuulnlisde(npthoitfoiedsuopwpl.iebdulblyoMr.teTeenn(aPhnott)o supplied by Mr. * Tenant ** . * * : AppentDs:Phos 166 2 *. 000074 Ro500= 0955 9 - Tennant Farm Herd Heal Incision Cale Team Report ? ---- - s Fiske Photograph Legend (continued) * 63 Nec"kThaelocpaetciieatienaamncuonnisdiednetriefdietdhiasnimmoaslt(lpihkoeltyodsuuepptloileidceby Mr. Tennant) - Nec"kThaelocpaetclieatienaamncuonnisdiednetriefdiedthiasnimmoaslt (photo likely dsuuepptloielidceb.y Mr. Tennant), 9 6 Nosteewaimthcosnpsoitdteyrmeedltahniosspiisgm(epnhottaotisounpptloibeed by Mr. normal Tennant). The cate :. 6 pNpose5wmithcodnisfifduesreemdehlainsoisigsme(pnhaottioosnuptpolbieednboyrmMarl. Tennant). The cattle . arcdaptaleatteewaimtchonspsoitdteyremdeltahnisospiisgm(epnhtoattoisounptpolibeednboyrmMarl. Tennant). The 3 Cattle team (CT) and steering commitce (SC) members at the Tennant Farm during the April 7-8 1999 site visit. From left tro ight: Dr. Robert . Pvoeptepreinnagray clriniciana):t elinicianipathologis), Dr. wPnetkersdMiooisgainn,(DCrT. RvoebteerritnaMruynson (CT: Sarah Caspar (SC: EPA On-Scenc Coordinator). (DCr.T:PesrcriyerHinaubreyckcleirni(cCiTa:n).veDtr.eriMniacrhyaepalthHoolomgiest()S,CD:r.USLiFsWaSD,avis. Heller Environmental Response Team). No shown: Dr. reg Sykes (CT: . : vDeutPeornintarby ipatohigoloagoitsuptorxiecsol)ogairstd;Dtra.kiRnigdpoilcgthureV);lDre. iRal(pShC:StDauhlfo(nSCt: toxicologist: not presen). * -_-- > > > > > > >, AfpenD: Phos 1:66 7 > Eisirss 000075 RGS000956 tee , :)y : ) ; ) y ' ; ' EEE EEE & 2 p A; Ce : je 5fMiB) Lh i : HE iF if Eso, a al 3 2x 4 BL 1.bo a STTIO :a et] RETR ": i R )' ASE y RE TR osiAEpS ea ) pl 5 oa pn aoa Re ! NE RE 8 rYH ieDe Gui n Z hHle : Bee 4 ) LATE IE > x5 hts id : ni eae , cHyal oo ceo my SN oT Nhe ', 0076 000: I--------------------------------------eeeeeet aa Po 3 ?7 5 o: p y 4 I o:o | bo 4 Tah, { h14 d Bis: :' i Elen ecg Sp rt RT : ~ S~E . ER aA 4 ? hi Cn Bs i i : ; a ::: YE5 Sa ia i 1og] . B SAR b >3 a 3 >= He I LE " De ) re "o 3 i > SR ! VA a [ ar 5 EID! s 0077 R 00958 a a. ) .. gre > ) 3: 3yon 5~) . i ' J p 4So > iy ' Oi Si RpRa) ra A PCE ' AE ri ETE 2 ' NH ac : Se ' x BL .i-JE=, . p> ),! . 3@& :4 } ' i SE y Tw ) ! i E os e i : PE ? EES 0 SeaTdee 0 ' y ) 10151756 * 0078 RGS000959 ------------------------------------ , 8 ry Re / h 5 ii ro PE : PS 2 ; Pe ir : .: --; i - . f -~ 4# } E i h ! i1 iah a :; lTeEeT., PeEe ETrEsS : E era C EE ? a ,3 1] E. ; is ; ' a3 L :s' =a : \ iio : : , > og 2A |4 ai re N PN FiTy ,y p BS l ons R atAE vi EE aay ; c : ID16175 y: O79 : 096 0 ) ) ) ! ' Pov: o \ TE 2 BTRrL p | ESHu] ' Jp nu y ; - Td Sa ; Segre Fes | AEE wR ee Ee , ey ) oy Pa er |S )) RN i a Pri eh yy 0 od ) as ? , ) , ER ]j 3: ' '' fo Hh o eF 4 JA AaEgP :) F7 E g = o -h gic ' i g " i 5 Bok Hn BE np ' y os ' )0080 RGS00096 = BE --- - ` ' . o ALY i y ` : " WE : NT x 3 : -.. + 3 Jx J ER 4 : = TOS, 3 he "3 ; ' a 7 | 4% oh ott ?2 I RCY T ct YiCpgSete e 3 PsETT Ee oats,msi ' ,? B bil . 3 5 EK 4 Hy Lan oT Ne : = oF f 0 Yd oi ? : SO a LS ; ' npyi, A = i om i I LAE RgPPEErS APE DARLING 5 Re, aEA Pgh TE CE a 8 % hr DRC PE : 3 > 7 )0081 oe ' . v. oa hl 4 `gh % i 7 a I -y a., = 8 "4 biBiy 7 . 9: i J Hg -- ~r ; '' T S=U RO SE NST 3 - ye a :' SECA mar Lr T ' ST ' a Rr ' : : B :J 7 6 Bl 4 :: ( . = ; ': e A &: SHA ul CB ow , iy 2 ; FP Ka of iy fo ,}' I I SRENeloos SE IFS ER eTe m 3 x { a E bE eiPR e sSe aPL A 1 tll1 TST YX 3 )so? 161760 )0082 e 1 ' ' A ATs ' : Le . al ' . Va - ' re 4os 3 : 2 * (=.29 ` % y ges i, RES ' SR. = Rr 4 ET tT 3 ge ;: =. w= ares LSEal ml, a i 3, TTR , ' = ~ : ll I No5 . 2 AN 2 . ' y: S A@RE5 bn : on . Fn EEE '' ' ro IHS <TH 7 J is SL Sp ia RE ' Fe BE i SER Pe Per Se Pr Soc otro J a LT ' : 10083 rr ) av ?' S=igXe,= AR TRYST iii. ErBE a : ole 2li Hgh e & me [| = ~ y X ! , oo he > : ie 8 Puss ' TON {i - : Th He 2 SEE 2 A : . a er ES Ral A] Pea CEinet 0084 650008 ) 3 gy ' i y pA BG ` y; ) BS4: : 2] : ul - \~ Kl Ln dT gos ren 3 ' . : LZz E, a Ea ` * h3 i [ Ef GATE) i ' ou +L a ? 4 REI ' IrE r. 4 ie gg [ s a ) FE] [& No ;! 2 aH e E nR c R e BLa: ? ? * 5 10151763 Aes ' C2 Fer ) Aa ' 33 5 ' i " L y 7S Wa b ) t \ BR] ) As Es, * bys ) - ht PS 5 4 Li ) Ds PIR I 0 A IM ) = jofross RAC Tr ! . Br A ) . TT L Een JE ) :' : A"pe ) 2 od )' I] 7 x, ?, :' LI ;X 5 } ? ao Sao iA % 7 i ; ) ) H= J a aEi Ni ee aEEa L , 1 4 ; : ' ' >, o1s1754 )0086 ra500096 --E--E----------------------------ereeeeeeeeeereeeee : TA 7h y WL ' 4 ar ' * 1 . hi p 1 Hy A TM i. pi yg ' v -. hk rd "aH rh Eien ) SENG 4 ' TT ar EF al ' ,' ER R y re 5 ey A por ret ye EsTEoE R-- E eR ' Re Comsay BEY ' , ROE . NF mead RR A as N ; : ' ' & gr CER Br ih r ' ale R.. aL I SEEod ' ' Be: =i3 . FC Ty =BeeSaeh b ! ', TL > Bh - Fisv SEa : KER S Ret y --- Yond rt hx eo '' (s A"wog 7 yh 3 %rn_. > hE :; ; EE #0 : Th! / : ' 4 )0087 RG5000968 arSeer Bower P-- ), i = SEE A | HU x PRok Oe i. ---- tS gid eeeEET :; m Soe f sf ca K rE "gc : eR RE . - : Soa EN a3 ) 3S a2 po 2. Bg en ] 3 2 2 3 a 9 Ste Ta T E E L J ee inate REPEL .1 PR= E RS ANP P rI a : E 3 R NY ER 2 A 2 IR 2 , 3. R y i . igoA 3 ': y: a : oordf 4: nin : : : . n 7 P N9F,SEIpes a \ I et 3 :: . i EY 5 i a od i i if y @ y 00089 or Aaa '' : ea RAN : , kd of AV a ny oo Hd od = pb 2 La wig ee orkern i ee by | a) , ;A imal AEA re! oi) Der ARE ' ' ad Brg 4 == Pe mr == ; J) gy. a ; id ln REE ' o' s ; --p _ = NX ; 4 roeae% : a og) > re es Ol AT 2 !) Sl ee "E x n = y ~3 =F th Ty FA, \ I; : 1 a9 PN bd a! y ' LAER RE :> 0090 a EID151768 EE ERS. Di D x"' b H4OA s a;. $YedBy i . i ok = a fen gA - re Pr a ', 3 ey SEN PERS ) i PR SE ' -- SR : == EEE ,' ee : EY ' ' pa '2' e i Ja : . -! = WIf R : 3 : '' gr 2 8 413 1 5 3 ) " ) y 5s sr i: 1 : \ "i o4 ZI . / ' 10091 I ds -? AIil H----a--nt SG eS, ET : i =Y ; Gi > Pay? 7 ; : R= mr "Es r 2SpiT n EiR ll ECoa or: : na = biel ry : -- " : Rh ; fi : Tail A . To , IS ' i hh : , Te I find C54 "oe 5 " ER : [UH4 | oWgZ = Ta1TR \ ER >> Ng F P, e i cIoh' 3 NE PIAS 5 RS Yi ,. an 00092 oar _ ) ' 3 " &ea 4 2, T: Whdon ' NM F RH : E ; RnIe ERE2EL3 eh | Ja) Iga CAR of 2 fi on ga Teir .LFea t v fry 4s 2 i bg Ee pt wil B> ae 2 STEW SPREES vV0AY: x 4 EY [RE ::' A Br Toh = x ' , ! = : u ed Ean " > } HL ae KY [ a : ' J= jo 3A a 'e 43 "a Esa A 3 een = \ y 5 r--- p= 3 Po fed oR RE EAE : i= k NET) B pS pn 4 ''i Yl AH = os ) ID164771 ? 00033 65000974 : - " : cd [1 : i I$ i EL > et HK ca ay ' . + FERS / Ex es 1 va ; AN T 18. : Ca. ' [aa , > -- ~ !J 1 FnN i (=r [ V4 ih 3: -dail C0yo aan , | "nyay |SA, wg EE FES ea eee i 2 oe EID15Y : 0094 00975 E-- E -- = AN, "9 i1 \ 57.4 Es) ul ; ES EE EN Gaame. | SEER .= > E 5 BL TE = : ! % i RYE ne 31 / CT 2 Sie V3 wl rs ARE AAA "7. oe Ed .5 Eogevnew BEET iWE . Vig ' 00095 000976 0 0o5f) 8; { o:f RopeT s SRB R EEI LMaERR REY v FREE CB La Sa re i S SlLRx bl THE BRC TEASE % v. | LEP PA ROS AY EE oi| ow vii vy Sel F ve& u os, Co en :a " p= ; Sh b3i%al : i 00096 Eons # EE Fd v BH ma T : R -- ,: vs EES AERA 3 \ SE |YR Fd | : Cr 1 PUPSCe CE \ | |' Ls oF | lie hy PR PW KL 7 id K4 a / rr v Ed 5 Le Ro ES -- EE S ,, i 3 5 "- = 3 or en ! br : A) 7 oA 4 ARR od Te 40 PAL an, TTE OWERAI 7 a aNA y I eda A NT ARA n5 tky i4 y, / lifks yp 00097 isHTS . DE oF] .% v . g --EEEEE-------------- 7;7 SEERrAe PE. | 4 " 5h Bo 3id o'f Pp : 4 i *) ) ig dE 05 aA NR boie ki 0 + a EINSRNT: A AT 532 by | i Sw ko | % pe p27 4 gl : : er ii fa ER 4 54 a XdLsT/ B.. ih ial SG Pkt La Pra PrStY a po bp am 5 0098 ---- a )y p ye. i Ed 3 ; iai : pa y ) A LET 7 i Ld ey oS Lar !! > :) E FRCEi ' en, oo % oo y )' vF 5) y f oEaoI . r a . dh" ip 3S5Ehie ) , ji wl 87 t , {mo ,) ; " { y ) r +' 3 ` || kie i z ea, Gok ; Rc oy Ho ey = ', i a i _a 00099 RGS00098 E-- " E -------------------------- v' y re Ve , a : ') vi | > be ) { ' RE Ho S"T LW = oy ASLSR N EAP [i 00" y a. y=e Ahd 2 3 FI > a POST So ) ) ' ! ) ) 3 bE WE 3' V4e | %5 ke ; v| iE] iWi 4 f x /B 7% f , 2 % A | ad &A . | 0100 mr 'EE ) ' jo; ' a R " Nn 5 Rvee ) , i,ne bai i E a T u & / 2 A A 3 rat & te . x os ADR fl / 2 ia FMR Jl Sl Le ER 5 ow Cr Bias Ea a/ H FL z 1 Zz SP PP - 5GAiE "wdee) |Fl Py. - go NE i. AE . )0101 > E 0 e bi rrr E dit re dt 3 go bn sy ST E igh ; gi on | Bi :[5 guy + [1h i pao a H 12T 2 i > } 4 ai 8 ih i Eo] 3 A ~ #7 : ge i Foes 0) ALY , i r ya leill..ffg eayay | als 40 ls Hg a A RE Sn wor Tw DEE -- 5 . AE EA PRE RI Li ' 1P0O4RRi NAREFEo aNRaEeihDeE Re , aR Ed v%ek iSPEtiE eUtA aaE de aR iEeeSe SEEa REe s E > E FIAiE S oSoSePel hE E CB AAAS EE E a Ri 2 Vig . Shas BEE 2] OoEr I9 R oi 5 SREAVE e & X e Ve WL AR VR de Se pes 4 Li NRE - A:, SA CH SESW TSAi , 7 hy se EARL. i AR os CAE EE TE | ET & " DPA N he ; FL EDEERE 7 , we SY } | A ge a A tdi) ah REN 3oid ee Sor < 2 00103 ED1s1781 e ) *)3 org 1 3 EEL : ST 1; Ei Hi i Ee GL "EE E 4yo a ievyas ByALoLmnd i yi i ds ) 4 Nhae t Lt ih RR LS a es Try i. 5 ) rN RSS retr e = ) Rl PORE : ':' . y: p# oask Sy Gy REVSPe ful ya Hatin AER So (a '" i9 7 hg fie ace i Sa ; 8 i R dllEFiIi jNe E LEha0l ] i Lat - bE LEA [i v: 1 n BR i bE a RAE . a 100104 eee , ' ) ' TM Sil H 2 4! > ve OE &! 8. ooSli 1ENS?E 8 5 I } Y a vs CL ER REEL "YT Whigs pi : be ` A>PE EL)r Bas '' oe 4 1 4 y +t . #9 " ral a Prd >. ' st2 05 8d vi bot| 5 gid H | i : 4, E. e) ; ipa Li a x )00105 RC -- E ron ---- '' '' , i, : ed '," 4 4 NE; tw Ba be Re r EE Ls y i7 " nw PS 0 vig Fi Nr7 :} SEly > r2and CERd TBe)" P Se i ; ' >vi - y od a "or PA 5S C v W TR il rn % Ea wrr T 1 SN RR --_-- : AJ v.| . Ss . oy| ean 24 : = i 10106 5- '' ' ' Lg y > I Bs i A 44 [1:8 Ne Phat 3 > Tn i 00167-- iste ) ' ) ) 3) ' : ; ' ' ' '> ) : :: >' 9: 9" 81 2 . - a,. uw UF CT. BA oS 2 S@e ao pe F1ig, SIP }. > # FE ooo oF La27 Cuor bo : Aa ; as} is: Be mae Rd fra 3 yr AY RT SNBe TNE (Sg 22 | us A BL ba TN ieok Lo z oF- Z [ B= aes: PE eae 000108 _FID151786 ' '' Teconan: Farm Herd Health Incstgaion Cae Team Report 3 I Herd Investigation -- Name: `Wilbur Beef Catt~Daltee: Earl Tennant Address: Route 3 Box 17. Washingion, A8pri.l 1999 WV 2611 ' {Derived from interview of Me. Erl Tennant by Drs. Peer Moisan, Lisa Heller `and Robert Munson on 4/8/99] A.Historyfrom lastcalving season > : `NMuomnbthesrdoufricnogwswhiinchhercdo,ws19c9a8lvceadl:viAnlglseyeaasr.ons194908... Numberof calves born: 35 Numberolifvceows calved 35_or 81.5. Abortionu/Silborn in 1998: S=6_ O%thoefrccaolwvsinexgpopsredo.bleimsn 1998: None. Sick calves in 1998: Scours: Ab6o(Nodueatths) -Weak calves in 1998: Several : Other lisinenerdseeriwwneeuaingkwhaetndadunhreiadndgceanlvleasrginuernsindg1jp9eo9rii8on:dt.s.MosBitrtchalwveeisghwterweassllooww-ignrotwhiencgalavneds Ageat wbeanioinng1i9nn918998; 5mos... Numberofcalves weaned: 3o0% ofcows > ness inexwpeoasende:d c1al5v%es in 1998: calve(s5)bornin 1998 (fAalll caarlveetslwlenreusroldstahtiecwonewasgn.ing time. Afew B. Cows . Ocluinleasrsidnisceoawssei:nSo19m9e8c:a1tdceoiwhsavae dparpkereeaviesrn1we9he9dn8put i the hollodwuring the Skin `csruemcmker. disease: So The darker eves resolve me with lesions aroundth w e hen they arekept away from the coronarybands. Thought tobe " mil d" LDRiaeamsreprnihereasats:o:ryACdifosewewassces:oewes3mhclaoadwmsdeihaiarnrdchoealadrwadhnaseminpecnwaelepvaietsshteawrxeirs(eairn3th--it1i49s9"8w)eeks old. OTthrerediasetafsoemridneis1ne99a8st:eisCnow1s99a8n:dAclaulmvestsoceoewmsmfoorrecahlefaltschouyrs,than in eTareatdrclioctwsyeawris. Vaccinagtiroonusndinghaerrldicifno1r9w9o8r:msNo.ne. Brucellosis vaccinations are not done in WV. . Diagnost`iNconweo.rk(4peerafrosrmaegod,i12hebldooind 1s9a9m8p:lesInwcelruedetnaekcernoapnsdy oparibrleodosdesroalmopglyinwga:s Estimate{dinbcoodncylucsoinvdeitfioornbrsuccoerlelo(nBiCsSanrdanlgeepto1s-p9i)roofsicsows in 1998 calving season: "Same 1999. MayhahevenselightlybetBCtSethran 1999 Append: Herd Hess History 06 o. rm - oT "000100 9 9 RGS000990 ---------------------------------------------------------------------------------- .: Tennant Fam Herd Healt Investigation C. Feading stor Cate Team Report Feed to cows during calving season 1998 (Include minerals): Com silage. Ground Fcolrn with suf tast. eOract rs poundntahly/brome/KY31ec on * Feed to cesvoliwirgshtatilnyscwmioinrtegerdubsremficonorgmeccrowadlilduvhrwiiennaggtshcheeeoars.domnwineintasm1.e99r8 (bIonucnluddseomfinreraanlsp):e Soawmuaess Feed 0 matin cont Quine rain ccm 1998 neue minerals Tacs `mineral salt (TDN sald). Feed Test Resultsfor1998: None. D. ter : Other commneentts nfsord1e9c95e:tsSirneotmhSe18prsobeleemissnf1r9e8sttare1d98 sn,e1s98s, twe usIea1g0e88 ee 3 Ionher hhaoebepen1i6sa. machomsinaetdinss,poco3r0.u0eanted fseTienFifrostms hedi > m mouth. e Otherce ows (15-20) werecircling thendied, : PART I: 1999 A. History from current calving season ' FiSLresnotgtchvalovafinbg:roeetAdbicnoguitsegMasoadntcr119,9c81:91h99y9e99a:rAO lontg. 1998o . 199h lt s TE vosate * o Nuohfo m coowb sncaln ve s1eo5dr9sr oanftar,:19po5:arc2e_I&uO%ntoegfrwccioitwhnsogwerxspocsoeadn.ldalien19s99: 1 :. SiOctkhcerafilnesoni1en5w5s5o7weSancedoiuvesse 1999.Wekfecmaovfeatn l108s9:calNvoens,e ill nursing . `lcoowwesrothnapnastnuorrem;aalr.elCoosae.aBl riretfhaviweeleiytghhissnabruetaortohuernwdi3se5phoeualntdhsy ainnd1a9p99p.ear b Cour 9 : ODSIlaeolnnnettsesesidanecemowes in 1999: None . Lend ?* Apppoened: E: Hrd Ho cy 3 A -- 000110 107 wo~s0e0e09n9s1 ; en . Respiry disse: None ' enna Fam HrdHesovesigaion Cale Team Repon Other disease in 1999: Cows are healthy i so far. Owner notices tha1t `cowsaefairlythin : Treatments fordiseasein 1999: None. VDarccaingaotiNsoonnwseoirnkhpeerdrfionrm19e9d9:in Nheornd.e1 1999: Include necropsy or blood sampling: Owner estimated body condition score (BCS.range 1-9) of cows in 1998 breeding. : Clinica BCS ofcows average) on day of herdvist: 11.5 (Range BCS 2-7). . . C. Feeding History Fee to cows during calvin ssson 199 (nce mineral) Hrayaond unfdd . : Feed Feed t0oadcesoociww.nss1ida9nmu9wi8enntNseoBrsrbiielfn1aog9rg9ee8sceiaslohvninhg19s9ge9aschoni1mi9on9es9 n(mIienciluld)e minerals): Ground : Feed Tet Ressor 1999 None . 0. Or .' Other coBhimeamveenfwdteescrrfeoerapstu1er9dsc9hb9.aytso7eddN5aitone8:pI90t5e6%s.ceoesimuncsse tthhhaaetewpaertoeebrlfceprmooslmwduitthnhealccvaionbdwfshiinlaln>wdnacsa1vlh9aav9ure5lsseg ll ivr ee sickorpo srs There ar epsof eihbors 3 `with premacatlveus broren, for total of 6 calves . . . . . . . . *: Seni. tc sn ry 100 .. --_-- -------- eT 000: RGS000992  FResusfor: Tennant Lactating beef mooeL 3 : [RN atiou n trSuipglieedsMn nMEdAaRvrt eaaqluisrMeEMdReaelqys |paerenaiterence o [orieance TB Tw [pra egnancy [on 11 7 5 Reserves 05 intake and Pertormance predictions @@ |OMI predicted [|OrMeseintveeroemd-% predicted: 66% o [ADs wens 233 10105203% @ I[MNEP AAlloowwaabbliee GGaainn o |nemanecan 001117 002 : DiMffeearednc%e ras 7 1 -s 5 losid Ibid. obsues wisaa WP Agvoail oe =a2 aa2 PErnetde.reMdaFxorFaogreagIenIankteake WMEP AAlloowwaabblee iMiklk hBakyAsloowoastele1M6i5k sans MPgeReqg Difergeance Tor sow) wwowa) w 2 aa Gs 1122,00 sIibds 1i7a oowsss 13wn9 was @ [[pEiiteCciovneceNnOtFrarteiqounirsedand [Erecive OF spies Rumen Balances 2517 wweds WWeP ffrroomm ubanctdeerifaeed o[eFnien ration oie NE! 1a0i7 559 OMwCAULBOM MCAULE DM oDIePr oP Solute Protein oS blieettNeEgr prec. Ruminal pH 004617 MMCCAALLLLBBDOMM TFoattailnaNtEiConin(acttilo)n 540 Total Nbalance id%ofof rreqquuiicemensns Preeddiciteed MUN [|rRuemnineael N Balance. o3 S[Siuhmemenr 22 6 m79% [ a EA ioe RU4arteFiaoorncaoOgsteMination Oizo OM p< predicted Excision 3-< Neocron:CaFneacraly P excretion: FToetcaall TGrontaary < lm oCoede mn possen Ares F - 011277 Ssigoay CCCoaomssitiooonwuttt., AMMAPEsaatllolowoww.. mmmiiilllk.kk - -- _ 000112 772 g9aa 8G%i OcpM 2S0e%r coiu"t ar omga 07.0100 M*OeMal 01X% Maio 0012 bbssmnaaiiad 370.32 gbraadsd 380.31 ggnraaisa 171522475SSSoiwtowa 109 eotstrso 765000993 E-- E -- . . . . . s plgtasssssseenssy : ER . 3 2, 188888388888288(8 2 3is I= 8 Eii 5+ 3,1|858388828883888288888888838888|F 2g [Roeose 3= 1! 1 . Hl i : =i gl! eccecccceccccd s| as 5 |sE3i32:f3 - i| rccccceccccccs [=FREaErE 2 2: EI #EMeELLEEEEEERHESREFlceiisess || es 3i I3 t 3es: w i. gli 2S2z%EEi,iZs.s. 2<: | BpEI3aZSi,lns3ez5d2 EER 5H8IiLfcFdEzE rraE rrrE edyEsElbRsEsBaes B* h 000113 &< no -- EID151791 -- ooo -------- . Genera Factors S JFNoaurmmseNraimne:grou TUeincntaatnitng1 bet cow Days to feed 365 nis est } Engns :eo FiFeeeeddPELinotesrsyesBasis LBHeadDay s0n 1% 5Asfryedmater Animal FacFtieorNsame s Grace Chcases5tSueanneiocnio FALSE Roma Type 0 Labectcoi w(recnitedgmk o ASgoe 702 cMoonnths. Ld `BBordeyedWeTiygphet Y900 Lsbeer wary os MaCStroeunerddeionWgneSSicgyohsrtetm 90032 Ltbevin gvZatepshcyross s DDOaaamrssbrmpeaaettdeerrnmaall v1f 7o1 NA + AHhenrgeeufsoerd 2. DOaayrssPSraeggenaCnatving Coetons 0108 vowass ow Sootyover : RiiokknPFgartowddauarctrdiyAo)vne(r3aagme)(cain) c5ot1s5 reacte7d0vaves 000% 3 . MREiorllpkaeiPcrvioeetdeMCiionkl(ldPaBrirroyi)nnaW0se6sgu0hm)te CP s02t1%s 0T35e83 ManagemeantnFaectors 3} one . Dianlty ppaassttuorre amlalsoswance SchonPressure forgo 1847a omowMpacotew 0 155cie . PFeeacaainng FWrtenqveedncy 22 ooirmapeseoFreadnOssaoipyorte2-THR . EnvironmCeWanltdaflISmFpaplceatenotnresd o51 1=no2=yes mon : PPCrrreoovvinoo:sussTTeemmppeerraattuurree 24000 %DDeeggrreeeeFss S _ nsa;szarnu .=. : - 000114 RG50c0ot0s9i9:5: ---- . . * . CSuiraremnEtrRpHesrs ?30 %enozeres s NtriighatCpooling 2i1 a1ep=i nzo-anvges.nei2geh=ktcwooiinhg Horcoat T Tent anovers oCamttSPcaantring (Heat Stress) 1setenlo.2i=roapiesshsaolirowio.o3n=nopen mast bd In summer, atte are exposed to 12 1=No dec sunigh, 2=diectsunl 2s Animal AdTRoeicmtssalsPpTaeomnmpiseoraanntsiure (optional) 1011.58o DegreeFs maparany RDeacroofrsosb ponjcaohannges 65633 glbeoiorter an tng aga) FesdbunkMSCuahnaeDsecpntistis 0 incnes aves stance btwesn cow fe : TogGroSwunn Surace } vn 2s Aagerast 1ostncalmviengal prio 24 months. . : rosez ["-- ee o00125-- ares: Res000996 o : Resistor Tennant Lactating bee Mover 2 12nsm0 s [Rafion Nutrients Supplied aMnEdARveaqlulirMedERead Heald Micali [T|poearcentaiterence Bn @ P[reHganamnecyrs T s T [|ouanctaion 8 7 reserves o intake and performance Predictions DMifeearlence 100%5 55 o0 MP Agvdail MPgaRead Differoednce 3 7ame)s 5a038 EC0 so s1o474 w 2 l 123 0 nf IDM predicted [[o|mreewnitveeorme%d predicted: 85% 239 Ibsid 120003% Ibid PErnetde.reMdaFxorFaogreagIentIankteake [Target ADG wiconceptus 126 sia : IIMMEPAAlllloowwaabbllee GGaainn o [ican 001815 asiisa 002 Ibsid MMEP AAllloowwaabbilee MMiilkk AA Allowable Mik Daystogain 1 CS : lEleetctCiovnecNenOtFrarteiqouinrsedand Rumen Batancespr MP from bacteria I[NpDeFrimneration [ene T5141% MDMC.AL 30M DDiIePt cp 072 MCAULBDM Soluble Protein li[eoterEnemg 9 [pred Romnaien 00.7414 MMCCAAUULLBEOOMM FToattailnNrEatCionin(rtaailo:n 545 Total Nbalance : Ruminal N Baiance |PemEa 0ad%of eequnrements Br UPrreedaicctoesdt MUN % Forage in raion 3 [pirmienmoasu er 1s3i8s0 rianm ROaMtiinovnaOiMn OMI [predicted Excretion : Nexcretion: UFieicnaalry Total P excretion: Fecal UTortianlary. 11220 0 Isbisidd 118337 IIobsisd 3268 Iosid 636 ga 8670%% coPm 2261%% ocpm as2s oodm 05232% OMeMals o1a5n Xuan 00.21 albnsahiagi 403.24 Igbasiaaid "0492 gonnad o9 C [lFoootmooayCos sts me 9 Aoeeuudis F 011277 Ssoawy CCCooosssvTtaouuvt.t. AWMAPEaaallllooowww,.. mimiilkkk 073257 oSionw 076 siom "sz . -- eww 000116 Ra8000997 . . s3* I5 n6jR9gRsRmssssssssnsy8 : 4. 38%88888888338f 2 : ha! 233 53|585833533383838 8 ban s 2 Hl - , ii censees :Eoi Ei a3 gl| eccccccccccccs F8$:512 32 gl; occccecccncccd Er5e5s5 | gi 2,81335828805808833333R53Es8M8R0[Rf3f ' 3i ' 3 3 15 3 BE33 segs "F 2 IiEeEsE 2{ 3 '' f: e, i z CLE Es ' 25 eciaiilg,8 : | [edeSaSiZse ' 53 SBtCiffrsr3r8riraarardeaddysgalalsflliEBidsEeaessds vY . o 000117 -g & "5 eos Ras000998 Results for: . Tennant MDrOyDpErLegna3nt [RraotieonNutrientsSuppliedaMnMEdeRAaevlEqasauhirMeEdtResaasd Praergineannacnyca Cacaion Ti ET3 4o [(cRaeisnerves i os Ocifaotresn5ce A5 33 : USTIRNoGcMTmIAoxnImSumorvogan1c21e15199 MP A0VS Co MP26Rwe=gd Oiforpehnc 3=20 2 EeCo s o2s 2is =ony |IRnooetnualllkaepetraeerdniOdecWtPIesedrfporromciacntcee:Pr5e3di%ctions iVTaeErAgAelltoowAwaDabbOlleewiaGctaoiinnncepus lC[hoAonkccApelropewtnastiweeiGgahin8 Tissue "11a50o35n howos 012343 ihbasd a1s5s2 bleod asSt shadsy PEOnrMteeprMreeaddxFiocFrtoeardgaeghemaisIene)ks MMEPAAlloowwaabblle Miikk DxaAylslloowlabmlsee1MCiSk 112200 bseaa 0000 bsod 00 hea |DNf[CifDeratFoecticnvneetoNNcOOnFFesruonpqpultrieeasdrndaRutmeinBaolanncses1531%7 ib0ses oie we MDWiEPeftfcpom ubancdteerifaeed sw167r2% gbgauu oooiiieinNNeee:gm 001660797MMCCACALLALLSBSDOOMMM STOoIauFtileNPErCottherinaon STonv oocepw 041 MCALLBON Fat nration ota av om Prec. Fuminpah se Tota balance 3 IFPRiuosmttinBmaalii,nNgsaAtxa:ncMeET ond mii A Lv F Zurm 9/9 %roefquirements vi reewp RP%UarrteeFdoaoincrcatoogenued MinUrNation Dltasain ow 0T2i0% MOauti s1on xan [PredictedExcretion Noxon: GFneacray 0012 bbaunndaa excretion: FTooctoa Gnary 2000383goonnnaddaa Ration Govts Tout Coe WE slew 511 ona RAS [CCoosouana.y nik proucion mn0.17 Ssiodaty CCoostsotwtAMXPaalllooww..mmiki_l__k ~~ N#NAA _ SSiioownt i Pppevds I 000118 ns S---- RGS000998.01  --_-- . . : 3 fEo p l5 iagsRaEgesRsEsszansSa3e5e3y pETTTTEeER | c i 2|8. 88885888333883] 2 S i . 33 s 5+ 3 =iv8%s8c8s8s8s8a3c8d8s8l8d3n3g) 2 F [FeEs 3= ! i ccccccccccec & g 21 3 38 ' gl; ecccccccacccce H$E8HE1 i 3:5 ; : ht lmcccccccccacee REE < 3 , [a 2,41|8%93-8388583835333253332(s3[E 3/3fE3] 3833 bog, is ) ) giz sg fas ))) i:Po rl CEi$1 ds ,) 2FH E55:23E E08 isSIeExEEsEEr5SxErRsESC3RuExE|RRE[RE[CABoN3EeEP 53e5Es5sE2 ) ) ) -- . ] 000119 - ; ne xos0e0r0s9t9e5n ' ' ' ' ' General FaFcatromrsName Tennant Diet Ory pregrantcon USIWS MAX) am ' DNauymbsetorfienegdroup: 1 Fotace PREOICTWY 365 EQuaTien ' UNniOtFs capacity 11 E%nogfisBhW v' FMeiekdPrEinctery Basis LB/Head/Day so1 wAsFed Feed Losses 0% % dy mater '? Animal FacFtioersN,ame Cicasest5udytest ' AGnriamdael Type 3SEOnrtyeCroflwo FALSE ' SAegxe 702 CMoownths : BBroedeydWTeyipghet 5001 LBbeel Marty ' CaotnucrieloWneiSgchotre 200 Wb 3 =v -5=v.feshy Breeding System 2 2way cross ' DDaanmsbrmeaetdemal 171 #NA 1 AHenrgeufsord ' Dams paternal 1178 17 Hereford ' Days Pregnant 24108 Days ' DLaacytsatiSoinnc#e Caiing 3640 Doa=sodrhreeyOrW o Roting Herd Average (dai) Mik Production (6a) ow 45.406 Predicte1d2values Mik Mi FPartotdeianin(d)airy) assume CP 3730%% asse ' Relative Mil Prod (beef) Expected CalfBinhWeight 11s a5 Lo 18653 Managem`eangtdiFiavcetors 1 none DGraalzyinpgasUtunrieSazleowance 0.000 AOcMteisbPOMI * ISneitliealctpoans-tPurreesmsausrse. for growthimilc 18470 1b15D5Mciaaclree FFeeeeddiinngg MFreetqhuoedncy 22 #to=ffoTriagmeeBsgrFaeidnsDeapiayrate 2=TMR > EnvironmeCnatlafliFmpalcatnotresd 01 1=no2=yes ' WiPnredviSoupseeTedmperature 405 mDpehgrees CPurrerveinotusTReHmperature 2300 %DegreeFs ' Page 1271809"8r125 PM 9. ---------------------- 000120 _ episirse RGS001000  Ld ' CCureunt rent RH Storm Exposure: 30 1 %1=n02yes HaNiigrhDteCpotolhing 11in1=none 2=withnightcooling Hide HairCoat 2 1ethin 2=avg3=thick 1 1200 mud2=5ome mudon lowerb OCatMtlSecPaalnetring (Heat Stress) 1 1 91%=(n101.02==r4a1p0i%d;sh9a0l=lo-w1,03%=)open mout : IRnecstuamlmTeerm.pecraattteuraere(oepxtpioonsaeld) to 12. 1015 1=No drect Degree7s sunlight, 2=girect surg Animal Activity Functions Time spent standing 18o ts per day DNiustmabnecrewofalbokdeyd positon cFhiaatnges 65626 (fyeientgd down and standing again) 3 clo Stoped feetid inches eedbunk Characteristics Bunklevel 6 inches(distancebetweencowfloor Target GrBouwnnkSurface 1 see codes 4 AHgeeradlCa1lsvtincaglIvnitnegrval 2146 months. months . . , , ) . ' '' Page 12115599 1:16 PM ug ,z -- Eoisi799 000121 RGS001001 I-- --e-- Resuitsfor: a : o [r[teicaonmamrtnrence S bfrnoenm ole Tennant Drypregnant MODEL # SUR aa tee Winey Tn7% Pod Ouonse5 on %i H3 1215/88 USING MAMIMUM DRY MATTER INTAKE (OMI) rYle MPAvail vSSoe0sr0 Siono MPReqd Difference| Sor Sr 15034 w T s m w Sm 9 [I(OI[onwrtatoskeemardanceidiPneedrfporerdmiacntcse:Pr1ed0i0c%tions 111080505% hbeead PoErwrdevedidaiFtoFeaodgreCghieavsneeike Hi roe on 205wenceptis 016%8 boIbsid WE Ato-- wati ik 8 |[pHAllaowmablie Gdain 2i1g7 iosid MAP lAlolowwabele iMikk P [Comepts weins Tse Sam eee [J t[[EertetctcivGe raNNoOernFmedocssoeesanmd aamtenoganinserr37gndaa WWoe foommuancitegrsfect > [=Sh o5i%r oWMoEeAaLeLBoOmM SBoeFurtcsr Protein H 3 pe oeSiar ot GGo65i55e MVGOAARBS DOMW TFTooortaarNebeann rcfaoeion 0 [[aemEminima msaatounces i Trem ad%ofrequirements Prreeddicitcedted MUN ReFoornagoeo nan S Emmi G2 Susnpant own : [msn mien Mast Sig TSoo :> [--T-- Go y b } ff oEmsporem wR CoCCnSTlHEonISWAEEnTSodoNowwmil 3 Awd ' 1d20o1s 00 wd 0f0resina " dfoakar oer JmTooekoonwm B30 Sw3oexnatn 0o523hhoaannnadiaas 525203gognnnaadtaas R_W__OmuAR__ OSom ny ' even 000122 RGS001002 TE ------------------------ s: E5g8 B3gE-ESSSL5L5E3RsLsLsLsLnLcLIaf 32) E+E. e88v8388888888888[3IR 5 : ef 23% 5L283.i188v858c80858c8s8s8a8a8d3a8a8fRg| 322 [[2a8o%a = o 2 " Sloscccccccccene | & 3 2 3 5, # &| at 3 gly ecsecceccccecd 5B5o%i :3 & i E323 3 . li aecoceceacecd | F EEE SE 2$, 21083%238538538383833333382333[53/REl3l[g = La gizz 3 g re 3 Ea EYER F8 EEiiLs g| i : [P1a 3:i5, 245 gE5i2,, g s3858ds 5 i218 isn erdeel EER ES 2 SScEliiBg5d5a5c5a5s5a5n5o5a5d5aa5llpogaslzeuesss 120 2o. oo Eo151801 000123 RGS001003 . _-- - Teanant Farm Herd Heslh Investigation - - 3- * 2 2 2 2 2 2 2 2 2 2 2 . o oS 2 [ o o. _---- - Catle Team Report C-- blank page) 000128 masooioos = x amen) ) . XY NEW BOLTON CENTER FINAL REPORT LaUbniovreartsiotryyooffPLeanrngsyelvAanniimaa,lNPeatwhBoollotgoynaCnednter Ascacessssisoin on NNo.:Uo P 350x 7797 Por: 1 T3o8x2iWco.loSgiryeet Road Submiter: Dr.PerryHabecker KePhnonneet:t(6S1q0u)ar4e4,4-P5A50019F3a4x8: (610) 258110 Report Address, Dry Run Investi-_ gation Team CCC aasseeCToroarcdkiinnas gt#o:r:NPoepa.rLyHebecker, VMD Report Date: 71599 TAD): Species: Bovine Production type: Bree: Sex F Agiely AnimaLD. #37 Sample JFeETex Date obtained: Reference Labs: mw 4 Adut OFens Olwesile OUnknown HISTORY SUMMARY: "led and ecropsiedforDr.Lisa Heller on June 10, 1999. Tissues aso submitted f toxicology. DIAGNOSIS: Entre lesionsofminimal significance. COMMENTS: iTshaesogcasitartoeindtewsittihnaalciedoossiinsodpuheitloiesxacteissbiuvteedcatrobophryevdiroautse inndgesctuirorne.nt bouts of endoprasiism. Epithelial abscessation in the forstomachs. LABORATORY FINDINGS: H1)IHSeTaOr,P2ApTieHcOesL:OGMiYniEmXaAl,MIfoNcAalTIlyOmNp:hocytic myocardiis focal Sacocyst spp. 32)) LLuinvge.r22p,ipeiceecess:NNoorrmmaall 5) SKpildeneeny:: NNoorrmmaall 7) ATedarse:naNl,or2mpaileces: Normal 89)21L0y)mpShmanloldien,e2stpcicnees,:pNicoersm:alMucosa-moderaely sever, diffuse osinophils; focal occidion parasite. 1112)) OAmbasoumm:aE2spipulieemlciesu,:m-sMbusccoesssae-si,lmdo,demuclaiefloycaslevceores,inaocpuhtiel,imaulifocal. 13) Reticulum: Epitheliume-abscesse, mid, acu, mulifocal; unicamuscularis granuloma,mininal, focal with intalsionlaanlt | "eTihgynmbuodsy:. Normal PerrLy. Habecker, VMD 000125 DUP 004 V * Photo Photograph Legend # T-41 Catneum1b-e4r1(,plraescpeedctfiovlelloyw.inEgaecxhapmihnoattoinoun)mbofetrhceocrroews,pbounldls,otrosttheeeeraarntdag 2 `Cowth#e4a2n:imTahleniunmdibveirduianlTcaobwlew1hiocfhtheisscraeppeordt.the run and was therefore not 43 car tagged or examined. Livestock in corral. The 42 adult cattle (39 cows, 2 bulls, 1 steer) and 12 tchaelvleastewaefrteehmeolodnionfthAipsriclor7r,al19f9or9.several hours prior to examination in "4 45 Cow #25: Comeal scar Cow #26: Comeal opacity 46 47 CCooww ##3370:: CCoommeeaall socpaarcity 48 49 Cow #40: Comeal opacity `Cow # 22: Mass (12 cm diameter), prescapular, subcutaneous, neck, right. 50 CowBr#o2w2n:-rSecadlpfelulidpucnocnttuernetsadnrdaidnreadi.nage of mass during examination. s1 Cowha#i2r2w:itMhainnutahel ceyxsptl.orDaitaigonnoosficsyswtaisc"ceapviidteyrrmeavleailnecdluasiloanrgceysmta"sosof fred sos Cowsp#on31t:anTeoonugsuoeriwgiitnhwshpiocthtywmaeslaonfonsoiss.igTnhiifsicwaancseatno ihnecriddehnetaallthf.inding - of no pathological significance. seen here, is normal Melanosisofepidermal tissues, as 53 Cow # 18: Mammary gland lump `most likely be an abscess. adjacent to teat. This was considered to 54 Groupofcattle, owned adjacent property. by a neighbor of Mr. Tennant, grazing on an 55 DeerMrc.arTceansnsaonntTaenndnaDrn.tSpyrkoepesr,twy.ithOinne5o0f0tfhereetoefdteehreTcaerncnaasnsetsboabsmerovned by. 56 `TenAnparnitlb8a,r19a9n9.d bAalrlnytahrrdeeaadpjapceeanrtedtotothheacvoerrdailedwhienrtehethpeasctatftelew months. 57 GrazeixnagmipnaasttiuorensalwoenrgetchoendDurcyteRdu.n Creek between the landfill site and the 8 `Tennant bar. Grazing pasture along the Dry Run Creek between the landfill ste and the 59 Tennant ban, Group of 16 cow skulls (photo supplied by Mr. Tennant) 60 `Worn incisors Tennant). of an unidentified cow, bull, orsteer (photo supplied by Mr. DRAFT 07/30/99 000126 DUP 028 ' x : Photo Photograph Legend (continued) ceB-------------------------------------- 61 Neck alopecia in an unidentified animal (photo suppliedby Mr. Tennant). 62 Nec`kThaelocpatetclieatienaamncuonnisdiednetriefidetdhiasnimmoaslt(lpihkoeltyodsuucpptloielidceb.y Mr. Tennant). 6 `The cattle team considered this Nose with spotty melanosis (photo most likely duc supplied by Mr. to lice. Tennant). The catlle 6 team considered this pigmentation tobe normal. Nose with diffuse melanosis (photo supplied by Mr. Tennant). The cattle 65 team considered this pigmentation to be normal Hard palate with spotty melanosis (photo supplied by Mr. Tennant). The 66 Cattclaetttleeatme(aCmTc)onasniddesrteeedrithnigscpoimgmmietntteaeti(oSnCt)ombeemnboerrmsala.t the Tennant PFoaprpmednugrain(gCTt:hevAeptreirlin7a-r8y t1o9x9ic9olsiotgeisvti)s,it.Dr.FrRoombelrettMtuonrsigohnt:(DCrT.:Robert vcleitneirciinaanr/ypactlhionliocgiiasnt));,DSra.rPaehteCrasMpoairsa(nSC(:CTE:PvAetOenr-iSnacreyne Coordinator), (DrC.T:PevrertyerHianbareyckcelirni(cCiTan:),veDtre.riMniacrhyapealthHoloomgiest()S,CD:r.USLiFsWaSD,avis-Heller vEentveirrionnarmyenptaatlhoRleogsipsotn/soexiTceolaomg)i.st;Nottaksihngowpni:ctuDrre.);GDrre.gRSaylkpehsS(taChTl: (SC: :- DuPont biologist; not present) toxicologist; not present). and Dr. Rudolph Valentine (SC: DuPont -_-- -- 000127 DUP 029 [ENN XER ee EA Nn are r it Gls ailing 5 FRA IE Toe, N BV . Cit BE) 3 i i os Ts ig) 5 Tid LE 7 ` i El 5 Fa od aiery Bl 5 5 E dl 2kg Gm ESS qd YSI LLLiL f= AE a 2 rea bei ss B ie i i i SCI RENCGtp TE x i Ar N fi = i S KWL B e NE, iTTor esWo eix) To THAT 3-- 4 o on FEE TURK ie HN Pu > 3 0128 DUP 030 Se ES EE a LER +h i EER Ee Em a: a %8 ns ;~~ RO oO PY al, <i, BE PCS Noe 17 et : i ta eoF rE Cnn rs pn ] Bo eat os ad 2 Bi a k'. b DUP 031 B Eb EC ae IC S n E EEA Re 3 E Bte e a @iR eI aa Som : ag" Fel I ai & yo - = b 2% . F) 5 20dd =a Soe f : bE > Fe Je Ty"| = A : i ED 1s) = EE. Vg gE S Hercagae neSAarE =i Ec and Pata Pa = a" | JE )0130 fd A DUP 032 tend 3% 2 le DT A E| PE Eat toa ; TRE Fh " Xx. oe Jr f Fohoe oy eB ov IEgr. || d Um PR os rf Hf : Fr k- Gy i mi E T 5 )01.31 DUP 033 HE fi 2 Ea re I 4 EL aa = 2 Ea 4p EE Ee 2. aE si, 5 E a Bs aey % . oy ow 5 Pbath A)cy - 2 ia Fl, SSoEEp EEE RE s TY~ i BER A St MN et ETSRE Pee, i r Ere emeee oo rr PRY Clhialdote w me ri 3" p a 4 :4 L = BEC4: |i : (CS b2s a0 = CaEEdm . REk J N os " \ = 10132 i DUP 034 ph ROT Sn 8 I : CE ANE SER 2 Fi AAS CE hie Wey 4 oy a a TSENG, TE A Sls ie `| eeGs. Bc oy 4 > SSE ' Pn sr SnSS i od SE SREY Cae acggolaor . i WEN 0 al oY wz ik a -- = =] iENu 5 a Ed SEER, | EE FS = % \ oi LN, ; i i EN? / Be yx = Jit) RY Es 4 7 aHE 6 i gl ip h. sote 7 a Fo] d EY Exot a 0133 DUP 035 Liar BARES army NTs NR pee eed, | mWeOestem r ee o on li.lf Sa E ole - h ee a aatl ae pc RE E sghe ee RE) gl A ESai al d r SR (slLif Sa ey: Za RN - pA 13 Er NSE 7 PR Eo +3 1 19 Ftiy ow pa" = Ral hd i = 4 No BFES ypa h mlaeelaS go ' gp Bhangol KE : Sages Br % isSC CS be Sa SEAR Be a 4 n pi LR me NR , CY Cp EE he EE Wf RA A bs 3 - I- 5 - ww . -- ? 4 ry i a. Fa 0134 DUP 036 en ST CN TEea rraaa aaa Se a i Ta rt Vi ro Tg ems a al5 5 4. PYBR Ea dphR=Y. ' iRR OY Py a a A- : ns " u VERE [4 ik A ped ; = h= Tay ORE od { hE 2etretilll > = re ey 2 2; Un om CE NE Ee Bo i -" 3 A= Ba tei rt HERa E E h_ei 4 i 0135 N DUP 037 PE Sg =~ eai cpe ad SI PE EY <n p2 aillEy EO A= of = Fit Cai i QE ee r 5 . Blmat 3 Hn Eo ---, es Si AEE ke od Ee 2 ead = WE i{ Bs { E Frag DLHRATE rag FG Cad a L ? ha ! i" is - v 3 ga & 3 LO a: t {2 === * pCBior SEpe i Ferra 0136 a i= i DUP 038 3 ; fise aiam NE SoSSta JEP = wd ras wo as) FEES TR 1} ; Re ay T= fo] = Sl a we SN a 2 ; Sarat . Soe EL : Sate any ead gS p00 "PLN ode." 1\ 8 a LAS Cy iT Lan \; \, EE ed ranean i a BE 3 DUP 039 a ih . ay be LT : a| RR mn. =] r ELE e Sr. SNE LE I Eg oL T r : 43 EN - ( oe a or ne a Rogi; e4 ,ET: a i ; ored BFS a> J yO EY T2R=E i CINE IR SR promos Wor CTT Vie 2 eh Snr eu BLD Ye hE dien e i 8i EarE CRE -o+a [hia fa KR k] ! "wim # 0138 B DUP 040 i T; b 2 AD RA a Jfiai,s : = : BEEN & . bi 0 y Bue 7 5 TE mend $3A LFE gh roll &tT BJrga) i&Ey EEL EF. | = May: EEE ns ay _ HERE 3 CR it fD v YN 5 eDs y ol Lod BRR eR A SEE TRB ead 5 bh %4 Bb | ee 0 LIS ry N gi Ee id am Na ee al ENG iaiid t. Fe ` a ge i Y FLW, P { 0139 1 DUP 041 LB 4-10 yg 5 F y EROS Fe os Hikes g B 0 mrem------ pit | 5 : > , DUP 042 Pa i i& : Lv OE LTYT oe - ; Bangi. (--Gren am | ars i 2 NW EB nd wr | i b. TR Rp 5 Rr Boe CE : pps a vo a Re Bo RE Ate - BY 7 BnNb. 0141 DUP 043 SH REAR REN w= ~ Eas of 4 ran ERle enaPYREes Baga SP SE BE NY > i, ;x A TE DL ARTE SE rm I bol Ri a Hb PE EAE 1 SAREE EEE any ]4 = fy Vo Ea Eg Bi SE Ra= m F lg =5Can a = SA Ne ad a JAS REE sy mi RR Li iis hd : iA ALINE TH =. Rains (oS ey ; t fe hEi E 7.or =2 S Rar s yor 5 EE Lr is pi = i Sh Res _ TR i % 2 )0142 i DUP 044 Cy YEE Fo Ba =N A i ww rey TR : Th b p 2 4 i= 37 od + 5 7a or A 5E 8 3 - = rani iL Ee en) ZX . = : = FEaE EYhe SEopmess Ei CTE SA EE i at is 7 i nd of 0143 . 3 DUP 045 AN TONORR SE RN ES RT > Ao ag Ca : o B ta e R 5a 2= ~ ge =a = jeu= $700 mn LEER | hi i i wFEkES S SRnE Sd 0 RN AE GE. Eh FR a EE Fa ean Ab byl rte AESJf 4 x Scat i TA A 3 a we tf ; g 9om ATES E >gio" s v 1 id &jWoa] 2NEme TP 8 i 0144 q DUP 046 ZEN RAT a | =~ E4 RbeR * E4E is RSvL3 : & dS Cap a TOE z Ea Eis E ER N: RY CRO pnt mcs. : SCR = LH 4 : pEsPR, * Se = ( g_ etJ N 3BEaakN - 2die WHPEPE, SEM=EL 4 i3 SpEy LEad ay LNHeeSR SE FE 4) iy & Ld ee r SEo |A=SN =Raym RE.) = Tapo ; Eo 0 Cia jd i i TTR SN Ai 0145 . 4 DUP 047 ER EH OE 3 ; 9 = LRE BNE 3 hs or ee 2 a 3a J 1A 2 SAN. i # i id ei i TT ap p 4 ait ae: wr Sa Tn & IE OR 4 EO DET i" WS +8 | ed 2I naling 5 . = il ad DUP 048 ERSTE Ema rea SEE oer SE: TTR A LE oS maa n GS 7 Ce Sa Ea ry CIN Na --" SwnE yo) hl EY Ti AN TN = TO TC EELTae $ i- . be ARNE ER TE ures ed by 19 eT Eh cg SE Fe a ) DUP 049 pas LB Oe BE NW aE r Ba ay iad a2 i WrYe. CE E HEeFdE n eaR rs.E o SE l RESEE EN 3 tboesaREsES pa =FrSaryeXyE TERNEE I EF hMeaNn PE Catal BIR CR ee i 55 z ;; & = 5z 0148 && 2 i DUP 050 Wd 75 7 $7 IER) - in Pith i oy mv, ; : gd 5 3) iil 5 Bet asks JINRY Ny ibis, a iB 0 " or go x ee, See Eran. HlYo. oaiu i R "E aE i OOCCRESHE. , oontaki llr oe i EL i a No I wu Ee ; he BE A |-- EWyT T{ enT d FI alr : i git Mei i a ; DUP 051 x5 _. a Ps BY RN NE 5) =0 ER ; , 774% 2 LS. So 1 2 amy 2 4 ji ET, TR a SIME 77 SIESoxir E32 BAY SRG 3 : E ) 4 biel ay wy 1 PSeni 3 5 n gh AyECep.iAv2 Rcia RIE.fy gd yi J a-7 Ey SgERa + A; p= DUP 052 D 7 Sa ~ rz ot : Pirie SW] on ak EoRd LT C--" Biai = = pa ho h-: " : i % i a ESR, EN hi fe OEE Pe EE 0 ua RC So i : NE 7 1a) DAR REhS TS 22 te grASagTak eei >" A BSHe rey R{TENE ERIN. ie, ETON ' UMYEm i bd i iN 7 #7 Fa - 1 3~ HN Af 4 es Fa og ere. SO | Ty 3 x Yo 3 he 8 SP Tin de EN FET Vy aed Raipes ih Vo SC 0 REE - RR SeOR men,Tec i AET REA 0151 DUP 053 : En JR FTAA ciE 5i =a i 40) Syo e I2 4 eLa) TE SH row ii Bl0 a TRE Ch LR FS 8 I RCE < CL SN is 3 LEE lg TE = RE 23 be HS LE A CO Re TE at z Eo a a i 5 Rix oN 22 iPSi fl )0152 DUP 054 d oh Li abd A ~ Te li Ck NJ SRN 2 ny"RSA=hs ad JRE l TR s {AoAaZSGa SF 4 oh aE Ar v "29 AY i R NP EnEsXa T oli i" Fo2. : Li i: ; ]a =A SL A IRN EHEo, cS YY G.-C A: "LfAeY no RC EN LI on oFa oo oH e a 10153 DUP 055 EA 2 = Cg R g imaRSO E is! BT i er J oT Se a : iE i osBhSraine er " NC ] RAN N5gfi: 8 NWIHIANE> ! i l FLEdET SREk GENERE |13ap i A. BI ilShe esstoBtC RR cp aolh. oe ie NL J EST1OP1NY)E 4bEiEda I sa rga&Spoan ims| i077GR Paes S RI SE e N hyaE58 er3 . VBeeSOE aBdeTaerCav h (G e e 00154 DUP 056 fi Wa i ACESS va TE DRE bI sea fa Tledd ly Sia ca AG LE RlS euneeE sShd ey oSEdGeisg R nye R e R)EF Bye ill'Sl Sahe Bl rOA ee WeE ne STeig 1 G SenoBW. Wg TE at BN f:od eR So Jee HPiORa iii vTis ALa E lesAE) N i a Te Toe 1 Ap Ere : faiFposa R lge erSa eZStaiH nengnS e hEeae tteee =lay i ' ua Nie / a EIRNN{7 Sn oAEn E 5 a0VR L OR oa SHAN vy 5 Wee z HERO 3 Tat 1M dfRa Esyooh mSa e Ne e rTE td HE fed), fruits =aAu 2/4 A i Fil Smee 00155 DUP 057 # \ LE EL Tae B2d APEREEETILC aee Ta aS aR f EBRYTRna a mee RSean e EGR BE diester EGea SE re SEe Ee Rh aeR NEEt R E i AR e E Eh EasdseLSe R a Lon FBo e i/ aCd G5 SEATERYR eanGa, A SNN T aa 2R0e he TeTS ee 7 Zi eT, WrlFlle cE > ol I Fle OR nA oe ol i t hl ------ 1 i, ie a 3 r : i 3 Eo 7 i ede 0156 DUP 058 EFah os y i 4 i PNA : ; RIS F re= 3 E RE3 4 &: Po ry j; % aalr : J -4 o "6dLOSYYE . R Wa E EETaLles ToL i: Loa = 2cdis i err ve : > . ie HE oNhUD on, Ag 7S10A8R x ge a 7 >i ac Nal Ra TY alt : Ri Ca 8% 0157 i DUP 059 ET Hg E Sse: T RTT A ; 2 BS we i en OR eal Hy, Aid 8 RTE i EEE > i 0158 La DUP 060 a Re, TY i dee. RL HE 2B Es SR Ne k4 whCad 3 To hel Py i 0159 Be DUP 061 < : . 4 Ea hn Po In BA pee 3 r=by2 H: a w ry z n- XLPhl. r rea4 o-o Fdyoa i pr CL ERO PE LY l bTo l TbEy iin MaEdEPRR. Wy TA oY ER dt lic is he A700 ah S ee e !j Eo te E m LaYEE 5 EH, NNR Pa os -A E A AN tl | -- CF 2 fe 7 AE B=t her T henE eA n T si = oi sa =SSE UsEsSSc# & 0180 DUP 062 AR226 _ 14 TH B 000161 - _. . DRAPT REPORT VASHINGTON, WDOROYD RCOONUNcTRYE,EKWEST VIRGINIA NOVEMBER 1997 EN tan? PREPARED BY: EnHvairroknmD.entsaplrenRgeesrp,onsPeh.DT.eam ap Ur8: Fish & WildlMiifcehaSeelrvTi.ceH/oZrnnvei,roPnhm.epn.tal Response Tean IN CONJUNCTION WrTH: HaRrEkACH/uEsRtTon OffFiacveiroofnmEemnetraglenRceysp&onRseemeTdeiaaml cReenstpeornse 069. 0 000162 USEPA 6861 . USFW 0579 TAOFB COL NTEE NTS LSTORFIGURES o.oo SECTIONI. RTEICKHSNCICRAELRANPPROLACoH SUvMMeARYnOF FIELD EFFORTRESULTSAND PRELOMENARY 10 NLiTROGDEsTOmN L1.. LL 20 M1E2THODsOuLOmGYm.a..............L - 2221 sesmesaptag 1 Soil Sampling Creerretttiss srs rast rtreetti rr rannns | 2263 25 `aoSurgnfaecge WaswtiaemrrpSwaamgaplisng.a'pt t.eg .r 1.1 .e ..e . s aga 2 225530 Vsesaesusonnsumapmtnga| issey 235534 FAungciotiMaimnao coSummp en11 cT rue 226621 tEiheln sfiectChawboroe)TToixicniyTesse E 263 Pincpetspromt S somToi Ts 38 2S0 u ODpuermn anr.e t..e Loo 230832 FSeuladpSeualgein1,08SAhipsmani, SToreep,ebsesaion o toto+ 30 mmsuBrase .Hamas SU Wa Sol a stm anaes LLL 8 3.001 BNAs LL... rrr 6 Cantew : : e505 63 0001 USEPA 6862 USFW 0580 BB0132 TPAeLMmESeSdLLs..CoEso LLL e 5S1u6s TOnogmwateuornsses 347 TolOrieCarbonsn Gr Si ofSi sd Sime 10 32 5493.1.8 soe Bove Feusempis WaterQuality Parameters ........uiiiiiiiiiiiiiii. Ssmplog mdTomeAsis... 10 |p 321 Benen LL 325 Fe 352265 BVeeesma 33 54 THeoygeTetisga.oof slomaoma ced Key +++ tea . 40 50 DSIUSMCMUSASRIYONOFo PRELIMINAn RY ECOLOGi ICAL RISKo ASSESSWEn NT SCREENs15 secronn 10 20 INTREOCDUOCLTOIRIOSGKNAISSoECS.SAMoEoLNT L _...__o ........i ........s .... 16 L1aa Osbeusees P3R1OBLEEeMlFOgReMdULRAakTaIsOeNsa.e_n...L .._...............g .... |i 22 23 EoxpnoiseoCnhoufncoseiCiono-m-ofm.C.io.ne.sn..s......o.nuy 24 Hund CouTossiyeAsemnenss _____._. | 11 - E24I2 O L oi S: 243 Mumma 245 Beem LL. : re USEPA 6863 002405 000164 ~~ USFW 0581 5 BT cCorpeon Cree a FO So rag C Ce e teeIT, BN 2012 gMpy a, p Ce C Creee Ce ce 25 e 2403 gp iROT e Cree CreRIa - 26 27 Coonmcapg m" Ce C Cee cen ln 2253 ERpee ee BRIT Creel 29, The , ea ces 292 phipog, ells iy asRepres RST n, Ttreviiag Earthwory Clenia oer enta, Of Bean;Laverery 3 Fes aRepresenta Olepom ey Of TerrestiyIaerieprye, 29.4 AmericanRobin(Turdy Force op Commu, 02 Rete 256 3 s.Migratory aRepresen teming Repre ta,ofWorm.caripyBirds. 257 298 Ruy ES sengy Coro pig, 0 210 eSmemnaay goor OsEpSgenay Ors pp "3 as 20 0 Mer assum Mem E HE p RApT Reese, or tas, Iotivarexgg C Reresn "Fresnog y CeeIE e ye Herbivor Cree ea veel Cel l a iii Creeca eoq04 000265 USEPA 6864 UR REeISveerrernesreesenrernesenrsesesrsenesenetotseeesenaesn--sn--en essa sessed - mm oo Set. rrr re eer HWE B10E0 soeereerrmeerrrreernsreeereisnsnerroet ----------re--n--eer? WB Hee IUT)LRMIHA wer reaenrsrerensmsseesrsteneenssrenen re . 12 Vadim TE EEE errno ---- - 50 RISKCHARACTERIZATION ...... _ BE BCe REA SOAACeAn BATE ven sesserreer er ot? a J IO : 54 Worm-eatingBirds. ........ trttatstresssntaeanrirnsbaneeidl - 5565 CCaammiivvoorreouuss BMiardns as.(..e..s..icifiiieildiiyiii +a 11a1 La rrreriaeeil ST Pv Mars covers e oso 8 S85 Cmivormus Mamas +1 55 lectMumvmo+r1o1u1 S10 Hears Mamas +111 60 UNCERTAINTYANALYSIS 70 CONCLUSIONS erro 30 70 72 BSeoaltlIe vverebCsorCmommmeuiniSteybvSerereenndnssndieaonnion+11111111.1.1.15050 13 Ta FahComms rovers WomeniBintsg o.oo oe) g TE tHE eeerreisiesssesernrarereeeeeeereereererBt 76 CumvoMraamus gy 17 piivorous Mammals 1s 5 Gorn SHS eesesnsenrssseosnreserisiresererennedtt ren USEPA 6865 059.25 000166 . USFW 058 79 fasesivarousMammy 80 s71u0vaHresyb.iv.or.ou.s.Marmanats CT tT een Tree 52 UTERATURECITED Te 2 APPENDIAX ees Small MaDz ac Szteesa s | APPENDIBX TT 60 - Aspe Repors TT APPENDICX Tosiio Testog Repors APPENDIX D "61 TTL ca Feld Notes... TTT - APPENDIEX 6 Satisied Analysis TTT 6 000167 063.05 USEPA 6866 LIST OF TABLES NUMBER ILE 1 Conceacarion of BNA's io Water 2 Conceaation of BNA's ia Soil 3 Conceauration of BNA's ia Sediment # . Concentrations of Meals ia Water s Results of Concentrations of Meals in Soil "6 Results of Conceatradoas of Meals in Sediment 7 Results of tse Azalyss for Pesdicide/PCB in Water 5 Resulis of tbe Analysis for Pesticice/PCBi Soil 5 Results of te Asalyss for Pesticide/PCB in Sediment - 0 VOA Cosceatrations ia Water n VOA Conceatrations in Soil n VOA Coccezaions in Sediment 3 Concentrations of Fluoride in Water 1 Conceations of Fluoride in Soil 1s `Concentrations of Fluoride in Sediment 1 Results of the Organo-fluoride Analysis in Sediment Concentrations of TOC in Sail 3 Results of the Analysis for Grain Size in Sail : jt Concentrations of TOC in Secimeat 0 Results of the Analysis (or Grain Size in Sediment 2 In Sit: Water Quality Parameters = `Concentrations of Bromide, Chloride, Nitrate, Phosphorus, and Sulfae in Water Cages " 080.0% 000168 USEPA 6867 USFW 0585 z 2 x Csnsotopreag C Fest Sumy, Feet S 2 FRs10 A0rig,gy u, Feet Sage, 22 CCE OE opp SofEBeaMaMeyr,ona 3 C Pi Conoct gyMazSzylgyp, p, : a 2 CS Toe Fi Tig 3 3 FC ESO ter pryfy TiFcie 1, Ea % PE of pr LP Conny PR itiT Ea . Ti Tite " Cn of ppgE@ oVnesgeTie ne . ots HL P Cory Vege Pl Tig m of Torr re Meng yy, Shorea gy, RSkSCO i pygS1careeRena MEning ang l,|on Wet ig vii cea 00016U3SEPA 6868 , - NUMBER LisT oF FIGURES LILE Sampliog Se Map viii USEPA 6869 To 0689.05 000170 USFW 0587 SECTION. RTIESCKHNSICCRAELENAPPROACH, SUMMARY OF FIELD EFFORT RESULTS, AND PRELIMINARY 10 INTRODUCTION Li Obese TToe orbieiave afdIisRepmroojveaclt vraosgrapmroivnidceonsduhcatiinlg isnupcpolrtao dteoUf.Ss.plEgsviiczlonFsmkessaflroPmroleesgieodn i or oamaa maieaaTotfossoflloessserdsiemoseiss,dl.1ndsheewdiacmoeesl,sltai3nwndosorfkfsioncd,betseefpiernoedfruo,rctlsiaeobnocrfastaowmrytaeoc,iteeoddydbtoeiwsntoingsgr,zadpiTeehnset tiosnco,ls o1f2ide.3prporjoedcucweerane e(0c:ol1o)giicaelnriifsykcaossneasmsimaennttsbapsreedse0t,h2e) cdeotlelrcmeidnedhaae.exist of . 12 Site Background. : TohFdh siuUiss5.hwaoErPTkAidnaglmbleeegitngpardsotcucccoodmonpnlaamfiianssmiawlsiohvaeodebeiWiaenWgsatdsiVshicrihganirnggie,adDWfeorooamdriCnnoienudou,fsmNiWaalYr.iranTdRoeisooouwwrceeesds mBahaneyDiusPaocnet Mcooafrsepsoraraoftbo.sfehrxsvoecdDairry.hRsuTzhh.erfdDararyresRsduimnraecfitlaloyiwnsasitbhtrhuaoatubgshluethmetoef(arr5mcecro'ensi,pmriobnplaenrncysoe1as2,kd i5rde2 iSeihseregeesaatooDcreyarReudnirohm atehs,DuwPhoicnht maanydlbe.ssIaacsseadlswoitbhetahrsephonroerdatlhaetsisobhsenrdvewdiliadihfee are, 20 METHODOLOGY TCheesiaopgparloseihkussesdesisnmheinsisdo(cUu.Sm.ensEPfoAllo19w9e7d).currBeansedU.So.n EhPeAprgoubildeamnsceffoormdleasdiaaninpgha1sned ocfontdhuecirinsgk eoomvmreemameminentna.tiodneAtssirgssanaselianbgalleeovwpeiilnogERoeAlhdewaessfnodcryo.ndwuaNcsutmedceornaodfuuescrtfehidseh 01f2idepdrwoviiinddveeesdikgualai.onne,iend3e5ddiltdvooencodomatpraleo3tbelseGisee x th cate, had seen repored prot is setvation. 21 `Soil Sampling : SSurrafFciegsuoriles1a.mplSeasmpwleerearcelaslcwieeed aelcsiadmpblaesevdeosdsaonngceDrfyoRmatnheanaddiinoln ourelferaennce ssinmapmlpet {ieonseleym bceod.naTmianraenrceoplnicceatnerasiuomnplgsrawdeir.e aSkuemnpliinngecwahsscamoplnincgearnea.in hReeplmiecaatdeoawsmp0ing o{soratsiaomnpsliwnegrseduetgehrmhieneudsb.yogfrcdainncgotmhesusmabmeprlsinagb3le1 Saanmdprlainngdom1ldyscohdoecssiwnegeGeceeergrmiidsceoddbeys Ling 1 random umbers able. SaSumpratls6nceeg.sosilAlsolafmsptoltesssuowmeprcleeosrcdowilerlnecgeaodluyEznRegTdC3fRcorEetcAooCnlaSomuringnadaieacdecsOaiprnbltoeinsns(TgsOeCPer)]o:cwgerodauiwrneos(izSeOssPpg)00eFn2s0fi1so.cmaShrieel ' E2.50 000171 foe USEPA 6870 USFW 058 CciotompmTaApiLnoi)s. meATadClsLd: ovTnlCaLi9pleeswioaisrdgceossliPeCstBoeSmd;poouTmnCdLsBeB(aasVmeO,pClSNe.eusrofaodla,lC1oN2eudonrAcc1ei,d5EsnxndaecoacrbprlmeosoBtfuNnmnAss fo 0 ambor SoRERY 5. VEEVASOR SEP ws si ken Bch of eo a `odes. - 22 Sediment Sampling 20d{SeednpdaiocmsoeiaenotncsasesmaamIspptleoLesseseenwsetoCrlrneeygeckoh.8lelceoScstaneemdapaamltmeinbsees:das.cmspowlneecarereaeaasesilooeucntesgdirtbeaadisneed.DroynSRudumnip,lnionezgeworiemsfecrtenoeceansdatmipalepoaaroeoan, T`AAhltecssceahdmipsmlueemwspaaespsclaisoog,wsmseicipnooe4nwodcsecscocnoaremdio iantdfgerdoolm5EhRaeTe 0CItR6EeaAcChseSsO7iPn1gb2o01 1sc,so,SdEmimmenoas sSammtploinnge. . FcvioadleedeLaiiroencheaewarhepafplereroeenpcresmeactaesm,pSTleboacsioarnyinAe.sfTooibcuhaermyicBa.l AmaryesIe,n4AArGesAIV,sfomr w:o ias 23 `Surface Water Sampling. : SsSuarimfpaslceefswoairtorenrssl.ampalSeunsrfywaecsree0wcaodtlle0erctaemd1palt-elioscawgteisrosnesSwcthoilclehlsecioodrrrdeaispcroenyndediLe.otoexrceBohAoSif.shePsvpeovteenrsceedoirnmeneast - lhVOelCssp)eliatp.ryinOe1n esspaiarmEnaRptTelCecIeihRnEleoAcnCatsiSonOnpPvlae1ss305e1r3d,epSsuortoecuatWoef4wr0.4ySasmmopicicnraogs.v(oWom)kuesss omnomeuestserosty Sprreiioecr satoaclTyAweLieldmeputnatHllseoraflerde,lsyAa:lnasla2ImtpnhlehsseeaasmianmaipsnlgesTvfoaAsLomRveealilsew.serueThereseHsesenrededdasbyastopirngiga4ens0nspsuisftpo SsTruAobLmriimdieee,adlsfaionrarlT,yAsiLfs wemes,atpsr$,esnTerCpvLheodsBapNhaAtre,hseTlCseaLmspp.leeswiAicsdief/oiPrCneBds.,mTlACleLscVwfiOasCcsks,ewsnais0eso,mptoiersiewcinens,e Feso,uTorneu A. Trbuay B. AreaIl 18 Aes IV,fo we bn 3 Fimephes promelessqessoes 1W0atmeeausulreitpeamapmeeercas wienreegmreesssseCdeilinsg (aHC)o,rhpaH,TM wdaitesrlvqeuadlitoyxymgeetne,(mTihlimgrimes wpaos woeedr aC(Vmn)gs./cLr)To.oecedonmfdeuocemtr,ivtwitaoysd[cmiaigllliiibmGhrooepslppeeyriocfe0nhtei4mneHdteo3r5r(xmamdhaosa/cSmo)Fl]e,odno.xoidgatTioaontsrsetds0uctteisonGopoufteynstioaaelsa[tvwoolitnss The HoriaTM was wed 1 eordunce he Ramfcrrrs ape menial 26 Drinking Water Wel Sampling p5Waitlmepirnbweeaadsd ssshhaoevmerp,lheeSfuwemolpmllMed0ibnbekinnwgpaulwraygteeeddrfwwoeerlrl3epoaenrtkihoeed fTofoesmap3prr4opfnamroma,tclwyPahfroalemeomtceiransidswie,rreecnta0ysiehde 2 USEPA 6871 000.5% ' 000172 USFW 058 25 Biological Sampling. 25.1 Small Mammal Srey `Semtaalllsmaanmdmatlosl wfelruoericdoellaenctdedtofrevoamlutaeteshiitsttoopadtebtoelromgiincaelbeofdfyectbsurodfeaexlpeovseulsreofoTsAiLc ccoolnltecatmeidnaf.romTitshseuebruerfdeernenscoefarsemaa.ll mAaUmmafilesldtrwarpappepdiongasaictteivwiteirees cwoemrpearceodndtucatneidmalisn aMcacmomrdaalncSeamwpiltihngEReTndC/PrRoEceAsCsinDgr.aft Standard Operating Procedure SOP #2029, Small Floocuatriotnasp.piAngfafreagsriwdewraeseessuubblliisshheeddoonnsiceeifaeraeraecaesarceoarlroecsaptoenddijnusg1t totthheesnooilrtshuomfplDirnyg. . Rreufnerienncseimairleaar wmaesadcoBowsbeaabibaecta2usteatteobbsaebrivtaetdpraelsoenagtthewassesaismciorrtoidtohrat(iFnigtuhreem1e).adoTwhse oar Dry Run, and because i was ouside the area thar could be directly influcaced by svuarrfiaecdeawmaotenrgferaocmh DorfythReust.apThareealseag1inhdowftahsebwarsaepdpionng tpheerioledagatahd ohfettirmaeppainadg eeffffoorrtt wreaqsuipreerdftoormcaepdtuurseiaag sMufufisceieunt Snpuemcibaelrsonfapmaampmsalssetfionrgsrtiadtsi.sticAallletvaalpusatwieorn.e sSpaamcpeldin1g0 wfeiecteapdaaritlya,nodbnacetedwthiethmoamroilnlgeadonudosncaendipneatnhueetbveunirarg.miDzuurrien.g Thape rcahpecskws,erteracphsecwkeerde: r`eubmabieterd, asnpdecireesse,taansdndeceasosfartcya.pRteeucreovwehirleedianntihemfailesldw1e0rdetlhaebaewleedrewitGhantshfeerwraepdianrecso,olrearps to the suging area for processing. Fanosrfcearcrhedantoimaslm,alplrmioarm(mapledrafcoarsmhinegett(heApnpeecnrdoipxsyA,).daBtaodfyromemtrtihcessipneclcuidmienng tlaoblelbwoadsy `awnedigrhte, cboodyroldnetenhgde,diacla lsheeentg.", Deaurrilnegagtah,e lnievcerrowpesiygahn,yaanbdnokrimdaoleiydweesigwhetrewenroetemdeaaasdurtehde cfoivnetrenatnsdofkitdhneeyg(asatprporionxtiesmtaitneallyw0a.c5tgweearceh)rewmeroeverdemforvoemdeafcorh hsipsetcoipmacesno.logSieccatlioannsaloyfsetsh,e Tsheeuslecbtuifofnesrewderfeormpallaicne.d Pirne2selravbeedleldiv4er0a-nmdLkgildansesyvsiaelctainondspwreerseersvuebdmiwtittehd 1t0o pAneirmcael RseufbemrietnecdefoPrathhoomlooggeyni(zAatRiPo)nfaonrdhTisAtoLpamtehaollo,gitcoall efvlaulouraitdieo,n.perTchee mroeimsatiunrien,gatnidsspueereweaast lipid analysis 2.52 Vegetation Sampling VVeeggeettaattiioonn AwsassescsomlelnescteFdieblyd hand for Protocol. reTshiedumeoasntalbysuins dpaenr EgrRaTssC/taRxEaAoCbseSrOvPed4a2t03al8l saraemaplaintgheloscaamtieongsriwdnaosdteasragestetdhefosroirlessaidmupeleasnawlyesries. taGkrena,ssTshaempalbeosvewegrreoutnadkpeonriiaoeaacohf pstleamnst afrtohme tshoeiismumrefdaicaewteitvhicaindietycoonfttahmeinsaoitledsafmpel.ingAnllodssamwpelrees cwoelrleecatneadlbyyzecdurfoirngTAthLe meals, oul fluoride, percent moiswure, ind percent lipids. 253 Aquatic Macroinvensbrate Sampling s USEPA 6872 ; 009-37 000173 USFW nsan TpoToirttevBueinnseancHseivoesrneobwogrne colnoSgmnmb gy wiwasispp olotEphcroCDmrnoaykmtAEo sRTEeCRnRErA Sop mSientmampmaove gdeo.i ps me colent Eoe et eeBA iaaooteasrnaaivd,edvDvivaonm10en.5iowkeessmt,iaxmsvdeapshalgtensrToponuoo i,,lESch aensitencscrviteewsds20 Ee net 300 popcbs re w To pe Sr . tr s iorn . lceovuags htse i lon wasdponsdda opieo112 o10v28 - eeS`witrhoinrythaoe epnanen.oWtorLriarrgoreydeetbilrissvc,heestsosof.neAos, adTnyndhotahreetr emxtmsreannencousAmnateesriaailsosofweeperneareeempnov:ed from . CSpoeninbai(QevAirGeEdeeereemds ssh+eeofmatyomandscomtomepsiBeeGsesos patny 250 Fi Coen oilrRveeiremcliA ClmeffosmnDmreyvRton ,dviTionpboisdny baretsceeoseiwlnoeeoTnftALaetisnd CSoebvedeieseanviSoeVopklhes8rt 1ioenwpalkomorbBesnoHweeowriepsnscwrwaiesFedFoikhoeinstpoi0pnses RSicenam sTsyore,sn,dFo tbdeeiEnRwTREmiAaGnvgeoaidmMaaacr foro cby c Tt 26 Toxin Tong 261 BuiaoieEaTroi )Tors FSFFiveeearosirieemsdisreesooywvsebtsckT hsetnofoobnr eat ssgiwes3odoaoserenykRbiooceoayrren.oeohuoorflofsien oFoan srfiioeseFsivre |weaissitBeedmferrTAsL melS. 0T1aroi,le15sit 262 hal ce Amid TosiciyTes SEAT . Cog. 15 Boo1%e USFW 0591 FFiveesedieomfen1t0sadaamksp,leeaas DwwrheyirceRhuatmikma0edomororeeavlai1ltuyatraienofdnergiaerooacwneaaharmieapaeseacedhamooft.xcehTyheeetss.stewFadosuirusoafwtoahrse wd. Pipes 1 deals te amphipod tosiiy est sediment sampling locations. 263 Pimephales promelas (issow) Toxicity Tess FT Fiove estufrfoarcesu3wmpapteleiessosdwioemfpel7edskaewyensr,aeatDtawrkhyeiRncu{honrt1ienmvedalomunoaeriao(lnaii2tayraaenffadetrhgeeraeodwaemrheiiasnsoeewaam(.oOcfRThShiee tettseetss.tt ered, Fire 1 deal the fubead migsow toxiiy tes water sampling locations. 27 Sumpliag Equipmen Decoaniaation . TShoveseqfuoellaotwtiongsasmapmlpinlgin1g heqeuoiplmleonwtigdescuomnetraimcianlatsieoqnuepnrcoec:edure was employed prior 10 24 21.. pRhoynspihcoasprheamtovdaelergent wish 3. p1o0tapbelrecewnattneircizsaecd rinse : s5.. sdiosllveedrwinastee[sricsesnee] 7. dey 28 Susard Operating Procedures 281 Documenation Documentation was conducted in accordance with the following SOPs: "_EERRTTCCIIRREEAACC SSOOPP #24000021,, SLaorgpbloeokDoDcoucmuemneintciaoinon "ERTC/IREAC SOP 4005, CainofCustody Procedures 282 Sumple Packaging. Shipmeas, Storage, Preservation, and Handling sScacmoprleanpcaecwkaigtiatg,h fsohlilpomweinntg,SsOoPrsa:ge, preservation and handling were conducted "_EERRTTCCIIRREEAACC SSOOPP 122000043,, SSaammppllee SPaarcakgaeg,inPgraensdeSahsiopmneantnd Hardling 283 Field Sunpling 154 Asalyial Techniques FfioellldowisnagmpSlOiPnsg:sciviies and field anslytes were conducted ia accordince with he _ERTCIREAC SOP 42001, General Field Sampling Guidelines f---- 5 . 000175 006% USFW 0592 ""EERRTTCC//RREEAACC SSOOPP 122000065,, SQauamlpiltiynAgssEuqruainpcmeenQtuaDleictoyntCaomniunrcorliSoanmples ""EERRTTCC//RREEAACC SSOOPP 1122001132,, SSouirlfaScaempWlaitnegr Sampling `"REERATCC/SROEPAC20S2O9P,1S2m0a1l6l,MSaemdmimaelntTSraapmppilnigngand Processing `REAC SOP 12032, Benthic Sampling 284 Health and Safety Heald and Safery was conductedinaccordance withthe folowiag SOPs: ""EERRTTCC//RREEAACC SSOOPP 433000112,.RREEAACCHHeeaall aenndd SSoaffteyy PGuriodgerlianmesPolicyHeesanrddIomusplWeamsertceaSsiitoens "ERTC/REAC SOP 3025, nclemens Weaher, Heat Stress and Cold Sress 50 RESULTS 30 Water, Soil, and Sedimeas Analysis 301 BNAS `SufaceWater : pArgoadluycsesdofotnhley sounrefadceetewcattioensoanmptlheessfurnodmarDdryBRNeAn,shcaen.refAeresnacmeplsezeaakm,inanidn hLeee UCprpeeerk ETdryilbhueaxryyDpbBeilaolcaact.on locoadndniteiodn, annumeesrtoiumsatTedenactoinvceleysm1adteonnifioefd C2omupgo/uLndosf (BTiIsCss.) inRcelsuudltisngforwathneoBwNnAaiaannaely2sinsdoaflksuersfeacceomwpaoteurndssamwpelreesftoauknedn iiniez DsruryfaRcuenwaatreprseaszepnlteesd i Table | and in Appeaciz B. well Water "liTshte, sSaemvpelrealtaTkIeCnsatwtehreeTdeennniafntedF.ahromwweevlelrporuodlucoendeonfotdheetedcteitoencstefdrocmomtpheousntdansdacrodulBdNbAe wteelnlciwvaeltyecshaamrapclteertiazkeednaantdtdheeTienfniaent2dsfaanrmaliksepner.esenRteesdulitnsTfaobrltee1 BanNdAinanAaplpyesnsdoifxtBhe Soil Afgearleynscseoftmheeadsoufwacaeresaoilprsoadmpulceesd raomfetwheismoelaaideodwsbitasdjfarceonmt ttohethsisanwdeaarmdbeBdNaAndlitshte. rFelfueoernacnehesnaemplweass. deCtaercbtaezdoalt2e nwaesstdiemtaetcetdedcoatncaenntersattiimoanteodfc2o3ncuegn/tKragtiinonoonfe4o1futhge/KGsreien 2o6n.eo3f2t4r3e0hueg/ekgAireaon1seoslasm.plDeifcnr-obmuyalrepahi1halotneewsaasmpdleetecrtoedm3acroenacterhier,atiaonnds towfo22o,f t27h,e - etshtriemeatseadmpcloencsenftrroatmioanrseaofI2V7, arneds6pe2cuivge/lKy.g inBiosn(e2s-aEmtphlyelhferxoymlpAhraelaat1e1waansd odneieecsiaemdplae 6 USEPA 6875 009.055 ' 000176 USFW 059: aSflr3ioa3mceA.ircecyaucelIooVfa.liaesDeis,oamcaplylelesspeh,firtosmeaelaharyeadIewV,a.ssLodnlcesadc,diieetdiaobanot,lamsn,eerPsoiAun,sse1sdesdc,ono1ce5eideahgoianiegosnbooorfop1e8:n0 csaommpploeusndisspwreesreeatfeodunida Tiabtlhee s2u1r2fadceinsAoplpseaamdpilxes5.. Resuls fr he SNA anne bos Sediment pdAresoeadlcuyecsdesdinotofhneltyAher3esfeedwIiVmiesssoetldaistmeaedmnpdtlcesesacmifporleonms2to2hf0eBsfNiivAetsceiotdmepacoauodnndctsew.coaroaDfofinsniotbe3fusyepeahgimy.locSatcoioo.ns cEotpyslehnerxayilopnhoifa2lteug/wKags, Creek, efeeace seam, dNeoteocteedr isnatdhredAlrseaco[m11posuenddismewnetveamfpoulned o Dry Run sediment samples. Numerous n3anag Tick ociees soning - aosarimgpmalsoeiswc.ncoaRmlepssouelu,tnsdcsfyocrwlehoraeeliBafNeo,Aunadalnkaielnayest,ihsealoDdfersbyyedcRemu,en,saitcLsaealem,pClcreoesehkios,lp,arnedPsAermHee,fderabscnoec3,s sasode5diarsss ia Azpesdix B. 302 TAL Meals SurfaceWater Aibneacralylulydlseidsumbo,ofttchhadfmesiurruefmad,cencwodabtaeulnrtf,sialmtmeeprrlecedusrsya,fcrpnoliemcskDefrlo,yr sTRluAenLs,imtuhemet,arlsesifleevreaers,scteh.aslelaAmim,,imaaosncddyL,veeesemCeroemes.k were not detected in any of he flerodr aired wate samples. Aafinllduemzriiendnguwsma,emprblaedrsie,ucmc,titecdapliencaiturems,fcetohrpapeedra,lwuaitmoeinrn,usmma,ampglaceoesps.pieurO,,f mhsanendgsaztnieoesfed,atrpeeortifaeosdusnimduem,Bsnssohdiiugmh, cCoenecsen.isations i the Dry Run Creek drainage, cluding the refreece sicearm, tas by Los uAnnldfulmzeiirnnecudmws,earmbpealrediseu,mc,ecccoeandlccieinnuzmta,hteciouopnnpfeoirfe,raeilrdouns,mammipa,lgensie.rsoin,Oumf3,nhdmezainlngesassoepfpseeds,ettpe1ottebadesshimiuemg,rhtssoiodsiDumrmy, Run than those measured in Lee Crock. pDreersacinliecddriensuTlatsbloef te3ndTAinLAmpepteanldsiannaBl.ysis in fered snd unfired wee samples are WellWager Wsgaelmleplnliew.uamt,eArnstisliavmmeorp,nlye,Gdaafrlrsloemnei,ct,he5bewdreylllvliaounnma,dthiceuamdTmeaiwneuarmne,t cnfhoartrommCiweuaemsc,ead<noablbayrlz,etdhmeaesrweaeunllyu.nsfsuieemrpied CinonAcpepnernadiioxnBs.measuredforthe remaining ls of TAL meals are presened in Tabi 4 and 7 009..45 USEPA 6876 . 000177 USFW 0594 Soil aevteerespelsitontitecsewseirl wsamepldes rfoormTAdLemfaoluss.DrAysiRmuoseyc,esudotwesme.essavd ite ee iwvarn iattteaaraiiaetweorasaxlldmianefieissseaymcofesheetimoltsmwmissSaGemnnyy CBosmetuioonm0foooE nb,e rsE ets rkeshrenghaeotmms6s00asg1u3n1s0emkcose.encFananoltnepwoihns of Nopendin nd Sedimens - e Sevieen seetdrimeetnet eemapnl wt AeormefeDbrnyiyRn,enldaofsiownTsABLbemed reaneli,seLaloneaelCysnris,e, .Fiaivovedeosoft1h4ewoBssacazpeilesns eeLesr eCede aapifehi speeatsu1ph sBr.y RuImn croemtperaoch myewevscsheead ttn ne. ck, psn, odin abn 1d on ised 5 oe r> eve of Bt oiieane,wmbiyarnen,e.uctbaoegidnlh,apnabprlsrC5ohpeaen,ardeo.neenFdo,ergedtasraeelsa,moeifkhles,oTuvAsLiesmriea,sn azalysisofsite and refereocesedimentsamples are presented ia Table 6 and Appeacix B. 503 PescielrCas Water No pence or PCBs wee decid ih Dry Run samples, i Le Crk sale or in the reference stream sample (Table 7: Appendix B). Soil No esicides ar PCBs wee decid inh Dry Run meadow samples, o ne efrce `meadow samples (Table 8; Appendix B). Ssdiment Nooepesvtiiciedense sPcCBewsaempeled(eTdei3n.hAeppDernydiRaun8.samples, th Les Crk sample. or sie voos Water Cet sample a nh eens svenrsmerTab 10; Append ---- 8 : USEPA 6877 ! 000.32% 000178 USFW 059 Sail TSeeTiacetuolayro/roKoaefR,ituueonNrnooemaeotwehcaarsonmeevelwonealicsaatleidedeotnoiersacptoeavdtieaciragceeapavlgriebcroaynfterscooAiomlrmespa0ao.muI9pnldessoikwlee3sr.nae6mpidnlueettgaheKecytme.3edcaiodanocItweaheastaDradradjyidaoicRnenuno,atf EP otfestLeoaendCrreeefkeesaacmpeles,olorsianmtplheeseafreeparecseensteedanmTsaballee.11 3RnedsAsppeofsdhiex VB.OC Satin Aicetsoeinretiwoeasodndetceo2cmicpeodonuciaendhtserawAtevireoenaIdoefVte0c.si5aemdupliegtah2eicDrohyneRcAireenasatImplaoldesfsao,m7p.nul2ee,urLKeNseo,CraetCeehkrlosvraoomlfpaoltrelm,e oeineen sraemfpelerseeaesoptreasmeostaemdpliea,TabRleesu1l2saodf tAspepeVaOdiCx aBm.alyss of site 12d eferesce 30.5 Toul Flworide uae1 Wel Waar . FFleuoirnidseawmapslesoor daetehedweiln tshaempDlreyaRkuennsoanrpbleesT,entneanLteefaCrrmee(Tkasblaempl13e;, Ahpeperaedfiesea8c)e. Sail FTuaserordiaedeTcwoLanscTedhneeresaceieosdnpspinreaahntegoebDdrerynoRomusnmtleoaawdloofwl1a8as0idmggni/ikfhigecianriAfereefzansIcVem1se03aiadhotigwohlsoafsmop3ill7es0f.lmugo/rSikodgle eacation, Reda ofte sal forte nlysis ae presaied in Table 14 20 Appendix 5. 316 .y! Sediment IFToiVtsosirnaidmLepelweianCsgeedeaekre,eceF(dl0ui2onrtihhdieegDhcrooynfcRe4nu5tnr0artmeiyco/nkskbgerdaigaaenhddeifnrUdopempearreofeTwrreinbocufet2ac9rry0esmAkbeksdamspailmnipinlgees,aArrbeeuaat. FiSootpohetametde1wribesesneondridiscethaienecdieewdfirtiohmLfetiheoerCibrdneeed,kf.lwlhOivcSehreadilsil,nmeolsofrsoaiumnepdlceinodinLaeceeieCrrDenresyk.ReunnRdeCstruoeldesekcorrfeesahsceeh einen uoride analysis ae presenedin Table 15 and in Appendix B. Orgumofuorides USEPA 6878 Sediment BhSieegcshacuvasonenleoadfilmfyoertohifondshooelmoesgeysdiipamrnedoanbrtldessm,usm,opnlslspy.ec4ilTfihimecisatleeidlcysouomibptuoauonfidnosgrgraapenporpforlpeorsrieisndeeesdciuonnmdapTraodbusln,eds2165.cdouhOleFd Gel on was alyzed for (Teralorostylene, herafivoropropsieze. 000179 i 009.55 USFW 0596 eCsalloorroodirfL1i,o,r1o2m3e.t3a,anhee,safplevrofrlouporroopcayscleo,bua1n0ed. 1P-eCrhlluooror-o1i.o1b,u2n.v2i,estee),saiosroonseihaozfe, t2h.e oLrsglaynsofsuiosnirtespocroemdpoiaunTdasblwee1r6e d0e4taicnadApipseiodisxedB.iments, Resa of he orgacofivonde 3.7 Toul OrganicCarbon1nd Grain Size of Sol 0d Sedimeat 3S0udmimAapripees nofdoiBuxl. oTrganiiOc tcaerCsboolnl1r2addggerdaifn sizr2e0aanovaleyrsmaigsearleowproefs5e.nt6e%diinnATzaebalesI17so-i2l0s i1a023 Taavbelera18g.eTbiOgCh oifn9t.h2einseAdrimeeantIVrasnogse.dSforlom ralinoswizoef 1d.et9e%rmiianaLteieonCsreaeeks(u0.mmahirgihzeodf 5% ia Area IV, Seinen grain size determination is pressed ia Table 20. 308 Water Quiliy Parameters - Wteaatpeerraquurael,itbyropmiirdaem,etcehrlsoriidnec,luidaintg ,pHp,hoscpohnadtuec,taivnidys,ulnfistbeidwiays,medaisssuorlevedd.ia ohxeygDera,y wReurseCtrheaetkcornedauccht,ihvietyre1fderlocfe steacomo,ceoatdratinioLnedeeCcrreeeakse,dTwhiehmoissctressosbiolgediosbtsaenrcveatfiroonms t`meealsaundrfeimlle.ntsOt1h2edranpaalryasmeestearrse parpepseeaorteeddion bTaeblinesh2e1e2x0pdec2t2,ed range. Results of tse 3.1.9 Bovine Fecal Samples = Siinxthfeecdailgsesatmipvleesprwoedruectaskoefnthe dafefeecriemdeciafeln,vironmental cotaminans were showing up | Ba Pkhse. wAadsdidteitoencatleldy,in4-amllebsyixlpfheceanlolsawmapslesdetaecctoendceinntarlaltisioxnssarmapnlgeosginfrcoomnc2e.6ntratio8n.s0 cToanncgeinntgraftrioomn 4o5f t3o0 1m1g0/kmgy./ks.AddiBteinosnoailc icnifdormwaatsiocneeissiperdeisnetewdo ionfThaeblseam2p3le2s2d4in Appeadin B. TAL Metals. ASolduimuimn,umva,nabdairuimu,m,2ncdatlince,wecroeppdeert,ectierdon,inltehaed,femcaalgnsaemspiluesm,, mAacndgiainoensael,fpoormsasiio,n presened in Table 2 1nd in Appendia B. Eluoride Fluoride was not detected in any of the fecal samples (Table 25; Appendix B). 32 Biotic Sunpling and Tissue Asalysis 32.0 Beatie Macroinvenebraes 10 - USEPA 6879 605.55 000180 USFW 0597 aOAxfao.usle,Ooffth2ts7hetwsloaatsseor1,miOtlchieggordcoohumapitsnewa,en|trMegocrlooilulspee,c,ieidn1 Tfturerorbmmestlaoerfisa,loosc3aotCmirouinscstascEaevmanpeslr,eyda,(nTa2wdb1elreoes26et)s.et "CoaleotphieriEaphwehmiechrowpeirreiarewperreeseaptrbeeydsc7taesda.byTh3e xDaip.teraThewePelerceoppriersieaa,icHdebmyiptaexraa orefctovpetoe1it9ax,a.xnadTwheMereeggarceloaoltlpeetscettretada,xwoeFnreoewmteihrceadlixevaaesrtwsdieitrvyeerwbsaessegorrbvoseuepdrsavaendldoaciwaethireoensrre|efptcrreeoasuceegahliboIecVyda,tioaonnned, ihItVeerwleaonswceseptrindiismveoarnlsiotyrueweatdsiovoetbrhsseietpryrvbeeesdocowaceeelaoocBfaetaiorgneefaeIriVeenrwcheneulromecbaet1ir1onouafsnadralrwoeecratteaixoacnasalIechIee,d.If,or`m3Te2herd ocaion. (TroeepulmicbaerA)of10ind2ivi3dualloscactoilolnectIeVd p(ererprliecpalteicCa).rangTehderoobmse2r0v3edadteeasrieyfeorfenicnedilvoicdauiaolns - hLaeexueaeurg(ohTcaoubstlaeah2en6)d.sAtseyTlahliredeanseu.mieWrpihcieanlnlaypyrdetosmesin,eantshtelsuoesftaathxceaoplwlueemcretereidtcyfaprilcoabmlultnyhdehaesnucmdeoyosf:aarneunamyeorscielcvuaedlrelalsy L"deeapei.nphitincelbooirdcgi,angnBiPaseeersl,i3s01ad2,4wCePhrsieeruordneooplmrieinsdneacoepi,hediylbaiy,ll2wl2e1ar,eaptdhee3s9Tc1uaribinetdilmvaoisdsauta,llson,cadrtei0opne3slicienvscleoyns.siesOxteibanetdr,y rigeaisfeiannd: pbryopiovrteioons.feweIar ginedaievriadlu,almsoastmaoxsta laolclaccitoeusd. wFeorre erxealmaplvee,loafrhee11n2d9wteoruel Foonootmo ificve ionbdsievrivdausalcse,s,1154bywesirxe0re1p0risndciaviidbeuaydlso,n1e5ibnydiv1i1duta0l,2036indwievrieduralesp,re0se4ate1d3 bbyy seener than 21 individuals. SCehvierraanlomwidaaew,eraedcolAlseecltieddafero(mTaablllelo2c6a)t.ionsSesvaemraplletdaxiancwluedrieng5L0euccaorlrlieccitee,d Pferrolmeasa, scaetdiiosn,sHbyuatlewlelr,e3b2rdoaTdultybelrelparreas.eaOtefdthhronuignheoxusatoebsderraviendaage oinlcyludainneglLoecpattioopnh.lefboiucr,, {{erkolmudtihneg rEelfmeirdeancc,e lSocciartiidoan.c, TPhieeumdoosltincaoopmhmioln, dainsdtrSicbzutaitoinomoybisdearcvewderweascoolnleectwehdeoenly3 uiFnradlroawwpaasnsuecmholbele,ercLsti.emdaiSoipmheiillltaiirvdlyee,l,yLNiilgporowognnoiumamp,bheaurnssd,,CaDenrydastacotipdafaneciwd,alocCcuawrtceiuoenlsi.cdaoeFl,olrEeelcxmainmdfparleee,,qSuEcelidrmtiyidda1sc3e,,d aHisonelrydaoen,e lPorceauidoonlimsophia, Siatiomyidac, and Physa were coleced in low numbers FRfieuvsnecuilfoiunnnaglcifgorrnoolmuptfheaedtipnmrgoessgternoclueocpasotfiwoAnessr.eelicdoAallletevcaotnuedgdhfHyrlaeoslmseltclhoe,miDonrmayasisRv,aurnceosldlrewaseitnroaerg-etgha(ehTeadrboelmreiss2ia6nd).dt emraaspfeicess wLeeurcerocconustiast0edntlLyepctoalplhclieebdi.froTmhaldlolsociaatniotnsscianphees wsausdythaermeaayafnldy Lneculeuroecduitah.e sProerdealtyorsPewrelersea.dominant at locarions Il 04 [Il and were represented primarily by the TGoueayov.eraanldl saescsoensdslmyenotnotfheecaonalloygsiicsalofcobinodliotgiiocnalfrcsotmpfooncuesnetssoin itghheteovfalhuaabtiitoant ofHahbaibaita, v n . USEPA 6880 009.2% 000181 USFW 0598 : : ett aasatheanpdricncainpableduesteerdmiasnaantgeoafberiaollopgriecdailctpoorreoaftabli,olsoegsicahlecsoangdieifoonr.ieHripgrheqiuaaglitbyoubravbeiy swuibltlseupapnodrsohfilghiequcaloinysebqiuoelongciec.al Hcoowemvemri, s1sabdabreiscptondseecslitnoesmiinnorquAalltietry,atidoinsscowrialalbblee cbioollloegcitceadl,toigmeptaheirr,mecartapriesscualls.relaWtihoensnhiphsacbaina baenqduabnitoilfoigeidca1l5ddasaubsaerqeuesnytsltyemuasteicdalfloyr wscarteecrasihaegditmhpaatctdraaidnsdtisecrDirmiynaRtuinngswtadtyeraqrueaalibtaysebfefeecntsmofdriofmiebdab3isatadreegsrulatdaotfiopna.st Tahaed 2p5wreelaalsatnhdeusse,agpoarfiucloamrmleyrwciitahlraoed siopdtuoescracalntefagcrialriisn.g 3T0hdeoltohssroafgriipcaurniuarnalvepgreatcattiicoens,, biaasvousgehverraelplcoancseemqueenbaytcesspetciaets srheosiusltdanbteorcoasdiadpeterdedtowghreanzinegv,alourateilnigmitnhaetdiiosnubiyvugtriaozninogf benibic macrolaveriebries 0d macroiaveriebrate i the curment sly. quTauleityacoafitzhabelbeabbiioaltoagticaapl apocteantiralloocfat2ons.eTahmeDofryriRvuerziss pyrimaraeryidseitmeartmeidne0d2bryurtahle eavriedaenuti,lzsegudipfriicmaanriployifoonrsgroafztihnegicpaarieananadr,eaaroeumagihn vheigsteoiraitce,indaincdathieonrseoafregrfaezwinrgeasrse owiuthgha scoommpelwehtaeltydeogpreandecda.nospuyppoarntdaexspuopsreidiasgoilly. diPvoerrsteanasndofaptpeareDnrlyyRruobausdtraaiqnuaagtei,c cwoamsmurneliattyi.velTyhbeisghonatomthiecredifveerresnictey aarneda.numIenriccoamlraastb,uatdhaecdeivoefrtsiety maancdroaibnuvnerdiaenbcreataet llooccaatsiionnssiIa. DIr.yIRIu,nanadeIsViswaalasr,rtedeucperdesseunbcsetoafnticaolnlay.minSiantcieonhaabtithaet clonasridelroactaitoionnssatmaayl be sigaificast. 322 Mammal 2F5o4urmsepaedcioews joufmspmianlgl mmiacsem)awlesre(mceauagdhotwdvuroilnsg, tshheotrreatpipliendg sehffroerwts.,wWhhiotlefbooodtieedsiwceer,e subamiced for lipid, TAL meal and tral fluoride analysis e"TxhierwmaeplpyinlgoweftfaoprpirnevgeasulcecdeastslienasAtrneael,imhpeoraaraena nfeiaerdesotbstehrevaltanidofni,llwohuitcahl,waass cthoemrpeawraesd m10tayeiondtihcarteaasenaes,colToghiscails Ntiegath.y irFvieegludlanrecgrivoepnschseidseinmtiilfairedhsaevberaalprseisgneinf:icsainetwipdreo,bleamnsd swihtrhewtshessammapllledmafmrmoamlsallcolalzeccatsedsihnowtheedmbelaadcokewneardeaasndadjdaegceecnertaotDirngy Rteuenth.. ShSohrrteawisl dcoemnmsoinlaryeaavleighwthbatroiwsnkncoolwonr.asThcheesbtlnauctk,timpopeudldte,etha,ndwhdeegreenetrhaeteixnigrteemeethpoobnsesrvoefdthien wiasssmtisasyinagrehneotleptorkmiadlaelyy,oabnsderavneodthiearsahprpeewsa.sedOfnoehmaeveadanodwevxoelse Ksiadmnpelyedoffarnomextec laorbeea on he right Kidney. independent of the adrenals. i`SfuffaincidenAtraeambIVerforoftimsetaidcoalw cvoomlepsarwiesroenscaoufghttisfsureomcotnhceenRierlateicoennsc.e ALriepai,d AcronecaenIi,raAtrieoan cofommpeaardeodwtovotlaets owbssersviegdifiincAarnelyadIeVpr(eps<s0e.d00i1n)t.he BReafreiruemncceonAcreenat,ratAizonzwIa,sasnidgnAifziacanItll.y lower in the Reference Area, Ase I, 2nd Are Il compared tothatabserved in Avea IV 2 USEPA 6881 085.55 000182 USFW 0599 (fS p=i0.e06s7).ume bevr ofisn sohreerwsrhebrewaeserwoamenrdhfcseaecogWceofsoamssbe.odyRceecsoAraonf dpidc.eTAL Bcseie of heoB pin.mes,ReTAoL rmeeaplsr, ae0srbiydsepecsiess 3s4 aceappprosgelieodcaa.Tes 323 FEuseoseisE of iewere RlellcearArmeu.DrwCyerrReeeakscocaluebcAsiree1dsdiIl.wTaaL,1od,adrCTeVrs.dwNeuoebfc,tolwvseeerrde . isdhreaetecnsueecesofofeueirlnocylghe.se,foAardacboaDmcrpkyoosRsemeswdaeamrcpeelewseuaebticcwaesldfloaedkwaaddAeuziaoodgIy3 `a ahicsteoriccraleeefkiscwhukbielsl wisorDeroyisneRmiua,nnelpywbaiepsraycalillisaiouagmnc,aoelcmyomzebeoadnnl.,0isrloiln,eelecesodns,caezmspuclaaigiaaogenlsscea,iiaonG(sah,sllsSiaaE,Ci0,sd Aa , ov v.y aCcoammeeirnaaglthyo,nisanodcfrmeeicsukcmeb0msdeaslfisoveim acAioyvanec[}Iaahtecnorrne0ocskassheeohoswbaesempdwlUmeeereaesrsHeAsivzgteheres8sre B CB oneeencae ionN.e aiewaleiioarsrnetsrwhie.ninsgAudsoTssaheedcIreVewiriwtiehtfraaeiscis7ag0nbidfdibciahafnirlgbyesiaeguhispsalmioeduaaotcrhoffolmfuuoDrdeesys cast of re chemical analyses ae preseed fa Tables 30:32 124 it Append 3. 324 Ewtworn oTe ru ept a cnhworym sdampleosf vweiencperodvuacsedwfeom elcohckhfoofof siiesgnrfivfviweassorGlrieaeifsEesnsi:n EO tese bhaensoouneeeefnnntosaiamhoAnenwesrosnermlIts.heeaIeesxspeoiIssVw,e,odobrr[tm0tcleianssdRueeefdewr(0esnccseriesgosilfssi.WcaCinoybraBelisglsesivenlgs BA ae Oii. rial tChoanppneosaendcsbicekrevlecdonicnswroartimontsakewaerferHoimghtehre ica eworrmssoa7ka3n exposes. FFubearaeosntsacofprheeemciaenhinwoTrabmletsis3u.e35anaalnydseisn Afporpepnicdia, 3T.AL meals and force 325 sve Vegeaion 5 USEPA 6852 609.2% 000183 USFW 06C Sflauortideo,efuumiinoeusno,caciaolinusm,bempaeegeosesthen,fsiockel,vpoessuam, canhdrsoodmiu,m,copFpaerrb,erc,i,thewredwoeree cooeneaeammprhaitipoosds,oalxtihocughettheserelpartieosnsahlipesaweTraebloet0sig0nidfiacanAt RatPtEhRe X0.C1.0 level, Further results of 40 SUMMARY OF PRELIMINARY ECOLOGICAL RISK ASSESSMENT SCREEN EESveAidnm1a90v,%y)stolhHlantcadormdwoaqptuaenerdicinonsngcweReneeagiifoonnesrTwIeedrbebyecoGmapoakirendvahigevaiemn,sat RxAeilglmiSohoIelncaBoTmneAaaGnrasdefrooerncawBihneigcsvhaolmsuees4s(eUoi.cSnh oommbieeernateivoinamseeidcodas3tfefdenbFeroislstlkoaswmieansgtsscmefionot,fsoerdiCtmeeonitm,emsobi. nB15sa4 afelso bae thaltealesereepirnogceesvewlillFobke Sediment CoTolanocewuinin1ngtitcneos,mpmToahsxetimsmuamaxcisoms,secmocrsahtieronaosa,mio,sneSreeoacpiopnr,gdeAedsneargiai,es1,ide. 1Snqhdueimleilkdelch.reieBvieeasschfaaicemtaororksf vhfaoelruecssek(dirmoefent3 reemesiiang,vareonm,ab,ehremf,ollboawikn,g cioon,mpo34usvaardA.l comidered 2 ik fers 1 wel: Foes Water arbalne m1 miscsomneaesizamin,corenccoredrednsst,hebescihemeaxrcese,de1ddheqelaehrmaerkivaalvoesrfoorrveaftoelcloowinnaEonm.pouTSose Smieneinm,tsckopfpaeri,r.and lon. Because ofthe ck of scrcaing benchmark, ore is conscred 0 be & Sail TTahleemtalxsimmaasrooitenetoantcne.nadroencso,dsecdresetniOngersieersE,xcaeneddeqduBaeyerneinrmacfakctovraslufeo sfolol ctohnaTmollaoawninsg cofobrepcok:oaf4isemesn,ingbbeernychlm,arrk.ohemf,olloCwoipnpgerc.owmpoo:unJdats,rreeSslsco,nsirdeardediaas,inkdfaict.ors B5ocweulsle Tore a riloroioromenae. 50 Discussion TheinedaOarygeRnaernatCerdeedkursineg.thMeieidmaelfyostosu1ggeeuststohaftoheesaciepteannadlWparorbl(emos akssssedsowigtghecopontieonnisa rEaubloefthie tahnedtle,swai.h Saosme lmeevtealslsprSopgereasrsiivnelNygdhroeppeinsgewiCthonnccenezsaiionnsdiinabneetarsoammpeledaenadlrsrehse, LCioknecweinsee,hisoendsmoesuss sousmpelesdaimnpDlreyd RAbuenrardotwhnes4tr3e4a0m1, cuAlplroampieasas1y shaevreenNgohferpfolulidiaknd cmeaarlss ESeitpgreesseans2owrelproDbieas.gpubeecrieadllduyrienvg aterfJolvdelefofforltoowniileb,eaArpbaenrouaasrldyes,e4dndthsroomugehmeablass.eimnaey Ctagied ik seen or he Dry Rm Cec i is USEPA 6884 009.54 000184 USFW 0602 Tloacraeteionrse,pliOcaptee wsaamyplaenaslyosfismeofadvaorwiagnrcaesswwserueseadk0ealiokefaocrhdoiffetrecafcievse isaoipllasnatmptlsisnuge EciotnhceeriaanttihoensAvaecaro|svsetgheeaftiovne staamnpliisgthearAerse.s 1B]ar2i0udmIVcovnecgeeatatsriaoino,nbwutassigiaifmioctainatty cSibgiueirivceadndiyn philgahnesriaakteheinAtrheeaR|ef0edrersecfeer1e0ndceavegAerteaatiIIo.ntMaanngtaanethseeAcvoecac1e,am1ti1o2ndwaIsV e{sgeeoatohne.areCaosb.altThwesreswigsifgiocnddiyffheiegahceeriinatArheauIoVrviedgoercliapiitdhocaonnceanttraktioen. i13 of RApepseunldsioxfB.the TAL meals 15d fluoride analysis are presented in Tables 36.38 asd in 33 Hisologica assay of small mammal liver and idoey jHuismtpoilnoggimcaile,asaanlydsiwshiotfz-lfiovoetredanmdiceidtnaepypesdecitioensaoofcfmtheeadiovwe avpolpsi,agshreoarsec.onschlruedwesd,thmeahdeorwe winedrtt0o psruebsseaanceivoefachnanegxetsrailolbievoeronrthiecroiegyhtKmiodrpnheoyloogfya. nThoerapbrovsideoefa3nneKcicddooceeylienviodneenacneiomfaal,n offcth,e iBsotwoepvatehrlwogeiacrael uwnoarbklestr aprseseeairedithaeTiambploer3a9oeaendoifathAepspeeoabcsierzvaB.t.ions, Fll summaries 34 Torcio Tesing : - Eanhworn. Beaasretdhwooarmtshetetsotrediciinyaeavyaloufattihoensoofilssaailm,pltehserceolilec5toedevaitdtehneceDrfyorRguraowCtrheeokf ssiuter,vivaSlurevifveaclswaosn c1a0r0t%woiarsalltotxriecaittymetnetstraepelipcarteessenaineddignroTwatbhlera4n0g1enddfiraomAp3p2e.n4dixC54.3%. Furher resus ofthe Eatheadmicnow sBuarsfeadceownatteher ttoaxkiecnitiyn etvhaelUupatpieornTorfisdwuarrfyceAwlaotcattisoanmipnledseetdo stihgeiffiactahnetadmomrianlnitoyw.. Sitursvipvaalsiatthhaet UlopcpaetironT,rirbauntagreyd Afrsoammpl7etowa1s005%8.% wThhielreessuprpveiavarltoibaellnooegrrowstamhplreelsa,teidncelffuedcitnsgwhaetere,feornestchee mcoirnmenloatwedipnoraansysioufmtchoencewnattreartisoanmsp,lehsowkeveenr hfersoemcDorrzyelRauionnsCraeeek.got sStuirvsiivcaalllwyassignneigfaictainvtely choence0n.u1r0atlieovenls. inTthheerfeiewraesd w3astiegnsifaimcpalnets,posFiatirvbeercorrerseullastioofntbeetfwaehsensdfamtihenandowsurtvoxiivcailtyantedxtiarroen presentedin Table 40 3nd in Appendia C. Amghigod HByaasleedllaanttehea,resgulrtsoowf tohfethe10ordgaaynissomlsidwpshaiseiwhdoleinsetdheimseendtimtoexnitcistaympeslteswtiahkentheatatmephUipppode,r TsraimbpulteasrytakAe.n.snTdhAeroebaseIrvleodcanteograst.iveTghreorveahweeffegctoweifsfcstisgnaibfiscearnvtelyd noengastuirvveilvyalciorealnayioedftwihteh it ie USEPA 6883 009.35 - 000185 USFW 0601 SECTION I ECOLOGICAL RISK ASSESSMENT 10 INTRODUCTION LL Obecive AThgeenocbyjRceigvioonf iIlsiraisckoansdeusesimnegst1waevsal0upartioovniodfepcotheanitciaall seucpoploorgtic0al htereaUt.Si.eEafvoisoxnimneinoigalcPoronecatinon {Seovle,lsseidnimseonli,,sseudfimiecnetv,anted,woadtebia:o3swaomrpklieasgwberee cporoldluicteiofnor(cuonrtalmoicziaends ldoywsn eraadi0ossoo,f saeHdnaedait, afnotrsturwfaasceiwnactoerrpowrearteedcionltloecitned4afeocrollaobgoircaatlorryis(koaxscsieysstmeestnitngo.rTthhee DirnfyorRmuaatiCornegeakthseirce.d duriog is field 12 sie Buckpround "iTohershiesifadwosrakeirnogubseceofmpprloadiucotsiowni(hrhmelWoecast:edViigniWaaisahiDnegptaonni,meWaotoodf NCaorurray!,RWeVso.urcTehseaondwhee oUf.tSh.e cEoPrpAoraaliloeng.inigntto aDrycoRnutaa.minDarnytsRuarsefbleoiwnsgthdriosucghharhgeedffarrosmr'1sapirnodpusetrryialaa1dan1sdf2llproiwmnareydsboyurctehofDuwgaotnetr ifaohinsishcearrdla.eTihzeefcalrymesrtcmiabauatbalnesothhatencuomuemroiunstadtesattsh,ablairneddneisssc,haarngdedoibneor uDrsyuaRlusdlfsrsosmchseobDsueprovnetd Rlaundnfislli.nceInthcedciodnosntroucthieosneofbrtoerlmaandlfiilel.s numerous ishand wildlife Kil bave also been reporied ia Dry? 20 PROBLEM FORMULATION c"oTnhtsaimisnaanstsse.smeDnutriwnsg tdheesipgrneeldi1mineavralyuartieskthaespsoetsesnmteinalt,eathtesptrooebcloelmogifcoarlmurlecaetpitoonrsparomcesesxipnoclsuede0d t5he TidheinstiifnifcoartimoantioofnCwOaCssh1ennd u3secdom0pairdiesntoinfyoftcohmeplmeatxeiemxpuomsucroenpcaetnhzwaatyosnooffCcoOmCpsouwnidtsheaxecceeedpiindgbbeenncchhmamrakrsk.s 10 ceologiel receptors and thei appropriate measurement endpoints. tTehrfsdturseipnothfetfheedprewliihmiensatraybilisskheadsstoexsiscmoelnotgipcraolcebsesncchommaprakrse.dBalelncchhermniackalssfaornaslyezeddiimasoneidl,nssotedliwmeernte.uasnedd 0Moridgeanntif1y95p0o,teLnotinagl ecaoln.tam19i9n5a,ntPsrosfucaodncetealr.fo199t2h,eUpSro.teEcPtiAon1o9f92a,quSauttiecrbainodtaM(aUb.rSe.yEP19A94)1,995C,oLmepnogunidnsd evxecneeabdriantgs,beanncdhmiacrkes wexeprosrureeiansseayfsorfofufeirs,ebveanltihaitcioannudsitenrgreisntrgieasliionnv-ebrasseebdrteexsposure models for igher 20 Ecological Risk Assessment "{Tohisstecroelloagtiecdacloinsakmisneasntssm.enTthewafsolwlrowiintg osiedpestweermrienceotmphlietsekdaosrstiistepdrewliitmintahryeFxpkoassseeosfsbmoenat (1) bsAsieotccieeosn,rdeatnomtsdieeaotrnecrhfmaiwcntaeos.rsccfocnoodousxicittceocdloongtiaclmoiiclnaatneetfslf.efctshisotforysiitenfocromnattaimoinnafnotrss,eleacntedfiondilcoatcoar @ An evaluationofecological receptors was prepaced. This consisted ofthe following + aEnxdposmuargenisccuednaerioofs wceorneamdietneartmoinn,edabnadsetdheonstiotxeiccoloongtiacmailnamnecclheavenliss,mhseoefxctehnet 1 USEPA 6885 000186 eas. ns USFW 06 contaminants. + oindsicetooresplecaiesiwterye sofeeexdcybasfeodromnasipoecniers poresmheenteandlror psaontde,nttelyptperensieanlt or expres ConamIskns based on haba eof behavior + Exposure puihwayls) ere determined for exch inicsor specie. + cEonxampinoanastn.duerffeect profes werevise for exch ndistor species and each ste + GAuinskncsha(rHsQc)eifozaiaocnhwasspeccoinedfuoctedrwahgiecohfienvxlvpedothseencasrlieousl.ion ofhazard - {Baavsoeudghonhhteweeosfscoonfsehrisvaetivve riask mltohdeeuClOs,Cs enifiedinthe ial sre wee inberealuied 22 tenoifthefCoinamiananisofCooncnern TThoe tciosnahmienatnhstofweporteentrieaslnceodncetrhowuegreh dheenprieliuminsaryihesocnriegeanl oinncalmuidenamsetalscsr,eefnu.oTrihcee,COnCds organafuoride compounds. 23 Exposure Charcurzsion Tnshdeepeoaebjreepmcoatrisvsebpeorfeetsxhepneotseoxnposskus,reeexatcseonsnteasmasinmpeadnnttmsa.sgtaoPioudeedtneearolmficenoxepnotashmueirpneaaptthowna,yasanadnrtdeendmveeipdrheionsndmtaery nnottauolgnhfbtawehiintcdsh annspoeraxfiCsOfChs,HQInalheslbtaesd iBoemcthe moaxrilmkasstoseecssomng ecnet,niaetwoinlnbde choencNloudOebdsherave"daAppotpeanrteinalt Effect Live (NOAED) qual or exceeds | Eoxppiosearoevt]ocCaOCnsispr.ese1ntaidndiftoiroang1e aXnpdospurryesvpieccoienssviampiinogensotifononcioualmdincaiuesdeftooraxgei,csisnlhiogghecr Treepsiptsonmsyosfteobeeexpmoseednthero,ughtienegsesitailonivofevneabcseasn,d1inndci1d5ehntwalasinegsesrtmiionnoefdsboyseEdxaimmiennitn.g resis ofthe oxiciy tess. 2 HuseChamceizaionToxicity Assessment Tooxdiecteaomfihnee tchheemefifccatlsaofncohdnetsaymsitneamnsshoan bhieotya,aies.nKencoewlosueonsddfegatrheesrafnytd,theeffmeetsc,hanndismmosdoef FOFianceiognenoefrahletoCxOiCcasloagilcall iofnofrwotrhsmeatsieloenctfioontohfepCpOrCospdseeasnsesinmSeenecttiedonndpo2i.n4t.s, Net review 261 Fleride 5I5nomrgaannuicfaNcuuoiindge candominminsgpehauobviequuCiotnournsbuitdnednsteo,thHeoewnevvierro,nmienntdalusloapdroofsefusriscuec,h imaily through amespherc postion. In low doses, is scceped ht fore 5 yo v USEPA 6886 C336 000187 USFW 0604 . . - SrproetnelctyivEesoefvetpeelhd ihntehuomaaonm5mcawoenolflbaToo oneprDpisalea . dHowemsanWieheDfevoselnd e$5e7e7 SGuapmbeo5n1a n1,d1d99a,to1oeden 5ihSstrineehedewemieswa onoan B socmen ssedveg ogoon ScerdueeneiBenogsadtStyoylbeo.b19M8a5oFoTea,tmSeni2oe.tr9B8g3hSpvoanoSspt Eer ment 242 Orpmotuerides oTOnnestahneofrleuearEixweeppsossie innSvagrmaisoAfeebdeuesnaleapAorrgoaicoeslnoclvdpineemhee ceodecrsof eescoturuneacoyanmorfeorpsenosepmriareest.o dlnueetedssmSUliedeendsd omlipwoeeentsofones Sd AneR1ss mon nd rss Segiency sty sonomml cls (ED 157 245 Aluminum KBecisaumsceioafhainsosmmoyneogseros?cixhviiyo, snate o(a0n, (gADo1IsnSnasanfv.oiuniod1 v4erfeeeonmnePeltrinomeprme rFaebsi8es teosotenlhoe tufSsRhYunrd,ose(AqTSERw19i3s0.oS pet TTCEo opinoses gaon0a s,s Tohnr.e 4Bmadguaatfoenr-- oefsfomeons-- oniowfsoomafod Coie fo habe (ATSDR 199) eorenvo OarNesotmFienewintA-- tnenaasn-- Gmf,roAn-- ,loSmaar-- noeimser sSteon noEpo onBa y amnamd eshAn(edTsSaoRet139o0u, nAsmhoisonvaebseneevwelmopmeeonrttrwitph gi Gonin 200 Aree CNSeaovtnesarn1et9v9br9iinAgarxiieinnsseee.dseaoeveoa,lwowfiimclahnediisaucsh(thEserapn1oe9r5ef0efetCshooofsiAtsn(r1io97e8c)1ao9n8d8r8e, opoaarinatbcanetvaassoitnoosesmaesSnebesasmnw baANglhonsrorspornHloemwerse,,rr1Faoeomaeprsersn maone tes 1s - USEPA 6887 , co9izy 000188 USFW 0605 (AEslfreorrem1c9in8o8a:nnae2rA.odbif2c0cr4onnd1i9d4o1ng.s.Th.e USw.iErPAad(1h9i8t1)rneenedet(hvtaalseetn)siie Genpuraedvolmeinn)anits fosaramsi0sfo1r0nI7tnvfseoirrgifbsiracaanensidryapnogneecroeonrrmi3e1(dpeinn1a7avfqoalueeanxypnovseAurrrseeeb1naiecassm;eawycheboeexibbidoodecyo(ncseicovaamnlaetcne)dennbdy vameanginiafmiaattihoenbococuorms (oUftS.eEoPoAd1c98h5a); however, daa do no indicate a Sgificns 245 Benium T2Trhe vemosautjgooih.cdyBoeefrptyhoelboeafarnyamlliplaymeer(8ne6)sibweayttlehruewmae.ynsvUiBprrooonnumgerhnetatchhseinwtgeeswiaelreressiunlatgnoof ofsfcc,oalbnendrdsyoolill . ormotn,iflyuroemrinid ,nphsosoplhbatlee,fnod shiuaf (geneermaldlyaim)mobwielea,l wHaotweerv-esarl,bbleeylfoirumms (ATSDR. 19934). SCDilutoe.w stoTuhearegsfeoorcaeth,elmboiewcrapylHlss,umniids emxpmetaiocytseulrdemtmioaanihunarmvpe,rbileeicmyitilttiedueymmdaabmsialsysoylbueinbelsxeoplecc(otmAepdTlSteoxDeaRdss1ao9r5dH33io)g.hneor iBnewfarirymnlw:atbissomfnaohtgaienfxspeeoictotwenadtweirb,kiiTaohfceoodndecgcerhenieznasofehtaoixsnibcaeiqetuynadtfeioccurnedaa.nsieBmsarlwysiltahunimdncinrsoeeasxeievnigndhleanyrcdeonxefisocsr (ATSDR 19533). miManjdaorsmeedxipimoesnustr.eermAl,otvnufuoogrsthaqiseueaevtseirchaletcdaelivoaegliusaatlpecodiehnptetoarreuslatithineocnusndheeigpaitbnigeveeseteeifonfneocsftescdioomfneabnetmribynleleirdumysililn. Concentaton and abstved toxiiy (0 benhic crganisms could be ound (ATSDR. 19933) 246 Chromium CC1h5o8rn6o4vm)e.iruImnto(bCho1er)tcfaermelsehxwyiasteiarnbaanxedidmvtaairloiennnestsey(ss+3t)ermaasnn,gdihnyghd,erxfoalrvyoasmlies-n2tntd(++6p6)r,eobcxiiudpaiitasiimoonsnstrersetghue(eEimnstollseytr nSimidpooaerctccaanmrtulipartoiccoeonsnsadersoshr,aeltaiHdvoeewsleeyrvmmeiirnn,oeru.tndhePrrfeaatcneiopxniiadctenedldCecrot"swhopyfdHrCorcx,oindwdeihdseirroeneasm,saCianrd"isohrsyepddirinimed3nentsds G(mrEasbyiesnroel1u9cb8io6lmi2pz3le.eaxInindnsgroeismu,abitsnhaansscoeflsoun,biiclAihCtyoruangudhlberosasovxaaidlibczeoidmyptolfeCxCrerstrpoelauyggo&hvmemomiexrdinsbggyaafsnoidiclaepnrHtiFaolnned ames and Bares 19833 mes ad Bales 19830). aTnhecsasaelnealn slaemesnttheinfmeammumaslstbfyoumndaiinniiolnoggiceaflfimcieantegl.ucoTshei,spfiodr,m Raunncpornosci1n5 Emeliesb1o98l6)(.StTevheensbeoam.sgn1i97f6i)c.uiCohnraomdituomxiiscitbyenoeffCicTMial ibsultonworeslinveltotCo rigbheecapuasnetosf . USEPA 6888 000183 C655 USFW 0606 : . i : . : aitcsculmouwlamteiomnbrbaynaequpaetricmeaanbdiltietryresatnridalipslannotncaonmdasainviimrayl.s inHohweevleorw,eraTolaprigec dleevgerlesehaosf wbaekennodvonc,umented (Eisler 19868), although, the mechanism ofsccumalaion remains Hgely atCoshxsuiocoicmtaiyi;ueiednlawiiistvhmeulatybanIgosersnmiica,lkcneaonrwzcnyinmaoebgoeaunciticvt,hieayn,odxailttceerirayetodofgbeClnoiroc,d.wcihAtehmChiisrgeh,ecxlohoniwcbseirniemndagirotehnsesi:sgarCnecartees4it opsatmhoorgeegniucl.atorryguapnsiestm,sa,ltebreahtaivoinsorianlpompoudliaftiicoantisornusc,trdei,srauapdtendhifbeieidoinng,af phihsottoepsaythnoileosgsy:, mRuacbobpiaslyfseadccdhiaeradreys Cirn tahcecusmoufltattiesdsuehsy,alcuaruosniantge,percihcoanpdirloairtyinslsuelrfoitsess,(aKnucdhenreuarnadl Suhnadbeannoorvma1l96c7o)n.diTihoinss,apcrceuvmeunltaitnigotnheblnoocrkmeadl brlaonosdpotriessoufemebcaarbiorlsi,csw.hiOcnhearmeaipferemseaatbolne odfamhaigsec0ondtihteiboneuwaacseltshecoinnhinbeitdiotnheorfeiinn.sulin production in the pancreatic les dut to oCfhnraocmeiluimlaalrsovlacuoales0,ndmeipthosvcohnonddraimaalgeswveilaisnwg,elainndgcnytdoplloassmoifcmliicgruoevficalt,iotnheafnodrm1a0t%ioonf cells ining the nephron surface (Evan and Dail 1976). al"vTeheolparreltiismsiunea,rfyolsliopweidn bCyritnhdueclecidatreisopniorfatiornyflcaamnmcaetiorysrpeeaccutliaotnesdion lbuengthteisssucearlreiandginog,f Doirberctonsckihnopcnonetuamcotnwiiat,hhailgvheloylcaorrerpoistihveeliaclhrcohmaingceasc,idazaondphfys,naayddbreindigpnrorduumcoers sfkoirnmautlicoenr.s and necrosis by3 mechanism indepenodfeanyt allergic response (Steven <1 a. 1976). 247 Copper (CRopTpEeCrS(C1u9)1do)aesndnoatpaopspseibalretocahracvienomguetnag(eVneinucgporpoaplerasnedsLIuRcIkSey1915907)8,).buCtoiptpsear tisecraatuosgeesn and acute toxicity is primarily elated to his propercy (Hatch 1978). rCoepsppeirriastoraynpeigsmeennatsl(elDeememnatyfoertaaln.im1a9l8s2)a.nd1iss3 clsompeosnseennttioalfomainryonm(eFae)luliolniyzamieosn aanndd (fVeunnugcoptianlienaoznydnmLesuscfkoeryen1e9r78g)y.proEdxuccetisosn,Ccuoninnegcetsitvioentilsesaudesfotormaactciuonm,ulaantdiopnigimnenttiasstuieosn, emsapyeclieaaldlytoinitnahbeilliitvyeor.ftHhighivleeverolssoofrCeuanmdiefxcyretheepaatiioc nmeatlabCoul.isWmh(eBnrloiovekcson19c8e8n)g, awthiiocnh eHxicgehedCsuacleervaelisn allesvoelinthhiebimteaeslsienstriealleamseeudbionloictheenbzlyoomde,sca(uDseimngayhoemoetlyasl.is1a9n8d2)j,aunTdoixciec. esyamlpt1o9m8s2)a,ppear when te liver sccumulses3 to 15 times the normal levelof Cu (Demaye Aprolposoed:uhfeogerxmaahcttiomnoecfhasnaibslmeoifnthoixbiictiotryy icsonmoptlkenxoewsn.witthhrfoolclhowriongmemePch4a5n0is(mWsiheabveeebtealn R1u57n1c)i;onimopxaiidartmieonntso(fRfeiunnecrisonaof.NA19D8P6)H:-acnydtinohcihicrioonmoefhreedmuectbaisoesaynmdinaelstier(atMiaonneolfmi98x1e),d Inanuclear inclusions may act 3 2 detoxifying mechanism where Ca is complexed by 2 USEPA 6889 ` 000190 069:29 USFW 060 een lgds,precing capac rgnels (Demayo 1, 198), RBumaingrns rce thue nmosa:kseeanvimealas arnmd aarsopercieessovsCvueoveo Csa,cYyounGgoeannuigolpscsai Litey 970). 248 tom Leeomna(iFs compmraontlyiedenteacfttecdlin1connceenrailoonyssof35 weplren3smaamrorseoinesia.fdrosguend. emetaeaynnacccotomopflmvmemcpeoodguoiltioxnttdocsaesslespnrtobcecspo.asTth.snidTssrpneoo1srtosierwopeelncsohrnen . go ernesektooexfpesbnotddoey o rdooEgnompec dop. epArdogcveseafforouvcso,.owfGdreolnnneiirotaynomta3ys:m0ep1ndeovslel Ebtumreagaead0dcesopurpaicoemnotoosf,TrTehoerum(oSanhscadhleiimeosfdimBoloeySrghbeeengiu1n5s8,0w)i.rhessicn sIrovnlcl 245 Lad L2eadndoieas lnotabsiobmaegyniefy txo agereatedxotceunmteinntfeodod(cWhaiinsn, aalntdhoDugehvascc1u9m9i5l,atEiorn by15pl8a8n0t)s Older organisms typically contain thehighest issue Pb concentrations, with the majority of the accumulation in the bony tissueofvertebrates (Eisler 1988b). reeeddneiianeggehveoigceecsue.mvlalIniaoeenr1uadtlhoaexraimnecaallofesP,nd ciisnioerlamdeopnssreaonmmroustnenpfnhfykdseicBcsawn,ehneeuemrcaedpaPO Co5or8mpaio:ounndIsnT.lonaeed.yPooucni g. mhireaoohwhaoyprredhringowSe mhsootisnsueaepiaebildeiof,cosiforoeescrane(Ew0salheeer Droessianrgnoafnseniedl GosHs,apPo19n78g) Be cements of sapropomnysten Tmehievltiio,elfrhefadunscgeosdf,P0Hvotownhensaeqtdu,iFmcpnratnoddeeticee aOsUQagaafnoesremaslcahseeeernxyscaeheelrtavonnesd, omnndescn.hcsaen:d eGecnuemrualr,uePoathheimstsophoeriTsoomrgaann (oEifslheerm1,593v9)e, rAtyigshfcconcbelnoaondtohnes mess,eavnd CTooaaitngemoral, mated hes oo feral mrves rv oespot odo Et PB inlarsacc.an uTpekr eulbyoousghpluapnfdcardpeeepoPsoioimn i$nA ,0dust,mAsenrdA eslylroesbtyedpoo soak rpoHganhd 2610 Manganese A 2 USEPA 6890 000191 069..5% USFW 06 tSTroeleunbliaeapaeonaradvahalelaernisnfssooml.o4fT0pdh1i5mcbobaii,l oRfGerlveiaaneassdetisoumoneiSnrscbaileiert a,ffCevcrteiad bbey IpHr,Ornedox Tirso Basher od wore 980) vSP iaanns,,RpAhG,8 CoowEiEnT RgTSoonnsdi8inPsAAVeWneadeipeensd-- epntpon-- oBebmro-- nteh te--ee-- ttl FmommnsaiountoftvhienSiohpacnenuaiaonslsefuunadllyhebFloew1be hdeeceirmetmseATooeoroes VVB einnetko aGE nimtehgeps iAsecSoyk.1o-- hpe btoy-- edecrenit-- n oC mec-- ope hens m-- ooemet . 5eofgvoyytrt.piaDasnmeasgseodadTva:cepopoGhrpaageteoiseminASTPdaie EeaYhua,owfhechesBshOpaSnofsmoeierpopfnoeenlyt jnovpi . This Piuipi ec or he Erofmer 60s C0 mtd aes 2013 zoe TZieingneuedbu(iczaindn)gbyihemeesaleoncbiinyolnocffo2irn0ns1o,0rmbMalehagNrvioowedtrihotannsedisrxediprtvodeuecitbimeonnpeiosrl(as2sornsacdgssns19hl99n)atnTdahfs . ZioptockinmoiwnnaoeWdoscumaie n ood han, eas segs br bo ant onZFidZnncaaisnbdsluecprCitmueaordyeffmTiecboioenlntiacalnfde(mcRkeAo)rn Zed-dwaeipdtnmdeamneerenontyuoeefichctsmrseNp(lCARaYhtoendohFeoense Cm15ae4m6am).a(LlaT.hse0PdpanCnccoeresmass1a9Snd8e,vcKosantiinseceuedmsenopdabVpilnhaeVshipireeim1vaa9rc8yu9ra)leaZiisonne,osfesZllnlrosncssletyphsyc.ssnmsldomnds TFirohooSonpn.heo,rZniundeantdiaondxhuicrecsmsoifoneamatas)e(zckesa{ca,ifoa1rn9i8an9f,gglGofilSoppnisencelolroeadndbynshe+evpheriompeeoyrsi topen Bh 25 Selcionof Assessment Endpains `dTihAsecsiunisfononrsGmrwaoioutnph.ghaulebleorUweSedd.fdEuoPnAr,g eaalsseechireoeosfcoonsomsdiisnsmuaetnenertnnednddpdohuirenitnsRgettgahiesonceod1neswBpoaron,docahnpdisoTbeeogpumuenibt oy{pfoeistrssp,rsemnsdeanoltdh,ee0DdlryaTonRhtuin,yCgrrweaestskyesmise.k.daTfwhoser,dstuiehncgrcewcokd,maspnadinsnsoofcLievewdainpnetsofremerbrenbsio.sodmobwdeiinot,g CfEnoAvceuRnseeTbdrwaS easrwdertkhyeseclwueenmreten gmeroeudps.croVseuonfBeoisfeepyeoss,1TaiorveiToar,nshaaemqsueeenvpeohnpslmsaioeds aond , 5 cos gy USEPA 6892 000192 USFW 0610 i - nangeese O (via doo snatymat cnfeuncmeeaandnohregviieopmmeanergnadnuebussmeaccteoormmpvopunaedrs tohamvoef eo wnaasepnarolftnsfdlo.amRspeimiaovnan.l Tfofhmoemgmheaealnammsasaphtwertaeeiwis amotcasenyziodlvnayugbohyf a oiengwahyerscateonseepo1i,esdDdsieaadianmepnmHtasnegaTsnheresteie(nndVdennc)yoofrp.srMaebidlneonmmeiangssanosesnce o E CD e two venskpoihsoinncdovsflidh.e ssHaol.wdeevvpeierangbamineoismelagioinnfwieaceicoiomnnayexbcoehoasdnggheiapfsacnmlaiyy Soke signiean (ATSOR 1990). T oe moun oe fmanganeasfefbsrheoonrrpceiedonebsoepspiatnrheg0g%audrisnyeeGaosncadtinscfvowaditihlli.wowrTohe,nreldvOolneess utoyense amheiFpiopn. yTis 8prhoss3bly(bAeTcSauOsRe 1b55a0h), on 3nd 2a veka e Bpueicketl (t 4iissbarc,owihfinoteeudmnweilntohhveiresvuimsraelanlmyseusnsoetdunotxdhidneeaslfoorsmfasitd.ieoNnsi,cfkaeNllilcskseel(sm6uacyh B Ee o an haenrimoranonsgma,ennetsietkh(rVloiu)gw,himlUintdnaegcr,haco0iidb3icucconndgisieodpniosmw,eenrNtipaamrnasiy,sbc,eocaploeumciramilrnlgey a F eteee niopgtossbnewa(avnci.ryT)theToeeincsvailprNoiincmnoennscneadnnrdhatv1iiocvnoeciphoenamedilfcasfoaoliesao.fs fNiom8 hTe moes apvorianmebxpaoaisenroustieosf.oefsNTaihveoenresvpasiuicgohhnyaderslmiaalemoncnisoahnebopfrlimanrnygaosfg,esrrs,osfnsid C goO t wesmheibg,disuaiial.vaatnidonnrenosudsteqhusioorligngxwe(piAogThSsOaRvwee1r9b9e8ne)nendotefod hinavaeniImeahlasrgeyx,poasesd i0 2412 Vanadiom Elman!avranaandiarusmiadpososgennooefcvsacomudnisaamumnrasclayebuntaslcaildynmcieonsnlsneer5h0,,disfpfseeecrwieaangtreyeissnlusndcgdee,sTnlhde Tareseasotmcatf rreamodves oxy3a2n0d cTotgs,15w0himchgi'mpnrdoves0heUSST.Essgiis 200 mig (rem ata. 1978) he elesoafovannadTiiusmptroocteseuarnadlsocfovoerrs sas ese3slloolfehSevween fnonoff ehckoraned 000. USEPA 000193 6891 USFW 060 27 ren on the sie? FAteeprolecvueclisvosfuessieescoafncaammiivnoarnosussubifridcsiednut an the se? 0 hceaiusne gneegantiovfce iompanctas eamndggroweth,ssuuirvwivnatl,anansd aeApstreeordlaeocvntetlihsveeossfuicesci?etesscoofnctaarmniinvaonrtosussumffiaciemntmtdoaecalusesheneIgnagteisvteionimofpcacosnantguremodw,rasguervsivsalo, aenndd fAireteperroledovunectlishveossfiutsceic?eescoafnptsacmiinvaanrsossmufafimcimeantlodu caousteh neignagteisvteionimopfaccotnscounmignrnoewdthr,asguer,vivsaol,, aendd rAaesepersoldeosvnceiltsvheossfuecs?cieesscoofonmtanmiivnoarnotussumffaimcmieanltstoduceautsehenehggeikvieonimopfaocnsaamningmroewdth(,rsaagveivsalo, anndd WrAearptreoldeouvncelitsveeossfuecs?iceescoofnnasmeicntiavnosroussufmiacmemnatltsodcauueshtneegiantgievsetioinmopfaccsonron egrodwth,omsugrevivsaolf,, aanodd rAtesepesroleodvnuelctsehsousfcesc?iecsscaofnhaembiinvaarnosussumfafimcmieanltstdo cuatuosteeheneignagteisvteioinompfacctosntaomningartoewdso,msguer,vivsall,, aunndd Conceprul Model "mpTaahtyehcwcoanoyemssesoeiutnahlecomsneoltdeaeccltewrdiemltiehessssuoubnrsecumroefnnattcaemein(ndcapanotrinhnsw.dorhAsatb)ihtaeantdDhraayrbsoRcvueenr-igCrsroteuiknsdstotteeimdceenrtomiifynncsraietcinceaplaienrxtp(oossm1uarle mrieancmseopmtmaoelrssc)ainsienshsatebhiainrneeganshtmeoawnyobaoedienegdxe,sptwoieosdnesotdnofdss,oitlea.ncdAopboenvne-aGgerlnoduatnrdoeauesgmohefstdiheaeltierce.ocnetpStaaocrtbsswumirahsycsebhersecoxlr.pnoasineldd i1f0noeocdionneganemssii,noanaonnsdf harteoeuirgnhcaebndoviivocenegalrcoiounngnaedcseteimwoinettohiftashreuesracfielcp,ethwoearsii,tnghefsertoimionnocainfdyeosnutfbatslhueirfnaecgeneeenmesosfeitssoa]ileoaidrhmegraesgd ,eto Thvearwioeosdofeedeasretasi,aipaanidanavairana,reacnepdtomres.adoFowraerxeaasmpprloev,idsemdailsltionmcntihvaebriotuspaersmhetlmmavy soucpepoopryt Cohonsneetoarmhaialnblainhttses dhiian blmiuitcnhspeteahsr,chsowafhmeferooewdsa,yKae1nmn,indAisvhvioadvunealpgicrsaocruinnvidovroetrseor3uesdsmzciaaammmrieavcolerpemosra.ymryThebegecaeoxlnpsouasmvepedtri0soensaioef ciroannasmfiencaoendampriyn.anthsetnochideesnarlesienpgieosrtsi.on ofsllscdimaendnsr,e consumptionofsortieswie may p"TahtehcwoanscsepTroatlhemosdeellcieedlimeesosmucroenmteanmtineanndtposinndtsa. bTihecphraerlaicmitnearriyseriosk dseevnenyecnriineessexmgoenrulree sfeludoirmiedne,t asnodil,wiacnhdlwraotfeo,romBeentthhaincema3c1rtohienvperniembarrcyecso.nt1ahm,inaanndtsecmxeeseiisngAwbeennccbhrmaaerkssm1aysibe = USEPA 6894 0a..24 000194 USFW 0612 ne sei sme: nip slid fo is cog isk asses. enema pos wer cont lui of namin he ry Ck: I preifboeinc verbrs communiy scr nd nin 2 prceionof il verars commit scared scion prieneof eccoonmomissscsvr pircosdsupcoerSeesconn docs ok eve ty preioenfrwoorp<uisnonioswevreo pnrsodociofvse ciens.s nore dos che econaieumTvoarsosoiorhc,sAr,hafgirooniofncoUnEtSai.ns in (rag oc hve econa amoopsusomnaflostiose,thrionsdceoeens.nie dos Khe prionbofeiovpemonaorvlinvar. ndgpersoianctoifvae rceisn edocs have prionhaanmopreemsarlsttaovralidgeiopnofociasin n ge dco hv . 5) prtertioneof npsceivenroussomawmmmalvo ennsudreehartoindgeesiocn ofscontminans in forage docs ot Jy petecin avatrossmeammvalas lndeu itrnee ioncosfsa. nise dos 26 PTrnoduectilonofpToesstaeablseoHrwnyapeootethsetscesoosyq.uestimonmys ea8nstmeioftxeexpd " onntshepasisnimeasnnfonsoihynie,sSosirsee2d pec vosrisieecsonsensus gaie cs onbsic nvercr mmeny ASvrevelntfnieccnosines fT a bave nega fc ans vere coma adveerteofhisibcitcsontamina Tes to cae ic 0 to uh grow, svi nd ave evs oSf seecmomeinnssuee too casge gnivofeairmspseodn ogrogw,, siia, x USEPA 6893 - cov.0; 000199 USFW 061 98) IInncgiedseinoanlofinvgeesgteiaonioofnsedimenc lncidenal ingestion ofwate } 28 Selston of Measurement Endpains caMshesaaerssaumcreienrmtiesenintsdpesoneilndtepsciibndyesamaeeacshsmaeeasnsmiuersnatmboleenfdtpeocoilntoxsg.csiaMldcetscsshhuaroresmvceenortfiisesnxdptpohasotei,saesMhroeeuslstdesdbeetoTnhaaeddvcanlue,ed uSasesdime10tdeendvpeoiqnutanicaiveeimat of ptental eT, an for 4 bus for exvapomog pEMonefssoesrunmraaelirofsoneonneexnwpdhpoiosiucnrhteisstwoecclroensaealmteiocnntseadnctaosnulhodfebobeabnsaicssoeefd.powtaeTsnht1eiaalsavparlpebsioelrnyonfoefccieoepnoaprspsrtoaiprn.isateSe,itanonahydie - sideelneicfeidedwfeorretdeiseitrem.ined to be represenaive of exposure hays and seven odpm NineSetctsionls2.5o.f specific messes endo ht comepond othe assesment encpons enifed Measurement endpaints for assessment endpoint: : protectionof enti nvecbrat commends sovcnure and uncon TcfioovlelecvliaoectdaattoieonmhsebfysvdeeoercrmeaionainnndigsnfaDxnryecRnuiino.cfoEdnhxieivbeirensagitcsnomdcmoutmnhmiruotnuyigthSyua,ncberveealruweaatsimoeanvcaorlfsuiaRntnvecdeirscoobnorstaheosuotwietfnroge sous CiSeeodelieml.eenTtahwnadesnadlnsployizcnesodolfftlorheeaiscrnegteseexsctadshwyoefetehosuitrvv(ievTaaAlLen)sdmeorraolos,wcB.NCAotl,leoiPcnaerkeudPsiCsnBeg5dh.oemVeanOhsCiapmhopdoes,orvHe,recpatlosy vSiezer,saendbtiaelrgeaspnoinscescairnbhoen e(TxOCc).h eThse icnhremicsmiyo rGeeseursmiwnerFeshepnotceornltoted wit absent Measurement endpointsfor sessment endpoint: proteronofsoil invenebrae community sucave and icin Thmeoeasedovewa:tlsaltowceattrhieonsssuuravnnidvsasleaannddd wfgirronwgotthn.eoeCfxalrheltohScwtioed.coEficleomnmpmfioltt,wesroniel kwoaosxccollllteecsctttsee.dd Tafhnredomsennedacppohaioenftdstohoref caarrbgona(n1a0l0e).lst (TAL) mess, BNA's, PetPCB, VOCs Turi, rain ster nd toa ganic Measurement endpaints for assessment endpoint Snprcogtaeidvoneofifmphactcaonmgmruowntih,sstuorevnisvuarleahnidtsdeiersoexupossusreutnosc.oncaminants dos nak have 27 USEPA 6896 065-25 000196 11QEW naa . m expoe setdowchohneccatmoinopcaneinierdaltseeovdneoimlfeintdthe,ntwcioafnieet,damioinrntsahoneilscBoofrcmoeousngpchoenddmiriefncogtutntoodxxiiicnictityth.ye tsFeesodtrismtteohntdp,eutwreaprtoemsrie,nseoorfifibeislntwrheiirseck CaoOerrreeemsosrsfbiymshafeyoerdatilsneageebosnaeolxripgnoavsneeimsdemtbsorwcahotiencsthammahiaynvbaeneasacfcruromimuskl.faoiToededriCengsOeisCatiloinrehacenedsptvoiisrassuimensac.iydHebinegahleexirpnwogoseepsdhiiotcno Seaiym1enhertefaenrdenwcaetearc.esTsheapmathmwaayy itnovtohleveregfreoruenndcweaatreera Fmaensapdoortw. iTuhnekfnoolwlno,wihnogwpeavcehrwatyhse Sere evaluatedinthis isk assessment: I B5enthic iDvierensetberxapeossure o sediment I 3SoilinvenDsibrrecatteesxposure to soil mo 5Fin Direct exposure fo water IV. aW)ommcatiinnggesbiiodn ofcarhworms 9b) inIcnicdiednecnaall iinnggeessttiioonnooffwsaoitler Vv. C5)amivoroIunsgbesitridon ofsmall mammals 9b) IInncciiddeenntcaall iinnggeessttiioonnooffswoaitler VI C5amivaroIunsgemstaimonmaoflsmall mammals b) iInncciiddeenncaall iinnggeesstiioonnooffswoaitler VIL aP)iscivoroIunsgmeasimomnaoflforage fish IInncciiddeennttaall iinnggeessttiioonnooffwsaetdeirment VIL 5OmivoroIunsgemstaimonmaoflforage fish b) IInncciiddeenntaall iinnggeessttiioonnooff wseadtiemrent IX InsecivorIonugesstmiaomnomfalanhworms . B) IInncciiddeennaall iinnggeessttiioonnooffwseadtiemrent X. Herbivorous mammal - > USEPA 6895 000835 000197 USFW 0613  nPortothecvtieon3onfecgmatniivveoriomupsacmtaomnmgarloswtoh,ssuurvirvahle,atainndgersetpiroondoufcctoivnetasmucicneasns.ts in forage does PtFrhooeocdsyioctehna1ianntdosr,cacduj1maaucelmnaottdiaosrne!asfs.tourdoiTehsemwseenrleecietlemedvcamtmeemodaasl0urieravenaomlseupnuaettceeisneid.kpAotionmpraemcmepaptloifrraonrpaegscopeiesccpsiepecisisewhsrh(eicfrihahcucwioeelozrnee, qidueanntiiffiieedd.fo the above receptors and the dieary exposure of recepiors fo Soneminant was Measurement endpoints for assessment endpoint: : nProottheactvieonanoefgnasteicvieviomrpoaucstmoanmgmraolwseh,esnusruvirveatlh,aatnidngreespiroondoucftcivoensaumcciensasntisn forage docs - tFhoeodsitcehaainndacacdjusmcuelnattiroensss.udiTehsewseelrecsteeldecmteeadstuoreevmaelnutateenrdipsokitnotmraemcmepatloirasnpescpeiceies wthheicshhuotirlinze SSpherceiwe,s (Blaerisnaobsre)vicwaeurdea,de15n3imeoddfeorlthfeosrbionvseecrtevcoerpotuosrsmaanmdmatlheiadnecsrpyecesx.posAuprpeorofprreicseeptfoorrsagteo contaminants was quantified. Measurement endpoints fo assessmeat endpoint: nPortotheactvieonaonfeghaetribvievoirmopuascmtaomnmgarloswttho,esunrvivsatlh,atuainngdersrteiepornoodfuccaovnetsaumcicneasnsts in forage does hFoeosdccehaanidnaadcjcaucmeunltatarieoans.sTtuhdeiesslweerceedsemleeacsteudrteomeenvtaleunadtpeoiinstretocempaomrmaSpleicaienss1psetchieesmwehaidcohwutviolilz,e (Mviecgrerautsiopne)nrcwyaisvaniidceunst,ifi1e5d3mfoordetlhefoabhoevrebirveecreoputsomrasmamnadlitahne sGpeecwiersy. Aepxpproopsreisoeforrecaeptsoprescie1s5 contaminants was quanified. 25 Life HistoryExposure Profile Information eRxepcoespetdorospceocmiaesmiwnearnessbeeleccatuesde offrosmpesciefviecrablehtarvoipohrisc, lpevaelrs.saOfhrgaabniistmussew.hoifchfewedeirneg lhiakbeiltystwoerbee wsehlieechiedrfiosk ecvaallcuualtaitoinonins tciosulidskbaessbeassmeednt.wisThselso vanaiimploorafanbptpircolopnrsiiidsyeeraotixoin.c iTnhfeortmaetrieosniaaln sipnevceinesebsrealsecrteedceoprotrisseleicstkedafsosesthsimseansteases:memnetaids othwe veoaln,hsohromrt,-aTlhsehtreevwe,srzaiclcovoenr,cbmriantke,raencedp1t6ord Rfoaxw.k.ThTeheavaiqaunarteiccepvleorresbpreacieesresceelpetcoterdspfoercitehsisfroirskthaisssiesksmsesnstesasem:enAtmiertihceafnatrhoebaidn mainndnroewd.-aiTlheed aque invenbrat recepor is. tea. 29.1 The amphipod (Hyallels ceca) as Representative of Benthic Inverebrates jusiiction cHsoanltlaeclswixtthesceadiwmaesntsfeolrecatseidgnaisfirceapnrtespeontiaotniovefoftbheenrtIhfieccilneve,rseubbriaqcueistoduuse dtiosttrhiebiutdiiornecitn aguatic sysems, imporance 153 food tem for aquatic-inverebrte consumers, and. eas of 89..25000198 USEPA 6898 [RESYYRNSP * : - . . - sE aTd w mninnoew,aPsimyepd haalofefoso rhpareroegmsetlassntwaeorexe ssirc(vTisAvLlw)eamnredtuaslsstd,oBw10N.Ad'Ces,oelPlemastuehPdCeEwtsax,tiVsiOysCasomf,plfieesrwiwaecre,e eonieorlespoonsegsintchaerbtooxnic(iTtOyC)(.estTionohredmeisr0eydertesrmsinewerirskhponreonanll.ied wit observed Measurement endpaints for assessment endpoint: + Pproetecitiovnofeworimm-peascitnagnbgerdsow0,enssuure trhavainndigreesvptriooandoulcftci,ovneausmuicneasnst.s in forage does not FEa oodwchaein acnAcupmpurlTaohtepitoenelesfidreidgeesmewsspeeircesieessmelecencattweedantndopselvsan)luFawetee<rpreilsdrke11n0icaeviidsanosspheeecieAssmheworhiuicceahneuprioilboiznre,t2rhdecshisee fo hesa , or otheccalopseleyrrel0iecdosnpaecmineas.nts was quand snd compared (0 exising (oxic daa Measurement endpoints for assessment endpoint: + FPirvoetcainoengoafticvaeimmipvoarcotuosnbigrrdoswttoh,enssuruvrievatlha,tainndgersetpiroonduofcctoinvteasmuicnceasnst.s in forage docs not aFFootdechaeain aacrpcesur.moaTlphteieosrneesfncoderiadegsemeswapeesrcueiresesemlmeenacttleeldntdmopaeoviranaltuearte)ecewrpietsokertsodpaeevcniiaeinsessdptoehrecsrreewdh-stihicolhveedleihazewe.t,hBeutsnietdae aOfoSthespe,ooirnotthoefrcleocseepltyorrseltaotecdonspteacmiiesn.ants was quantified nd comptuo evxseindg toxicity Measurement endpoints for assessment endpoint: + Fproovneacvieonaonfcegaamtiivvoeriomupsacmtaomnmagrloswtoh,enssuurvrievatlha,tainndgersetpiroonduofcotnivteasmuiccneassn.s in forage does EFEeoodee chaarinospjcacscuaemnaetlaafrtoeornsa.gsetTsuhpdeiecesiseewlseemcrtaeeldslemleemscastmeumdraetlmesen)vtawelenudraptodiiennstirfteioceemdpatfomormrpatleheicaiansbosivpseechrieeersceewdphfooirxcs,haVunuidllphzeees Gian exposureof receptors to conaminants was quantified. Measurement endpoiats for assessment endpoint: + pPotrhoavte aeonfecpgiasttciiivveooriomunpsacmtaomnmarlosvteo,enssuruvrievatlha,tainndgersetpiroondoufctciovenasmuicnceasn.ts in forage docs EFoond chaaeinvaacdcaaucmeupnltaatfrioeosrn.agsetTuhsdeipeesscciwlecesir(eedTshme)eleacwsteuerrdee1miedenevtnailefuniadetpdeoirfniotsrkrttehoceempaatmboromvsaepleirceacsneapstrpoerctsiheeasnmwdihntikh,chMdsuiiieeitazlreoy posure af receptors Contaminans was quinified Measurement endpointsforassessment endpoint: = : USEPA 6897 000199 000.227 USFW 061 esiaerthworms were observed n both the wooded nd open field srs of he Dry Rum Creek LifsHistory. piElxarnrttwliolnrerm.sanNfdeemaeidtcoroonfodaouendsa,d.ntThdehidemeocpsarytiiminamgrpypolsraoanuntrtcaenrdoefqiufimoroaedmlenrtdeemsaxiandpselqa1unnkadtmeoonmtaefnreo,esfSv"inewg assori rcoonusegrhvatthionbomdeychwaalnliswmhsicrhempuosotrlbyedkeevpetlmoopiesdt:. eEsapirrhawtoornmdsepweengsenoenraillyussmoensofopbeen ianndsoiinlswlitshwvietrhy copaHrsofeetesxturteh,anin4s(oiLlesewi19t8h5h)i.gh clay content in regionsof high rainfall. mEocxacrunrtyuwvsiopterhcmoisuetswecalBneearlmmasp,phrrooovddauirciiecesac,noodcvoimodonuscssp,sapnaehncedienpsagareesnptritodiltuchcayeelyob:vycsSraeocxs.usabflterleupzlaaediooonrtnig,osanhocoreungth eissmenmtiaal,. wTehlle-gproopvunlaitmimoantoufrean(dcolaetswceonr)m, msaperciiee,s nstdaneynsoanceenKtoniencioonns (oxfeyaournss and Lofty 1977). deEesssiictcadoteisoisnccaahntaidvoenasmaebvniedernattlecmwopaleydrsoaaunfrdseuhraevtix.vienIngstademvmeusrcoshfe pemonopvruielraoetnaimseolnnytastulhravcinovnamdl,iadttooenescosoucncohoanassnss,oanl cWoonrdimtsiomnasybaelcomemifgavroeratboldeeoenpceerasgaialnar(Eudnwdaerrdgso SaantdeLsoofftiyna15c7t7)i.ve und] enconmen fpSoroelmtidefae,sappeeodcsifessreosmotfahewraoodwmuislngnguzrmoobnweertlhoocrfaostueegdghmjoueusntttistnhpoeronntliovRfeasthcebhyinnsgco.antnidOnutiahnlelcryrspaeedcdiiienisgesseuwgmmiensts ianpcprreoaxsiimnagtetlhye4n.umybeearosfunsdeegrmeanbtosr.stTorhyecIofnedistpiaonnso(fEEdiwsaerndisafaonedrdLsofwyas97e0)p,ic a oe Exposure Profile 1iD0ikreevsacslecusaotmneetanrctis.wkiotShurtcvhoienvsteaalomaringnadantgiersdomswsto.hlTseinstdshpueoeipnrrtiesmsiafdrouylelroaowunitanelgoyefssxepxwoipnlreears1o0f3obreessxoohnsdwaoicrilmedsoeoinnctoihuiss worms 0 determine exposure to higher Taphic eve organisms. 293 Fathend Minow (Pimephalespromela) 33 Reresenaive of Fish Community lustification Tcaqhauemaptfoichsiesoyansdt,emmdisi,nrenciomwcpoonwtraaascntsceweliet5cht3ewdaftaoesodrtehfpreesomeunfgcoahrtthivetehaoetfiioenmgncilcveoon,rsouuumbseirufsii,sthoavdnsudeciitssoeeiosofsdsioeeary sboratery toxicity evaluations LifeHistory = USEPA 6900 . n 069.15 000200 1180s ann SseeciinmeansbaathnrtyoxiRciutnyCevelsuktisions, These speciesaealso likly our i he surface - it isos (Fella gscal TheesmFphipood,nHyosf1e00ac0nd0eSpeosshacAomrmemrmaienctle.ryI.nfoTpuhrneedyfemraeeydshahlasbtibeetsfeehsoy,iuasceslanokmusg,dhasp,oomn0adrwrsseha2encsdh. ee vet encrally in ower numbers(US. EPA 1994) lTEela scaomweenceeopinioisecsadheissvaereienisdse,ahlatedsfevoeardgdoannbicrsomuisrgsfeiorgaht.osxiBicoelcocgiocaaorlufghvsaasleumafasiionln,ogf Ee iammoec.nsaAnvoyidiannccae dofelwiigththbsydimmoevenmsecnotnuimtpoahnes UseSd.imeEnPtAke1e9p5s9).hese B Reproduesa ioen i.nttserrsmaasalaeacneadnfsieemseadxlfueoalfh,edMoitlolegsetdabheeeirl(afrmongrelrgpehradonidfnegmfaalupemspslaednseawvke.agpeThiesp.ic - Dani narpdiwumhc,ioptlhsTihmoenlfbeeemgagsloee.s sDtwuerreipnsgocatouhmpeuolglasitpniheognr.mpherieinotmdoalhIeerrevlmeaaesressuyppieuarmm.fenahnrced aSaheem.nToye avvealraeigeehbsreoenoisdofsniomzeemnfhaorlfcoeovmniaddliuetcHisyo,anltlnoedtlhapechmyesaciroasluoipgsiuc1ma8,lwesghegsessepe(frUebSsr.loioEzdaP,iAobnu1sk99ie9st) EDevemlopsingeaemmbprmoynomsemnaatnl.td.hUcAnxdheeardtfyvmaoruean,bgalterhcokjnuedviettniionlnaes.dHeeyaactlhheflfeameaamlcaeleecpsaromsduaecseeuslpepiarasemowdxaiiiolmasthhele road ring eveenrdayy time period (US. EPA 1994). HEa illeel ceicdaurhanevediasianguies(:llmyofsresp6rionsdntuacrdt,ivwefi)tohramg ethse8a(dpUoSrl.ee-sEecepPnrAtosd1au9gc5e9is)v: saandgss.agTehsef0rsdt `ExPropfileofor sHlluelargteeca SinceedisctscoanacottwiAthlcoentacmiencateednsesdimteinktaisnsheesmteonxti,cihyeeraelusasioofn hieheestrlilmbye edo nee expats 293 Eaton (Eiseniafoeidea)s RepresentativeofTeresita Invercbrses lugtification. BExribownorsmgs wsefrooeddscmtabsetdifoaonr rmheapgnryshesonmcsatlivlmeatnoofytmeaedbriueims-tsainzdiendv1eprreebcdroantadocriests.iodnusAe, fnodheImrpfarianncge diet of esis, T Ea e aTaktbeomecmen.aotcocmobnianmeidnwanittsi3r2edtsaconntvaectrwcihlrtthee ucronosuumnedris.n sInl3pr6eosennt.s i. USEPA 6899 009.25 200201 LISFW 06 {oBrereriefmdifinonegddtrueerrsiionaugrrticheessbaarrreeeedelisinmagkbeisdes,ahseaodnl;bthyorwmoeabvleiern,riodlbelinns.IitvMieoesstotoftfroeorbmaigpinongrwaralchegohrmicgnlosSgeuiveoewnhatehrressse Gwiutihidne1o1f0h3ekiblroemeedtienrgsp(ecrimo)d,ofrohbeisne eypscsal(lUy5.enEuPmAto19h9e9)s.ume oreging shes snd roo ExzosureProfile AT(eUdrSus.littEoAPrmyAesri1iz9ec9s3a)nv.abrTyihfnelosomwre0es3trrepeo1rsepcde,batoowdirwytewhieegeihrgdahfgtoi(nm7g7.7h37o.am3entaodn1gh5ee5s.srelpa(omUeSdr.eupEpoP(mA621h9ao93ms)e ange of 0.3 acre) were sssumed for this isk essen. 2 AABmWefirodioacdyainanrgeberiienpooncrairentdbfeeooftexi0ps.ecs9ptee1cdifeos1.c(5o2UniSsgEuPmBeAW.i1d11a79.y953a)cn. adAsyasuowfmaftioenrogdi5nn.g1ed7s.t5i1o05.nb8rocdeeyosfwsit0w.h1s4egrog.s. T(suh3me.adci,cshaoaftrchkobeemArmi,esr,sincraaailsnsp,breobrbreiinsessc)o,n(cUsaSit.sepoiEflsPleAia.css,o1n9pa9i3l,cleyEshv)ralriaicanhbdleeFtapiralto.p(e1r59s8.i%o.ndsoofgDuonrnviden,rgecsbphrrtienegns, saiunnmvdienr7terb,preanrtcdeesnltitnhffulltd(meiniagrtrhayetoorsmypprsoiensagisoin(o)nn.estTinhrgeesspeuesmsrmonet)orc0eharn9g5ye poparrroepno9t3rdpFaeinrscienaetnpwdoe8rncpeesorsere6ni3t pSescecsesnmfueina, ndied32ofp1e0rc0e%nteixnvaebmrastewsi(lUbSe,aEsPsAu.me1d9.53) For oe purposes of is fuk AHwoonwoecdvicedorec,nkawlislsoiibleiiunnsggeeesdstii8o5o3nnstrueibesfooirftthe1e0A.i4mngeperseiticeoansrrooebfintfhocreouhdleidetnAmoreebrepicofaodnunafdobriinhte(h3Atpmeeraarertio..n A19m5e3r)i.canAsrsoubimninisg132.2fogoadyi.ngestion rt of 117.5 g/day, the sol ingeion re. fo tt. 295 Reduiled Hawk (Bueojamciensis) 3 RepresevativeofCarnivorous Bic fcwion "cCTorhmeepeokrsesidteia.olneT,dsrdealiawetkiavlelwoaawbssufsnoerdltaenecdtevsaeaidslburuaettpioroensn,eonftaasdtiovnleaiokmfeilaniahcroaiomodinovfionraocseueusrarboiernldc.ed1sut toahefisDrdoyieRaturhyye cdSooonuscreecntetoratthieonreodfaciolnetdamhinaawniswhfiocuhndalilnoswmsaflormtahmemeavalluiastsiuoenwoifllcaolnscoapmrionvaindce ainn hacecufroantde LifeHistory. Ro1p9e7ed7n)i.alneT.dheihTsahwhekaysbaialtesistnhhehimgaohcslytpvlciaoriimns,mloep,nrbanutcdtghwreioydvseerss,eprncedaodmemAamsenrieiycifaaonutnBedtseinomw(aBnouldleUndnidateedFssaSrnnaeenasdr (orGesS. 19A8n7).poTirsstpecsiesfesedaer,bt.h hroewde-vaelre,dfhoamwahnduess.oanmd raapeerinchxooin vteuwnibnrgokfeonr P 3 000.1% 000U2SE0P2A 6902 1QEW NAN . : - . tTThe aftenmdmmsiosniohmws,.slpghrosgmoeisdeawilnindep,l,ry15dsisaaeldbatmendlionf EaNkohc,hsAm1ms eeuraircnsodrgihs foiounbddin.ea onto conenaaions 05. EPA 915) TTEhe fhe muis tna.ifs io aomonvasmlpotr aeirrfcosne sd,wgYoeomu,nogtHphlie aEolha1fa2ddcbaat,ntdaUdeSsw.,eEslFpAel198ns5)d. A ulfeind fmminsniowmscsopsiapnwanw5nni9tnhgeassgppaeinnngidtofScpoaeisdono.sbopasswntporugohsuoputtam1ao0s5pt. feThshee esaatotnaoye4dTo0s0h.15I0r0esenym pempwait fwegni.nAtHtas slhsinp0gndineotelld,eptepnwdnoi0nn0e1gm0poin1r3ya0norLosatrmg2as aesnSoaenwitbaewiihdoyod eaotodlypgu'n.cosmvmeonn (l35. EyPA S192823.8 Ecos Profle S Siincenedeetecoxorpnteaarec.nidthmicnonnomwissnstedd waotekrenthesoielynevaltuatioun fs tthe plrimacwy fioudls! 256 American Robi Tudas migrates) Reresenivs of Wormcain Bis lugiification. TehsaesmAeamrroifeafno1sbiiqanumhiwovasstsoseduliseecidtoeidttailsonreaenpd4restsepsaiervycesocofmaopmeontiivcoodrnoaushThahenadpnrceacfmeirvmeonrcoeouass bes7odidsl ReonaCvoeer,or sk seen. To pes 15 Tl to oot Dry tine aCThreseAemseriiacaaaptegobaibTbeueesasnnidmpleitg,rltafahtfroorbiUsSa.SoSueEgihxnoegusF1anmnadgssCtheaonfshXepAcaosnncidn.ehnhaGUielSver.ncenhndet Sreennien hwaeanbnpdrppeeionrwedmeeonsfoafoirdnrnsdweoiisensg,nopTedobnstseEcsqdU,ENsEoImsEenreSeasci0ncFoaamtmbhonnwlcaYuscpssprS0 oeinead Fees shout promis oo eving ees of mre mporinc, chEeienpnrgimaTvroyaefnrocroghisnngsdtescbhonuuiqguhe hfoerytocrobmemioinnl0yssheossulocooafnrhteesgsro1u2nlydd oknfsavniecrvhoeorfabrgtarsnocu1hnnedds i oSommietuiowviesi1F4gmetis ihipcitmeaenylfooerodusmsokdnseo(r0ye5.OolEhPeACso1o9fnb95e)e..borercehinigniseos, oAwTnObMaSd : 2 USEPA 6901 ) cco. :s 000203 USFW 0619 dos 0 tere fox whicallowsfo the valuation ofconaminans inthefood sce. Life History {RIhenedkeobxocxredpeitrnsib,aobnaincofdotpfherenmbamreneadeddsoi(wnHsg,asfedmsiiscosh,ibsraes1d9,8f5oe;xJdhoanevasend1nnowdopBoeirdmmeaednygeen1st9,8h8f,oemnMecenbrts,s19s6ee7.aemnWnihdse rDaovfuinsod1( d974.), w dTuosdneuadrSsinccgnhtr hwmeaanrtkce1dd9i81n)seAdes,hoinve umnsdualletxycemerpotooimodsn,alxSsoolamdnacnweeissrnid Guwrloouodsetncsncikk. 0oBi3lmneedy f1r9o8f8m).hmunttinwgilrdeese(dSchwarzanrdcShcehdwahn k980)rhIneacSeoomnihs deuns.oont . "paToh se bs,iomdif uDrausivmkiss,ix 1ls9y7u41n; kMo,epopmdaren1si9,s8i.bcidcSsa,omi5nv5ov,re,cgactoainosnu,mmavitneegrrfsouecdhbfasrmuseskssuecs,ah.oadnmdai5ss05,s SS(luspS0plcayo.nctshu1m0rededdSwfcohhewnairliznls1eb9su8tr7oy,npolnuess0fododBtionFye1u908t)a.fDoursionrgsimnpisoonf satoo nott food MSTiaeelreoasrnnmdlsfheemopauele4rf9yo1ex5ers6puailyf,yorifbse, eontemMivaernrtgohisngnged5Aepyrreo(mV(mSeicrhd1u9ir8ts)nodsGSuecmnhei,enuFp1eo9l8d1ss) hTi ahwekpsupnstdwwoewilwsn,eaaenndeOdMpeososibuly19c86o7Dy)o.atNevs.a(iMlervphee9d8ni7siSofcshaeremsdafsnod Srennedvaoarsbet1c9u81ll.oyRaedhmfgix may ive fom sx 0 en ers nh wid (Shar nd Schwere 1981 `ExaouureProfile Ardoumlteeradngfeosxvwerighformom342.731071.k23g4 sBeaersbo(ureaind 1Da9v8i7s 1974: Jones nd Bimey 198). "0reT0do.f1oo6nxdgis/iginBmgWaeisdttaeyiotefonsobrefjshopvpernoexdio(mUxcSal.nygE0eP0rA1o61m5g503g.).0B69TWgogIBwa(tU.WsS.nsPfoiAroenn19b5t%r)e.edfoTitnosghnagsorlo. hnSeodsdethvweeuwiaegtheinoifunngiets2s.7toifong(r7i0ro0hfe0y.W01i8g8h,iegegdeBpdfaoacodydifwnoegoerdseiimonnagubeicnsodff4eb5y20tl.he1o4yw5ae'nsdBepWoocmroeeyrs oiFnge1s0t0io%n mall art wil med rate of 232.2 g/day (232.2 mLiday).Forthe purpoofstehiss risk assessment, a diet Ahmelsoeiildlnifgoxec.sdiTboohnyexepofrfoeoss2n.hg8sspivoenericioenfounfhnteis3c3oflgadayieiybae3ssboe1ln i4r1enpgrneegnde(tBieeyoeotr2ne.a8of.1pe1r1c9en90t)wfaonr 297 Mink (fuels vison ss RepreseonfCtaranitviorvoues Mammals lustificasion. USEPA 6904 `. 000.14 000204 USFW 0622 . . . * fond sch sellrasles.eunmsic,iocnh,ippsr,y cic,ittweslhyegryound ie nd aren 199. hT a e beeingy csosanswibtpohnoeahtiwssleaorslcs.ularyNrsdoheiaptsadehoprPasc,apocnreansondaislasiclvmJa,Ccso.lllsywn.ecdT1ubo5ykeomyesaoetuiiosnnfgo.gwionone Bn 985). wesn aats sot6 oy Gl od Farad 1977 `EaA xclotsurmeeProtfainrldi.eofsnemsatol r1h9ae0s,e1dT93ob5a0lv5ok,vseFaseArpp1o3r9r)ed.dbHoodmyewweeeiiggshht5o6vfa0r0y59f610o2mdkg114123.3256o5e patof 148.38srs ws sine or is ok cme. ThEe eof areeSodnthbncdecssaootdnaofysmcao(miUmn5a.slssEe,tFbAi0ss01,9%9rs5erplsF,omaiadlspuesrcpossFewoshoidocfhnh5viesa5yisofknn Boao 6n59i1shaBoymdwaa15sy6 0hms40ev0epfoyssKekidwofoodts13e8s.p)e.cieATsot(sUiSg. EssPiAeopn1a9i9r3c)ed. Tateins36 3o1ff 0 fick y wweisnB, gEaB ie ofw3i.s6l1 oiyli(5b6y6imeLlo)we.st sit gestion tedfotrashaveilee.sbArsdcooihanaeweskdticioonlndrenptobfcJefseounha dain2eec rluenhte.oa ffsohe0h4orlmdoeuisfee oeaoontrt1leofo11999n0pteorocrentatheofw,hoit (fioooaotsieidtlmfwosesitsnmFireoem1(5rovpawlhes,ics:3 Tymatsoeioscttooinnnniieeodnoigest.iovfegaryaw.shoT.iffsheovwichiscm.woaufssoetaes(4dsu3mmoe0udsge)rhit(pUSer,setEaPhiAes ee ugovwas1sdt0iotdvoebste0c00Iafo0nm0e0s7ga5ofBsWoodmyThwoeifisgvhatll(u1 warsoatfSheaenfmlwohiviceafdowotyebdy Te, eofnt ec ed a (100) 043 101 ein te of 26 256 Red Fox Fupes vsp sRepess euiveofCamivoros Mammals lhTuegifriecE datfiooxnwuasesvlasecadno3rthaeepvaeosaorirnv,eoofncfdo3necaiammhiiovicoodrunasfsinmca5umcmmsaeoln.eduI31n3e6i Omdy,caRruyn ome ound in Small aml so will pov 3 cise USEPA 6903 000.15 000205 USFW 062 k - . } cTohmepomsiitnikonw,arselseilveectaebdunasdarnetpdriessceinbiuirvoen,ofnd3 claimkeilviohrooodusofmoacmcmuarelncdeue3ttoheiDsrdyieRaurny cCorneceeknsziaer.iofnsodfcitalnlaowrsifoasthfeoeuvnadliunatciloanomsfcaonndafuimshintiasisouenwiinllsi1e5saplr.oviIdneadadnitaicocnu,rahtee Zoe to the mink which allows for the valuationofcontaminants a i food source LifeHistory UMniintkedarSetdaitsessiabuntdedinovtehre mweuscthtofobCoraelaflomNior,thNeAmwerMiexci,csoo,utahnwdarTdextarsou(Jgohnoenssatnhde eBsitme n1o9t88c)o.mmTohnelyy cafnoubnedfionuunpdlainnvdiareaslsly(oanneyshaanbdiBaircnoenyta1i9n8i8n)g. pAelmthnoeungshwpareismatrays,roecouyrmrale, ei activity ofen extends nto midny(Hofmeister 1989). hDeenisnarke saellwfaysfonneeasrawnatderB,irannedyt1h9e8y8)a.eMuaslueaslleynadn olidvmeusiknrhaitebuorwrnowbourrrcoownsswuhciicehdabrye tleosbseellianbeoraastienhceanmionneksoocncupfioeldlobwy fsehmoarleelsin(eB(arfbooeusrannddBDiavmiesy1199784)8.).HMoimnekaanegessaltaernyd an mark hei teritorics by spraying (Merri 1987). dSieeatssonmaalyfocoondsaisvtaoifacirlayyfigsohv.efmosgst.hfdha,rsynackoesm,poosdieonns(,Braarbbbiosu,raannddpDlaavnitss 1a9m7o4n)g.oTthheeirr oifttehmes JsounmemsearnideBiimnemyan19y88r;egSiconhswoafrNzoirtnhd SAcmhewriacraz(1B9a8r1)b.ourCraanydfiDsahviase1a9m81o; rJopnresioannd Birney 1983; Mera 1987) fBrreosmd4i0ng10o7cc5urdsayrso(meJrainunar1y9t87;caSrclyhwAparriel wanidhShcihghwlayrvear1i9a8b1l).e geAshtiatgiholnypevrriiosdsberasnignignlge vlairnyeoafrmo1n1g 1r7egyioounnsg(BmiarybobuerpraondduDcaevdi(sSc1h9w7a6raHoafnfdmSecshewra1r9z851;98J1o),nesAvaenrdaBgeimievyess1i9z8e8s, OoMcfecaaigsenioan1na9ld8l7ay;rgSsrceahxtuwaahlrolzmyaemndatdouwrSlec.hbwyefaorxncesz,m1co9on8yd1o)h.rss(,YMobuoebnmcga:tas1,e9a8wn7ed;aSdnoceghdswwaairlslzbpoarunetdyfSoicnvehmw1i0anrskzx(1wM9ee8er1kis. m19i5n7;sScehlwdiormecxzcaeneddSwcohwayreazrs1o98f1)a.geAilntthhoeugwhisdom(eScihnwdaivrizduaanldhSacvhewvaerdz u19p81).six years, Afrdoaml1m9i1n0k1w.e9i0g0haocrems (5U2.S0.10EP1.A73109g93().Mert 1987: US. EPA 1995). Home rangesvary fAemyeaalre-mriounnkd(oU.oSd. iEnPgeAsti1o9n93t).eTo ex0.p22relsgs tBhWisidvaalyuehisnbuneintseosftlimaayte,d tfhoer fboootdh imnagleestainodn Oaft11w4asgidmaayl.tiApnliebexyidmtahteedlowwaetsetrreipnogretsteidonboadeyowfei0g.h1t1(/5g20B8Wi1d0ayiyewldassfroeopdorgeedstfioronfararrme aitsdwafsemmaalleisp(iU.eSd, bEyPhAe1l99o3w)e.stTroeepxapiredssbotdiys wvaeliugehtinoufSni2s0ofda0yyi,elrd sa wwaatteer iinnggeessttiioonn Faaihowfil$l7b.2e sluamye(d57..2 mLiday). For the purposes of his risk assessment, cst of 100% . USEPA 6905 36 00099.:1155 00206 USFW 0623 soApfrsnetudhmiiecneptrcdeedyeinnbaecilemdeshn(ti1aplher)iinmwnatacgsyieumnngeeecasdhteafioonnitsaimsebeyriwwsahksciscohteamiiaksvnmaka:iemayabbClyeeoniernnodrsmtiutnmhseosroaferiehs,mpthmeyrefosr, Cdeesrciraiivoednnoexfh.e peice evof ecidler sediment ingenionevins somnpsusmpenorenrr cmnLoinonfgseueerhnviaisonttfiossvrieyazeipiprnrmofomaocrdh1mu0oa0ftmh1fai0oysrr2bto3ehk0eianmgsumesieea(ldPsblmy(iLegeienprho,kem1im9svo7i5ume;ancctShmroiotchhuin1a9ms8)9,wofasFIneuKsedepoinprcoeadsictsiils baTloocdmuyyt:iseideoofb10108.m11mbianseledngathnweasfoplrloewdiincg. rTihtwoeefiasgeidhnimgoenlfs c1p0n8taomwsegiEooe s is . log Weight (5) = -5378 + 3.316 og Length (mm) c(1AK8ood.la1hln3myoasfeifhdno.eonednArssi1s5nu7g4das).neidovnaTshleitdusinempiennorgtf tto1ho.e7bv5esoipp3m.rr6adciecpneechrseccseodBnmWteaiondkftasteyhoef1rhta9tsa3obe0le.n5a3rie5 prfreefpoofsotroshsre alhicels tcoanntbreipvreeciacsiesdumhpaiton (ssahdofeiha:s9i.z6epmaeyrcconoetfantihtne0f.o0o3ld dmofegsedKeiodmlneemsubiiycsny1s97m0o1: . iniFpogrurenitishcieevodepfyuigrrpasobmsosedooofysffwieisaeghmtmamadieen,ee(s1ig1t1crn)waoa1msn0 soacstspfosuvhmreerbdsoietmyhdeai.tmteThnhetis slevvaellui oef(0s0en diomehntgscesonmtiasenddoinyh.e omsfefiidslihme(104nf2tgbaoydyyt.ewe)ipgrhetd..icWehdesneimsenvlunegeissimounlwieepielgehfd.obTiyhnihseipnrfoo,ioddvnadcsge eenan vrmometr, 29.8 Raccoon (Procyon loroa)s RepresnuaiveofOmnivrous Mammals Josificaion cCiThorhemeepcoorssnaiicctccei.onooinLn,asicwodlanisacovflsecllooanwebasumdnfidnaaoasnnhrtretesipesroaeiulsbenundtiaiotnnivf,oeofracoanofgden8akamerininioaviooordsnuofnsasmccaeummmseaenlecednuu.teo1irsprdyeiBrrt accurate doe 0 the raccoon which allows or theovhalsuuateiosnnodflcaomrtowmiilraans raosrtn) LifeHigiors. seRReaansccdsccoosaoo.nnnssifpunarrdremeflseamrlnedasdmq.iauruastmRih-acescsichzo(aeoKbdnaisuaofem,mlnayipnvahnoneria1ev9cs8il2la)ya.lnoydnRbasacaurcrerofaoaocnbesoundhdvSaewntaamttpshyr,aodufzgophiooadudthwNeaorestohopAmmereeicra wher or fog amis ceri 5 USEPA 6906 de 0915 000207 ies nana o1f5r63)ibutnwwaitlielra(nkSeegtehree1a9c4t3i)vitRiaescctooonasppeoranivsteicpalrliymeasldSoonm wshakteovedr a a(vSileaeblre {h(eSeeaddnpdreairmooanraik1l9ye8c7s)n.duFvsora,cgmaoumspf,lfece,oirmasnc,cooropnpaosnrv,inn ses,ronsggli,lmcaorrwativhduhea,(yivbedeyc1o19m34e1)s(iPvReiesironaungrd Fowler 1975). mNRaatcuiclnogorne(scKcancuotfnhmseaenseh1s9oe8r2nm)aleMlyoinsngasfoocfectuhbrestUowniilmeldMcSoamcsehogareeJcushnsreifvioensyhseaaerkrtopsurnwdoed(ssGaaofnliddmmuaecnhu19rm5ia0n)eg. i{mramaylmeseaat,rcwwnhioitrlhmeaeflvelmyealaloetfseemmxaavlaerslelyirnmitnahgkeeexchnsteyhseessounSs(atSnbadrnedeercrsisonongn 1s19e95s81s7)o;.nKaakumnar1e98t3)eYrouhneg sTehseTiaohngoeSmiae5adraefnsgwoentoo9fw8s7)ar.ancdcHohooamnhedaevapenegbneedsesnwopentoihcreaelanli(ySma8anlfdsoewrasghoeu,nndh1ra9eb8di7)ae,cPafeoods p(rveasa)oubrrceesrn,isagensnd piesrohctepaeendcsoemonmgolny(oHnotfhfeuamnsnodoGuforvesnscohetaeens1i9n7h7)e ses. Kimbers of 0.110 animals Raccoons we fundner everysutic habia. Duin the 450 yes coon populations i8hao8vhekniisnloconrger1aa9sm7es0(d)gkrge)Aatd(lmuyela(nrSaa4cn3ed1oeerknsgso)wnweh1ii9gl8eh7)bd.euoIlwneAeflneamba2al4mensadc,aa1nd2uwlketgimg(ahNlueopwrtaaokc5c.1o99o9kn1gs),w(emaiengadhnce3od.nu6s7puKmetgo.) 035k of food pe ay (wel al. 1987. nRadccFooownlserfe1e9d79p)r.imIanrMy ayn lfsa,onruessecdombso, ogriisn,,sveecsd,reFarroygsc,ocmrpayofsiishi,onegogsfa(ePcaolomnesr ing te sues was principy made upofsects 59 percent wild chery (17 percent S(`2bolkpaceskrbbceeerrnr)iye,s(r(Lo1id6eenwpteerslcy(e2nmtp)ae,nrcdcreanUytfn)iishceo(8m19p(5er2c)penrteA),etnsWn,aaisalhnsid(nSrgapieocrnceasnmto)su,nhttesrdpootfinlsSeemsir(l5aepr.eersaccecnotmo)s,ofainnsdh ECGcirhpiilsuareyised,a wtshofoisl(ln1odwpmeicrnacbedsnpite)(a2(r3Tyypcseoocmnpao1nr9,k5i0s)o.nh: (m5oplleusrccs,,mmaasisneeswsanrdmosv(e0:0 (p1e4rcpeer)eaennd TasThgeeses1ho5o.(maenfdeaewnrtgsheoonuos9af88n7dr.hacecHroooemnsedherapaevnngdbesesonnrritehceparanleilm(ayalnsdfewargsebo,innhda1rb9ei9da7,)BeTfsohaoedehsroeosrtouraacnneggsee,s.afanodr hadiillemhaelehormaeccaoonngeffoounddianlcefesmsaleGseoinrgtihae sracomoancsasipppprrooxxiimmaiillyy6359aha(C== 1186 SSEE)) r(eLso.teNu1m97b9e)r. sP0o.pu1l1i0o0n2deannsiimtaielsspleohedcetpareendssoanrglyman(HtohefEammonuanntd oGfornesscohuracnegs 1i9n7t7h)e Exsosure Profile KFoaret,e paunrdpoasdeisetofofti0s ipserkcesnstesfiomreagnet,a3hbaonddy2w0eipegrhceonft2clkai.msanweirnegessetisoanmer.t Aof05.05 Ninielsiipoynintgeieafi9n.g4epneiorncieeabfyth 9.dpieertchenstybindscseepiftornagecsoionn i(eBeoe0r.e0a4.7 g19y91).. USEPA 6907 3 009.37 000208 v USFW 062 Deg eAgduaaiiloynwadetreiviendgebsyioCnalrdaeeroanfdB0.r18aLuinte(s1p9e8r3d).yA(Ldiidofaw1eya0)s0tc%alcfuilshatweidlulsbiengassnumaeldl.omeric 295 Storrsiled Shrew (Blaring brevieauds) 1 RepresenadveofInsectivorous Mammals Luifiation "iTthedisehaorryaicloempdosshitrieownw,arselsaetlievcetaedbaundraenptredsiesncartbiuvteoiofniiansebcottihvmoroosuts amnadmdmraylshabbeicaau,seanodf plliaknetlsinaosowdoelfloaccusrercensc,etahteythteenDdrytoRfuanvoCrrseoielkisnivtee.rteAblrtahteosugwhhteheitrhdyieasremianysbcuonnsdiasntcoef Hasesnecses,mbenyta,stshuismisnpgectiheastmthaeyirdeipereasyenctoamnpisnisdeoctnivcoormopursimseasmmsoallel,y inverebrates in thi risk LieHiors Tiths ersahnogret (aJiolneeds sahnrdewBiismaenyex1t9r8e8)m.elyItacotcicveu,pileasrg2e,vaanrdithyeoafvym-obiosdtieadndshdreeyw hcaobmimtosnswuicthhi3n5 wmeaerdsfhieesl,dsb,ogasn,d mpaositsurefsor(eBstarfbloouorrsanwditDhavaimspl1e97d4e;cJaoyniensgamnadnBei,mebyru1s9h8l8a)n.d,Sfheonrceetraoiwlse,d ssuhboaeiwvseaarne(aMceirvreib1o9t8h7)d.ayDaunridnngihgahtrsthwhirntoeurgs,hothtuihstesypeeacri,esalmtahyouugnhdemrogsotofptheisraocftiitvooirtypdoir. (Hoffmeiser 1989). - aTnhiemhalomdeensriatnygmeoafyhbiesgsrpeeactieerstvhaarnie2s5wiinhdivtihdeuialdsrapmeartiaccrpeo(puSlcahtwiaonrzcyacnleds.ScIhnwaperazk 1y9e8a1r)s., I1n98o7t)h,er years, his species may have an animal density ofone inividual per acre (Mein * aAnldtnwoiulglhvosrhoarctiioluesdcsohnrseuwmsserwohnagtleyvperreffoeordantiemmaslrmeasienra,mhpelye 1974). These food tems include earthworms, slugs, snails, asrusppoplpyor(tBuanribsotuicr oamnsdiDvaevreiss insects, achropods, fungi, Dveagveitsab1l9e74m;atJeorne,ssaenedds,Bisnmaekyes,19s8al;amSacnhdwearrse,zsamanldlSmcahmwmaarlzs,19a8n1d).yoPulnantbimradrise(rBiasrgbeonuerranlldy cmoannseumemday0acognrseaitcetreexutpenttoin2w0inpteerrc(enSteohfwtahreaensdzhrSewc'hswadriczt 1(9B8a1r,boIunrsaonmde rDeagviiosns,19p7l4a)n.t `PSruebymtaesimlsstrhaytglaarnedsntprcoodnucseumaevdeinmommetdhiaatteqluyicakrleystiomrmeodbiinlazceascthheei(rpMreeryi:(M1e98r7i). 1987) Usesnisnegofechsomleolclattoiolnocaantde sfeonodt-amnadrktoinmgovsehoabrotuted(Hosfhmreeiwsetleyr h1e98a9v)i.lyAonntehleabiohraetaerisnygstanedm. o(afnSrdcuhanwrwaeasrtyzisangnadnnedSsttc.hwBuaotrhnzanre1es9nct81os)nea.setrlbTuuwcitsoletdtuynupdesesuraoglfrynoejusntudsaabsfreeentwbeaaiitln3hcbhyleostg.ibsreolscpoe,wcitohes,otgahreborruecneoddviesnrug,rfnnaecdse h1a98v7e),muliple enances. The breeding nests typically larger than the resting nest (Merri Brergeieodnisn,gbarpepeedairnsg0macyomsmuebnsicdee iinneaeralrylysparnindg mainddseuxmtemnedribnuot tpheesfkal,agaalitnhoiunghcairnlysafmael.l (Hoffmeister 1989; Jones ndBimey 1988). Gestation periods sre approximately 21 0 22 USEPA 6908 08015 000209 USFW nance anyksSwcithhwlar19s8a1e.ofThaepypournog xarifmuflaolyutrmteoalreyne Eyooumrso(nJo0nees nedmBoimnesy o1fa98g8e; S(Bcahrwbaoruar (1nSdehDaarvsi 11n9d74S;cShtwhawrzar1r9a8n)d. Sehware 1981) Both sexes may breed heir oe pring NpPaortsuersatulomspdrroeadncscooorocsnosn,ofstfuehmnceee,hsweheossrshvealesiw,le(bdoorbscaahttrese,awlSiknculou,fdenhefdisshfh,erresawln)ackabeses,c,aauolswheloos,ufgthhhamisos,dtiohsfiakstheteses,le - Sriahswasrhand1s98(1B.asTbhouerfnedeDaxvip197eo4;fcJaosnthesoaarndenBdiscmehyeyw198i8a;thMe ewilrd is19s8p7e;oSxcihmwaaerlzy aonnde Vea (Schwarz and Schwarz 1981. `Exoosure Profile 2A1d9s8uh7l)ot.rseHhaoloremedeahlreeandegesscuovuealsdyowoebimgsh01.f0r00omp11e2c10er3e c0(ofdeigerndamimtes1(9o8)7)m.(ntTheheesrceonfnotdraem,Biinamwteeayds s1a9es8es8u;(mrMecdeartshaet ctr of 1), sie hearescomprising he ose sampling locations ws approximacly 20 . BFdoVeoiyddbaianysgeashliaoivnbeaebeneseenrpaeonpgnioenndger(dUoS(m.US0E..4P9EAP01A909.316)92.95g)r.TaomAenxpeparrvegesraahmgeoefffoobomdeyrinfwgoeesoitdgihoItnnprseetcodoanfyt(e159h3 mulniipslioefdgbyatyhefocloowmepstarriposroined btodhyawneiaghitngaefst1i2ognrtamestio yfioerldmefrooidngiensgteisotniaonersewseroef for3th0e7p.u6r4pogsdeasyo.fOifsheFsiskvsaelsusem,ehneth.ighest ood ingestion rate of1.95 /ay wibelusled {Aiswavarloienginesutinosn aoftgoafy0.,22t3heg/wgatBeWriindgyeshtiaosnbaeeen rweaosrmieudlp(lUSi.edEbPyAt1h99l5)o.wesTtoreexpperreesds bad weight of 13 0 yield a water instion te of2 g/day (7 millers per day (mLday)). fshhoirolfallnigenedgseissohnirorenwcastieonocrfe ttehhyesaohrpeoobsrostuehmdwaaspshprauerswetduv.iassTihocekoamapnvoiasvisoaubrmle'essrWdioitemht t3isessoimneiglrarrpr(re0ftearreetrnoecffetorfeeo,r i`niempmaotrecrf(orSchhewacrpzeassnumS(cBehyweata1l9.81)1.994A). soTihliisngveasltuieonwatselofi8p.ipdercbeynthoefthhiegdhieestt a{oyod.inFgoersitoneapuerpoofsenseofshheofroeoddchsaenwmo(1d9el nghsaFioyy iaeslseds)s0ment.ngirewsiisonasrsturoedf0th7a4t $00 percent af he gtof the shored shrew was comprisedofeaiworms. 29.10 Meadow Vole (Microtupennsyvanicus) as RepresentofHeivorous Mammals Lusificrion ETiheearmyeacodmopwossivtoiloen.wsshasnedlaenccteedi1nsNorrptrheAsmneurtiicv,eporfefheerrebnicveorfoorusmimsatmmraesl,s ibedcaiusseelohfonfds ofoccumence se Dry Run Creek sc. "0 USEPA 6909 069.15 000210 USFW 0627 Lifs History . TBnieomsee a1d9o88w:a vvoleebosd gios.n1ev98aa, f7t)m,ph,AalSgoevusetgahbnadhnekmyss,te1enadbmuoknredesanhctoovrmsm,oontiltnhyNyeofhroastuvnhedAamlxeohrbaiebceint(ksonnsoeuswcnhna(ds0 ESPoaopaenBiiismsteuoyibve1a9co8en8de; dMosefh,re armoa1uj9co8ir7d;perSiectehcqwhueaisrs,izeaasnnfdo{eSchceharwboawirsozn(1B9(u8H1b)oo,ufrmDaeenindseeDravv1ei9gs8e9a;1t9iJ7vo4eneJcsoo1venesdr Bimey 1988). TCmhoeehsaomnedprBoanpegaeayoifto1nh9d8me.meiaPcdoopvuwleavtloiloeenxvscieneididnog s1li0ze0uwvciotlahsspdeearsaosanca,rlehlaBybieaav,erraynbtdnwpoodoptDouualvvariteisoyn1e9ss7is4z,;e . JPhaeoyeasnn 1ueBsnidsenesvt1ee9g8se8a)at.idAvaecwicnvoiavnyedoacdrcuskdi(dsutrBnincagivrbeosbonfdodmDaaeuyvaairdnsodw1i9v7g0oh)l,, niWndehlavlbawcuoagrohnnoui(nttJeohrneseyescet1ainn,dg BStisomck 1o9f88r)s. sE,lbaeiroautgehspuhnedreicraglronuentdssnerscsosmremolnolbyibluilk abnovedrroeusn(idBairnbetohuercennderDaovif3s 1574; Jones and Birney 1988). Tfdhioevsimde(usaMdlisowe(voa1l9ei8rs7)ebabnhooidwvDeuarvveoirrus,sn1fs9e7ee4td;ivnHogorfpytrmi4emnladsccteayrnonn1i9bg8ar9al)si.ssemsB,lhusacevgdgreeasbs,seel(nePgoruacmpessop,i)ebdieri3sn ,msaoajmnoder cSpoemcpioesnehnotarodfstfhododieftorinthseowmientreergiionasb(aJvoen-ens dandbeBliorwn-egyro1u9n8d8;caHcohfeFsm(eMiesrerrie198199)8.7)This "SSTuehceacemJseosaniedonsow(aBnvadorlBbeioiumsreoyanne1d9o8Df8at)vh.iesTmh1oe9s7tg4)ep.srotliBirofiencepdmeiarnmigomdaocliscsua,rbsopurdtoudr2u1icnidgnatgyhselwiwviaelrrhmaifeeerrrmlsioizenerssirnoarnfgaihinedg rTSa8mE).1 The11hyioluneg (yaovuernaggimnagrfioeurraopisdelvyearn)d(BmrabyoburreeadnbdyD2i5vidy1s974o;fJagoene(sBiansdboBuirranenyd Davis 1974) M(eBadiorwsbanldoeDsauvaires 1p9r7e4y)e.dTuhpeosne bpryednaetxolsyianlcllusdpeecoiwelss,ofhapwrkesd,atosrhyikbeir,dsblaucnidaymsa,mcmroawlss, fDoaxveiss. w1e9a7s6e,lsM,emtiniks, c1a9t8s7,).raccDouonts,fokhuerav,ypporsedsautmiosn,,sohnrleyws3, asnmdalslnapkreospo(rBiuosnouorfnhde population exceeds sixty days of ag (Schwarcand Schwarz 1981). Exposure Profile Atdealomfeiadoswpevcoilessvwieriigsh ffoomm2l0es0t6h5ngornaemsac(tM1e0r3i.21c98e:sU(SM.erErPi:A11998973)).. TThehrehfoormee, ConWtaasmianastseudmeadreath(aatre3 umseafdoowrvoofle1)c,osuilndceotbhiesirnea10c0ompperricseinntgotfheitns -diest fsaommplitnheg Tocsions was approximately 20 sees. A$7f0o2o1d ig/gnBgWiedratsye iirsanrogpionngrefdofmor0t.hi3s0s1p0e.c3i5egs/(gU.SB.WiEdaPyA, 1i9n9d5).3meTsonexwparteesrsitnhgeessteiovnaliuees {7 nisofgayt,he highest reponed load ingestion ae of 0.35 g/g BWIdy and the vier lt " 620.2~ 0 USEPA 6910 000211 USFW 0628 Ei12neesion teoadf0.g2 oyynBWdyofwe7r0e mgi pslnbvy hse ownegerrrioenprmeeboofdy+3weigsh uraf320 S cB sllto nstoearipedo2y.AoTesrfonhaaghteenioo ad vs oofFapi agnorynere oevoSegEeEmsi1o1n1rt9e9o)f224 fetid JFoithke ptrpooeos frhbfoid sthanpmiioodnetynhs ik ssa, ws sumed ta 100 so AssuMPTIONS iiste amaeatneveesnxumppoiosns wceroe nmaadn ocuognhcfo8d 1Fk dAeSalEm2entaoesneofin. + Toe miaimamm oiftnhe c.onan eves messed in sdimen, ll ar water collet on se vas + TocrmrsaruencionecneaionsofCOCs repre in ems, sl water nd bo were assumed: 4 Ase ae tr (AUP) of vas sumed or all pais wing he ie fo eg, : . Conuminants were assumed 0 be 100 percent bioavailable. + sary nampsonoifocnonmoprsmSaen wwaasrsabpaionemd sfomorhebereaenperso. h receptor seis, However + CAiesenseeeseeyhohevatms crtoyrnopwrcettdo,dpe1goemcistnewtorheeswvheatat.ls uAoldhdbieosGfetbweeadrstuoenantmtilAnyrsteofcvosniecen9r : oterol1r0e3eLwrasesasnteaydddatcnomlemrdeoteedrsaevpweoesneewrLsaDpwct1.0,3FNWtooPeOsrnsverieseedfoArsphpueoenklseoElecymt Lwgeeve (iANyEOEloAsOwFNeotEpaofnn1d0ewcoarrecdof1o10cownpsvewrti vepocnoedewLCoevrerseeOdeeLcDvnditooAAdwvLheeOrsAheEeELlehacttLkeovre poidsetaeteensarolhaerameeydi.omasveyde vdioeesoSlhuitnhgoNoJtoansafsyfeainsaweerse + Ifnotromcai e, covmein(dossrweme epps Koaraptdps wseis sceo5na.miMncEiNioGer, bTyhwoe wee Jose (mga)=Conaminn Dos (mg iy ngs Ra (Kg)x. VBodwighs (3) a 000.55 USEPA 6911 000212 USFW 0629 T3reifc,sedcrioemnnveetnrstsipoiencnigaeelssliobowansswdeiadestoaarnly sbtooixdniycsliuwydeeildgehvfetnl.sthceFii toceradflctouhrleaatnpinueoernpstpoeocsiedesesspetcieeoswrftombtibhenieesctoihncsevokentvretoarestldesdeitstosloma3yendiati,nl adailiky nedcoifsdoeernttfaholre Ter ings aie dh dosemaythen beused10 evauae th risk to other species if no specific toxicity dat 5 available (678 th gm ecepon: tSooxmienscwohnetnaimnigensateodf3ctstrhiecpere(es.ge.nead levlels.uarenmotfoiod chnainu accummulat) ors, but insiead ae direct 40 EFFECTSPROFILE fMuratnhyerccoonntsaidmeirnaatnitosn dinettehciterdisaktatshseesDsrmyenRt,ubnuCtdreoeekssintdotoexcnloutdheatvheembeanschpomtaernktsi.al Tchoinstaemxicnlaundtesod fthceomncferrno.m tBhaesietdoxoinctfheecrtessualrtsepofrtehespernetlneiexmdt:ifnlaurorirsiykdea,srsiecshslmoernotf,iuthoerofmoeltlhoawnien,galcuommipnouumn,dasrweenree,bceornyslildieurme,dchCrOoCmsiuamn,d - icolplpebre, firuornt,helreaed,vamlaunagtaedneussei,ngnifckoeold, cvhaaniandiaucmc,umaunldatziinoc.n moBdaeslesd.onCotnhteacmhienmaintssuyexrecseueltdsi,ntghtehseeircoremsppoeuctnidvse cboemnmcuhnmiatrikessarien athsesuamqueadtitco banedaftfeercrteisnwgiraeecceoptsoyrstsepmecsiaes tnhedDnreygaRtuivnelCyreiemkpascitte.ing species, populations, and. 41 Fluoride `fMlauourriedrefcoarlap(e19r9i0o)doidfen9i9ifwieeedkss.kTehelaLnedOdtAeEnatLallidaebnntoirfimeadliinttiheissinstruadsywthaast w4ermegeFxUpoksgeBdWt/odsaoyd.iuAm NreOsuAltEs.L wLasOAcaElcLuolfatemdgf/rokmgtBheWL/dOaAyEaLndusainngeasntiamcacteepdtNedOcAonEvLerosifon0f.a4/cktgorBWoifd10a.y Bwialslebdeounstehdesteo evaluate the risk posed by fluoride mammalian receptors aF5leomwinagset1a3l.m(g19F8U7k)gfoBuWn/ddasyig.nifNiocanetffgercotswewherreateobrseedurcvteidonati1n0EumrgopFeUakngsaBrWliidnagy.feAadsdsieutchc,ontthaisiniisnkg a1s0smesesmkentBwWiildlaeys.timate fluoride related risk usaiLOnAEgL of 13 mg/kg BWiday and a NOAEL of 42 Organofluorides Ncoomsptouduinesdpwearsuifnoiunngd(0intthhedileittaerrayttuorxei.cityofwichlorofluoromeotrhanye other fluorinated organic: 43 Alminm Dixon et aluminum al. in (1979) conducted drinking water for a study 90 days that evaluated the prior to breeding. reproductive successof rats exposed to The highest dose administered was 77.5 milligramsperkilogram body weight per day (mg/kg BW/day) and did not result in reproductive taobn5or5mamlgi'tikees.BLWaildeatayl.of(1a9l9u5m)icnounmd.uctAetd tah1s80d-odsea,ydrbienhakviinogrwaalteerffescttusdyweirnewhoibcsherrviesd,weirnecleuxdpionsged3 significant reduction in spontaneous locomotor activity and significant deficits in acquisition and retention of leamed responses. Based on these results, a LOAEL of 55 mgkg BWIday and an estimated NOAELof5.5 mg/kg BWiday will be us(0evealudate the risk posed by aluminum ( mammalian receptors (Table 1) USEPA 6912 ' 069.57 000213 recur Ana: off wee aeri ovedmhaennpaonnne gSsewre fchopiTcoantyinp4o03eppencosnia8psommpg:pi0]g o AAeaA Lm I R A eeo pmafay taog mts ioe onto, Toe tnocuek NOa REy br he wm Ben re ero wove Ba kr sLONEL of 4n5 meiys rors re S FirA e aRomies Come CoAmsL sP0A0sAmHesmiaimi r,so AnLSsLloS ae eneens etoe no2Tos1o0ts E ots Be y ed pSiosm oFsor te puppteA s oftsk sessment the bran va fori the 5 wis *viiedevo csa:o . Eid 188) voT wedsven isn ih hoi t of orgie scleweye eese. ieiotekaanmeemoeonnCleoooorast. alVLEhoSgehomoyetSLtvoianr n5A5nSmbBeeHYOBoirs TT OAELby dni oro os sentiom E Tuo spane hai awy axmpoessviel snincghionu peneadtsicosi crmneasismsss ofe8.eSff0e5c.0 ao vTohsasymSeot etsSsoirni,i poe i mean Srat : wet por Ee meavsa Aofeo0.n of 10 eS nefs omma LmoL E HermSA Cy A SI AT 46 Chromium " USEPA 6913 000%5:45555 000214 USFW 0631 icing anCdoHaselin 61918210)l5esx5p.0oseimdHyu2ko,0ocw3k]-edyewuareiootgrd,sprr0weeo2eid7eon,fsspi1s0p77Aofar7hmceiydvkWoesinm(amarn)isn,orfubrCni+spaensm1e)e8 E ToO run, e e aNeesfoef.tSn 1vconeonledaHioSns Fweehseddrin svhane aof sbohianis `E However, HaseltiS ne etalb. (a198sd5)r, isnaeavmmnpoauownutpanupdbdlaIistshheoeerdedswtGeurdryorsewpooTprvoteteidpberyeeWEmi1snlseirc(op1p9r8ne6uda)biosneoa1ter0ssvmtiThadsut b1.l41a2c4dk F rine prosOee sE of isk swcawmnehspnie,s.si.LcOHyRowEeeLvvweersa,oiflt1e0oimttyemca|nnmping BrWedeeasys)4oNfofsOcCAor,EnnLsrweeoy - enon corveoin10e.d. ANOKELof0.1 mys BWIca was dred fom o LOAEL A sed CcooanddutcorwhieFherdeaohopneoironptomessdyotfhnid2m.i5imnespvsdseonf.CrLiOKnEgLoefin0h3e3 1ids aNeOdAEdLeaxf a7 Copper : Onesud wn aa s oao da whidcowga tacseowseredmaendinhheAneN(fefOOecdHEMLofg1o9fa017im. nForodfpCatpwoimesamumsoadfslfoop0cixi.pcAoansns,of ams Seer siswrehiconeedsowpvhiocc3ae33enmmidnseede3sh5.e5bfrmrpchowoafCaahdacnofeochodicsCkeonups,mApaidoonpsoo(sfSe3h5s0(m1H3ahc%h ottoppitvewryerpwaebdioedswenriseaos fk0eih3 LpOeAEiL.231 mEkgass 1043 en oTesreu. praingiothe ery veyfot mammal avian egos were fund ne 9 ta hEergsni mioeltofwwisnsgtivttmevec.hsnrdWoeeusagteheres redu of sakaesledri0m.p8l2at aendd e1.e n64smugecPsooocgiBopenWisoIod Ee gonad tea pee Lowi 1 199). sT d ce onnc ownceeeedmcihsiw1o9f0u)sanddAahartme3imtaegtesaifnoofuPaaca6ts>edm(sOeyctlain1el634.s1y01m9pH4o.mssFoof ne " .. 000215 USEPA 6914 009-34 11eEW naan pheedpiusraponsdesaoNfhOiAsEiLsokfs0e.s3wsmaesnuts,ed3.LOAEL of3 pkg ws used to deermineri 0 avian Several SsaiTncieAwsevrinendeilrcoactasetmdeddhywthfio1Scuhmniddkehtgea/rdm2ia.n2yeodmfgt/hPkeogcf/adfuasysedcoufsrePedbduicgreesdiiusocnisuotcnocesimnamtomhfaelpfsl.raenqAeuedsnuovdoaf e oohsnitkeadsosewsassiammNieOiAsnEi,Lreodf03.1(303mdgadsafyola owi3ngLmd OaAnEgL (ofClLSkm197g9). aFowehree {ico daerskmtomiamnmael. 410 Manganese TTrhe sieifnfeescdeelddv,uecRefaodsr cemsxapnoogesaerndeos0nel1et3vemols(cyLasvBkaWreiyydewailyd.eolfy1m,982ma)e.sntIgnlmiak1eiln3y aMecsdrrisseeeiOeu,:sbilleehvetlioofh1dei4e0ffoomrm2y2o4f - Pa e onesiaofcM oncaneo a(ioorn3o0O fd2ay0s0remsuyesd BdeWcirdeeayseodfmaavnyg(a1nG6aMendCsaLaLesykeeys19d80.in rAedmuuccehd opm eves Gianusosind Mary 1982). GInercaoln,gvaasnodIurvle.a3ssayhrsidteigmvhsaos5f9e3m0uiimcsekg(uHoeBijnetmWeasniconi/akfltm,aadlnhe.gmaaa1nt9eo8sl7eyo)g.i5caMla,SmOuSscfuolo1s0k3ewleaelksephaaddn,o eflveaclk . E GFoerrviesk d oakmaasifemssasnmLgeOannAse,EsLaedutoisiahnergsyalnexsepcdcoespmeeadmlmecavoelnlivoaefnrs1ie3ocmnepaokrc.oBAoWNfdO1a0A.yEwLilolfb1e3mueed2g53BWLIcOayAvEa5Ls Nloiestrud,ies peraining to the diary toxicity of manganese 1 3a avian recepor wee found in the aan Neel Ta Sevoena :siSsuilfwaentreedcausevseNdaxO3leA2Ew7dLh1icofh219e87rp.emr5icenmnetddaehcereeakfstfeeodcmtasbooosdfyNsiweeninggeshstie(oxAncmetpbo:rmofasormembeaotldsyal..we1Wi9ig7sh6tt)a..r rT1hntis3 ela mawsiisswicrhoonkvbeaneedstaoaLgNsOOslANEEeeOLLEoofLnf 66o22f.5t8.6m2myy//m kkagddaayp ywbaywsamnsug leuidspel(dyAitnmogbdrioeeseNOtAaiEle.sLk1r9b7o6yam)m.afmiFmcoarrnltshoef 0 NScoise sfrowmriengaesvtiedsNitwialenotrbe mderimthinendeoeds.eofNit avian species. Tssefor, he ik10 isn 412 Vamadiom oGorvaigaeowsneinTcheiinsdmfio0co3dhdLaovOseAefEwLasoofcao3nn.uLvCemnSnpe0/doksdofa3n1ddamiAglNyVOdAoEKsLedboiyfem0(u.l3iS1plslyiivnnggoaatnhneedaBdLcacOeleApsEseadLf1oa9fc6t)No.rOoATfhEi1Ls0 Coovmeeresanoafinoen bbyodsynwnogtsho0n.r0a2c5oRmmToEnlCySob1s9e8r5)v.edTihnimsiccaelc(u0l0at0i3onksgoufeodnind3aLOsnAdEtLheonfby0r57e2 4 USEPA 6915 00g:s5 000216 USFW 063% iimsgkVtio kmaBmWmiadlaiyaninrdecNepOoArsEiLn hoisfi0s0k37a2ssmegssVmienkte.BWiay. These values will be ued 0 estimate 4Rorsepolmiecrat(es19o6f0)13excphoskeedncs hvairycintgkocveoarnnyciensnggactioonns ocfveannaodafivuramnofadniauopsme.rirTohdeodf y21 dianyv.alvTedhefesednidnyg fefofuincdietnhcaytoffdoioadryullzevteiloon.f40Amtyl/ekvgelinotfh2e0d0icmsge/skugk,emdorianlitmyarwkaesdndoetperdesnaslion tienswtecihgihcktegnasi.nTahned T`htihsodrsirteapoJrvteedltvasahconevttearrtyedl0e3vedlaofl2y0dmosk2 scboouvled bbey tmoulleiraptheidnwgthhemdoieesaurylacnotncteonxtircatciotn sby {40r.8e0p0reksgXenRaTiEveCcShi1c9k8e5)n.inTgheissticolnelrattei(o0n.1s4l0 ekgd/diany)LO1nAdEtLheonf7bymtghViinkverBsWeiocfatyhesnbdoadyNwOeAigEhLt OF. mg Vike BWI day. These values willbe used 0 estimate risk to avian recepirs. a3 zine : Soefve1r4a4l.5sdmiueksgwdeareyacvaauilsaebdleawdheiccrheadseesienmrinoewddhtheaenfdfeacnsiofiangiensctheidckZennsto(itdash. taAl.co1n9c8e9n)c.atIinona Swiemiilgahr(sDedanceoanl.duc19t9e1d),onTcn hsuidycacokcnodnuecctenendgasotni,oJanpoafn3es6e1qmuaylk,pdacoynccenraaruo1nrosef1da3ec9tidmoyni/knyb/oddayy Cpauurspoesde7sopfertcheinstimkoraalssietsysminencth,ickLs OiAdErLeodfuc1e3d9fomogd/ndaakye w(ialsluasneddCtoamdaertdeersmiene1t9h86e)e.ffFeocr the S2vfiaacntsopreocfie1s0..This value was convened 0 4 NOAEL of 13.9 mg/day by dividing the LOAEL by JAeasrtu(dNyAcSond1u97c9t)e.d oFnordotghes,puinrdpiocsaetseodftthhatis1r,i0s0k0amsskesssme(n2t5,meL/kOgA/EdLay)ocfau5s0ed1nndo aefNfecOs aAfoeErfa2Ln5e. ekregusaed tcoaduesceedrmidneecrreiasseotinhfeoofdoxmnadkehaendmowuesieg.htIons.srBeycacuosnedtuhcetefdreotn ifeseimsi,la3r of sheeofmi3n7k0, TEOAofE37L0 myke/day was used a3nNOAdELof37 wis use to determin ritso the mink. 50 RISK CHARACTERIZATION "iTeheDfroyllRouwninCgrmeeetkhsoide,wismpulisceadtioocnasloefhuleaterxipsko.suTroeecsonicmeanecatthieornisskn0edwitdbee dienttehremimnoedde.l sTyhseteHmQs umieltshiondg (reUpsr.oduEcPtAive19l8u5,reBaorrnrheoduusceedetraol. w1.986T)hceomcopmapraersiesxopnossaureecxopnrcesesnetdtiaornsctso eocfolpogeicnaltnidnptoaikensvasluucehs as populton effec eves or: Hazard Quotient (HQ) = No OMberavneEdxpAodsvuerreseCEofnfeccetnLmevaeilo(nN_O_AEL) {AneHoQrggraeniastme.r tAhaHQaneesisndtihcaanteosnthdaoteesxpnoosuriendtoitchaetcoacnkaomfirniasnk.hTashethHQposthenotuiladlb1e cnaeurspereatdevderbsaeseefdfeocntsthien Severicy ofhe affect reported. Theresult ofthe ikchascerztion sr presented nex, S51 Benthic Inverebrate Community Severe snd Function c"Tohmembneincyisiunrvveeryibsrhaotweedco3mdmeucnrieatsyeiin DcroymRmuunnaipapxeoanr1asmibce adirviesrksoerantdwaabreuansdoansn.ceTihneObreyntRhuinc 55 compared to the Reference seam. Since lad use 1nd avaiable habia are th same slong both " freed 006.5i5 USEPA 6916 000217 i erneeeannse,ptoeeardoeenrbesentninaydTvSosr, s1annd4ib0e.nrncdhesiAn DnPyopRubS emnaiybem5smltte,yddtcoespnulsmeasfnonr mSiienaisn.pperunonee,TcroeoyvemsAwi0nhi5ldo0rnEeAo,kAe1m.oinT,hieoconlesoanvd,eSeacgp5aitp.romovuit.sifpomcsswer,sd ooierOe1n0:TwivclomSpiancde ehseasvdemieoeonaclsoneyshoseey,dehlogSssoE0eTwhonl DBFo:nKwuim ctshSpeEsT 52 Salim Communi Sears tnd Fancion Rhoen lTlovxenaa coomvmitstoeMs netnppd HtbaentskWBeadnAcouf Bs ll condiins Oy 53 Fin Communies TaGoheeelvceocamomnuodniioutenytiwirlpypomTfmac ay beseko d.iRcet mashneiSls fypevonadlemfieSnTovitcmoyvrSaoluessoadsyhow maceeariCi1o0wnesienpeoTehsrrewcdeowiveegrApsfc,e.BpoLooswwievpeeircssclveosrnybet1a0wdeessneodissndicssaoavvlierdSed tfisnogn oe emshaing Som heed he ao se se Womesing Bis fonCee,sdi swd, To moe porem iati hetmm,a cborm,tcfp-- npaeot-- oafcdoo-- :esdre kComlponunnsdsamFoeordlhioonrFmkmseaoomsncokonrdsrrseedboes1a.theoBdrceGulfteonSgsme pr.reebmeoiree psTeonlene5 55 Camiverou Bits AfocrgeoC,eesonssnlhdiawnk.edsrrsThiennemkoldiaecesrseodton wtnevse,cmobrene eockme,tncopofgcroesnnmriof,vcsonodrmooieirney ihoenEaismpacostunodnrsbusFoeordoodTohnoaoanonsmkreaHavneesipeunsk.2cBsyrtdauetnf1,h5ahsrkedlfuse,csog,PanESgeseS,nmTks0) = 56 Camivoros Mammals (Teresa fein) ARCocmaomCiernnoseisniai5ka,sa0mm,innnewmstoda.etsSheeomdomneowretswFimgahtmscoancemananbe,ofcFhokooBnu,3nCeoopspo,royf " Ges ~ 086237 USEPA 6917 - # 000218 (srw 063s agar,voakimncednl,1crduerBaalonrddfdireoersasrnaidrasunkt1hf0azuacrksd oqsf ueiicodlneocrnogeneseplrrveeatsnievceedhnmisr.TaolrBeyheG2seeaco,mpoanuns2.d 7 piciorous Mammals B B Aconsde evairvsaekWaesssdrlsemnidasemadosdsste,laTbmhapseiecmdiaoevdnoerleopnutswmersiagmhetmacadlhomoinaymccb,ee 8nomfTasckoinntdaoumgein0ansdgnffesoietriseionwO,roeyf mens sropcrotersaednnecronemaTdarbvnlaevs4eh2epsuhsi.msT.ocHFaoroodNucohrionmrehkancsu1loot sconsnidderreedsaurlitkbfescrrd 55 Omaiveoss Mammals IB Rnconkeserifevroierwkaa,ssedoemareamnnidnwmeidotdo.eaTbahrsameidvdoonerwoeupwseeeimgashmtmacolnsscntmranay,iobcne raotofTcnko,nadcmuoiepnp1aers,nPgoeaienonir,oyf eitinnradrid GcurdeibnoeecaiuesepwriioresnbaostidneeTetdaeoclnedeodmn2s.esrvatsieveipnuss,, FTohodehchairoiuakrocmaeleclhaaitons n0dk` 55 tnscavorous Mammals IRenecomnaeriahiefrvirweasgs,edssesorm,meainnntdemdwoedtreh.t iITsnehedbmoionndawerleopsimgaehmmoahdlanssmchiuaemibnnseumz3o,ftc1okoinmdoaumn,n10sciofnpoegr.een3Deoyf aEa cenewvaFmoenhidacnhsnindreffoakonrscdinddscrtweadeintoinkks 3aincdtorrres uhsanoanae crckodnosfesurd xvoaidtciivlneosngpsccel,pbreBsnYcehGemldarsik,nsTooaorl,e1s4de2 S10 Hubivorous Mammal EAAocmoanCisomectvheidvsehfeoirsaakysa.ssdsslrsmneendaswdmaordt:heaTtbhaheseermdSoohdnoerwloeputrswedimigachmthmctaolnscamemnaiaytraabne,s c3o:fhiosonkanmdi,unaenas1f9dorimnagensgtahienocnDsreoy,f Ceolmopraooulnuederoowomedenicakhneihairoekcscnlsbceleradeiodoninssskcdfoaeinurshsadtunse0iznipaurctdsk.oQfutBooiicdnaelfsogtti,psrlGeobssee,nnceshdmaianrsTksaslf,er4ai2n.sd 60 UNCERTAINTY ANALYSIS CThoenreirseredawthesn tieerrrain hreesuis, aNssejssmsenotuepesroofsswhhiechecnoinnctluedetnuanncvearrain,d naeoedr,to3b0e4 otain Knowle etEneoscnasnVbeenoitfonefnhdeeieuadicnngeuchdekyofnvoaaFlkcidiadspsruwemsphetitohnweshnreokhsreecsaostmneacnetcpplrmocadedsoesc..s eTCoxHniEssewr(veigas.tidcvolenmesi(nu0ammiioannniofswlehieec eEsihes, Whenever posible, ik aleuation were based an conservative values. For example, NOAELS " 000.5.5 USEPA 6918 " ren 000219, none : 70 --_ used to clei HQ were te lowes ilu foundi erase, ofene mecha. moneinmptorvceos.noRrkosluoanani ehseeinocnoimplmcsinssCoOflodveas osoemeamn spantwheic hee rk ieLirtnetadryuryaedvaileeuesixfnporgtohlnoteovxincOi:ymorfeCepOpCesocsw1eroeCanoOtkavrbayiklhabelie fcioaerltorserciesptsotr smepaecdyiebs.eergAnonasnemSSpoatntweasss mmsaodensto Tiocdh fNpeotOraAsEoLmeSottfeaceponadcs..rUensfeeorhr.ontsyl,gidlerswohl wweeee smehrescaen orseivs eof ne ot TlAoelvsieaweandesselswhtiwrrsscFaonvQdeuwcsitdatodoowwyeessa pxppoapsiorisuencNoOnAeEfnLrSaaisrnodneL.OTAHEsILnasrdfoeyr i1sp4koSmsesssmeetyntH.soTmoie NpRrEopLre"hNiOchAEsLcSe eforramaencp1r.NOIAnEeLkssednclaainrso.f 10 vas ued co Be LOAEE 0s nCDoosyems.ministnongeoalbwooegdidgychnwedwiigaehtserrec.apnrAebleoGrsoeepsaerpoainnncuinimsss mofEemtghicuioymwmhrisesncvgoieips,ewroder irn iufnoiotf mofomeg SNosrecospwvaerstonw.eOw, te Sods weigh snd pein oe for he pecs pores rots He SSAonimesssinsgiersepe.ecofi,nbeogrlreonaasdmssioncmnaenbokiseroyfisciseyu.nvPerostisfpoanereoofdfcncohrosmreeaerrciwhfioochmrwbehocdsheteodn C15o4maamitnhaneeexpsosuorfecsoemnena.nSspeecsc.s WNIOKAiEngLShewrDeryeRnoinalCyocsklsieda1foemxspueds103wivngesnoeof S{Tohriewsriisoiveoyepiimensec.ifrIonrmsapeicoiFnesk.svealeslen,heoesorrhsreegasin whiesrSesedafion dmaesoelreemnotepieinn eGEpxooprieondsnicneosnerenmirino.nustwyrefoocdlnapdnfreeexchianrcgasearlessponsspeocies nbaspednan evse,snodf csoodsnwaang rTTehkssvcSssonoingocenlriakoasntdnetah ameNrpOwEseLcoSnnaduu]clidrswistlkh eoheepteonno. c5WoismipftlheiCHhQbtcaassueonnliesprfseoevmsismoemecesrm.soi1meos ution wire mat wing LOAEL icy encmar concuusions 1 Bembic Ivers Community Sever and Funcion oDues ro3mnboat tne barbinsurnveyyanRdahn,e tNimcoeuss6niltseiairaildyernpdarmeedal cDoynaRmianisosno v * 000455 us!EPpA a 6919 000220 USFW 0637 ovide evidence for poten fects o th bee commun. 72 Soil nvenebrte Commaniey Severe 2nd Fancion TnEe soucre avnatubncseonfeeorDmferhecRsuorinlarinnvkeerbs.ret.AeHmcoeowremivmceuarniistncysed,oes asrniowkoarph spnheracerowm1spb,rr iiesce)3.sosiogki dniufcinhcdainent Teen mol, raepiphsotmhcaoiasmimsaaynbsetbhiencges.d up he evr se. Bed ona ood 73 Fish Communities owas shown iaofvnhiaehaRueaprbgeriseheusinovfeentreeobfrautnnoddxlmiucolwlsa.biDlowrayhsseaRryn,.KhaTthiilsarfvWaliafnhodbbweseirfrveneedsgru3sstucepeappom0re CE e pt ueris emporesmot,onofRofecptooenrsaFmoofiabfnoiotdsbainashiienDbreisyldshRiuacmrca(ol1m.smuabinimetpyeomranayvenGrrcpebiercleiyosf)afmveaicydteansschoe ebms1c0 ooportl.ve Icnoansdudmoenr,s huigehtoleGveelasrofymexails.were ned nh fh, which may 74 Womneaing Birds . RB eesulse n ofhee efto,cshoilulna rmee,lin fnnocrdwamono iobrlnomraitfcsinoer.gomReeudpchohnres.ohfeThhiAsimtseorrriiiccasalnwisrioalbsidsnoei ciialtesdc alwsiophsoc gstgheaesslte logial is o van repr. 75 Camivorous Bids Ro esai oo fhe froodtnceheaihnanmdmoaedmhemlfarolafscoaurmai.vmoertRoehupasonires.sofTushcsah siisshk wrsiseodclieawtkeidklwsintshohsisugegcecosonncaecmliiongaionaks! Tk to vi eceprs, 76 Camivorous Mammals Roo esulesa of tohneat fmoiosdacthasdiuniemdovedoesmlfefcoar.ntoPrruieis,msalalnfdmweaiimcnmhgaolocafsrlmsuiov.arroomRueesphmoaarnsmeom.fahlisistssorcirchiaslswitsiaelsdorecediKaifeloldxs io sugges ecological ik fo mammalian eee. 77 Piivorous Mammals mRests ofsthaendfBoooordricdhetiannhdmaosidece.llofroRereuipasorcroismvortfohuahisnsetmo,arimcTamhlaiwslirslkuecishKasiolhceisamstioendskuwigitgnheshdeosileogcpioecnanalamilinkiis0sk mammalian recep. 8 Omnivoraus Mammals - ------ st 009-30 000221 Wht Line 0R38 - iRetsutlosmoefatlh,e fNouoadncchea,innmdewilcfhoorraomonriovmreotuhsanmea,mmTalhsisicshsstsshoacscedowiitnhdihceatsee Cpooneanmiilneinssk z mamnmealsioainanrcelcoerptior.sh tse. Reportoftorical wide Kill alo sess ccogicl rok 75 Inseciverous Mammals Rpeaseunlislofrihkedsfeootdo cmheaailns,mofdueolrdfeo,r isnedctwiivcrlooursofmlaemrmoamlesanseuc.hT1hsheriskhtsosaslocsahveedwwiintdhibccee CSoouneanmriensonsfheisnhhreeswosiltaankdelnoroninsicea,rahtweorrmssugugee.st Pehcyosliooglioaglicrails.noInrmadailfieon,topteesdfecels lphoyeveonaitalh i{issiksf.o Tthiesschoruelwds,prseosmeneofrohleseestn1imraglasnhiadmshihghacoenecdenatnrasthiorneswsofsnmdeaolshnsdmafllluomraimdemanlshioen : mhaemmsiatleidaun r1eocdeipaorny toxery. Repors of irc wilde ls 50 suggest scologial isk 0 70 Hesbivorous Mammals Rreesnulaslofskthedefotodecahlan,mfoudoerldef,oanhderibcihvloororuosflmoarmommeatlhsanseu.chT3hithsekmiesaadsoowcivioeld wiintdhitchees3e CSoommaeomfinthaenses ianntihmealsosilhaandiogrhicopnlcaenntttriastsiuoe.nsoInfamdedtiatlisonsontdhleudriiredcipottehnetiiasl sriss.fo Tthhiesvcooluelsd, oexsiec.prRoeipeomrss ofoirsgtrainasl hwaitlfdeedkoinllsvoallessonsudgghesetrecsmoallolgimeasmrmiasltsko omnamtmealstieandureec1epdoresa. r 0 SUMMARY sDeuvreirnegstohenpaarstmsaelvesrail iverhse,rd.frTmheesrewahbnoorgmralaiztsieisshacvaerilncalluodnegdtahnecreraecahsoefDdrinyciRdeenceCroefeski,labosrsrecpaovreesd, Dmionralneedscsein,nnewdborni.ghanmdoraauliltycrastte,creosasesllbgeheaveilosr,essoffhnisssheorfd.aiItn aindiaidoulnk0caplreo,bmleomsmwai!h ipsosetre, n{hie aFalmiernkainndghfrrosm DarvyeRna,lsTrhepoertseldsnoufmeiroursiskaahsskeisssmeinntDsruyppRourtn,isansdewriilodetaitlTs (uc. Gfeoem) hfoer iDdyuRauunsCrfeoerktsl,nmdefaldmoawy, bseehaamv,in3gnaddvpearrsieafnecBtasboinatshehaecalroegpcrelsecntomonmuhneesst.thtThbesaebafhfecsolmdaeyldb,e eTlaatneid rtonengri.cheAd Slemvienliomfumme,tatlsh,sNyumoprtdoem,samnadniwfieeshtlbryoftlheuohreadmestrhacnehahartacstpeaotftuo abeircesoalxanit,ofatned Cioknseesnstewinth,tneumcoenrcoluussiioenssofctohmeporiusnkdsseswsemrenptr.eseInntsiniDroynRuontshepceocmipoaulndhsotshe iweenrcefiseduaidTInCstiosr TmeanyaiavleolpyrelseentnrdetCompohuensdysstine,hencBeNaAislcayn)mheatfcuorutlhderniovbeesstcgcaiuorne.lyThdeenDiuPeodn.t Tahnesdelcohmtpodunndss - {oto Dy Run f the only sppaentsore ofichorauromedhan in sal adjacent to the ream. USEPA 6921 s 052 9.32 - 000222 1ISFW 0839 LITERATURE CITED E agence y or TomxricaSiuobnsasncIsnca.nUdnDdieresUSe.ReDgeipsaeryen(eAnTtSoDfR)H.eat19h90a.ndTHuamaxn SiervciPcreolsfiCloeofnogtraAicluNmaoi.rul2m0.6.9P3r-e0p6a0r6e.d Research Triangle Prk, NC. AgeencyfeorTonnremSautbsoanncsesnea.ndUDnidseerasUeSR.egDsecpayre(mAeTnStDoRf).Hea1l9t9h0.snTd HoumsancSeroPvricolefsleCofoonrgcMaaincgNacon,esa2e0.5:9P5e-e0p8u0e6d Resereh Tangle Pak, NC. agenechyfnoeesTomxeicrSmuobsntasncIensc.anUdndDeisreaUsSe. RDeegpvsme(nATtSoDfR)H.eal1t9h911.ndTaHsuicmoalnogSieeravliPcreosfiCloenfomracVtenNcod.iu2m0.5-3P3r.ep0a6e0e6d Researeh Triangle Park, NC. seenncfeorsTmoeerSuobsnancIensc.anUdndDeirsUcSs.ReDgeipsaeryn(eAnTSoDfRH)e.alt1h99t.ndTHoomaxniSecrvioPcreoslfClooenfgmoarcBiercNyaam2l.05:P95e-a0r6e0d6 Researen Trisnle ark, NC. gCeenncycfIonrcTromryiicoSnudbsntea.nUcensearndUsD.isDcepsaRremgeinsteoyfH(eAaTlStDhRa)n.d H19u9m6a.nTSaesrivciocleosgiCcoanlePsroefiNloe.f2r0N5i.c9k3e-l0,606P,reRpeasreeadrbcyh Triangle Park, NC. AGamgbsroseJ, FAoMo.d SBeSi. TLeasrhsoenl,, a3n:d1L8F1.1B87o.sc. 1976. "Longer toicalogialassssment of ickel in ras and Barbour, RW, and WH. Davis. 1974, Mammalsof Kets. Lexingon, KY: UniversofKeavicky Press. 323. B79e5m6.iouGseer,sLaW.sGtWf,o EScuoelo,giScMa.l RiBsakrtAetlls,e1s.meBne.auPchamup, RbHN.umGlabredrneir6,75E,.cOLiRndaNerL,6.n3V51..OENneviiltloannmdenAalESReovsieen.s Dison, Ok Ridge Masons Laboratory, Os Ridge, T. Bseyaer,3WrNs.8EE. Comer, and. Geroul, 199. "Esme of Soi Ingesion by WiifeJ. Wildl Mage. hBreopoaksst,esLi._ciy19b8y.<o"pInphiebitPihon..D. oDfisNeArDaPoHn-,cyRautcghevrosmUenivererdsu,caNseewaBnrdunasnweincuka,tNonJofacute dietylnimasamine BYourlkl,.NYA:ndAlJ. fFeadsA.ndK.oipr.,19I7c7.. The Audubon SociesFieldGude to North American 8rd, Eastern Region New Buon. P1989. Boi f Prys ofhe World Neve York,NY: WK. SithPublishers. Syemum, RU. RE. Eka, LL. Hopkins. 1974. Varadtam. Washingion, D.C. National AcadofeScimencyes Co : 5 009.3% USEPA 6922 000223 Effet on Agua Boe: 1954 Revision ES/ERITMSGR], Maria Maris Energy Symes, In, Suri, .W. 1977, "EcofFarid on Livestock foofOcwcasil onal Medicine, 1504058, Tyson, EL. 1950. "Summes Food HisoftheRaccoon in Soutwest Wishinion" J. Marna, 31443449, WU.aSt.erEnRveigruoiuomennsa1lnPdroSwucnidoanrA,geCncyr(UaSan.dSEPuiRn)d,anr1981D.iviAsniopn,osWuasrheiannidorniskD.Ca.sEsPAeIs06so-rm4a5ers-en0ni0tc., Office of 5RegoEtnuvioinonamndenSsanrtacrsi,oCn rAgiencaynd(USSa.ndEPaAr) Di1v98i5s.ionA,mWbalsehriwnagtioenr.gD.aC.lerifeoraren OfficofWace FU.rSe.shEwnerveisrennmdeMnalirnetcOtrigoannAig.encUyi(sUtS.SEuPeAs).En1v98i5r.onMmeetnhaoldPssfoercMieoansuArgienngcyt.heEAcFweAsIiOiA0o1SfSffuens + UW.aS.hiEnngvoirnoBmCe.nclEPPAr/sSeeIiOoIn-4A9ge0n0cy (US. EPA) 1999. RikAssessment Guldrce or sper Volume|. LUise.. FEendveiroanlmReengailerrotvcoilounmeAg31e.ncoy.(U4.6S,.EDPAe).e9r92.1.Ambir WerQuel Cri orthe ProecionofAsc SUuSn.esEnEvnioronnmmeennatllPPrrooecciionnAgAegsecys(,USOf.fiEcPeAaf)R. e95s5.sWcainhddeDepvodsouprmeenF,acWtaosrshiHnagnidnb.oo.kC..VEoPAl/SuDomIfRIeL,S3U1nist oUZfSoS,iwscEoinomverinmrtosAraimsreonocasal.tPerdtCecoionnaAgnentcyw(iUthS.eEsPhA)a 19I9m.eriMtraetestfUrnMhieeadsoSutrdiensgEsnheirTonmeentasntsdPBoivioeeseocniuAmsleasnieoyn RU.eSg.ioEnnv1iroBnTmAeGn.talTePcrhonsisciaoSnupApgeonrcSye(cUoSn.. EPPhAi)a.del1g9h5i5s.,RPeav.ised Region Il BTAG Benchmark Values US. EPA VNianioZninsdsRreneBsakCrouanncdilLFo.fCJaawmorask.i.As1s98o0.ciEfCeoctmsmoifeVsanSaedinuimlientChreiCeasnafdoiraEnnEvnivriroonnmmeenntt,QuOaay,, Canadsc PVleennuugmoppresss8,,. NnedwT.Y0o.rkL,ucKkYe.y. 1978. Metal Toiciy in Mammals: 2. Chemisal Toviisof Metals andl, BWMiiicoercboheseomm1eS,sofpJr.hoCmy..LRae1Tu4i4sL7Ds8eis4a:6m.fonedcaandlHVI.nhGieiloboni5n.d1S9i1m.al"aAiroyn bHyydBreonczaorabovnon(eBsenazned(Csprsrpen)Sailydvreonsyhasrechin Wixton, B.G.1n B.E. Davis. 1993. "Lesd in Soi. Lad in Sil Task Fare, Science Reviews, Northwood, 1325p. Woalsen, EA. 1975. Arsnial pesticide. ACS Sr 7 176 atinid er, 1994). USEPA 6924 PF) 069s-e5ca4 000224 USFW nR42 FCruvteea,iWopon34snRdi1al. B6r0n., 1983, "Sain of omc elon is mammals nd Weds" American Jura of Coumanova VL. Bowman nd LR. Weigh 1984, "Toxicity of Meal lors in te Lu: Ec on Alveolar - SCMalecurikopnDh,aRge,Tsaan1d57m5A,lave"oLleanrdTCyopneaInl Ceealloss.":JBaTosxvicio.l.TeEnrveirsoan. MHeaalthm13C:345l-856l. ees Merd Highway." Emon heniCe2.To.nHMalaernegrn,idTPsS5.3H1a8ri.. 1991, Elec of ZinToicyon Thad Fuscien odHisclosy a Br DDrGerGarteReMn,yDofMD,sRedcs 19P85r.essN.ewEngland Wide Habis Nal Hindt Disrib,uion, bes MA. Deiat, A. MLC TnyeslasoLKWir.e TCaRlC,Cri19a8t3.R"eiEseinofECmoipomemoennlHoCmoanrne,l,LiTbErCaHr1y5s2n5d5Fan Anis, - EDivsioan,nmRaLr.atRHJeSahrPe,rp3encdiv1e.. L3e0.33-169.75. "Assessment of Environmenal Fairs Afecsing Mae Feil" Edwards, CA, ndLR Lofy. 1971. Th BlogofEars. ohn Wiley snd Sons, NewYork,NY. : "hich, PR DS. Dabin 2D, Whes, 1988,The Brders ebook. Simon nd Sehr, Firid. New York 165 - SEoinR.Si1t9g86i,e"aCthgroomirum$H50.8a6)rt6o7F5i.dsh, Wii,ad Inverse: Synopc Review:" US. Fishand Wide SieerrveRs1i9t8gi.at"ARerpsoertn5a0.z12a).roFish,Wife, odverbs ASymopic Revie: US. Fihand Wide = Ei te, Rt, o198g85e.t"LeepaodrsH. 3a5s1.i1to)Fdissh, Wilt,ad overebes: A Synape Revie." Uned Stes Fish ond : vin AePo27Tsd W.G.aitnDomlss,vn97,4n,1oD"ThCeuEmlDieoncveoEsf,SEvKu.imSiCehrreiotmRoan,FaonA. hbCeobuPrr.oMxiCamoanl..TNuRLb.CeBCsiNofop.h,1e9R0na17td.)K16i.8d9TneoyrL.as" Fleming, W.1. aa CSAo.mSecshleGru,iE19n8.iIafnlmsrecreaafTtihetMoetlhoodnodf FCuhermiies ATdUmTiYSsHs1i-1o4n5,on Toxicity and Furie .2 EFleemirngo, SW.u.,iCnEg. AGrrcuh,rCvA.. CSocnheTro,scaon,d C1M64.7 B4u5n3c-k,901.987. EfoffralDoss of Fluide on Nesting .) GViianngtasonse,sG.AdsmndisMsTioMna.rrNyo,wr1t9o82s.ic"aAll3r7a5i3o1n.s in Bein Dopamine 3n GABA Followin Inorganic o Organic Goldman, EA. 1950, Rscaons of ortandMiddle Americ! Wihingion, DC: US. Fish snd WH. Servi | L: B 5 USEPA 6923 000-255 000225 USFW 0641 TL mh nd Lo el Pre Nag 1 vu esd. os Sn ees Hl 0d SON NERY 2 oN\iAMiA yeTAGE VA aS le NR ERRen HF WE ny 4B os poy