Document J813oO3D2orOojbEJam0Vm0X

FILE NAME Jewelers JEWEL DATE 1979 Oct 2 DOC JEWEL005 DOCUMENT DESCRIPTION Published Transcript of House Hearing THE REP SENTAIVESREPRESNTAIVES + he ai, FIRST ee PROVIDENCE WOCUPATIONL HEARING HELD U.S. PROVIDENC onth Printed WASHINGTO GOVERNMT PROVIDENC, viscASES : EDUCATION HEARINGLABOR p7e2980, PRINTG CONGRES Industry OFICE . Printed for the HELD use IN of the FIRST Comite SEION on R.L, ON Education OF ON ne ON 2S | . OF ONBEFORE THR. THE 2 Part 4: Jewelry AND THEIR Lf and OCTBER AND REPSNTAIVES STANDRS COMPENSATION LABOR 2, pp Labor 1978 cy oe | 1980 ! : ; iv AKL D. i36k, ih SHIDLP 0 SuncomMiTeE PERKINS, MYERS, iTAMS, MILER, KURTON, Kentucky, Monta Californa Californa EDWARD FrPensylvai I. Ofico BEARD, ON an) ANDAND LABOR LABOR Lasor Chairman Chairman ASHBROK JEFORDSERLNBORERLNBOR ERLNBOR Ilinos EDWARDS COLEMAN GO DLING EDWARDS ERDAHL . | SALTK SUGTS WILAM MICHAEL iONRAY OAT SDWARE PET R DALE BE. [errs WUSTIN EORGE,uIWATD :UL KE MARIO WILAMKOSEPH HiLIP SILAM OWN HANK KOGVBEK. BRADEMS,THOMPSN, WILAMS, ANDREWS, CORKAD, BAILEY, K. A. J. STACK,PEYSR, KILPE, WEIS, J. 0. P. SIMON, New MURPHY. MYERS,MILER,BEART), Tinois M. BIAG I, (BIL ) GAYDOS, BURTON, D, FORD, F. Pensylvat RATCHFOD, CONTES CONTES Colrado Monta Florida NewMichganPuertoYork Californa Rhode North New. CLAY, York CONTE S CONTE S CONTES CONTENTS CONTENTS York Penpsyiva CONTES PensylvaiRico Island Carotina Misouri CONTENTS CONTENTS CONTES Jersey ON Conectiu 2 R. Bailargeon Denis 197 Bramn Island M.D Group pulmonary ocupationl Providenc Island Denis pulmonary M.D. Asociaton ocupational ocupational and Providence Providence Providence pulmonary division division pulmonary manager CranstomangermangermangersafetyAmericanAmerican Corp. health JamesRichard GEIGY Frankovich safety Hoechst turing Frankovich George president president George Frankovich DivsonRhode Divsion Health James chief , RhodeRhode asociate Health, ValeriVealerie Valerie Providence R.I Providence Robert _ Nascimento Robert .,_ agent International Nascimento Nascimento, Rhode Island Providenc Weisberg, Peloguin, International Comite Comite Shafner, Healthofsion Snap, RHic.ea,nd Heat LovetP,eloquinPeloquinPeloquin Robert R.I... Rhode IslanCdomite International for Ocupational Ocupationl Providenc Providenc, Linda Comite Workes Mathew, Providenc director Providenc Comite Health, Rice Providenc David Eliot, and Raoul, H. Robert R., Linda, Frost DavidMathew Departmen,Ocupationl Snap specialsthealth Robert Ocupational Robert excutive F.,Safety Esq., Esq., Rhode Esq., Weisberg E., Occupational Weisberg Providenc,excutive Insulators ocupationlocupational Ph.and sion Ocupational Providenc ERLNBOR Providenc, Providenc, Raditon Department Providence busines Ocupationl Grotn, Health HealthD., Island Island Health IlinoisIlinois and for R.I Providenc Grotn Esq Rhode Con excutive director Health Providence Safety Providenc Safetyand D. Health Health D. Ocupational in Sid, Providence Providence health Ocupational Health Providence Providence ew of ee Raditon RadiationControl eR Control tome cee onge Health Department Ofice Health EDWARDS Ohio Oklahom Departmen,Ocupationl Asociatn.ocupationl Ofice Comite Ohio American Asbetos Workes National America, divsion, DivsionDisease October Rhode presidnt/xcuve cont wen Interaionl ~~~ Workers, InstiuteControl, Hoechst Rhode: en health Island Control,ne OficeR.I_-R.I_-Ocupationl .:- Surveilance, enviroment, Providenc, Providenc, pulmonary. specialst, director, ane Rhode R.I_-+ Departmen Comite Asociaton eee wen R.I_- R.I_-~ Ocupationl. Robert _.-~ .-~+ 197.-coi- wne- Asociatn, Coventry, consultan, Manufac- Hospital, - R.I-- one- Hazard Radia- CIBA- e- Island Divi- on agent, Union, Rhode for--- 2 of ee bne health ee ey AS a--- ele 2, e ne of Isiand and we ne ee -- Inc. ee we + ce ew Health Cn Lung = for we Corp., we se Island loca] ee oe wen ee31, wo gh and ene ene ee RL Safety e- eeeEast of- of -- nee ens Nascimento, Frankovich, Bailrgeon, Weisberg, Landrigan, atemnt Shafner, fuctring Bramn, Prepared Health, Table Tabie TabieHealth sion of Kely, article eat Evalutions Providenc, Provicen, Prepared Rhode plating Isiand, ment from and Safety Jones, pared health LO7e9.tterRobert Sid, and Dr, 2 to of... 1-PoteniDalprtmen,Ocupationl TrichlotaneIniormatn Contaiers, . staemntEduentio, tosimonyconsulint, staemnts, Mathew, Jewlers RobertGrotan, Health, Rhode Robert George leters, in R.L., Frost F., Con., and Philip Island ew B., Earl K.F.,M.1D., lenis 93 2Empioyent OCUPATIONL OCUPATIONAL DISEASE THEIR Bh. E., and Field J., DISEASE en ew .0. ondR., R., PS OCUPATIONLOCUPATIONLatorney, DISEAS THEIR DISEASE 103 Health OCUPATIONAL THEIR 103 in D., OCUPATIONAL AND suplemntal Providenc, staemnt OCUPATIONL THEIR exposure COMPENSATION COMPENSATION COMPENSATION OCUPATIONL OCUPATIONAL DISEASE THEIR and Tied and COMPENSATION staemnt O'Brien, jewlry March R.1.: to agent, 58 encouterd OcupationlRaditon submited Decmber pulmonary Asbetos. JewlryJewlry divsion, Jewlry IndustryIndustry Group and Industry material, in 18, Shafner,by. elctropaing Asbeto-Type Interaionl Part presidnt/xcuva Workes, , 1979 jewlry Control, TUESDAY during Health OCTBER Rhode Healthdisease 1978. DISEAS DISEAS AND THEIR M.1)., COMPENSATION COMPENSATI COMPENSATION - Island Iv Industry 22 Industry of 2- Industry and of 1979 e , 2 1979197 we ee ee et en and OCTBER OCTBER Bartink, REPSNTAIVES cetra er health REPSNTAIV Island and in 1Q78_.- 1978_.- investgao.-+92 SUBCOMITE LABOR Specialst,Rhode 2-02 The subcomite COMITE COMITECOMITE Jewlry EDUCATION Providenc SUBCOMITE EDUCATION R.I. subcomite AND Providence 71 depart-Rhode Stuart COMITE Providence 07 077 aoe - - TheThe Lung local SUBCOMITE 31, COMMITTEE subcommittee subcom it esubcommitteesubcomite subcommittee pursantpursuant to 80 29 9 Rhode Health REPSNTAIVE REPRESNTAIVES EDUCATIONLABOR EDUCATION EDUCATION pursuant notice notice , pursuant Pek pursuant Building Providence R.I. a.m. a.m. Providence _ particular Rtheosdimeony Isinud Standrs distwintgnueisshed comiteocupationl Subcomite Weareproblemsocupationl distnguishedmay pyoluartsienlgf random witnes elctroplating jewinlherryntcovering hearingeldcitserao-se.lctro-hearings Beazp.minority fiheialvtdeycoTvehriingscoveringofvery h1a9p78_y variety isLaborcounselBamciuonmuon,rseil Wod BhfeEaiAreiRlnDgd Labotorday series order. problems and series Wood investigaons_ and ant ant Employment in and September Distribution September 1978_of employmenetmployment elctroplating electroplating Rhode and Rhode 29 ant ant; minority to BEARD Distribution employment jewelry electro- 30 Rhode Isinud March 1978_ list we field one Edie order wish. can have thevery that of but of talk at may that wbilel we a The Island . and at your will my or to may of have for your be right may be have this of had labor. problems Dr. Mr. not a a oe q@ ; or w Phili.p. Earl here exist It is on read J. that in to my of Wood to be any the who of in we Subcomite, also my positon. Pasbech hearings on comite them, . will this : pleasure, ; have on distnguisheddistinguished maymay may Labor Standards right incorpatedLandrigan. repsntaiviesndustry. ocupational Standrs Landrigan tesimony portion Congres testify in of wihso Edie Waree ofinhad. wil that Baum your into the of pro very ; here This. will. Landrigan Landrigan can talk staemnt Washingto, yourself director disease yourself and minor- Rhodceourse, tashgiast~t hapy record asist- the staf andthe and . . con in to 1tshe now Identify Mm . Bruce on to and haveD.C.,first come the of who Congres repsntaivesSubcomite repsentaives Pasbach incorporated any any of*S wer, . : : adequate employed ishments(143,437industry ployers, health, Service wants. nints,pints which other Stute this Fiie,ijes, The risk lie cr 424 Of in 50 jewlrythe industry industry of nus or the PHILP J. DIRECTOR the industry may exposedto wide variety LANDRIGAN DIRECTOR DIVISION Workers LANDRIGAN Khodewhich be LANDRIGAN DIRECTORin DIRECTOR DIVISION DIVISION LANDRIGAN in M.D. DIVISION is PHILP Workers which toxic EVALUATIONS LANDRIGAN M.D. exposed SURVEILANCE FIELD STUDIES ANDOCUPATIONAL HAZRD espcialy highincluding physical aditon ampution OCUPATIONL SAFETY noise may EVALUATIONS AND Island OCUPATIONAL SAFETY OCUPATIONAL OF tion Act io at iN As of My Dr. of Workers the industry may jewelry industry are asbestos substances substances Jewelry Jewelry including including solvents solvents asbestos ad ition CONTROL with including FOR DEPARTMENT DEPARTMENT employ noiseandresult physical including amputaion INSTIUTE Jewelryworking guarded DEPARTMENT alonebased OCUPATIONAL DISEASE CONTROL would machine preses OF guarded CONTROL300 in DEPARTMEN hazards in of CENTR Landrigan WELFARE specialst jewlry jewlry describngdescribng industry detail sir physican inheavily subtances some efcts AND workers industry Philip physican fewer some WELFARE New over Dun several workers detail the solvent Landrigan Landrigan would Public employed Ocupationl chlorethan like methyl recnt 1, 1 Ocupational U.S. specialst chlorethane chlorfm 31,00 chlorethane has medicine Institute for Health metal NationalInstiute Instiute Director agent where Ocupational repsentd greasing cleanig Evaluations Evaluations safetyocupationalocupatinl Bradste vapor cleanig increasing industry years diped Cincnati conducting ocupational workers,jewelry jewelry Trichlorethan conducting some trichlorethanethe diped Evaluations research developingresponsiblerecomende Trichlorethan ocupational recomende ocupational employes manufctring andworkesworkerstrichlorethan trichlorethan ventilaon subtance recomend and absence conductingconducting asitance absence proper exhaust trichlorethane exhaust trainingNIOSH conducting Market nearly exposure trainingtraining of NIOSH workers trichloethan has simlar costume exposure Safety responiblties The Safety Health harmful of minersminers under doses strong the responsiblites Health system Mr. Chairman properties proetis neurolgic lower anestheic properties symptomssystem comonly sen discuss Chairman the hazards trichlorethane hciogmhmonly pleased ocupational jews exposure lower wityhou one- trichloroethane with employed in physician , the Public Oc upational Field Director conducting Safety and Division ocupational asistance education NIOSH Mine programs programs programs responsibilities havocecupationalbeen jeweljerweylry jewelroyc upationoaclupational ocupational . OF on has the 815 and em- and The aimed . I substances of chloroethane chloroethane cleaning jewelry greasing metal open tanks which are solvent characterize describing some talk about known known as use increasing jewelry trichloroethane trichlorethane trichloroethane cases a exhaust vapor can those est hazaerds ' on central nervous system depresant depres ant neurolgic The symptoms dizziness OF exposed effects cd oe substance nausea _ slowed time has been been manufctring repsntedestablihmentsemploys employes percnt anotherwordshalf conetraions trichlosanearhytmias arhytmiampsruospcelrepoper recomnd aginst cirulatorcyiulatory efects trichloethan files jewlryemployed manufcturing another produce presureExposure Tothe musclethe wcioruklsahtoorpys efects wtoricrhlkoreethrantsrichlorethanecardiac NewcostumeEngland repsentdemiplnoydeusstry innearly percent muscle heart protectrecomenvdndtisitulrabatniceosn recomend partscirulatory whichin vapors recomendations an andnearlysmal 411 blood published intheexposure exposurecormperephonsrivtes problemswmoirnkuetres fewer employes heart anrdecomended milion problems resulting cardiac heavily manufacturing arepnresdnted costume the high NIOSH produce 15 trichlorethane and protect workshops list workshops trichlorethane 31,000 workers The jewelry heavily jewelry workers workers England industry industry of small than fewer than between the the workers workers establishments in manufacturing concentrations to and and to a of ch solvent NIOSH for produce trichloroethane problems resulting resulting in have serious disturbances workers trichlorethane disturbances heart rhythm workers against effects trichloroethane that that exposure to trichloroethane airborne vapors the per any minute published comprehensive comprehensive recomendations which used workers medical supervison xposed 10 to employees employees implcations thehealth ofcirulatotryrichlorsthane Trichlorethan published 1976. document refpatiedlyles of For published workersThat document Exposure trichlor- implications Trichlorethane Recomend supervison Ocupational avilable Recomendmedical are Standard Exposure implications workers implications for health animals studies July studies only workers That studiesand Trichlorethanfrom NIOSH heart Governmet NIOSH pleased copy plants healthplants riskoften NIOSH BEARD document in plants produces submit for ampleased folowsPrinting injury, detail smal BEARD beenrate. are greater larger Mr. wil problems guarded of larger acepted are than likelyworkers shops Contiued documentThat aceptd exposedmetal oe industrial industrial industrial in in the has on the a workers exposed These NIOSH the Recomended Recommended andpublished July Government That Government Q am hearing record be be acepted follows furnished document ] the the be workers noted -4.:*i2 folows se^'n ue to furnished workers including than rapid I to at the are a inin larger cirulatory industry. folws workers industrial resulting exposure exposure exposure solvent hazrdsmachine vapors industrial damage nausea, strong volatile diped heavilyfumes, workers lower years health drop et. wide acid is to am to exposed ef ects faced to ls of in in es -..: a in .1 as a industrial vomitng, anesthic ontaiers ampution, avilabe Criteriachlor- exposed substance Piecs 1,1-tri- pleased cardiac sytem. central: 1,-tri- variety ationsperiod. 1,1,1- doses mists is the lung the to the are as of intoofde- _ ofby and to ' { eonfd Labor, that is8t avilbe varitons exposure che of 10 enviromtal enviromtal detrminaos suceiv 16 confirmatoy monitrng the to ocupationl Pertin the enviromtal aditsuai Envirometal Recordkeping jewlry Exposure metal ilnes coper employe of recomnde limt soldering industry exces recomnde enviromental intaed confirmed exprinces fevr promptly promptly procedur monitrng intaed soldering promptly these confirmed posible condit exposure evnig monitrng fels to home the employer desires desires Afected evnig been excesive if low metalic time worke frequntly thes implemnted implentd often ilnes Monitrng of until very and days mainted injury least permanet evrya that contiue spart of Normal hazrd fever limits monitoring monitoring then Exposure serious jewelry conetraion anlysie fumes jewlry industry jewelry determination detrmination be be be found. types years. shal samples exceds control of advised Esch These aditsuai pouring control procedure be (e) taken For to in and Exposure Dr. hazard jewelry ing this chest pain be in ocupationl metal fumes ocupational pouring Fumes cause can worker breathing after liberated , metal chills onset symptoms is obvist hours delayed precede working exposure that the records exposed employes fumes employes being develops 16 chu fumes notified night worker the he shal of employes the employes be worker fever * white fevr acute continue elevated white grade Although Although spontaneously after few hours may cause longer episodes spontaeously metal fume most day permanent no of . for permanet exposure resumed Another at suficient . exposure may manufacture detrminaton after . workshift abdominal andincluding each used,Least during worker's worker's exposure during each workshift ~ :. exposure abdominal cramps tremortremor anemia spectrum neurolgic neurologic damage damage '. - exposure variations variations and Enviromental RecordkepingRecordkeping monitoring functions be mainted Sevral kidney variations in in unsual workers functions variations( revsible. sampling prominetprominet symptos fatigueAlbuqeru Albuquerque expriencd These monitoring maintained lung'and cough smal monitoring health Environmetal Recordkeping records of Thes respiatory protecionprotecionprotecion and information conetraions prominet sevral respiratoy include conetraions chest can For environmetal workerslearnedworkes involvedlabeld operations earlier exposure respiratory information damage or the functions job job ofworkers Recordkeping Environmental records shal records records records respiratory Each shall methodsmethods of used used TWA able able to obtain in operationsoperations maintained for at sampling and analysis analysis ceiling ceiling conetraions information #2 respiratory operationcsough: lung lunagnd kidney Sevra which least and unsual unusual prominent ilnes kidney One least chest the ilnes years cough coughand pain in concentrations a ago 27 75 percent symptoms the his One smal our symptoms symptoms symptoms group ocasionalyocasionalocyasionaly factory factory symptoms symptoms those thoseworkers or workers 36 involvedinvolved had material material may lead investigate an epidemic lung cancer epidemic AlbuquerAqlbuuequerque N. Albuquerque was nasal symptoms congestion symptoms the plant soldering apearsimply operations several simplysilver so afterafter environmetal environmental introduced proces environmental environmetal information symptoms exposures obtain jewelry course contained silver investigationinvestigaon found *silver medical shal more investigation of be @ exposures . 1 the this be was retained had the or 36 group and was been introduced compound course our for years percent compund whichthat contained medical years records percent brazing When conetraions retained records was partif shall retained trichlorethane 20 of cadmium percent cadmium ocupationl ocupationlocupationl include ocasionly aloy environmetal medical shal factory When trichlorethane later, asked liberated -- ------,---- is We the were the 1,1,1 trichlorethane trichlorethane employe trichlorethane Records cadmium inadequate should included to inadequate an fumes conetraions medical aplicable These employe be tolungtion blodthe increased shal conetraions exposures tion was thefound exposures aplicable compound should workers mploye ; records in the when employe's records that medical records the designated medical employe of investigae mium cadmium silver brazing that Secretary fatigue, mium was recordsmedical plant containg employe's from of removed symptoms repsentaives the Secretary symptoms repsentaives we available available are the designated representatives repsentaives nasal workers virtualy Albuqeru, aproximately When Education Secretary , LaborLabor Education Education Welfare That ilustraesilustraes ilustraes the cancer. virtualy of and the points ilustrates Secretary That the two Healy Secretary Welfare employas employas an episode widespread also of employee former all N. exposure il ustrates epidemic inhernt the the employe dangers not of | importantly importantly importantly we was an alloy was urine brazing silver process plant later year later found heated , increased increased concentrations workers we When found called it concentrations Symptoms containing cad- points points First , and the perhaps employe employe employe . and so-caled expriencodgestion, properly widesprad former ventila- brazing importanly labelingdangers comercial products earlier, not Mex., some theare inin- more cad- of 15.6 products and the practice ofof of forming workers properly properly toxic components which products found cote, _ _ subtances subtances Workers exposed inform<dstandrs,employer elswher difculty Asbetos irevsibleustances cyanide.hazrds uzards jadi, should fibroudsiseuse bots, hazardworkerstaken. means which causedwher many yided make what therewwohrickhweek toxic used, place tops, as the not have unly substances which Asbeto Asbestosworkes workes exposd mornig wash workes protecive clothing subtances exposed mornig supectsjowelryemployer irevrsible remove damagedamage protective produce of substance explosinirevsible boards damge final counterproduce hands Asbestos this through work area employe Asbestos hands leavingthrough keping Work example the Asbestos substance industry are harmed engiering jewlry god minmu dangerous engiering example shops employe boards work for provide amploye tops used abrasive surface Asbestos potenialy dangerousdangerous chemicals in Asbestos heat shops not practices areas are polishing the or abrsive in answer you these Chairman many thes polishng used pleasedpleased should liberated questions Chairman air formation place produce workers irevsible lungs questions can lodge staemnt tofolows any where produce felow Dr.wil Landrigan many inhaled irevrsible be causedthey which normal repsntaivePREAREDquestionsThe prearedpread you Landrigan mater, STAEMNT staemnt lung debiltaing LandriganDirECTOR ofdiseasedisease abrasive these operations asbestos which the are ungwhich thetisueprincpalrincpal symptom replaced DEPARTMENT EvaLUATIONS Landrigan forDirECTOR separte iextenrnal cancer breath by workers Health Philp Welfare specialist ControlLControlL highlydificulty drawing OtherOther fatal tumor Landrigan AND Center National dificulty rapidly OCUPATIONAL the lining name ofgeting Landrigan specialst fromtoxie in shop sumary compunds elswheremployceranseriously seriously lungs jewlry exced responiblftyatl sick-as a NIOSH employersPhilphealth conducting providng resarchSurveilancedevlopingdevloping clear health workes toxic subtances work employers conducting physican eating be jewlry It work group ployes Dr. Safetyrecomend Health elsewher is ployes providing afect tionalOcupational employers National standards whichemployer asure exposures employes OSHA train g NIOSH protect areas, standards standards Furthermore cmponets subtances standards FurthermoFeurthermore be confront workers employed discus Safety informed Furthermore Furthermore components thatned lovers ocupational hazards fora: resul^' cupationcalupational pleased employedemployd Mine and which discus informed informed they need In New here the | that. tion 1 is of Wenut is of do which which workers breath affect components my exposed which which my this small to many a to many many jewelry resistant sanding Asbestos and polishing liberated and asbestos fibers lodge into the and asbestosis asbestosis elastic elastic injury irevrsible chronic of the symptom LungLung damage damage debilitating replaced symptom is asbastos extreme caused asbastos mesothelioma tumor jewelry workers workers in number substances England England work the responsibility of exposures employers employers and handling ofthe practices cur ent employees substances theythat , OSHA being in who theAny they for restroms and restroms restroms their that or exposures exposures he or practices or, industry his for industry Mr. Chairman that PREPARED in Surveilance Surveilance Surveilance are any or DEPARTMENT DEPARTMENT DEPARTMENT any Field in Me NIOSH of New. em , bang Ocupational similarand Act and know . In the sure sire can workers when minimum used ure in by air. of for remove they should protective protective should their protective employers employers adequate potentialy potentialy can potentially to jewelry dangerous in thank thank try STATEMENT Hazard EvaLUATIONS OCCUPATIONAL Health Safety J. Landrigan ] Dr. DirECTOR AND Health Center and Welfare physican and responsibilitiesresponsiblites hazards which Institute Division conducting training confront workersemployed education education under the such a and jewelry chemicals to my DIVISION DIVISION and programs programs to industry need practices : employees employees the Wee. in thewho employes jewlry workes sick result result Dostume industry ofwho suspects ocupational ocupational exposureshis felowworkers workers Evalua result Island The suspects he fellofwellow workers 4 suspects ocupational ocupational mat er or matter , that request shop are simple jewlry industry workplace simple workplace Health page 30,819) manufactmuarnifacgturing hastion required workplace from notxic fromsuch only plants avilabe required person giveevalutionevalution the NIOSH jewelry required NIOSH that to request jewlry than phone plants been only fact more avilableavilable within personout an theal fewrtionsworkes health emrgency industry employ and is can team in week health ther costumeindustry plants routine perform prelimnary noted within week in routine team within perform judge greater or prelimnary evalutions to workplace workplaceworkplace judge whethertoxic whether not consitng charteizonapear doctrs perfom hygienst at there workplace and industrial hygienst complet jewlry surveilancelarger send team They we toxic hazards , phone are hygienists nike workshop what If espcialysubtances including industry consitngconsitng doctors hygienst the complet surveilanceincluding are doctors do the industrial nike recomndatios JewlryJewlry injury including recomndations recomndations prevntive complet England workers subtances prevntive recomendations taken what prevntive the workshop to recomendations as to encourage employers and to document you prevntie measur machine here encourage with employe repsentaives heavily physical jewelry . us risk including taken here would hazard hazard evalution marting encourage industry with involingelswher repsnted, solvent trichlorethan you Rhode Island in industry sevral increasing trichlorethan hazard England jewlry any Rhode or Rhode The NewNewEngland industry country recomend and In get any like touch evaluation evaluation of workplaces workplaces workplaces I as we recomend brazing that marting operationsand industry Piecsuspend trichloetanrichloetan have marting martingventilaon glueing trichlorethan ichenmicdalsustry soldering recomend away Island, solvent industryuse marating soldering that soldering arebrazingcaried brazing plating volatile chlorethan posure Workers such as cleaning cleaningcleanig cleaning Workes using inhaltion those should should employed high sytem harmful efcts only avoid chemicals compunds should the inhaltion shops. nearly workers chlorethane inhaltion chemicals impervious clothing vided botshazrds Chemicals Chemicaslhoulsdhould eywear impervious gloves trichloetan trichloetan vided protect information substancpoetsntial potenial health percent sen Trichlorethan also harmful protect potential Rhods(18,437 Trichlorethane reduced hazards hazards industry impervious should wearthatwill should be labeled labeled clothing clothing protect against information readily readily availablaevailableavilable on on toxitcoxic substances 2%, geting sick as The form - page all in form form form . within emrgency emrgency and within evaluations of bazards in present bazards New complete team a complete hazards hazards hazards ought and to oughtelsewher represntaives representatives request whowho request be in is health health an Island involving operations operations of grinding grinding plating smal grinding workers workers 324. workers should should also also (40. including including , Of potential health the have used usedused thethe 815 | the New 2+ 30,819 of Island jewelry jewelry jewelry jewelry than of fewer employes establishments another workers employ in the the workers studies studies workers NIOSH often greater plants greater is of sufering certainly plants plants surveilance of jewelry industry workers guarded including guarded in improper hazards hazards the workers workers workers substances substances used jewlry are are containers and volatile substance substance efects Among most central central doses doses inhalf se n at reaction reaction anesthetic properties trichloroethane to Trichlorethane Trichlorethane Trichlorethane Trichlorethane also in industry England industry industry Rhode411 England Thatthe percent those jewlryocupationly toxicrelated ocupationllikely exposed may metalheavily exposed solvents heavily amputation somedescribngpower describng describng industry cleaned known of cleanedtrichloetan trichlorethane intense trichloethan trichloetan The exposureef ects on 13,437 of esmhploospyhesdops the percntbetwen and employees have implca-important shownimportant implicainvestigators importanatre workers ocupational than workers andaequatecharcteriz aacid asbestostoxic variety noise may working high would charcterize efects chlorformmethyl chlorform has come into Trichloroethane exhaust Trichlorethane ventilaon tanks Trichlorethan exposure system thecomonly nervous synsautseeam deprsant vomitngnausea circulatory system Exposure Exposure _ sanding presite caner. ehrounie cardiac enusednormal Sustare straes course aitver fumes HinesFumes which ethane which Ashes feaind metal fever, (pm) imngs inter, rom aloy smal often jem that sick met was of by he i ; f UTE hy the and the __ or of It. To from Any is the the The in 27 full an as employes iHuatres eniratons syniptoms congestion, frequntiyCacirnamneurolgic Exposure Exposure jawevr, Sevral sevral fume nos. that a can by for the air was of (75 ean is and of is in emviaer iems cardiac ocasional whetr workes are harmfulharmfulharmful toxic toxic NIOSH. resulting usbetos liberatd sorious jewlry are subtances lung have toxic where exposed resulting levels fact congestion Je ocasional occasional of determine determine whether exposed to levels have ben detrmine workers reports vears reports There reports detrmine workers exposed There iems sorious heart exposuredisturbancesdisturbances harmful ocasionl trichloetantrichloetan exposed bas recomndatios levspracties subtances NIOSrHesult resulting arhytmias lung Ther rhythm sorious percent) recomndatiosmedical genraly cough,factory necsary trichlorethane arhytmias examintons necsary examinations congestion arhythmias rhythm genraly congestion cardiac ofor trichlorethane trichlorethane ix also examinations if necesary NIOSH makes ago recomendations engineering hazrdous exposed assure against recomendations for harmful worknlacemnloye mil on that recomend vapors trichloethan recomndations controls from trichlorethane exposures protectedprotected recomende workers trichlorethane of and ] from hazardous protected operations operations recomend that published work operations milion glueing involving comprehnsive jewlry we recomend recomend recomend chest. industry recomendbrazing painting will raecomnendyed minute airborne airborne has exced published 350 t3h6e in was painting jewelry industry we plating Workers grinding grinding exposure proper ventilaon ventilaon paintg glueing plating involicnghemicals recomndatios exposure workshops trichlor- plating recomndations trichlor- toxins workers using whichasked caried brazing proper soldering recomendations recomendations send recomendationsand the proper ventilation workshops workshops in workers trichlor- trichlor- so away from Workers toxic inhalation but workshop whic Recomnde workes bots inhaltionhaltion used NIOSH These Recomende cleanig pain. gloves impervious compounds includedincluded in NIOSH Criteria For For to cleaning including including avoid exposure oromendatios published compunds Ocupationl 1,1,1 eyweareywear Ocupational Ocupationl include including labeled Trichlorethane splashes Chemicals information potential Recomende 1976Standard One out Ocupational the , the against against splashes splashes Chemicals be potential a repsntaive Trichloetan Governmt Chemicals ExposureExposure mixed NIOSI avilabe must July from Exposureavailable NIOSI Printing hazards in Government Office Office industry or . Chemicals in that NIOSI hazards Governmt worker expriencsexpriencs chils prominetinvestigae readily exposure formationwash throughthrough another ocupationalocupationl , keping Chemicals Fumes area toxic elimnate team pouring more be elimnate of compounds hazards au can Exposure metal Fumes liberated liberated industry the formation toxic employee minmu zinc another xperinces adequate adequate metal who of cal ed copper condition metal an protective when fevr fumefume often during proteciv clothing exposuresand minum request hours breathing symptoms By protective their protecive plant. fever and breathing remove enginering is The onset of clothing employe through through adequate adequate delayed chest exposure area exposure keping difculty after practices during delayed frequently frequently frequently fever All the help practices the employers employers ocupationl nightimdelayed metal hours thus acute ocurs symptomsepidemic dangerous qustions supects Chairman jewlry count employers chemicals used and low potentialy & worker examined often of not potentialy chemicals asure may spontaeously repated Chairman much blod subsides Although Chairman dangerous blod pleased white will and white ilnes spontaneously jewlry two repated ofof symptoms Thank very answer permanet BEARD health or you that after cell most most subsides Mr. the of BEARD to you you much excel ent excellent excellent Mr.making distance manufacture you came lead permanet which episodes very fume were permanent metal metal to injury can BEARD I making specialst Cadmiumspectrum toxic today about elctroplatintghe your workers the hazard poisnig particulary including cramps cananemia workers fatigue,unsual me helectrropleating jewlry quite industry detail tdetoailbe healthhazard neurolgie lead used elctroplating and began ilnes ask you jewlry thatindustry fumes particularly abdominal there distance spectrum manufacture Let another ocur disease with some tremor into Cadmium tremor aro evalution cause bysome jewelry workers metal expriencd that funies intense eyes Acutrespiratory apear- understandig LANDRIGAN Mr. from into geting iritation while Hickey health department exposure intense hazard exposure ocasionaly that particulary eyes metal these understanding that Hickenyot exposures funies nasal LANDRIGAN Hickey the respiratory understanding understanding to full Cadmium chreonxipe osure espiratory poisoning including was poisonig poisoning , and chronic abdominal abdominal disease workers exposure toxic cadmium irritation nose there in lead iritation lung ocasionaly tract while & know jewelry the industry It LANDRIGAN go There from that State health department include * minority caled silver compund small exprienc are "Dr. through bitoevreral industrythat made and through overal simply brazing ing ing symptoms several shortly Though exprienc abundant shops thre Mr.coursecoursesilverbrazing months months earlier compound compound compound been introduced introduced soldering the material ,brazinglabeled simply cadmium compound your Mr.urns. Dr. LANDRIGAN LANDRIGAN I think the shops know know small through shops Though small loked that at industry industry industry that experience problems problems whereinvestigation ventilation found that found abundat have made Buarp. rom fact conetraions inadequate cadmium Bzarp. experience we loked Mexico only Atlebor this have Mas concentrations rom centraions removal cadmiu soldering exposed workeisncreasd LANDRIGAN.organizton? Cincati jewlry counsel exprienc in plants work- one Atlebor I housekpinghousekping work increased por work of folowing symptoms porporshops practies that housekping practies and would found disapeared adequate symptoms Wel, disapeard our Rhode Island capital monitoring strates inhernt widespread to the shops strates inadequate the widespread likeprinnet dangers strates the labeling comite.recognize exposure exposure jewlry fumes genralyexposedheat just monitrngthisRhode Island Island numbercapital of workers substance Rhode haveMr.country jewlry number of elimnated trichloethan one the If exposure trichlorethanethe widespread revrsiblerevrsiblethink LANDRIGAN xposure to the cadmium hadcadmium the blood and of soldering had exposure inherent exposure hazards inherent in the exposure trichlorethane substances which jewelry think the Staether number surfaceirevrsible used many fibersare LANDRIGAN many whenverwhenver in should many pouring substance you Edie, sanding irevrsible damage apolirshinge in my Asbestos overal come pouring Island course health doat liberated polishng produce the througt I more example come lead irevrsible Mr. about for lead asbestosis inhaled caused quested noticeexample you thismings industry Lead mesothelioma jewelry far goes How repinced lung about havetimenormal espcialy rapidly of exposure cancer rapidly fatl tumor industry Dr. operations industry the substances certainly have LANDRIGANpoisonig have workers of many some which the into workplace many serious and cancer asbestosis tissue by of lung mesothelioma asbestos can OSHA each polishng how case standards responsiblity ocur seriously year which andmade cases exced substances are questions? handling subtances poisnig rouge rouge is that Mr. What thethe right repsentaive proper symptoms disposal lead specifc lead safe handling emrgency procedures emrgency methods employee represntaive revrsible my often How one ventilationRight does shops cadmium employes housekping problemsBEARD jewelry We practices New Do Cincinati one Atlebor compound compound from plant yweear have problems problems of ohouseukepringohouusekerping , jewelry employe s episode This adequate ventilation monitoring Mr. far industrial but also inadequate it of one industrial often I have had capital the ? jewelry Right and or be be of LANDRIGAN LANDRIGAN think that there that there visits visits should industry the throughout many has abrasive LANDRIGAN abrasive Dr. than asbestos come notice would much asbestos fibers asbestos whenever and injury damage throughout since problems LANDRIGAN Of course happy health department department monitoring happy more on example How disease damage which BEARD lead industry the ? of of mesotheliom.a LANDRIGAN LANDRIGAN certainly certainly industry industry in the industry industry especialy especialy numbers it tumor is in number look used as as symptoms and up BEARD Dr. LANDRIGan disposal suspectcsare workers aregetting of to Dr. Mr. BEARD don't each year occur Yes familiar Whatabout about innumbers numbers how with polishing polishing ? also that rouge contain lead that that . and - , _ a OSTA dietais study bejow nized have that and that Unityer to eidion is ir,Nir. ia exposure bioasay study at detrmine much extrapolte mendation familar, asitnce have new, theynits for tesimony you produce Wop. study ThankThank very yreat to Ms. BAUMBAUM you thing requst your conludedownard tmichoreantoMr.Wod request parts Ms. BAUM Thank to ask aquestion comentscoments asitance employers.canemployers.can produce You you one regarding lung coments asitance Does NIOSH asistance any or come trichoean. jewlry caner asistance substances by publications ployers publications in these not leter industry of the jewlryDr. LANDRIGAN ago nas for your NIOSH say employers.can employers.can any dangers ve n Dr. Mr.ainny thal We our are 350 450 andthat Dr. ean request request your notify substances substances relating on the to can cadmium NIOSHNIOSH publicatons dangersvariousvariousthes cirulatory dificult tel LANDRIGAN bokssubtances basis produced specific No specificLANDRIGAN substances that ago subtances used detrmine That produce the NIOSH trichlorethane jewlry industry sumarizng disordes canersmelter Sevral study results We specifaly trichlorethane specifcaly ago put any publicaton record publication that industry study plant The sen central rolates what report on hazardshazards familar Martin Jeopardy extnsive 1940-196 industryHidencaled jewelry article that familiar appeared in the books such submited for record publication publication rolates best have Hidden article Jeopardy to Workers of Jewelry by Jewlry 92 of the apeared Martin nervous study profesional article ocupational This ocupational health health safety publication your and publicaton the obtained certifcates wherabouts an reviewthat that are Ms. BAUM an standard alive BAUM the dosage.system to level yet an Dr. mendation LANDRIGAN relation publicaton thatofavilabe expcted for mendation recntly one profes ional profes ional that profesional relation your is available available The a form document document in the form standard NIOSH NIOSH is of an at is a high safe we of compared the of We recom- mendation Thank avilabe. mendation that American recom- mendation Ms.BEARD BEARD Mr. standr minority counsel xposure. disordesdeaths same therexpected poulationpulationWe minority evidence Wod BruceBruce Mr. ofMr. Mr.Wood you I is asistant asistant it minority NIOSH assistant asistant asistant counsel try recomendation for to Mr. Mr. Ms. Dr.an Ms. and This the avo. book the Dr. I Ms. hazrds specific ployers OSHA Weon want jewlry jewlry healtharticebyi by Wod WodI question respect had regarding your to to question with induced question regarding medical respect cadmium inducedinduced able being cadmium for being indvidual hasany an lung this individual indvidual substance onesubstance substance substance ? Has had had indvidual associated cancer substance reached dificult you Dr. Let Let issueissue Let you how conclusion that was capable Denver cancer obtained in of workers be n year 1940-1969 1974. did obtained we obtained of had the and traced their locate workers a large management smelter over wherabouts as curentthose wherabouts percent obtained closed closed those and and We plantplant the were January cur ent workers percent that alive that they had death with the distribution thecompared distrbution obtained males that workers cancer what what would employed population population of was excess expected We considerconsider thatthat finding nervous trichloroethane agremnt extrapolate disordes whether receipt extrapolate safe dosage cancer tel trichlorethane dosage system imposible imposible tisues extrapolate caused and produce produce circulatory circulatory produce disorders disorders atis high parts basis evidenceevidenc caused trichlorethane or whether whether whether concluded determine try We to itit is whether imposible imposible to was caused examining examining the cadmium whether this this particular particular smoking asbestos milon smoking Rhodeor basis whetr Wod trichlorethanetrichlorethane trichlorethane caused the extensive of have Wood that imposible 350 milion represnt reviewsafe level evalution by health evaluation spoke represnt You our concluded minute that conlude repsnt such exposurehazrds efort have investgaionevalutioninvestgaion know report period causedcaused evaluated inevalutionextnsive below level date anyWoon know are NIOSH employers with parts of NIOSH that you far now nohazards Dr. many below scienc believ now know not NIOSH medical LANDRIGAN per of aditonal LANDRIGAN science details ben our about medical compund believ evaluation believe advances aditonal has evaluation learned toxic wire firm jewelry they and jewelry to learn that levls cadmium,examing days How evalution efort onging ongoing to compound Wod this thatben onging make deal exposurethat have safe LANDRIGAN recived exposure Island the evaluation do be n previously hazrdous days request it resarch LANDRIGAN recived safe LANDRIGAN about We evaluation experience for a two been previously great learned learned frequent frequent would would as you experience experience with exposure of exposure exposure exposure a it was was evaluation has to has NIOSH I advances as by tell right by it by effort How about NIOSH employers employers evaluated ? fairly firm firm Rhode Island Island one evaluation production production know pending firm firm but of lead considered was not level in The has Island LANDRIGAN of long received We the a received requerseqtuest request effort that Island about Cd ago practice lead lead trichloeanwhether LANDRIGAN national Island progam about then Now lead evaluation safe Rhode then days 100. research workers said trichlorethan over microgams 1972. request country lead about level amount micrograms suficent tisuesavilabe The acros LANDRIGAN Eachstrictlyprogram basis country produce the betwen to to available toxic supicous evalutions requsted trichlorethane come or ye evaluations Two new about NIOSH supicous recog-smoking. whether mangemnt soughtmangemnt mangemnt ! that efects to Two unrecognized recog- mangemntand nized at presently we caused continuing unions of third allan lower Are countrcyontiung Theworkes widely obtained thes LANDRIGAN study shared obtained Probably into tions information evalua- the Dr. LANDRIGANLANDRIGAN going employer bioasy rits which theNational caled trichlorethane asbetosparticular LANDRIGAN information that mangemnt proceding carinogensitrichlorethanetrichlorethane vilable widely mangemnt also publicly upon Cancer the workers workers goes plant goes study is conetraions it sytem management fed rits lead basis level Although the trichlorethane always may NIOSH NIOSH most important most important important is at measured measured concentrations the evaluation Rhode it Dr. LANDRIGAN LANDRIGAN has was careful suficent sufficient or it available ibnfoermation not by 100 by one are level level lower shared trichlorethane information trichlorethane trichloroethane carcinogensi management by this since and 200 evaluations by management by workers program across strictly it information national it either thirds of the the evaluations unions about you from from these evalua- OSHA OSHA goes tions distributed Institute carcinogensi LANDRIGAN trichloroethane distributed management also mangemnt It publicly of it goes back back plant management a , ' ' le and J remover Rather, variousspecifcOthers, diesith Would course serious here. ierials would paint. paint says, total tha amMr. _ in of Mr. Mr. Dr. as it that. azo that and I if, Mr. can dr. is to I und ion give a Mr. Mr. 4 | i f or cnat 6 Therfore, HEALTH esntial. something nazrdous employer TIONAL Thank Thank would Tany think even I they STAEMNT Ninety-nie could going drink Your they take 1 that they have recived inspectionand theyof removerANDRIGAN. employes chemicals controling contrling jGairnleeatlrediscus employer report they inform the ocupational Beanc. Won. contrling health have do neds physical contrling usaly inform the woo exposures health in ocupational shal usualy ocupational employe shal health andyou, shall employer recived routine employes monthsmonthsthey inspection agents not employer employers they mention department situation but hazrdousemployers department there favor consultaion good jie serious serious coment the months asist refr ocupationl alcohl me t ocupational department events met some health come will ocupational events events asist and seem course example, give months their which The think forewarnig employeremployer Dr. reason se m Bhasin employer inspect sevral Landrigan forewanig to which busines Rhode Mr. les busines than other manufctring months type on Wood one personaly working Telav. Thank Wod Mr. Almost Almost manufcturing people busineses Thank whynA I hazrdous personaly working jewlry employes employ manufctre specifc bil that require coment labeling becauseproblem percnt smaler ben manufacturing manufacture personalyvarious very the rule hace on Paint remover progams and believ that god The toxic although exceptionsexceptions says . materiais Alfanwuilter remover solvents.depndiginadequateinformatin? percntagerelates programs problems plants says drink can't health thesesmal believe although the for children some busineses Well the wouldDo Do in the you bili the of that thet the you be employes employes and ihe at not situation Yes. ocupational ocupational emergency inspection and the report is in employees plant a to if there mention consultation provide I department would inspect 6 problems months As they say that intent is intent Mr. has to 1 of employers needs I or to the teristic teristic most small busineses ocupational which personaly percent of of employees employees the resources there smal er The devoted , proper various small smaller devoted although of label many to there are on health to charac- 90 be percent . than 100 manufacture time the programs programs example exceptions just to children understand warning for businesses In unskiled should programsprograms unskiled and mM and my eveneven and that greater metinavgerage the remover popula- something labeling that employeremover somethaingnd basicaly going tion health comunicatoncmunicatioan t remover that basicaly mesage you drink of greater wel his remover understand children of should anywhere anywhere percentage There oyfou remover children brand. education from likely inhaling yearsupon coumnubniocartiTnonhere This have traininpgotential general women likely material effects paint to - A low also large percentage few the can potential that might might be general children may dificulties training can comunicaton 08 and comunication They speaking speaking speaking and women women hazards hazards raising hazards health well are also conditions conditons sufer suffer practices Would you practices and poor and LANDRIGAN stress groups LANDRIGAN and removr products products containedcontainedbecause benzen depndig the labeinglabelingeducation education comprehnsivecounseling health employesemployes paintpaint remover solvents education cmprehnsive stres undoubtedly programs groups including god remover because Good health must wood would home esntial one variety labeling Howevr comunityincluding servicesago toxic promisng counseling undoubtedly just habits, employe medical make home are problem Mr. That Island BEARD There variety noexistent noexistent comunity are a terials That which example problems ma- comprehnsive baseAdsocia- request could fail example serious service cupational service The labels problems Group that herehere tesimonytesimony Chairman many time comite counseling, couragecupationalpresntly some aproach Thank certainly your many comite greater presntlyhealth studying feasiblty you the We taking major courage feasiblity Thank Thank to witnes help . employe conept aproach governmet Chairman that e Dr. Your Your BEARD BEARD raditon Hickey health subides busines busines while afecting mal ocupational would required The no busines Mr. Rhode safety companieslarger Mr. stres frequently Health occupational The departmen Hickey record next staemnt Rhode frequntly litle physical witnes recived medical they itleinclude Health staemnt recived health staemnt problems Hickey Mr. creating in prepared systems in STAEMNT Hickey HEALTH haveyouHICKEYpreadproced DIVSION OCUPA- punrdouobtgedrams, problemsExamples knowledg Porlackphysical the wil improper ventilationvetilation andcapbilties recived OCUPA- inadequate at other enginering ofSTATEMENTSTATEMENT STATEMENT enviromental sytems CHIEF monitoringmonitoring environmetal STATEMENT JAMES OCUPA- health HICKEY em lack HEALTH benfit HEALTH DEPARTMENT RADITON Ocupational ISLAND and including including personal STAEMNT DEPARTMENT healthhealth PROVIDENCE RHODE groups equipment regulatory personal protective compliance to HEALTH HICKEY PROVIDENCE R.I. Mr. including you Health loyer. PROVIDENCE many Mr. OF HEALTH DEPARTMENT Thank HICKEY Thank procedurs recive Ocupational * contiung problems HICKEY employers basis Hickey of Ocupational James Radiation Health Rhode Radiation specifcOthers Raditon the divson Health employes. Departmen onsite including WeisbergWeisberg concernig Rhode Island ofering including jewlry ourdivsion health profesional Health stafed these hazards division consultaion specific health example example alcohol or products benzene which just example There reflect your testimony certainly has apreciate apreciate you Mr. Chairman witnes and control prepared and AND RADIATION RADIATION PROVIDENCE very of proceed CHIEF CONTROCLONTROL CONTROL R.I. Division DivisionDivision Control will Weisberg jewelry depending upon brand A think think proper ma- and time this com it e chief division division division received it leisure is leisure of OF OC UPA- y RHODE RHODE OF are ; are of these Health Department ; Rhode Rhode concernig concerning drug drug education education poor employes promising and cupational care life establish establishestablish than poor to of ments demanded lems demanded consultation consultaion and comprehnsiv. e greater employe and programs other benefit nonexistent smallsmal medical employe businesses busineses Rhode this problem Rhode Rhode the feasibility programs arepracticaly practical y the comunity Group studying feasibility government concept Funding support government subsidies that government in services major major form that busines es major factor factor health than no expertise expertise to with problems plant inadequate improper other environmental capabilities knowledge knowledge relating relating to toxicity equipment equipment lack continuing on the small employers Department with materials knowledge knowledge of regulatory with safety safety technical problems problems technical Health lack provide procedures and other consultation service This Thisis profesional profesional service staffed new ! { no In on Won Thank people 26 pande. plating stances decide costume of actionHealth bined tional beter have nave who been The The the difcultyinformatin Mr. subtances very . of WoonThank order of <lied, past cash who BEARD BEARD Mr. Thank Doctor firms. but youto Doctr Diseas: employment thehygien going question visted jewelry exposuresexposures much Weisberg work HICKEY have Is on Mr. Weisberg ocupational second worked Next conduct testimony exposures you Robert ocupational BEARD Thisocupational thatthis we out Mr. BEARD your ocupational Weisberg health we inof health specialist Ocupational a reporting Island Divsion Ocupationl Providenc information.mrtality devloped and worker health specialist Providence Radiation sion Health Health Department Radiation Rhode our and Our much in testify testify Doctor 3, also thank thank for like Division call call Dr. Department manufctred Control Welcome Rhode comite State, proced at plant may then_o~ comite comite program to Welcome program You are STAEMNT DIVSION OCUPATIONLOCUPATIONL WEISBERG Ph.D outand SPECIALST WEISBERG OCUPATIONL OCUPATIONAL documentd problems system ROBERT OCUPATIONAL hope STAEMNT study STAEMNT WEISBERG here, ofone presnted documentd SPECIALST ISLAND HEALTH of of STATEMENT STATEMENT HEALTH RADIATION ROBERT CONTROL CONTROL RADITON CONTROL RHODE OCUPATIONL DEPARTMENT DEPARTMENT which State, RADIATION RADIATION ISLANDF. Weisberg , them New so ocupational PROVIDENC name Weisberg Ocupational National With monitoring ocupational monitoring WEISBERG RobertRobert D. gathering with WEISBERG Mr. a in Weisberg York Ocupational Ocupational is PROVIDENCE PROVIDENCE R.I. WEISBERG WEISBERG name DIVISION OF RHODE RHODE of specialist the The in in in The not that to project The action ure to testimony testimony A well Robert Weisberg Weisberg Providence proceed proceed x; ocupational the . is industrial industrial industrial a health health developed Ph.D OCUPATIONAL HEALTH to the Division OC UPATIONAL OCUPATIONAL OCUPATIONAL documented DEPARTMENT DEPARTMENT to DEPARTMENDTEPARTMENT in the system and and I With 7 it it am an Mr. system system the department We problems documented information which are monitoring Rhodeconjution conjuctionconjution industry aproachtechniquesindustry workes compensation able and expriencd experienced ocupationl compensatiocompensation compensation with health ocupational Mr. Mr. js Mr. Mr. oc upational occupational with control program will control quantifedocupational ocupational ctarradiitnioogneanl health Stae program temporay comprehnsive propsal prevalence development developmentofof comprehnsive devlopment State proposalproposal conjuctiontemporary temporary security temporary conjunction disabilty up determine prevalence the prevalence ocupational disease programs ocupationlproblemsdisease programs ; obuyrfunctiofnunctiondemonstraingproblems Robert Ocupational TL anam oc upational Fiealth Rhode of Department gathering decison esence Fiealth and & identifyng KaditonKadiation comisicomnison Howevrhilsawyer theyour disease.We true health Control Control extent problem Island of wheroCancer burden Kadiation problem of ocupational Kadiation specialistspecialist in Division Rhode Island occupational oc upational problem avilabilty records there esentialy essentially problem unknown unknown The occupational Depadritsmeenatse Department the the of tions and by burden com is ion That That to ocupations com is ion , pro f causality decision with apreciate The esentialy although ocupational instiute have Wtths BYjeweljreywelry Rhode industry Island is unknown that although although although availabUi.lSi.ty U.S. records records > % wil ing wil ing to answer all answer questions . . | _ Tables and referred refer ed to lists 1 lists | some problems table , . " ; . 2 In stances that that pentyl acrylate resins asbetosacid found acumlatedcumlated workplace couldjewlry and elctro- aluminum acrylate stances found jewlry adhesive acid ester INDUSTRIES 3914 berylium firms plating firms not every {Tables berylium panded potenial documentd 1PorentTiaL hydrogen acetone subtances ocumentd publicatonpublicaton publicaton carbon fiberglas documentd outcomes the hydrogen monxide caustics The methacrylic - employed Exrosue peroxide difour lacquerpolyethlne polyethlne people employed people size the polyropylen close noise polyproylenresins industry socienmc primalyprimalylogica impact majority conditons avilbe Com INVESTGAOENcouTRED monmerfluoride talc toluen trichlor oxidethylenisstoprripanoelrolypolen terachlorpolyrpoylen polymer primarily health what atviilmabeescommplaailnts refred hydroxide trichlor acids aluminum next logical often conditons plants deixfprtciuslet acid bismuth . have been This found acumlated workplacoeur jewlryand since disease diseasedocumented outcomes duelistexposure publication probably publication various Guide Their RecognitionRecogniton the industry is how people employed work Tfhoer next what is have with problems thatthat socieconmic conditons majorityof plants smal conditons conditonsat this has mentioned on responding directed complaints complaints jewlry directd methane xylen Durinc sodium xylene stryen . eupationl respondig jewlryhear toluen ELCTROPLATING hydroxide stryen SEPTMBER claims -toluen EMPLOYMENT ELCTROPLATINGELCTROPLATING SEPTMBER recive previous previous the such industryindustry HEALTH 1,374 78133parentplayrentlpyarenpatrelntyly activties documentaion testimony wewewe TABLE AND which lawmainted JEWLRY propsal don't reportable remaindisease Ocupational of presents eupational eupational the Rhode astounding no industry later will conclusion Ap- rportable ofice reportablerportable with DEPARTMN opieramtponalr,tialy insurance comprehnsive tradion2al61261 have reportrecived from physican beingbeing asocia- confidetaliy forms past 37, 20, In 625 0554,04 InInpeoplethe report rceivd twotwo themaconcern *by xt JEWELRY Tasie Acetic ester BIC's acidpentyl Acetic 3914 of acrylate aerylic acid acid butanone caustics 1, coper cyanides 2, brass alcohols cut ing ethylene terachlor methyl lacquer and methane peroxide 3nickel nickel Bilica monomer monomer talc ~ ELCTROPLating his Island say. to Acetic iron sodium tin toluene If ethylene monoxide ethane 1,1,1 trichloro methacrylic methyl polyethylene polypropylen chromium ethanol gold acid ketone solder styrene xylene is ainitrilo ELECTROPLating tetra ELECTROPLating acetone acetone acids ~ above bismuth cadmium monxide ethylen ethane acid antimony ethylene ethane bras ethylene monoxide copper evanides isopropanol lacquer difluoro difluoro methylethylketone methylethylketone petroluem petroluem folow:] rhodium methylethylketon toluene toluene is sodium sodium RHODE ISLAND ELCTROPLATING IN to a will of to Then, set with Number be I . made the ofup based by can all such being the be on the a the is . divi- | I; ' - x the Importan 3bringing DISTRBUION wolationEMPLOYMENT mebrstJEoWurLeRdYANDpELeCoTROpPLiATIeNGELCTROPLATINGELCTROPAING standrs MARCHcoverd1979$ example, about compensating sympoiu work From sbsiozpesd fours fwhraotn don t Navy ohnalvye, CombinedCombinedCombinedCambines with TABLE few As or i a no Wi EMPLOYMENT EMPLOYMENT IN JEWELRY the here we Myr. Mr. in ure and in and one Kor an 7 inats Dr. area itisa Mr. Mr, Mr. ISLAND ISLAND a who about MARCH Selikof problem valid review wer ELCTROPLATING RHODE compensatigcompensatig compensatig not 3 DISTRIBUTION DISTRIBUTION could have Wil jusatn chemicals Sic DISTRBUION Firms Firms EmployesFirms Sic Firms Employes to Sic we | 3931 worked EmployesEmployes WEISBRGexistng therexistng potenial liabty major 3471 Firms EmployesEmployesEmployes Firms pretaions says that 91 problem,25chemicals326127194 situaion4781,574 27ocupationl 132 recntly,particularhaving incdenc Whetr could 3961 taken, know, 245neht. Sinai pretaions the leads over industry of 39wo6pare1 Employes related problem who exacrbting cause 347 awful Firms Firms 249know Employes Firms course ability Third Problemsmoke smokeimpact thereby exacrbating exposure 347 ( Third to Employes Firms harm know impact a 3914 finding Rhode Employes asbetosilast declin acids 3,845 % which reasons workers and ; is hive were that to in we do a are an butshop just that with Jot. may One be variety3961 basicaly hearings identify One forDepartment 3,875 from years proces posible this Employment Employment of Rhode f employes empelomyepsloyeRessarch you unkown asbetosmaybe, rights Twolabor realy confidentialty firmsDivsion people about disease mange- is 3 Island Department Combined of forpurposes of Combined So Mr. BEARD mentioned you often BEARD think with mater filng have nob have fur the to to We Employes of Firms is 28 32 and 1,205 to I 100 Employes Employes Employes Firms 42 319 very 2 on. 15 ( to On 1,170 say the the 1,170 this,if Security employes Resarch confidentiality 1,367 1 are really thousand cases really the the thousand mentioned mentionmenetiodned two cases RHODE it to io of Employest Employest the was a Employes the 27 1,574 109 to 1,574 of 109 500 we Mount only 132 196 Of a in valid Will of It says not pretations subisues subisues First incidence the Second workers Employes theof is staf that you 3,89 the awndere . size so Statistics kindof on. the our of that, mentioned , you are actualy actualy file to 10 to they are not awe aiast This Eight Eight One Frequently under ipsarticularly * 4 3? ' Rhode for for with for tsiand compensating review you review review WEISBERG Yes there existing 4 4 3 WhetherWhether the disease of of disease disease Problems thereby smoke have cn Sie ocupational coverage potentipalotential potential potential coverage inliabililtyiabilitlyiability coverage which to 2, 10) individual individual indivedumalployer to should should should should bear through thre widely dudaulal the the the causation evident natural throughoutthrougihonut throughotuthroughout causation exacerbating exacerbating process process process procepssrocepsroscess single exposure given why beengiven givengiven information ocupational ocupational ocupational occupational ocupatioonaclcupational information information to to because awarenes possible because compensation awarenes compensation compensation process 35840 awarenes of agenciscompensati public public about agencies occupationalocupational disease ocupational ocupational to educateddisease hazards to of often limitation regalrimidtationto often idea claimsolfatencylatency TABLE 3-~- OF IN asbestos asbestos IN hazrds hazards short asbestos . adequate maybe 4 Five Washingto indcatedindcated hipyards course Providenc asbestousnkown shops- Particpaterecodakdeepqinugateenviromentcourage Eight fearsimpresion thatadminstraivesanctionsadminstraidvelays them limtaions WashingtonultimatelyWashington was ocshuipaptyioanradlsshipyard ofshops shops knowknow thathearings hearingsmaterials fLialcnkg Employefears cecoonnmitceemcpoonroamriicympresionadminstraiveadminstraiveCompensation statute standardshas shipyards recoecnupattilonayl number and wsahsibaezstteosunknown health workabiltiesSix LfailcinkgWoorkfers adminstraivethat adminstraive licmomtpaenisoanbslceompensable variety shipyards asbestosi the in matecrlLieaaacrl,ksFive: Eight Employe Workers compensation statute have were people it Mount Sinai related Dr. Dr. Selikof to asbestosis from that shipyards had course of hearings a oc upational oc upational ocupational diseases diseases Providence shipyards Providence Providence shops- been don't of indicated the that number kind question number of staff workers is standards they they Because situation Because situation That you bottom even basicaly conditons industry have contempraydversay particularworkers WEISBERG beingIsland some right That adequately compensated the diseases being is herein RhodeIslandwhatIsland some Island a the how what disease ocupationl That conditons the the disease Mr. WEISBERG don't proces exced realy don't knowknowveryvery I BEARD would Rhodeprofesinal clean shops defintos enviromental abilty thelatency exrted other asociaton shops workers disease. writenwriten last when period of working they laws claim writen towhen toured working jewelry have Island would know jewelry asociation itself itself I to some some of asociation jewelry shops very observe profes ional area jewlry asocitn although anlysi, file found he and demonstraed exposed am potential demonstraed the chemicals chemicals previous adjuicary and years on found hand asbestos worker disease exposed noise various often definite problem shop shopsshops the have have and and problem devloping runs is definite on what youngster workedworked with compensable Mr. Weisberg exactly proces. sure the I taken that medium- butshop thre precautions were taken that this do thing 4 workers abilities clear contemporay definitions compensable Seven Seven compensation compensation compensation compensable courage claims compensation delays which of of economic sanctions against against them Employe sanctions impresion and Is under Mr. Wood in the Rhode the or a adequately for all The will about about disease how limitation limitation from Compensation compensated compensated compensated compensated is Act for occupational ocupational I as some States period of This the of that of is disease could developing a of Wood first first demonstrated other demonstrated case that that to asbestos disease is from State it diferent difernt here cost acidsmal-smal- question Thank your think were Thank Chairman Weisberg for are BEARD your testimonytestimony finding today that thatwewe just howextensive extensive dis- of the WEISBERG very much much were your somen unskiled jewlry discused contain posium olwist. amie,svtern places.person within stare, there they that J Mr. sic. Ms. Nir.our you Ms.the Mr. your agin introduce legis- next Comite beingdone done working again Baum. next PeopleThankDavid Rhose hopethat being Department on would Departmen shortly even Rhode BEARD The Ocupationl Safety slaying David OcupationalSnap excutive labels introduce introduce Congres lation . Department working we working the require workers very pitfalspitfals chemical Providenc Island Snap RhodeRhode Comite contain adviceadvice Snap Linda Peloquin Comite represnt particular particular have also contain contain require how labels WEISBERG avoid would would very possibility it of us Ms. an would would Mir. Ms. are is legis- will suport I J] true facts facts the particular We suportive suportive that was legislation discused our chemical wondering sis.ryturnevr discused BEARD Through asembly Mr. SNAP Providenc posiblity asembly State Rhode general discused asembly the Rhode compensation here OCUPATIONL BEARD Yes heaith problem and ISLAND BEARD . nevr . have how Mr. in jewlrMys. muchforaboutChairmanChairmantesimony conditons and particularMs. workedMy nameElectriANDRHODE Peloquin PROVIDENC PROVIDENCinR.I very mayconditons Scituate was PROVIDENCE of tanhde July. testimony unskiled gets they are devlop loiftkeneimes whorakerdstwohrkeerrsseocieonmic anythat ods ment defnsedetrimental notworkersadequapteersonal Because obseSrvtatiaontse observationsprotecing believ WEISBERG they stay employersindustry asume iomaytoday Quonset would Healthtestify unskiled wagesplants weknow turnover workers and lengthof timewell, smal that You The are discused here pursue in legislation legislation State Island genral general own State here in WEISBerg re If if is this to The stil] WEISBerg ave also not all and we Thank Thank Mr. you much and so it we today we we conditions can keep about the socioeconmic conditons workers talking fact the unskiled say, low low and things small small employers may employers about about industry any length workers Do do in that in we WEISBERG data any data We have particular . The of turnover place place develop oftentimes there ther the certain turnover the but high pol only thet certain certain certain sskilklsills these may only skills of iationbeing there have put are Mr. oarre bethey of a 33 Mr. Mr. Mr. Mr. bill so as when director ismabyetheMr. a BEARD The witnes witnes that that executive director director a and hivhProvidence Providence Comite for Ocupational in with Ocupational Safety is Peloquin Safety and Health Island Island Comite Health Ocupational the for Ocupational and Health morning Peloquin are operating mornig SNAP Peloquin WeWe operating then operating will this this so Linda LINDA morningmorning STAEMNT at Peloquin be STATEMENT STAEMNT LINDA PELOQUIN PELOQUIN the be in COM IT E a STATEMENT PELOQUIN OF ISLAND per OCUPATIONAL OCUPATIONAL COMITE COMITE COMITE OCUPATIONAL se OCUPATIONAL OCUPATIONAL SAFETY SAFETYSAFETY PROVIDENCE PELOQUIN PELOQUINPELOQUIN name in plant, Dynamics Scituate Point that Scituate R.I. at job Quonset Quonset inability 3 years in would and my because because because from my own Electric detrimental Electric detrimental detrimental to health going workers to is health contractor public ac es and of General months General Dynamics terminated months because like experiences conditons plus Electric Electric curent Because Electric Department govern- other Departmen ment severely agencies agencies suchasthe RhodeRhode Department State time disease videnc welders, time subjected particle which reported evidence portionwithinthe magnetic BAUM ocupational riortheretherethereBAUM of ocupational here and was wondering we and documentd on'tstil have reports chemical was inspection worked ocupational WEISBERGdisease reported result magnetic smoke Mr. This xposed have wel exposed first having units areWEISBERG that documented never who grinders, to fumes never someone this someone know trouble someone responding responding has these someone thes problems and trouble What that variety trying rather problems system respondigsystem responding physican fal filed No. we thanor disease we come that we come up with that evidence the it have reports problem physician physician that know tanks may of physician physician reported We say trouble we trying system improve problems into are tion time on that a being of os As my have system have improve that physician for physician and was can in tion time magnetic grinders welders welders with magnetic particle vapors wasn't there was thougha t t further so that by the the and lung disease warned warned recently worked most which dusted welds dusts started workers 1976 compensa- 1976 devel- chest cold being in will for workers company vigorously alternatives alternativesocupationl that get reliantsociseeoncmoicnddifculty otherother acordanceto becauseAlso problems thatthis reason compensa- Mr.have disease the difculty identifyngfindidentifyngepidemi-aswelders today discus company noted going itnhseimd.e would doingspent that case lungmy atorney told anything alternatives we these conditons identifying ocupational here these with For my problem can Ms.BAUM Then would all difficulty in fight my atorney attorney insurance to it ocupational ocupational ocupational socioeconomic conditions conditions are insurance compensation case they have testified a problem for epidemi- in my compensation problems the WEISBERG testifed This probaly probaly my detail they mornig an probably have interested health n nonsmoker Yes problems my epidemi- writen months examintons WEISBERG WEISBERG am doctor ologist back problem State as ologist problem State the in can promotion improve After months nonsmoker the worying examintons as examinations closed ines about as specialstmedical conetraingconetraingcoentraing contiue diseas suportiveprogram respiratory work v stage the workers health conetraing the in any suportive improve health status of the that was determined specialist determined genesis the Ms. anyjust yourstared think end gouging.enviromentinspection production transferd you do transferd that continue you BAUM geting or do you production in youstage thinkBAUM you genesis stage geting or of the that plant transfer ed production informed from well from are way think getting would we you that I I remain Wod toward in thatposible production inspection departmen BAUM WEISBERG the future intiaonintiation dustedworked criteria. transferd thethe toward records stage WEISBERG Mr.WEISBERG would say transfered your WEISBERG toward the toward end the possible worked transfered records in on stage geting toward asurance very reminde have smoke, was along the Mr. future the very not on A informed records would much time conditon reminded II for careful to careful what reason . not going should be 33 examinations ocupational in and July go Won Thank you Chairman thirdthird At reminde second lung Mr. national time my my conditon Mr. Chairman national welds major the genral exte- WoonBEARD Mr. most and that Mr. just question YouYou mentioned the national sym- of with asked inform inform supervisor problem workers tuiners enough pinint stored Muss 40 i they fied. Ms. Vis. no: Anu to the ws Ms. tue Ms. Ms. Ms. Ms. Ms. told Loic with an xz. Ms. Mr. Ms. <r. Ms. Mr. Ms. Mr. Ms, of feei Mr. Ms. Mr. Ms. that this teed and ftohre ow, noir Ms. Depariment. it partment Island dilema mentionedmentioned aginst were incdent Ms. LEPRE realyrealy campign whether they Hopefuly, their InRhode Islanddilema mentioned that there were Beanp. LEPRE . know whether or their asked that stafs what smuli when tre, smallsmal , take case mentioned that goal. that. thni realy ana I it me know to m in 50 whether not during company know wash only three small type that Rhode we Hopefully that legislation company working conditions the organizg company people working had gues country regardles where organizng for acidents the Did for Hopefully Federal country legislation this regardles of improve will type of improve working job they my list conditions In if conditions it | of they was acidents union acidentslaw to occurred campaign in the plant and or did guess they they with required type by Everyone Everyone what your for chemicals chemicals fingers not information pitfal s Everyone be guarn- ont got actualy came We up up list listed on that 15 10 hapened the thematerials theirReprsentaives hapend the acidents given your actualy teed information inthe pitfals Reprsentaives and Ias of BAUM acidents You talk list actualy had your employerted comite information the chairmantodepartmen talk about your you know comited quickly year about LEPERE You second Thanks that Ms. you have that I Thanks know Represntaives am is it to were Ms. LEPERE me. in your case of of chemicals What was aboutfirst about because LEPRE Mr. Did make BEARD LEPERE with for BEARD work you you chemicals chemicals example example example Ms. case Ms. Yes it in Ms. they a it the first will chemicals you bronchits LEPRE was company was disease with BEARD LEPERE The Mr. Yes your work chemicals example did it andmy bronchits case time when had a caused BEARD bronchits labels working labels situationchemicals represntaive rather feel feel information onshort working you bring acknowledg acknowledg rather Island chemicals injury rubed My report worked enough your time represntaive were information the I was cye. the that win that condition acknowledged bring that court condition They in from with problems chemicals chemicals information sulfuric bring of removed was case my be with Rhode Rhode tainers Labels The raisedcase which Rhode ocur? with LEPE department department Hospital has even LEPEOr aces Hospital your tainers my to BEARDBEARD had them removed my Ms. acid. aye. raised be of the a are that to you Mr. BEARD the containers Thank stored there LEPERE potential potential potential the & Mr. T bejob up Was tesimonytesimony workers Mr. The very I cabinetscabinets workers ; see was My Mr. questions much . stored Ms. labels Rhode director could testimony of Why say workers LEPERE think Ms. Robert LEPERE Why think of any is except to not boss The The witnes you Robert Robert executive executive director the the to BEARD what department injury injury BEARD whatsoldering have presntaion going health Mr. did ocurocur Mr.Mr. LEPERE department show solderingsoldering department department Mr. Mr. Mr. departmen Asociaton presntaion would . to LEPERE soldering pointMs. the Mr. LEPERELEPERE department department i6niits you soldering questions hazrds STAEMNT Island What would the questions Bearp. Jonzs.Bran.Jowgs. you somesomeslidesslides presntaion I further to out M. no M. BEARD have further of 8 have some I is BEARD ISLAND Baura some you wondering where has itNo; OF was wondering worked hazrds hazrds through Ms.Mis BAUM wondering you is where wondering the plant worked I represented represented union comite time , represented at time 1 it at LUNG don t We but represnted have a going at one time ROBERT going time LEPERE this but - union I case LEPREThe did Ms. union still the a a a ready court have still union court imposibleimposible to Rhode JONES, because would make court LEPERE complaints Did I any a theMs. make descripton I Ms. complaints BAUM BAUM complaints either LEPERE anybodHyealth Department ofthatOSHA De-or ASOCITN, kind complaints Health Department prepared island Ms. Rhode My called the Rhode Rhode Island workes PROGAM informationout describe there visualy asbestos Unfortunately plant Ms. doctor UnfortunatelyUnfortunately the partment come and partmentpartment company was and Unfortunately required required required to thre Was thre timesfinaly staemnt PROVIDENC, stances therlargely regading Island Department that cause regarding workers OSHA Ms. LEPERE separate LEPERE lung filed three never has complaints They right Snapp complaints the neverThis information askedwere BAUMstil ConectiuConectiut found hapend found suposed god problem certainly in employers suposedsuposed they are Ms.BAUM .think cause that as into boards the condition and was at they were working the of . times point asbestos three . are They complaints out hapened find claimed claimed & and finally while &.I. got was while com- to now. supposed just found that employers are supposed Mr. BEARD JONES No Do havehave prepared prepared that staemnt statementstaemnt right nownow to you have that presentation show JONES onhave Island like Asociation writenwriten Rhode monograph monograph describes major industry health describes should state has within jewelry jewelry through comite comite The describes in monograph should would 6 I like to enter into record the record record ready readyto we ks weks and sake the . would BEARD thesake of the would you it because reporter because once once be shown shown reporter her the there in best JONES best describe is visualy JONES exposures information has come While hearing real thatfound needs investigated regarding regarding exposures found hazardous that of brought inspections Island inspections the - beenDepartment Department information been certainly acumlated types jewelry types industry industries and to say jewelry industryindustry reasonably of problem areas areas are certainly certainly have very j | i : mS tonclsure, ReactionCutenAtmuneSCOVENR to t firtaon/excs Axsuciaton BLIDE iners the the aprecnito within azrds industry have hydrocabns CANCERCANER that are of industrial ndustrial Temrsive ser Vale AstM uum SLOS Hues isue ( and WK information conerndwould conernd enginering and chemistry Kerean Cadmiu OxidantAsixalis Acwis dustscolectedcolected on have themucs medicine peol pulmonary secrtion/mpaed (Bronchits, OastRucive particulary hygien Letter Cuting comite Lune 3 Jones folows to taf_Directo emphysema) mongraph SYTEMIC BLIDE Providenc, engirng, conerd information Counsel No. Washington Congres of Lung PnSCE) Lung ANsoSvOeCmIAbTerON cilia. Comite and Beard's Reprsntaive sytem deprsidoemnperdicsnieo,n should *dasertd. bcsdetacns Mlustriad Thank would Lahar, i i iS hos On mat our as it uve de affir. AR No, _ Uealth Director nouid inade Ean. you is be f, Ma. J FL. [Leter Shanodr.k meiseadirusoviore # a Sincerly, within for ready. ahave The BLIDE iC from Thesew.ithtnt Advisury CANCER Pasnacn, hygien, grateful aciahy LUNG CANCER your ene tus cels LUNG cels Uncontroled growthgrowth unknown advisory Uncotrled people jones Asbestos . cel s 19.C. an hydrocarbons Mr. ure a.: we the are aromatic Standrs, industry,desribe hydrocarbonshydrocabonsEnclosed Congres ows:] jewelry oils hydrocarbonshazard United Polyclic aromatic hydrocarbons hydrocarbons Laborof f who send hy the lind are SLIDE a the where tne are BLIDE Ruor Lune } dusts copy end slides I Cuting without experts Poisons were of of B. the Dispaes Beard. Istanp the . BLIDE 617 SYSTEMIC sytems hemoglbin lungs Afect than the Poisons formation blod other I cel than cel hemoglobin hydrocarbon Chlorinated hydrocarbon formation and hemoglobin solvents nervous Chlorinated hydrocarbon ) solvents sytem heart damge damage carcinogenicsystem damage sytem BLIDE nervous Mercury nervous a 6, , of and in about would systemnervous system system pos- pos- We point in have Mercuy SPHYXIATNg Education. colectd ASPHYXIATNg ASPHYXIATNg Please tthoe coapsy sASlPHYiXIAdTINega ASPHYXIATNg PolutansPolutants Polutants out , Rhode been the on 7 ats aby case BTL Sincerely deaneaugiis ome) - Bronchits ASTRUCIVeASTRUCTIVeASTRUCTIVeBronchits Lung Confuding INFORMATIONTemporayWorkmens secrtion emphysa Temporay Uncotrled and impared emphysa compenastio. PROBLEMSWITH secrtion companies. certifcaes. Hospital ^verwhe^lmverwhelm RESTICVEsecrtion LUNG PREVALNCE Confuding identfy hydrocatns RESTRICTIVE Fibros e ee defns Confudig normaltisueweeewe ee degrase ee we ee consider. Reportine Granulomtsi leadingoften leading OcUPATINL GranulomtsiGranulomatosi leading pigment we often SLIDE e e en Lung imparedlaing LungHYPERSNItivy HYPERSNItivyHYPERSNItivy asthma HYPERSNItivy Lung asthma asthma reversible revsible expNosuroe LonitorlePrimarily HospitallosuranceOilSnHesADeath data.factorsworkidentify Kery medical reporting disabilty history.traumtic Propiems records. sytem. insurance, (cigaret Disease injury. Wits ilnes S9 LIDE smoking) MepicaL 8 BLIDE 4 not cases : Systems Temporay Hospital Sources Primarily ON Primarily Primarily BLIDE 7 oF Electroplaters degreasers Shipyard LunG epoxies epoxies OD vSyt he ag te pes D1srase sy tem insurance Afect. reportingsystem BsyLtemIDEsytems records WITHMEDICAL traumatic injury. smoking dWuostsdCuotilinsgNickel ArsenicPolyecliAsbestosMechanism SYTEMS unkown.growth of cel s. cigarete not cigaret smoking BLIDE andSLIilDlEness cases _ wT Lune BLIDE 6 cases bronchitsbronchits ilnes Cancr 27150451 bronchits workes - heart; Mercuy poa- system 3 un of in, is of ALMUD Island. , Styrene what Mr. Meinl CHEMICALpreathing.EXPOSURE ANDAFECTDAFECTD Glueing:RHODE Cleanig:ISLANDSihea-Tic ibrous REXhPOSoURdESe EMPLOYES Plating: fibrosi.casting: fighting, tisue RHODE ISLAND RHODE ISLAND AFECTED EMPLOYEES ISLAND INVESTIGATED INVESTIGATED and insulation, being 1976 JiULnY TO NOV TwoINVESTIGATED the Total Total curing dust, Lead, employes afectedinustry asbetosalkine stricve talc .ve employesemployes employes . employes manufcture rofing, are 8 Chemical industry manufacture silca, jewelryplantsplants 5,745 manufcturemanufcture where disease19 construction Jewlry ruber. Another examples problems tehanat5,745 the Jewelry CNS industry.materialsbockage categories manufcture damge) 1,349170 manufacture primary asthma cause 144 Pigment ; Fire Cable Vinyi ALMUD Untauves Untauves ILIvo ibrous and and tisue tisue 0 esntialy esntialy or dies e lung e berylium berylium lung we industrye industry slide ee slide SLIDE asthme or hypersnitvy e can cause cotn cotn these problemsproblems } 5 iu i i 3 7 ] 1 9 1 ? 2 category ocupational ocupational asthma asthma isocyanates ocupationalasthma asthma asthmaasthmaasthmaare are isocyanates isocyanates isocyanaitesocyanaitseoscyanates amine 12 e cotn cotn the e are the suf ocates talc the the problems substances hardners substances hardners epoxy of airways manufctring in Spray are 15 2,640 that Asbetos two are we airwaysirtaion2,64040 530 Berylium, .- very of are OHAC Wire Employment which the polycipolyci aromticaromtic study OcupationsOcupationsOcupationsOcupations study Ocupations for OHAC whic toplisted are obstruct men in exampimpm Rh questiofi 12,00 damge main vedfounadnd ^'abont ies 4 ne reactions reactions reactions en slide slide reactions slide We have on ee potenial for are of a re are appear ofee things thingIssland re ne NextNext slideslidWe hile cancause cause lung lung sometimesevesrevere been beentaking taking taking taking a looklooklook atat jeweljreywelrythejewlry Island RhodeRhode RhodeIsland industry Rhode cancer in Island Asbestos substances jetweh lrye hydrocarbons jewelry polyc i tihen occupations hazards ocupations ocupations be n work been of other : fightingfighting . insulation insulation insulation roofing fighting | :, " +2), ' to lead There degreasing > Metal anemia manufctring Berylium granuloma problem carbon Jewlry Bources problem industry people SLIDE manufacturing insulation cult Berylium chlorinated investigation monxide Lead Jewelry Metalcasting irtan interfes jewlry Lead which causes ) Sea dusts anemia CNS Polishing damgedamge existing Cleaning Polishing Chlorinated CNS irtan problem ources Next Polishing Chlorinated disease. solvents These mists Plating Mr.SolderingJONESJONES agents cancer tradionalocupationl question someextent give sytemstokidea already Basicaly agents iritants actualy traditonal have ) Mr. ourselvs questionRhode useful problems Basicaly into is polutans what main disease about ocupational the problems obstructive nature categories ocupational Island lung and airways degrasing. reporting which identify they disease examples obstructive examples examples andblocked the trial you SLIDE the One manufacturing anemia CNS casting CNS anemia dusts silica Chlorinated solvents irritants asbestos alkaline ) are Epoxy curing asthma the Basically have been nature extent extent main categories categories disease lung disease physical found period Usualyinsdious history relationshp emphysema industry some typical subtances UsualyUsualy Listed blocked Rhode Island that can cause materials confundigconfuding factors detrmingdetrming efectcause evntualy Acidsand materials airways impaired another don't result alkaline areas breathinbgreathing me two investgaion. relationship United people very examples lot rember industry . areas jewlry it overinjury. already oxygen is and alkaline me theand materials materials with It isa problem. jewlry detcing monxide poulation cigaretsGenral'sGenral's tobacotobaco problem disease, ofhand xisting concern. but pulation other about very If thaninduse-fect ifverylongTheythese at and The talked problem iritant Nextlood, Next problem problem problem slide granuloma with irritant irritant granuloma poisoning poisoning poisnig major Berylium problem Berylium the granulomait slide. areas and which granuloma blod slide One none here One causeof of the today. repoting asking the ourselves the ocupational disease we concerned of major aresubstances physicaly chronic physicaly bronchits substances which bronchitis which airways iritation the There kind cause airways airways and and what very two good good far at rem ber as We the was generalnew and lokednature are other andbeen As and in ones in and and extent question that metal at talked about about concluded need conclude a ocupational ocupational ocupational oscyuspatteiomnasl obstructed lot reporting found are more period of stensiitmvee examples difcult are you One don't have of area two relationship relationship relationship genral of largevery in people the the difficult dificult dificult smoking Asphyxiatng pol utants the asphyxiation another polutants and ones thatthat Asphyxiating Asphyxiating Asphyxiating actualy the polutants lot more jewelry industry the interfers uptake asphyxiation asphyxiation of the first things we might information ocupational that are diseases ocupational ocupational ocupational traditonal traditional reporting systems here reporting are of them them very disease disease are them real y These are major that illness identify insidous or of history establish kind big history information that smoke much General's remember identify identify a occupational investigation concernconcernmonxide carbon wasexisting oxygen of oxygen in the look was existng whatIsland We the We nature loked lo ked beenbeen problems already been problems and far foundfound detcingwith thesedetcting traumatic these these They developdevelop over taken over long relationship relationship relationship if cause andefect effect efct heavierfact smokers smokersindusind-us figures If this problem ofhand ofhand products oc upational oc upational oc upational diseasevery very , prety aroblems information industries exposure workers identifedsimuary question ditarent. scientfic, seaires, picture Next making Hhode urxenic Many which sent focus hons, nese oiner neeu aver wuod ney Sem trial nite: to can 70 Next Next Next Next type see look that is that traditonal information above breathing is Next prety information prety gaveup The worker Next We much traditonal side. and traditonal sude hood a sude ike io air leit. ie do & are of a on traditional iv had information to of The above the worker that hood wu peole powdery breathing but thingsthings silica sources did comite we exprienc comite pastpast at people comite for fact We except lok silica take the his experience the pulmonary on experience of powdery breathing pulmonary about six physicians pulmonary the physicans which have al respirator What operation done comite might po l This Hygienst should ventilaon decided isgive wantedintialy physicans us what nature good bowl decided the nature information information extent might of and idea indcating mixng in during extent they weighing were mixing operations intersting of up of documenteddocumented scientfic conlusion they prob- devloped cleand transfermasure related that information had material idea . cleanup Proper example take example certainly information draw valid problems investment what information we notcleanup scientifcbut valid that dry conclusions conclusions community about what conclusions operation community questioqnuestion thing whole gives inlok htaasvtee probiems Manycleanuptimes ofmethodsoperation mixng example arepowder when be from next toxic exposure indepth Workers can comunity The to take either about slide thing whole with what people we investment diferntwords the look with workplace from Workers mixing operations direction that they intersting interesting cannot that problems problem this did was to was agent exposure exposed This was committee com it e We oc upa- occupa- some bit lit le view in taste we We to an a list of right breathing right at operation mixing during during the often investment type operation and again and inhaled inhaled is toxic methods investment Many times to & be Next exposed type are experienced exposures that experienced brokenbreaking silica agin invest- have excesive exposed exposures excesive . This at. a worker broken down sionaly the jems, of gidnen we heve za ake Next decide about but of iook but hethis going the easilygoing araw left easily araw it which inhale a which respirator is sometimes which should have local ventilation ventilation excsive ventilation have excesive as at of the at endtheoperations control lot operations becomes times operationsthe very definitely definitely that the that isairborne be should operationoperation isolated should next should isolated isolated right operations to another another invest- when the invest- good operation by Departmen contaminatsHealth Island Rhode identified contaminats month worker going identifed November the 1976 Department number present Sometimes airborne ventilaedcasting going chloride arsenic July that vinyl exposures 1976.subtanil comitepriority airborne broken tables afected thatmight Island Island November November . affected There affected limits health limits very very AWgain ethese Health a month ranges month were The dozen list ranges of substantial excesive anglaendexposuresxpow surese that be Sometimes ventilation ventilation ventilation the investment investment investment investment to going there exposure exposure bebroken investment doing no wet He metal control and control control tables away a any powder inside inside doing bit tables solidfied thereoptehraetiroen ventilated where where hood whereUs ttherhe ereto no often _ they side that We initially solvents. industries wanted excsive that prety indepth Howevr contaminating surfacesurfaces take indepth fumes over thearea However problem excesive work contaminating industries had pretty wanted airey good either will were workers had problems exposure xposure contaminating the taken rather I might the ideaelctroplating elctroplating comite hair these welding and elctroplating have on acumlate burden than good and industry foundry work their rather leadOver industries elctroplating opera- look exposures exposure. that neds investigaoninvestgaion evanting textile I particularyparticulary would jewelry are What high medical setle detect cuting This evanatingnonsevanating now textile because actual knowledg now specifcaly that like particularyparticulary is actual has never do where right jewelry have focus sumary AnotherAnother exposures done to problems slide list major workers Howevr,hardprevnt prevnt ruber knowledg metaldusted with trial which Rhode recuring mold have cast order whichwhichindus- metal make is of major Next are say exposures This This jewelry would hygienst jewlry manufcturing found recuring prevnt hard powderdownmold Certainly casting sticking this not ruber ruber manufacturing work that exposures developed developed a of that problems elctroplating we procesing textile specificaly procesing summary sumary feel manufacturing are typicaly priority at The comite priority in excesive the present present m a fairly will clothes foundry proces opera- process area investigation one all investigation investigation wouldlike been over exposures indus- indus- Next way recurring commonly commonly exposures odbal Certainly no the get the to exposures all where where workers and time time acumlate investigation in Island done Island done Another of These These casting casting molds rubber from take place over haveyearsyears during inspectionsprocesinspections downard device talc draft solvent am problems puls breathingbreathing that downard sugesting but area, period and period resurfacing problems is problemthe Unfortunaely tale jewelry toxic and resurfacing industry One inspections these the are the worker's breathing Unfortunately these making making jewelry item lead jewelry jewelry two these Next and item industry most and proces castings Exposurethe these substances have ben which PolishingPolishing measured metal basic are cast and castings castings This plaster- plaster- on thethe two degrasinmgaking castingcasting an contaming polishnsg ventilation another made invest- problem you being mixture made mixture being s their polishing Polishing Polishing another material poured lide thesytems adedoften that problem material more aded polishing polishing aded puster casting being investment . mixture mixed that being powder ventilation operations That investment tilatingtilating What polishng sytems mixed You hands, was mixingmixing dry You dozen ven- whels materialmaterial tilating polishing powder Next mixed from being five the powder mixed this mixing mixing The percentage the up powder in What originaly whe ls largely the ventilating whels silica cause the system system can surfaces ventilang god polishng theywhels worker largely fibrosis overloade overloade percent mixing can moving ventilation machines percent silica and percent silicaoperations the have poor silica that ; fibrosisthis their actactassand sand moving machinesmachines problem the lead on they inhaling quite levels workers knowledge workersworkers is is to low level surfaces hands hands in ingest burden burden of medical itin a make it order order to to like like This The from asbestos Unfortunately remove contaminated of most with of powder is substances substances substances However designed original y been Most area systems Most will be ventilate in measured in is will have often a ven- consequence consequence consequence ventilation ventilation good ventilation ventilation main main ofpe . We are ie ayienc ocuring side Next HT1ONS some iave very are defmieyhas avhabie Next something that constructionsemingly inocus Vextie is oneNext frequently most has the inocu s ported ported eloris dry prolens in the ben industry hasbeen the degreasers that consequnce Workes fibers inocus items too quickly a hauies problems solvent questions machine pecpic, remove items degreasers out problems there there solvent malfunctiong Solderingotherother location exposure exposure recived moreindustrial that wouldthere emphasize ther While with drafts questions emphasize solvent degreasers malfunctionigmalfunctionigcoling cooling surveilance has been mentioned are Soldering lead and in workHer close defintely You industrialindustrial hygienst thathascaninformation example thre Soren cadmiumveryvery defintely operation worker hygienist Workers problem inspections totaltoalStae this the this Workers operation andfor very working industrial hazrds recogniton control ventilation is beyond provide thisthisoperationnot provide drafts location mentioned already been mentioned close the operation again local ventilation ventilation we the ventilation ventilation ventilation Sometis isAnother the heavily trained Another monxide oven These gas type monoxide monxide mange t aditon properly simply fired monoxide realy notproduced proely properly ventilated produced amounts medical what point workers aditon workers can and soldering soldering ovens large be exposed ; something tuhse now. new von veuch they not Tuo Thisever, to something ocuring construction ef think Next side Even Even construction Workers spackling consequnce wtiain for we cently centlyThatspackling spacklingcompounds wha av le compounds contained csontaainyed contained such have the lave glad really answer answer questions major area got more thing thing hygiene major of There prev- to has go polutans some to far key fair amountamount information information done industrial hygienist out which department department seed and key be the working a recogniton so broad recogniton and andthe if actualy the and carbon based . exposed pational pational who monitoring very very heavily monitoring to In department trained very monitoring health hazards for heavily industrialized industrialized area area capbiltycapability very up set actualy amcetudalicyal surveilance have done are repoting only Ther big The defintely education.comunity episodic worker medicaldata indus- workersworkers would thinwgould mentioned mentioned mentioned mentioned education pamphlets trialwde knowledg knowledg There particularTher ther comesmymy onthethe do my atnio mentioned number stres stres ventilation particularlytoday atentionwhat particularly very ventilation and very need definitely worker om things one talking talking talkingwith particulary with wworkoingrkiwnorgkiwngith How- definitely done having medical education con- in lacktrialwide Educa- Theyworwkeorsrkersare oul- part episodic episodic get ing is reporting BEARD . worker some of done physicians reporting evaluate worker thank you Mr. Jones worker by employers employers also also will enn alent semingly semingly inocuos as i Until can be fibers problem Until asbestos specific would hazards would any specific specific Verdi is there to be would be ne ds surveilance While have have col- col- exposuresexposures has more clearly people do wweelllinspections in oaiee inspections Sevatluaatiotneevaluationofevaluation Rhode occu- Island of oc u- are GE have lots of industry industry and The and this being ihOst being exposed people exposed systems litle (rey sytems data medical physicians physicians There indus- usuitly health health indicated indicated As and dangersquestion There no question about . peopleat the areaarea of worker worker and and mangemntmangemnt from funding chemical. plaster milonspotenial danger am case directions programprogramprogramhowevrhowevrhowevritfunding RIOSH has the involvedinvolved rightawrens a supects that the healthwrong workes times Lung want don'tAsociation Asociation RIOSHRIOSHand want to complaing only one jewelry isthe only leave 93 problems problemworkers thing complaing and foundry manufacturing in manufcturing employing industry the though old subtances foundries employing foundries slide Welding seriouseriousWe known hazrds wel and Weldingis capints health Wod questions questions evalution example, presntaio asbestos Electric involved with concerns semingly maniacturing Textile painterwoking maniacturing chemials ever beging stage report is invesugating chemicals final BEARD is theinocus we While large problems controls not problemsproblemsproper asbetoasgpianckling, Spray painting broad community comunity comunity community had based Educa- education Tipping loaded based education managementfunding Educa- no OSHAin During the funding right acros very small more and Wesupects cals frequentlyfrequently Many so need need get impression out mostold involved if of problems plaster OSHA Many thingthat departmendepartment problems impresion anyone It impresionimpresion that tohfe my indepth fairly Rhode island Many where carer about Rhode island indepth has about taken in withwith large about are some much it as serious a very hazrds are some very much more was much taken look We Ms. workers health have have taken loaded about health , hazrds very We have , facilty some questions specifc very with procesing much presntaion said procesing , beginning in begin ing proces ing JONES jewelry industry industry problems industry thought thought with thought right recivedrecived exist very properindustrialndustrial problems proper industrial ; partic- The refred above clearly hazardous hazardous are up whentimes case I rip ing war rip ing riping out most old had awareness awareness with thousands JONES Mr. worker inspector complaint thatOSHA OSHA on complaint of that the problems problems jewelry asbestos asbestos are informedinformedMr.BEARD BEARDvery Ms. Ms. BEARD No come Mr. Mr. Wood . up Mr. final stage BEARD [record Mr. BEARD report report I report the is a my career a asbestos again with asbestos the Next where where was loaded spackling asbestos is across sure Nation not side. milions get calls workers workers workers is Many something times department department there or when inspectors that complain g often inven workers working inspectors working inspector not times complaining worker complaining find aware at all they are though Even lot clasic subtances instance the - well industry known realy workers very that hazards Baum We workers workers very is about very weak and is any. as . State questions at have as do ex can no questions questions of wel . that be a Thank presntaion you much in your presntaion submit for submit when wil when made Iright When will is when made it received part would When Until be bereferedto folows folows follows received itwill have bmadee as of we to the are folows six State. thre col- far be re- home ete Such o evalcre ASOCIATON contes RMODE suntaces sociatn's ASOCITN RMODE RMODE RMODE RMODE Christma LUNG respiatory ASOCIATED ASOCIATED RMODE workes. ISLAND to tne it ChristmaChristma R. Westminster 187 Westminr industrial 401 Rob't industrial contamis Asociatn's Ucupation SILCA ASOCITED Westminer ) 421-687 Providenc repoted CASTINGCASTING Island Rhode industrialAsemnt Jones Jones importance xacerbt Island Jones repsnt blod OiperatinonsOperationsOperations Am efcts hazrds. episodicsurveys, Advisory and the hygienst Am Asoc compgite and Am informatin Air Air Contaminats Contamis BERYLIUM ( materils expcted disea, Comite be mangemnt mangetserve disea intersdagencias , toluen mebrs workes stimuls wher-wher- wher- exposure mongraph opinos stimulsdisea. toluen neded stimuls composite of Comite see expasure. restied methylmethyl opinos BUFING is Comite workplace POLISHNGPOLISHNG mongraph workplace mongraph exces] AND DIATOMCEOUS disease w sunci a.r ne uire fic wide ISLAND ISLAND The SeatProvidence ( Rob't Rob't Am as of Contaminats to workers , organizations government organiztons workersstimulus Rhode Rhode page page of toxic mongraph aua thisthis vi ir i tian exe vespite obvious ASOCIATON ASOCIATON sw ri oWEdL ures ASOCIATION ASOCIATION ASOCIATON 10cal be to workes People People the ain noved jn I. Providence 02903 af Whie 02903 quickly that af Jones Jones much in that hypien useful Jones Jones an than far heith Asoco Asoco with more AsocAsoco be is for and efectsthe maner data their know governmet and on the about actual about agencias agencias is often health impact the in on varbety etaus industry this has the report of be n of report health workplace to Rhode of va gatherd recognizes is Rhode that tne While afect tie other which cause op primary con eras a lung is route for of the entry thie control for of toxic toxie air also ever that tne tin Ss of RHODE ISLAND the ASOCIATED and is report SILICA TALC SILCA fibrosi ieaith LEAD of for LEADa to ef ects is them BERYLIUM BERYLIUM BERYLIUM serve of of in the as (see PLASTIC PLASTIC PLASTIC Island last page of oF the and BUFING It BUFING guide i8 as^' SILICA SILCA SILICA in formationToxic central Rhode iritaion iritation tisue chemical inflamtory fe lung(lung iritaion 7 4 CHOI.Re ate & oN Fe whe MLon > + , of iuODE Shu {401} Mali Christmas ISLAND irtaion Seal LUNG ASOCIATONProvidenc,Probl R. |. 02903 Therefore Therfore mongraph indsputable actul indsputable CLEANIG higlhted indisputable suports supports - - suports the industrial industrial makes ELCTROPAING BERYLIUM lung ASOCIATED measures proces ventilaon ventilation industrial equipmentquipment industrialhazards ELCTROPLATING (fibrosi(fibrosi industrial hygienst trained available at either that absolute and terms equipment personal to who are Rhode Health Island Health ({rtaion, CYANIDE asphyxiantasphyxiantMIST ) resources Adminstration asphyxiant (fibrosi) 421-6487resources 421-687 stae obtained granulomts)} vapors OPERATIONS poagfeBecausesuch posiblycardiac nervous briefly deprsion the thethesedaussts, efects system terms carinogec contiued monraph.canvapors, AND BUFING LEAD SILICA (blod and EARTH nervous system efects) ALKALIS iritaion TAC SILICA RHODE ACIDACIDMIST ( iritation efects)(blod ISLAND TOXIC - and AIR JEWLRY - and lungscaring made aircoontaminnats contamints Because dustsmodnusgrtasph mases page of system IslandRhode AND EPOXY BR COATING GLUEING OLRENG - - AND > * gives HARDENIG SOLVENTS ASBETOS AMONIA FLUORINES CARBON CADMIUM LTAY manufcturing Island Departmen toal of state's san- Diced and health particulary dificult 1,0 making more nervous costume jewlry 15,720 posible system elctroplaing hoks efects) carinogen) to Excesive *Because ulation. diseas used ruber snokers socks. metal Such not cer in lung Both of that slot is Tale wax I. jewlry metalmetal is be the it or is mesothlima, by ruber tale asbetos casting. tisue, aplied manualy Ruber used death, used (7) tale is In used bcaen informatin employent espcialy hazrds Asbetos downraft manuly downdraft exposure exposed trade. to to @ and used often Rhode to usedOnly Mold downdraft in progesivlyconditons contamied materials industry alwysfromasbetos that asbetos Casting exposure predictfigures prevnt ExcesiveExcesive caner metals silca Island would great also to type in Rhode with talc ruber be the in of can these the the hardenig restrict caled shops, very and with asbetosi ventilao. restic espcialy result materials produces asbestosprogesively brushes reflect workes number molds. Island cause with metal low chestiung the a or dusting diseas useful progesively of the who and fron who abilty compared industry meltingjewlry mesothelioma but has The xignfcant worke's scar~like espcialy people tables exposed exposed is total to smoke > and is been major that abdominal coasinly mokersThe atickng at smokersulation ulation not ali and not are is silcoai.hardenig tempraues number operatins espcialy measured Becauseused employment abilty employment amounts hazrds numberrisk othercan to by pure. not the less of be to Operations ling. from of avible. Such avilabe poundig not be smokers precise ruber information always some in of in from breathe jewlryhigh 8 The in These the Riode with (30-8F) information asociated asbetos workes the timesriak andvery mold, than breathingequiped mercuy; hazrd ofwho normaly workers Teland often and tale Tele such that pethods genralgreater serious they dung and tale with as from silca. filed sncke, is operations. precious elasticresult power coper can pop-among can- and much local white lost can can used is is aplied aplied In manualy socks slot or downdraft talc used used and Both Both asbestos tissue and diseases diseases progresively death mesothelioma Asbestos cer mesothelioma espcialy Because information information are or by also and these mold, 3) cast of with lost in 2) lead, in- wax or the zinc, can to the ruber( rub erpounding with signficant signfcant industry like cause scar asbestosi asbestosis worker's worker's asbestosi worker's chest reflect reflect reflect the total number people people 138" 230C=* pt aw 770 oF firns hazrds hazrds measured purehardenighardenig of the lining breathe breathe be smokersother number of jewelry jewelry avilabefrom high available . provisonfolwingwtakhinegfTirhese.*Security stae's gives vast data total a more for san- of * Rhode Island Jewlry greater pop| 8 utized. aditonal transfed signfcat permant ventilao potenial eiastic casting Cieanig oxhaust Clearly, majority 30F), ronginy werkps equiped winmze ingestd Kerause debate sm%p2c lbieuym maid t{2h6e8n por wFuurss used . as in is the While airborne mold casting fun benduring molting Potenial irtaing biolgcaly metal some isolate While majority plastic ruberezposuresezposures been measured funes investnventilaon Excesiv irtan irtan also include irtabily have ketles, can which an.ing pots islead exhaust investmn widesprad methacrylte necsary and contaiers in active casting while harden and casting not lucite whic jewlry Mathylsignfcat by jewlry firms shops be area when airborne while esntial has casting lack lack contamion when exposure ingestion contamiton god the surface airbone casting contamination contamination of work castingbody shouldshould areas clean and operations. investmnweighn, Polishng final jewlrysmothnes temprnuas minmize after casting areasareasareas fruitful kept areas to central moping exposure airpone casting cancan afect afect the -pus re It causingparlysianemia tremor flour-ike oxide ground whels operations Removalexposure aluminum aluminum silcon stick iron and parlysi anemia atnehmiea tsyrmeptmoomrs investmn discued the with weighng healthhealth pain damge tre An afrer contain iocal water taing, the in or silca. meta] othfe open from mtonset has oeasure casting that and usaly is lead hcealnp maurseat wthheentscaioes silca . be jocal to by for hazrd contre] ocur wet is is silca central as dust as dust the removed muscle muscle the to a rather during of from ary may dry the than the powder for is is In heat which poured is this While Potential whoseand vapors respiratoy methacrylate methacrylate noveltyPOLISHNG novelty items novelty the items POLISHING POLISHING AND POLISHING POLISHNGPolishing smothsmoth Polishng Polishng Polishing and aplied . is are discused exposure that white to Ti. lost metal Wax majority casts exposure clear clear by plastic BUFINGBUFING is buf ing casting involve It imparts silcon operations silicon oneur. nervous uinSd A are of of biolgicaly mebranes exposure methyl of produce plastic . in that to levl. mechanil can sevre arefd iabrssion mechanical providas providas the use cloth finish cake ground stick documentd hazrds lead It documented documented documented documented producing silca a actuai futre workes Vo keping pen Low threat body within inveis toxic toxic plastics are are materials used jewlry ftiolruemns firms irtabilty are and include vapor methacrylate methacrylate headache irtabilty used to to in are poison. eat testing in prelimnaryabrasion jewelry preliminary In as po r 8 surface surface prelimnaryleather workpreliminarywhels smothnes smothnes to Abrasives whe ls leather They iron consitconsit diatomaceousdiatomceous A oxide lack diatomceous diatomceous and operations polishng polishing buffing bufing operations beryl ium earth with and eH BUS" WeTasS also for styrene Tne are con- skin Mathyl not Mathyl Mathyl neated fumes motal to rining pots amounts highs the that the evolve metai of are in leaddiatomaceous funes. nave fiumse: mubper moldlow be n be p Aluminum metals investmn metals oxide diatomceus earth Cesting,s up diatomceous during damge metal oxide The of dry to fibrosis and diatomaceous but diatomaceous not not temperature carbide is silicon apear produce reaction tempratue investmn quanties serious tempratue oxide exposure serious powder even workers reaction temperature temperature temperature and quantities reaction however physicalysweping- do tisue produces cesive can course welting howevr mixing quanties can workers jewlry mixed cesive cast. pieces ae mechanism . (ap inert dusts the t4 he l3 ung ert aie po rly a : a oes bk control moping and during during mixng weighing weighing removed removed powder metal mixng andVapor and aon Once and mixng observd abrsive rather the minze alkies. silca cleanig mopingsilica rather exposure physicaly investmn Removal exposurewighn physicaly degrasing dust and investment jewlry operations health withstand ventilaon of ofphysicaly 1,-trichloean jet materialscompunds, ventilaon investmn machines removal hazrds ventilaon for withstand Such guns temperatures casting tempratues grease, Rhode tempraus metal bentoxic investmn poisng metal Exposure extremly jewlry in investment lung tisuetisue ranging investm devlopment normaly solvents healthand/or granulomas sometimes charcterized charcterizd granulomas by charteizdberylium devlopment manufctre,curently Polished, fibrosi and removal in metal we poisoning the from micro- micro- to normaly normaly these are has be n which pose of], bufed and metal beryliumof Therexposure curently presnt hazrde Skin mental where do a not @long result are oxides it must intoxleainformation. increas of to there before of with some before be trichloeyn, organic the is operations adquately contacAlso, Of the of they one confusion, degrasing excsive solvents, sintiar central cleaned has real withchanceto or the have cool sore most to of interfnce elctropaing. exposure solvents coner fatigue, led that nervous to dried; and of noise acids remove chlorinated perchlotyen is in- from the ex- acidents frequntlycondes like por Com- alkalies degreasingderasing machines trichloetyln Exposure solvents machinesmachines richlorethylne trichloethylne use health are health trichloetyln perchlotyen are the solvents 1,1,1 trichloroethylene these hazrds jewlry along Excesive Exposure manufacture trichlorethane result jewelry manufacture , with excesive beforeadequately conditons ineficent the operator not adequately articles ineficentremoval articles location of location not and design inefcnt exposureexcsive from thereexposure health efect from mental perchloethylne trichlorethylen symptoms symptoms perchlorethylen perchloethylne visual intoxcaion disturbance iregular vomitng Such decreasing intoxicaton iregular in ir itation which degreaser excesive depresion depresion disturbance disturbance signficantly signficantly intoxication blister efcts formation productivy formation decrasingability iritaion trichlorethylne formation local levls causing trichlorethylen trichlorethylen seen operations abilty industrialtrichloetyln levels the ocur and oxide,miayn the mainted trichloeynbrylium, smothnes reaction.workes aystens bufing consit jewlry whels. earth,which but and are Of are and not of Abrasive course, surface porly as bave lung-cearing diatoxceus ex- operations designed, Alunius cioged serious ben to fused are the to perchloethylne acids whose Forential tWhhiele perchlotyen perchlotyennoise frequntly perchlotyenof more condense condes majority condesand interfenc to of porfrominterfenc caste of and biolgcaly solvents fromnervous solvents like are is fatigtuoe micous made acidents that of chlorinated metal, concern acidents materials to exposure and some led isjewalryenare include toxic Plasticsnarcotictoluen fires which at naeto iahigh and are enbedKethy2 a skin con-styreneawlesdo. These use hv and Tt of spent evore ide qermatis. Industrial corpsiorprecious mera.s Tynieal nvauine gterap procesa penwe uptake of area must seid ulerad uecompsitn wreats alkine glowizeother far be ane the The oF tuic of af pas. Cat top er ie mists also of af the which cempounds posiblty Orcupationl Taetropling ELCTROPAING chemical yroblems specifc various report. oxygen metals cause of the path of base. muarde around degrasing prevntio, chemicn potenial _Pygieane aginst around aplies degrasing evolve hazrd muarded aginst degreasing sen by This of. wide and water are produce degrasing SOLDERINGSOLDERING SOLDERING be open chlorinated an@ by the gas an^' Mists from pieces pieces explosin, joined chlorinated Island Jewlry joined joined health possible- if for acts the are often Soldering may may Phosgen Toxiclogy tisueshealth be inreaction reaction Jewlry Soldering the cyanies directiy fil mechaniclmechanical lungs lungs operations are is nitrc inspectors inadvertn nitric problems avilbe mechanil operationsoperations which hydrochlric necsary solutions solutions e.g. hydrochloric exposure are nitrc observd is solderd draw documentd corosive have cyanide production corsive ident- have Local result mixing contribute exposure contamied respiatory and lung production and contribute governmt as has production exces exces posible human plating Island posible signifcant significant airways fruitl imparment imparment agencies ofand signfcant include area area constiuents result enzyme highly ample impairment toxic the in for purose asphyxiton. improer can cyanide prevnt alkalis constiuents health cobalt listed metal purposes atmospher filed brighteng and side-by hydrogenoferingimproer prevnt nickel The metal mixing filed .Coper nickel and fire. and can or on drums a in Rhode in of in exposure death of acids by and with to areas are for the ~ used the to alkaline being from polutants polutants the government and mechanical soldered and necsary there very silver soldering soldering polutants are toxic tisue result fumes may potential exhaust A fruitful investigation of further bet er defintion definition constiuents constiuents constiuents and and asociated that in asociated on Oven soldering the Oven atmosphere either either free cover prevent sweling jew.ryified ef te or and In lung due Pronehits.irtans sulfric aditon repatedof to Function. Exceasiv solvents, airways. chroniccan the a lowpor acid, te be level or no after soldering methods methodsmethods after solderingovens documented to is documented exposureexposure Solderers work very close local exhaust ventilaon workers breathing cadmium cadmium breathingbreathingir taion iritation clasifed and permant ventilation theindustryclasified clas ified clasifed and (e.g. industry jewlry jewlry solder industry fluxes the studied studied carbonbased howevr not carbonmonxide monxide exposureor amonia amonia amonia to provide i wreations, wfliutihddiennt;oexample,Phosgen soivents ineton poisngsolventand the such OF as tisueluanngdsvapors has Prosgenpasgen is as elctropaing elctropaingelctroplating pas elctroplating elctroplating elctroplating extrmely a should thatlead pplleaesas are toxic be oecmposcd Cilpents: ventilation exposure in exposure and com pe damge damge damge by heat mucrde in ex- procuedaginst be but in is an when specific specific open posible- around as be flame.oxygen- chlorinated oxygen- degrasing oxygen- for report : report potential health problems problems observed posiblty acpiodstential contamied Island astphyoxixationc boyfe-ring periodcaly explosinandtisues directly respiratoy plating toxic hydrogen asbetos chemicals problems production health inspectors inadvertndirectlycyanies acts chemicals inadvertent gas This This directly result oxygen problems the an and and problems seen by and documentd improe Othercyanies of materials ventilaontanksplating potenial resiatn alkali materials sloture porly alkali involve solutions chemical solutions solutions porly porly and relasing mentioned Contact with asbetos Contact din corosivecorsi ulcerated corsive Contactis alkis result asociated investipaon asbetos furtherfurtherfor investipation investipaon investipation is investpaion orightenrs orightenrsincludeinclude such are health arsenic Brightenrs can bronchits bronchitis BrightenrsBrightenrs cobalt the cause bronchitsbronchitis pneumonia cause wet akip ruber erupts temporey exposure, irtae solvents damagebecomegloves and oped with aith a is platingplating areas are improperimproper respiratory highly highly hydrogen AND boards. enzyme in asphyxiaton acraped Rhode include side leat potential icmypraonpiedredisposal clean, ventilation in sytemselctroplaters elctroplaters or elctroplaters found may result elctroplaters asociated pneumonia result tibee. alkalis of af is boards hazrds hazards asociated improve cobalt luster arsenicpneumonia and of and the can toor hand lungs, cause opera: the ketone. raye a. Dermatis nyarecarbons soldering coughing musclarcentrel , then are reshlung senitzednot a and skin tnTh In- are and the _~ have jewlryrecorded powdered asbestos Controls itemsposible have made from items made asbestos Forms Toxic levels dust recorded hold recorded ventilaon boards are dry into usedprocedur levls SOLDERING ocured utilsed pasta respiratosceramic ventilaon ventilation Controls is procedure utilised should place place procedur in asbestos periodcaly asbestos periodcaly periodcaly soldering hand asbestos periodicaly for soldering AND fibers LACQUERING acraped relasing periodicaly fibers LACQUERING LACQUERING Heat acraped acraped a ENAMLING or enamel sprayed LACQUERING prevnt usaly diped LACQUERING solder LACQUERING toxicdiped fumes finished Jewelry finished hazard finshedwith or solvents major operations operations exposure to solvents major found withlacquer usaly the is have health Solvents operations solvents not Solventsisolated ventilated aromatic not boths > inhaltion Excesive acetone primarily drying ventilated Excesive toluen primarily halation quanties aromtic ketone haltion toluen excsive quantiesketones diznes temporay of excsive methyl solvents hydrocarbons nervous resitant clean releasing with these asbestos releasing asbestos boards of for that the enamel primarily these dizzindeizssines dizines should used for area fibers soldering be and . drawis dong a by dip ed exposure exposure sprayed inhaltion when are _ aromatic hydrocarbons hydrocarbons can cause fatigue lungs sytem depresion muscular nervous incordinatoisincordination ie muscular irtaion the a eyes irtaion . the carbon jewlry an the EPOXY GLUEING necsary ANDAND methods based,solder COATING of GLUEING togettoghetehrer exhaust resins agentsepoxy EPOXYGLUEING sometimes glued together 00 resin piecespieces is resin itself produced curing but resintisue have used cause blisters . Polyamine not PolyPaomlyianmien dermatis bronchiospasm episodes bronchiospam The adition they cancancause lungs been a tO industry resins The hardeners hardeners hardenrs allergic ef ects ef ects which hardeners caused caused Dermatitis exhaust of lungs f: ved and" very by and coated resins Hardenr with agents curing skin lung withwith irritate Dermati s 7) 6) 5) &) 3) 2) 1) St. of Co., Halbot, Seliof, National Medical Morgan, Metals Group, HEW, of Hamilton, Clayton, Averican iouis,G., hr-shole Contandin MO. I., Foned et Dust formed Physical Conferc " Air Health are and J 2 Wiley nati, Air OH Contandin and 6. MA. and Sons, and (197) Limit is mechanicl industrial industrial Ffects crushing Somedown forces (1973) proceses formed solid pp. mechanical forces grinding Inhady are eli grindg of 106-12 - A., others industrialA I for pp. (eds.), LR Envirometal solide to staeby RITENCS are particles Funes rfapoirdlmyedand been ganeous , inusaly welding_and welding_and temprature in n^t^...l foundings Cleve the Polutans, Industrial tempratue . and welding_and Di . Gas defined vrimesdivrimesdi C.V. defined fornless expands that Mosby J. Pooe fornles An it.m(197), fo o Sciences. liquid and=~ Cincin- Co., phe ya nS Documentai. suspension suspension . to whatever aot ona tens tts dropletsdroplets A eeVapor ust is Gs the water gas eous vapor count 4 exists POSA ane : over of wrdt^'Shtas orese ee maeigin water.the Tok G2 Liquid TOR E Cee USE ad ecmahie. over tel apes fmwehinc! : DUBS siege spa ge! fe Hod" cans, oa ; existe By the eriangbear: = ee Sede - =