Document E0MDed0JVyxd5pgnzNwEnv3L

DownloadRandom document
COVANCE "UNAUDITED DRAFT August 20, 1998 Sponsor: 3M St. Paul, Minnesota FINAL REPORT Study Title: 4-Week Capsule Toxicity Study with `Potassium Salt (PFOS; T-6295) Perfluorooctane Sulfonic in Cynomolgus Monkeys Acid Author: Peter J. Thomford, PhD Study Completion Date: "To be determined Performing Laboratory: Covance Laboratories Inc. 3301 Kinsman Boulevard Madison, Wisconsin 53704-2595 Laboratory Project Identification: Covance 6329-222 `Sponsor Project Identification: 3M Study No. T-6295.6 Page 1 of 212 02408 -_-- CovamnMcTeT6e2320s0.5s226s2 COMPLIANCE STATEMENT 4-WecPoktCaaspssiuulmeSTaoltxi(cPiEtOySS;tuTd-y62w9i5t)h PinerCfylnuoormooolcgtuanseMSounlfkoenyisc Acid `AGllooadspLeacbtosroafttohriysPsratcutdiyceweSrteanidnaradcsc,or4d0anCcFeRwi7t9h2.the Environmental Protection Agency SPtetuedryJD.iTrheocmtofrord, PhD Covance Laboratories Inc. A-- ndrew-- M_ Seae cat, PhD Study Monitor 3M Date -- Date A------ 2 02409 _-- CovawnScrMeT6a362s299-s252e62 QUALITY ASSURANCE STATEMENT `This report, with the exception of Appendices 6, 7, 8, and 9, has been reviewed by the Quality Assurance Unit of Covance Laboratories Inc., in accordance with the 4E0nvCirFoRnm7e9n2.talThPerdoatetcatiionn AApgpeenncdyic(eEsP6A,)7,Go8,odanLdab9owrearteorgyePnrearcattiecdeSbtyanadnadradrse, responsibilityofthe were conducted and Sponsor and the findingsreported Sponsor's designees. to the study director The and the followinginspections study director mmaannaaggeemmeenntt.acWcroirtdtienngsttoatsutsarnedpaorrdtsopoefriantsipnegcptrioocnesduarneds.findings are issued to Covance Tnspection -- Date Reporied to Dates From 0421/98 To 04/21/98 Protocol Phase Review Study Director and Study Director Manag nt 04721798 05/20/98 05/20/98 Protocol Amendment Review 05120198 " 05/20/98 05/21/98 05/20/98 05/21/98 Protocol Amendment Review Clinical Laboratory Inspection 05/20/98 05/21/98 06/01/98 07/08/98 06/01/98 Postlife 07/13/98 Data Review 06/01/98 07/13/98 08/14/98 08/14/98 Protocol Amendment Review 08/14/98 08/10/98 08/18/98 Report Review 08/18/98 Representative Quality Assurance Unit Date 3 002410 -_-- CovanMcTeT6a2320m0-5s2262 STUDY IDENTIFICATION 4-WeePoktCaaspssiuulmeSTalotxi(cPiFtOySS;tuTd-y62w9i5t)h PinerCfylnuoormooolcgtuanseMSounlfkoenyisc Acid Test Material Sponsor Study Monitor Altemate Study Monitor Study Location Study Director Study Timetable `Study Initiation Date IInn--LLiiffee T(eErxmpienriamteinotnaDla)tSetart Date Experimental Termination Date PeSraflltuo(rPoFoOcSt;anTe-S6u2l9f5o)nic Acid Potassium 3M BTuoixlidcionlgog2y20S-e2rEv-i0c2e,s 3M Center St. Paul, Minnesota 55144-1000 A3nMdrew M. Seacat, PhD 612.575.3161 3MaMrvin T. Case, DVM, PhD 612.733.5180 3C3o0v1anKciensLambaonraBtoourlieesvaIrndc. Madison, Wisconsin 53704-2595 PeterJ. Thomford, PhD Covance P.O. Box Laboratories 7545 Inc. Madison, Wisconsin 608.241.7207 53707-7545 April 17, 1998 April 23, 1998 May 22,1998 To be determined 4 002411 KEY PERSONNEL CovanMceT6632299.52262 Study Director Study Toxicologist Study Coordinator Supervisor, Large Animal Toxicology Supervisor, Dose Formulation Supervisor, Laboratory Animal Medicine Clinical Pathologist Supervisor, Clinical Pathology Anatomical Pathologist Supervisor, Anatomical Pathology PeteJr.Thomford, PhD Dale Aldridge, BS Patricia K. McKee Pesik, BS, LAT Meechelle Bordeaux, LAT Dixie Bushee, BS, LATG DDiopnlnoamJa.teC,lAemCoLnsA,MDVM, MS RDiopbleormtaLt.e,HaAllC,VDPVM(C,liPnihcaDl Pathology) Ronald Markevitch, BS,MT (ASCP) `Thomas E. Palmer, PhD Kimberly W. Durland, BS, HT 5 002412 -_-- 0 TCounR Tce66392S 952262 CONTENTS Page Reserve (Archive) Samples... rms 12 TAENGFCAON. corres, "HOUSING ANG MBIRLENANCE ....ccrsssrss JUSUFICALON covers essen rss SS ------------ 13 sss: 13 Group Designations and DOSE PLEPATBON wc. DOSE LEVIS wero. sss: 14 14 Methodof Administration................. sss: 16 BClOinYicaWlEOIbGsHeSrvc atio onss.....t .....s .............. runsanna snanaes sens nennsnssssssasssasssnnnnen 16 Rectal Body TEMPERUIES ......sssss 17 17 Blood Hormone Determination...................... rss 17 Serum PFOS Level CHClPAthOIORY Deters mination....s ....... r sss 17 18 NAEddCiTtOiPoSnYalc Blood COr lleCtion .t ..............v.vrvoreenn rms 18 19 Palmitoyl CoAOxidaseDeterminations ........................... EE -- Cell Proliferation EVAIation........................ uremsnsssssssssssasssasssasusasasasssasssasssasasae 19 Liver PFOS Determination........................ rissa 19 HTiISSSULE OPIPEASENIOVAIOON.ZYocct rersssst sneessss mses oeerererssmennirrsee 19 20 SHALSHCAlADBIYSES......cccvsmmssssso 20 DOSE ARAIYSES ....coocoeeer rrr r-------- sss 33 Clinical ObSErvations .......................... rs sss sessssssis 2. Body WEIGhLS ...c.oceeveevererssssssssssnsenen rms 33 02413 -_-- ComvaTnMceeT66m32290s-522s62 CONTENTS (Continued) RESULTS (Continued) Page ReFcOtOaClOBMOSYUTMPEOMN Pr ETUIs ES ss rs 22 22 SBe1r0u0mHPORMOMSONLGevAelNGDEItYeSMUEASU.O.N..c..c.ocvo.vsosvomsssmesssm CHinical PAROIOBY wos 23 23 CLeVlElrPPrORGOCSTaDteitonetEmiVatAioInU. An ON.e ..e .ovr coes ssemsss 23 ee 23 24 ADRUOCE PAOIORY corse 24 CONCLUSIONS tse 24 PATHOLOGYREPORT ccc, 21 COM ONTM HEDAE TA..N . TS 30 COGDeEnSer,aAl CBodBesRanEdVABIDIAEATVINILDIOUONNNISTSS,v .....s ....coe nsmmssns 31 32 AC bbrevd fioartCiloinS nsiacnadl UPniAtstfoOrClIinOicaBl YHE.MA.OIcOg.Ysore oo 33 35 `ACbobdreesvfioartiAoNnOs MaIndCAUnlitPsUfONrOClIinOicRalYC..H..E.MvoIeSreTomYs.me.e.res 37 30 TABLE 1 2 SummaryofClinical SummofaClirnicyal OObbsseerrvv-a-3aAt0Mt.iM/iioWnEuonEtKesnslYsP.os.t.d..o.s.e.............o.o.o.r.r.n4410 3 4 Summary ofClinical SummofaClirnicyal OObbsesrevartvi--oan9t60s0 iMMiionnuuntteesss PPOOSStdSoEse.........o......44.32 5 7 SS ummu aryoOm ffBCloidnm iycWaelia OghBtDr SatEa y rVUna(SCKtHgEi)A.UoI.E.nd s oo.44 45 Summary of Rectal Body Temperature Data (-C)...ovoeooos 8 9 Summaryof Clinical SummofaClirnicyal HHemeatmoalotgyoDDaltaao-t~gDDaaayyy2-7 9.o .. o 47 49 53 10 11 SummofaClirnicyal Summaryof Clinical ChemDiatse t-DArYy-7 Chemistry Data - Day overs 2... 57 63 1132SSumumamrymooffaCClliirnniiccyaall CChemhisEtrymDDaattiaa--SDDaa(yy 71r.....y. 14 SummaryofClinical Chemistry Data - Day29... 69 75 15 16 ISnucimdmeanrcyeooffCMlaiCnriocaslcoCphiecmOiBsStErIyVDAaUOtNaS.- .D.a.y........u 30.........oom or 81 87 89 17 IncidenceofMiCroScopic OBSEIVAUONS wove 90 7 002414 _-- CovanwcIeMrT6e.362m209s.526s2 CONTENTS (Continued) APPRPOELNOCDOIIXDEL VIRONS o ...ns rssers smssme smeosos sssen, so P9a03g3e PPrPRIOOOOIMOCOCOCO!!O AAMc EMNIEMEt ENt NNOO..s 2 Lo m ss ommm es s es 03 113 MPartOeOrCiOa]l ASafMetEy DEat!a SNHO.EL3.... remeron 115 117 120 API InPdiEvniNduaDdl2ICAXRiCc D v]FORBiA SEEDIAdVA] Oc NaS clcvon orossa smrmss, oson,121122786 Individual Rectal Body Temperature Data (-C).......ovmrevooenoomonso APPENDIX 3 coosvnransssssssessssmsmssssssssssssmssmsmsossosnn, 133 131 Individual Body Weight Data (Kg) ..vecrversmsmrersoensnso APPE4cNoDvIX senesmsssissssssssensssssssssssssssmsossonnnn 138 140 IIndinvidudalCCliliinniivccaalliCHHeEmMdaItSoTluYogyaDaltdD.at.a....v.....ve.oe.m.smorrmeowsomesoeensosoooen1s5. 1341 APIPnEdNSA.DomisaIslvvXsPnOirhnOsIdsOGsYsDusanstamRs.o.lm.s.s.ss.svsesosssmsessmsrnrsesssomesoosesnesosnen1sn8n, 6185 APSPuEmNmaDrIy6Xandc Indivo idual c HOMMOo NG ARo AIYSEn S Datas ... Figure 1'- MeanEStrDaatda-iol Males... snore 198 199 FiFgiugurree 32 -- MMeeaannTEsrtriadiiooldDaotat-hFDyEaMrtAaloE-snM.Bi.I.En.S.e..............o.mo.e.ro.o.so.o.oonnosonoorn. 203 204 205 Fig4u-Mreaen Triiodothyronine Data -FEmales........o...ooooonoror. 206 APPEND7cIXcs 201 APSPeErNuDmIaXnd8Lc iverPFOs SLevel Ds eterminations oe... 210209 APCePllEPrNODU9FITXAOcNcEovVcAsUssAsOsNs.ss.scs.ecmmcarmrssrsesmssssmsssimmosssossmssensosssmosmsmnnn221121 8 002415 _-- CovanmIcMeTT6-3a6220s-9252s62 ABSTRACT m`aTxheipmuurpmosteoloefrattheids sdtousdeyawnadsltoowperrodvoisdee ldeavtealsfotrodbeeteursmeidniinngaacnhreosntiicmattoexidcity study and (foPFaOssSe;ssT-t6h2e9e5f)f,ecotnofcrtihteictaelsetnmzatyemreiall,evPeelsr,flhuoorrmoooncetsa,neaSnudloftohneirc sAecliedctPeodtbaisoscihuemmiScalatl parameters. GMraoluepan1,dtfhermeealaenicmyanlosm/oselxguisn Gmroonukpey2s, awnedreonaessainginmeadl/tosetxhrieneGgrroouupps3)(.twAonainmiamlaslsi/nsex in w(Gerioguhpts/d2ayan(dmg3/krge/cdeaiyv)e,d rgeelsapteicnticvaeplsyu,lteisucroantteadinwiintgh0l.a0c2toasned(21.:09P9FaOnSd/k1:g9,owfebyo,dy troetsaplecmtaitveerliya)l. dAosneimlaelvselifnorGrcoacuhpgIrroeucpeiwvaesd 2g0el.a0timng/ckagp/sdualye.s containing lactose only. The wFeoroedowbasserpvreodvitdweidceondacielyor(at.wmi.ceanddailpy..m.W)faotremrowrtaasliptryovainddedmaodrilbiubnidtiutmy.. TAhtelaenasitmaonlcse. cdaoinlsyu,mapntiimoanlswwaesraesesexsasmeidnqeudalfiotrataibvneolyr.malIintaidedsitainodn,siagnnismaolfstowxeircietyo,bsaenrdvfeodod baephparvoixoirm.atBeoldyy30w,e6i0g,htanddat9a0wmeirneuctoelslepcotsetddtowsiecfeowreseikgnlsyobfepgiononrihnegal2thweoerkasbnboefromrael tinhietrieaatfitoenr.ofRetcrteaatlmbenotd,yotnemDpaeyra-t1u,roens twheerefirrsetcdoarydeodfttwriecaetmwenete,klayndbetgwiincneiwnege2klwyeeks ebsetfroiorle,itnhiytrioatiidonstoifmutlreaattimnegnth.ormBolnoeo,d tsraimipoldeosthfyorronhionrem(oTn3)e,aannadlytsheysro[xesitnra(dTi4o)l], ewsetrreone, tchoellseactmepdlebsefwoerreeinsietnitattioonAonfitLryetaitcmseInntc.a,nfdorpraenadloysseeso.n DBaloyo2d9.samSpelreusmfworassehraurvmested, and DPaFyOsS2,c3onc(eanptprraotxiiomnataneallyy2s4eshwoeurrse acfotlelrecttheedfbrestfoarnedisnietcioatnidondoosfet,rreeastpmeecnttivaenlyd),pr7e,do1s4,e on and 29. samples Serum was harvested, and samples were collected for hematology and were sent to the Sponsor for analyses. Blood clinical chemistry tests before initiation of treatment and on predose on Days Day 2, 7, 29. and In addition, blood for 14. Additional blood clinical chemistry tests was was collected at the time of collected `eOxnsaDnaguyin30a,titohne,aannidmaslasmpwleerse waenersethsehtiipzpeedd, twoeitghheeSdp,oenxssoarngfuoirnpaotsesdi,blaenfdutnuerceroapnsaileyds.is.At necropsy, macroscopic observations were recorded, and selected tissues were collected ' cc2416 -_-- CovanMcTTe e6632w290s.52262 paenldmiptroeyslerCveodA. oIxniaddadsietiaocnt,ivaitsyaamnpalleysoefs.livReerprweassenctoaltlievcteesdafmrpolmeseaocfhliavneir,matelstfeosr, and. fpoarncprroelaisfewreateiocnoclellelctneudclferaormanetaicghenaneivmaalulaatinodn.senAt stoamPpaltehoolfogliyveArsswoacsiactoelsleIcntteedmfatrioomnal ecxaacmhiannaitmiaolnsanwderseendtotnoetohne Stpheonasdroernaflosr,PeFyOe,Sfceomnocreanltrbaotnieonmaanrarloyws,esl.unMgi,clriovserc,okpiidcney, pancreas, spleen, testes, and thymus from each animal. eAflflecatnsimoanlcslisnuircvalivoebdsetrovtahteiosncsh,ebduoldeydwseaicgrhiftisc,e.fo`oTdhecroenwseurmpetnioont,esrtemcattaelrbiaoldyrelated temperatures, clinical pathology, or macroscopic or microscopic findings. sTthiemruelawteirneg hnoorampopnaer,enotretshtyrmoaxtienr.iaTlh-ererleatweedreeffneoctaspopnareesnttrotenset,measttreiroill,-ttheylraotiedd effects on estradiol or riodothyronine at 0.02 study, itis not possibletodetermine mg/kg/day. Given the conclusively whether low number of there was a test animals in this fmeatmearliealgirevleant2e.d0emffge/cktgo/ndaeystwreadrieolnuomretrriiciaodloltyhylroowneirnet.haEnstthroasdeioolfltehveelcsonftorrotlheanmiamlaelsanodn f`Doamyal2e9gainvdenth2e.i0r rmegs/pkegc/tdiaveywperersetunduymevarliuceas.llyTrlioiwoedrotthhaynrotnhionseeloefvetlhsefcoornttrhoelmaanliemaalnsdon vDaalyue2s.9;Throiwoedvoetrh,yrtohneiinperelsevteuldsyfvoarlauneismwaelrsegailvseonconosri0d.e0r2abmlgy/lkogw/edraythwaenrtehenucmoenrtiroclally haingihmearlsongiDvaeny22.90cmogm/pkagr/edadywwitehrethneuirmeprriecstauldlyy lloewveelrscwohmiplaerterdiiwoidtohthtyhreoinripnreelsetvuedlys for levels +Inwceyenkos,motlhgerueswmeornekneoysaptpraeraetnedt wteistthm0a,er0i.0a2l,-roerla2t.e0dmegffePcFtOs So/nkcgl/idnaicyaloroablsleyrfvoartiaotnlse,ast pbaotdhyolwoegiyghftisn,difnogosd. cTohnesuomnpetimoanl,eraecntdalobneodfyemtaemlpeetrraetautreeds,wiotrhc2l.i0nimcagl oPrFOaSna/tkoem/idcaayl aanpapleyasreesdatnodhcaevle plroowleifrelreavteilons oefveaslturaatdiioonls ownillDabye p2r9.oviDdaetda bfyrotmhelSivpeornasnodrsaenrduPmaPthFoOlSogy `Associates International, respectively. 10 002417 _-- CowvanMTcTe.e60322s09-25s262 PURPOSE `The purpose of this maximum tolerated study dose was to provide and lower dose data for determining levels to be used in a an estimated chronic toxicity study and (toPFaOssSe;ssT-t6h2e9e5f)f,ecotnofcrtihteictaelsetnmzatyemreialle,vPelesr,flhuoorrmoooncetsa,neaSnudloftohneirc sAecliedctPeodtbaisoscihuemmiScalatl `parameters. REGULATORY COMPLIANCE AAlglenascpyecGtosoodf LthaibsosrtautdoyrywePrraecdtiocneeSitnanadcacrodrsd,a4n0ceCwFiRth7t9h2e.Environmental Protection TEST MATERIAL AND VEHICLE `Test Material LTohteNtoes.t2m1a7t,eriisala,wPheirtfelutooroofofc-twahnieteSuplofwodneirc.AcItidwaPsotraescseiiuvemdSaatltC(ovPaOnSc;e To-n6295), September 4, 1997. The test material was stored at room temperature. tIhnaftordemfaitnieonthoentessytntmhaetseirsiamletishoodns,filsetawbiitlihtyt,hepuSrpiotyn,socro.mposition, or other characteristics Vehicle (`Tehxepivreahtiicolnedwataes Fleabcrtuosaery(S1p3e,c1t9r9u9m),. NIet wwaBsrurnescewiivcekd, aNt eCwovJaenrsceey)o,nLMoatrNcoh. NNO192 30, 1998. The vehicle was stored at room temperature. Information on synthesis the vehicle is on file with methods, purity, composition, the manufacturer. or other characteristics that define. un 002418 _-- MrCoevanIcmMeT6.s362209.s5262 ARerseesrevreve(sAarmchpilvee)(1S0agmpealcehs)ofeach lotofthe test material, vehicle, and each test tmeamtpeerriaatlu/raec.toTsehetsrietusraamtipolneswawsiltlabkeentbreafnosrfeeirnrietditaotitohne oSfpotnrseoatrmaefntteracnodmsptloerteidoantorfotohme in-life phase. RDeismpaoisniitniogntest material will be retained at Covance for use in possible future studics. TEST SYSTEM YTeosutnAgnaidmualltot adult cynomolgus monkeys were obiained from Covance Research Products initiation Inc. (Alice, Texas), of treatment. on March 10, 1998. The animals weighed 2.010 2.5 kg at EIdaecnhtiafniicmaatliownas assigned a permanent number upon arrival and identified with collar tag before initiation of treatment. All data for an animal are recorded under this number, SAcecvleinmmaatlieosnand seven females were received on March 10, 1998, transferred from the RCoovoamnc2e01i5n-fhooru3se8 sdtaoycskcboelfoorneyionnitiMaatirocnhof16t,re1at9m9e8n,t.andInacgecnleirmaalt,eadniinmaAlnsiminalthis shipment appeared healthy. abnormalities indicative of During acclimation, the animals were examined for health problems. In addition, three tuberculosis tests, a physical examination, and a fecal flotation for parasites were done on cach animal, a`Tbhneorpmhaylsiitciaels.exRaemsiunlattsioofn tdhoenteuabfetrecrultohseisantiemstaslswewreerenergeacteiivveedforreavlelaalneidmnaolsm;atjhoerresults nareegarteicvoerdfoerdpianratshietedaotav.a. TOhneeremsaulltes aonfdthoenefefcaelmaflleotawteiroen etelsitmsiinnadtiecdatferdotmhsetaundiymals were consideration based on clinical pathology findings or abnormal fecal observations during 12 002419 _-- CuovranMceTe-6m63229s9.52s62 1a0ccglriomuaptsio(nt.woThaenriemawlesr/esesxixinmGalreosupan1d, tshirxefeeamnailmeaslsin/stehxe irnanGdroomuipza2t,iaonndfoorneasasniigmnamlesnetx. in Group colony. 3). Animals not selected for the study were transferred to the Covance stock AHnoiumsailngRaonodmM2a0i1n5tweansanucseed for this study. Environmental controls for the animal room were set 12-hour to maintain 18 to 29EC, light/12-hour dark cycle. a relative humidity of 30 to 70%, Variations from these conditions and are a. documented in the data and are considered to have had no effect on the outcome of the study. The animals were housed individualilny stainless steel cages. Certified numbers primate diet are recorded (in#3t7he26dCa,ta.HaTrlhaendTieetkliasdr)ouwtaisneplryoavniadleydzeodncbey or twice daily. The lot the manufacturer for anuntdrictoinotnaalmicnoamnptonaneanltysseasnadreenovnirfoinlemewnittahlCcoovnatnacmei-nMaantdsi.soRne.suFlrtusitosfosrpeacdidfiiteidonnaultrient supplements were provided, but did not require analysis. m`Wiactreorowrgaasnpirsomvsiadneddaednlviibriotnumme.nta`Slacmopnlteasmoinfatnhtes.watTehraerreesaunltaslyazreedofnorfilsepewciitfhied Covance-Madison. There were no interfered with known contaminants this study. in the diet or water at levels that would have Justification nPoFnOhSumisaankpnriomwantehsep(astuicchpaesrtohxeicsyonmoemporlolgiufsermaotonrk(ePyP))rienstphoenrdats.imWilhaerlnyetxophousmeadntso PP, (.e., Tow species. to no hepatic response) and therefore are an appropriate human surrogate 13 002420 _-- CovaunMcTTe 66e322m99-s5226s2 PROCEDURES PTrhoitsosctouldAymweansdcmoenndtucNtoesd.in1 atchcroorudghan3c.e TwihtehptrhoetoPcroolt,opcrooltodcaotledaAmpernidlm1e7n,ts19,9a8n,dand protocol deviations are in Appendix 1 SGerloecutpioDneosfigannaitmiaolnssfoarntdhDostsuedyLewvaeslsbased on clinical observations, clinical pathology, `acnodmpouttheerridzaetdabalsocakppirnogprpiraotcee.duArneidmeaslisgnweedretoaascshiigenveed btoodtyrewaetimgenhtt gbraoluapnsceuwsiitnhagrespect to treatment group. Group Dose Level (mg/kg/day) Total Material Dose Level (mg/kg/day) Number of Animals Males Females T (control) 0 2 (low dose) 0.02 200 2 2 200" 3 3 3 (high The dose) control group 20 (Group 1) received 200 an equivalent 1 amount of Tactose 1 in b Tgehleatlionwc-adpossuelegsroasupthreectoetiavlemdattheeritaelstamdamtienriisatletrreidtutroatGerdowuipth3.lactose (1:99, ww). The 9, high-dose ww). group received the test material riturated with lactose GDeolsaetiPnrceappasrualteiso(nTorpac, Inc. Fairfield, New Jersey), Size No. 2, Lot No, 122630 r(eixtpuirraatteidownidtahtelaJcutnosee2a6n,d20l0a2ct)o,seweornelyu(sceodnftorroldogsreouapd)miwneirsetrdaitsipoen.nseTdheintteostcampastuelreisaltwice weekly and stored at room temperature. bVeahsiecdloe.n tLhaectveohsieclweasasussuepdplasietdhefovreGhircoluepin1.the dose preparations. Dose levels were 1 002421 _-- CovaSnMcTei.663e2295:m25262 For Group 1 dose preparations, the specified amount of lactose was weighed and transferred into the gelatin capsule. The top and bottom halves of each capsule were joined, and the `number, group capsule was placed into the appropriate container number, animal number, and dose level. labeled withstudy `Test Material. For Group 2 and 3 dose preparations, the test material was dissolved in acetone and triturated with lactose (1:999 and 1:9, wiw, respectively) once before initiation of treatment. Acetone (Spectrum, Gardena, California), Lot No. LH0253 (expiration date June 2000) was used to dilute the test material with lactose was necessary to facilitate capsule preparation. with lactose. Trituration For Group 3 dose preparations, the specified amount of test material was weighed, placed into a labeled mixing container, container. The preparation was and the appropriate volume of acetone stirred manually until the test material was added to the was dissolved. `The specified amount of lactose was weighed, placed into the `mixing container, and thoroughly mixed using a spatula. This preparation was exposed to air until theacetone was evaporated and stirred periodically. Samples of the finished preparation for dose analyses were transferred to moisture. atackoenntadiinreerctalnydfsrtoomretdheatcornotoaimnetre.mpTerhaetutrrietuarnadtepdrtoetsetcmtaetderfiraolmwlaisght and For and Group placed 2 preparations,therequired amount of the Group 3 preparation was measured into a labeledmixing container. The specified amount of lactose was weighed, placed into the mixing container, and thoroughly mixed using a spatula for approximately 5 minutes. Samples of the finished preparation for dose analyses were taken directly from the container. The triturated test material was transferred to a container and storedatroom temperature and protected from light and moisture. `The specified amount of triturated test material was weighed and transferred into the gelatin capsule. was placed into The top and bottom halves of each capsule the appropriate container labeled with study were joined, and the capsule number, `group number, animal number, and dose level. i 02422 _-- MrCoevanImcMeT6-s362299.s5262 D`SoasmeplAensa(l1ysgecsach) were collected from the top, middle, and bottom of the test mtaetmepreiraalt/ulraec.tosTeheprseapmarpalteisonwserfoersthhieplpoewd-uanndedrhaimgbh-ideonstecgornodiutpisoansndtosttohreeSdpaotnrsooormfor analysis. pHroemsotguedynestiatbyilsitaympanlaelsyscios.lleOctneed sfertoomftshaemmpildedsl(e1ogfetahcehp)rewpearreattiaoknesnwferroemutsheedlfoowr-tahned tPhiegShp-odnossotresftormaantaeliyasilsl.ctose preparations at the end ofthe inlfe phase and shipped to Results of the Sponsor are in homogeneity, Appendix 7. stability, and dose confirmation analyses provided by the MGeeltathiondcaopfsAudlmeisnwiesrterautsieodnfor test material preparation administration to compare with odfateaxpforsoumrep.revious toxicology studies using the oral route, which is the most likely route (T7hedadyossfevepcrke)pafroarti2o9nsdawyesre(saeedmPirnoitsotceorledDeovriaaltlyioinnsgfeolrateixncecpatpisounlse)s.onTcheeddaoisliyng tubes ownerteheflmuosshtedrewcietnhtl5ymreLcoorfdreedvberosdeyowsemiogshitss,wawtietrh.thIendeixvciedputailondoosfesbowdeyreweciaglchutlcaotleldecbtaisoend days when the previous same time each day. body weight was used. Animals were dosed at approximately the "CTlhieniacnailmaOlbssewrevraetoibosnesrvedtwicedaily (a.m. and p.m) for mortality and moribundity. aEbancohramnailmfailndwiansgsobwseerrevreedcdoaridleyd,.anAdnifmoaoldscownesruemopbtsieornvewdasapapsrsoexsismeadtqeulayli3t0a,ti6v0e,lya;nd. r90ecmoinrudteaesds ptohsetydwoesreefoorbsseirgvnesod.fpAonoirmhaelasltwheroer oabbsneorrvmeadlobnecheavwieoer.klyE;ffaecbtnsorwmearlefindings or an indication of normal was recorded. 16 002423 -_-- CovamnIcMTeT6e-362s29-s9252s62 Body Weights iInnidtiivaitdiuonalofbotdreyawtmeeingtht(MdaotnadwaeyraenrdecTohrudresddatyw)i,coenweteheklfyirsbtedgaiynnoifngtr2eawtemeenkts, baenfdortewice weekly thereafter. calculations. An additional body weight was recorded on Day -1 forthe Day 1 dose RReeccttaallbBooddyyteTmepmepreartuarteusrweesre taken at approximately 11:00 twice weekly beginning f2owreeexkcesptbeifoonrse).iniAtniiatmiaolnsofwetrreeantomtenatne[sMtohnetdiazyedanfodrTthhuerpsrdoacyed(usreee.Protocol Deviations Blood Hormone Approximately 5 Determination mL of whole blood were collected from a femoral vein of each animal bbeeftowreeenin0it7i:a0ti0onanodf 0t9r:e0a0t.menAtni(mDaalys-7w)earendfapsrteeddosoveeornniDghatyb2e9f.orBelcooolldecwtaisoncso.llAelcltesdamples cwleotr.e cSoalmlpeclteesdwweirtehocuetntarnitfiucgoeadguwliatnhti,nma| ihnotuarinaefdtratcrololoecmtitoenm,pearnadtusreer,uamnsdaamlplloewsewdetroe Dhaaryve2s9teodn.lyS)earnudmswtaorseddiivniadefdreienzteortswetotaopmparionxtiamiante-l6y0etqou-al80alCiquunottisl (pbalcokoeddcoolnlrecyteidcoen easntdrosnhei,pepsetrdio(lo,AtnhiyrLoyitdicsstiImnucl.a,tfionrgahnoarlymsoense.,Tthreiisodaomtphlyersonwienree(Ta3n)a,lyazneddtfhoyrroexstirnad(iTo4l),. : Results of these analyses were provided by Ani Lytics Inc., and are in Appendix 6. SApeprruomxiPmaFtOeSlyL5ev(eDlaDye-t7eornmliyn)aotrio2nmL of whole blood were collected from a femoral (vaepipnroofxiemaacthealnyi2m4alhobuerfsoraeftienrittihaetifoinrsotfatnrdesatemceonntd(dDoasye,-r7)esapnecdtipvreeldyo)s,e7,on14D,aaynsd22,9.3 aAnntiimcaoalgsulwaenrte, mfaasitnetdaoivneerdniatghrtoboemfotreempceorlalteuctrieo,nsa.ndAlalllsoawmepdletoscwleotr,e Scoalmlpelcetesdwweirtehout cfreenetzreirfusgtedtowimtahiinnta1ihno-u6r0atfote-r8c0ollCecutnitioln,paacnkdesdeornudmrwyaiscehaarnvdesstheidpapnedd tsototrheedSipnoansor for analyses. The samples were analyzed for PFOS. `Sponsor are in Appendix 8. Results of analyses provided by the 17 002424 --_-- CovanMMcTTe -6a36e229w9-25s262s BCllionoidcaslamPpaltehsolwoegrye collected from each animal on Days -7 and 29 for hematology and `celaicnhicaanlicmhaelmipsrterdyosteestosn. DIanyasdd2i,t7i,ona,nbdlo14o.d fAonricmlailniscawlecrheemfaisstterdyotveesrtnsiwgahts;cwoaltleecrtwedasfrom provaidldibietudm. evaluated: Blood was collected from the femoral vein. The following were Hematology red blood cell hemoglobin (erythrocyte) count hematocrit `mean corpuscular volume `mmeeaann ccoorrppuussccuullaarrhheemmoogglloobbiinn concentration platelet count `white blood cell (leukocyte) count difsfeegrmenetnitaledblnoeoutdrcoeplhlilcocuonutnt Iymphocyte count monocyte count eosinophil count basophil count rbeltoiocdulcoeclyltemocropuhntology glucose urea nitrogen creatinine total protein albumin globulin total bilirubin cholesterol triglycerides aalsapnaritnaetaemaimniontortarnasnfsefrearsaese alkaline phosphatase Clinical Chemistry `sograbmitmoal gdleuhytdarmoygetnraansseferase creatine kinase calcium sinoodriguamnic phosphorus potassium chloride serum bile acids amylase lipase pancreatic-specific amylase `AWdhdoilteiobnlaolodBl(oapopdroCxoilmleactteiloyn20 mL) was collected from the vena cava of each animal at WthaestpiomteaosfsieuxmsaEnDgTuiAn.atiSoanm(pSleeesPwreorteoctorlanDsefveirarteidoinnstofocronetxaceipnteirosn(sa)p.prTohxeimaantteilcyoa5gumlLant ach) and shipped to stored in afreezer set the Sponsor possible to maintain -60 future analysis. to -80 C until packed ondry ice and 18 002425 --_-- CmovaTnMceeT6m2320s0-52s262 Necropsy xOynlaDzianye,30w,eiagnhiemda,lsbltehadtfwoer rreeqfuaisrteedd toevstesr,niegxhstanwgeurineaatneeds,thaentdizneedcrwoiptshiekde.taAmniinmeaalnsdwere necropsied in random order. oTrhifeicneesc;rtohpesycriannicalludceadviatym;atchreosbrcaoipnicanedxasmpiinnaalticoorndo;ftthheeneaxsatlemcaalvistuyrafancdepoafratnhaesbaoldy; all sinuses; viscera. cervical tissues and organs; and the thoracic, abdominal, and pelvic cavities and Palmitoyl CoA A sample of the Oxidase Determinations right lateral lobe ofliverwas collected from each animal at scheduled sacrifice. `maintain The sample -60 10 -80C was until flash-frozen in liquid nitrogen andstoredina analyzed for palmitoyl CoA oxidase activity. freezer set to RCeeplrlePsreonltiafteirvaetisoanmpElveasluoafttihoenliver, testes, and pancreas were collected and preserved in ezvianlcufaotrimoanliwne.reAfetmebrefdidxaetdioinn,psaarmapffliensafnodr psrhoilpipfeerdattoioPnatcehlollnougcyleAasrsoacnitaitgeesn I(nPtCerNnAat)ional IfnotrePrnCatNiAonaelvaalrueatiinoAn.ppReensduilxts9.of the evaluation provided by Pathology Associates ALivsearmpPlFeOofSlDiveetrewramsincaotlileocnted from each animal at sacrifice, weighed, flash-frozen in ilciequainddnisthriopgpeen,d waintdhsptolraesdmainsaamfpreleezsertsoetthteoSmpaoinnstoarinfo-r6P0FtOo S-8a0naClyusnitsi.l pRaescukletdsoonf tdhreyse analyses provided by the Sponsorare in Appendix 8. Tissue Preservation pTrheesefrovleldowiinng10ti%ssnueeust(rawlh-ebnufperreesedntf)oormrarleipnr,eusnelnetsastiovtehesrawmipsleesspweceirfeiecdo,llfeocrtpeodssainbdle future microscopic examination: 19 02426 --_-- adrenal (2) aorta brain cecum cervix colon duodenum epididymis (2) esophagus eyes [preserved in Davidson=s fixative (2)] femur with bone marrow (articular surface of the distal end) hgeaalrltbladder ijleejuumnum kidney (2) liver lung `lmyammpmhanroydgel(amnedsenteric) CovanMmceTr6232s09.5s2262 muscle (thigh) ovary (2) pancreas pituitary prostate rectum salivary gland sciatic nerve [mandibular (2)] seminal vesicle (2) skin spliunamlbacro)rd (cervical, thoracic, and spleen sternum stomach with bone marrow ttehsytimsu(s2) thyroid trachea (2) with parathyroid urinary bladder uterus vagina THhisetaodpraetnhalosl,ogeyye, femoral bone marrow, lung, liver, kidney, pancreas, spleen, testes, and etxhaymmiunsewdermieceromsbceodpdiceadlliyn rpaoramffeian,chseacntiimoaneld(,sseteaPirnoetdowciotlhDheevmiaattiooxnyslifnoraenxdcecpotsiionn,sa)n.d Bone marrow smears from the sternum of prepared, stained with Wright's stain, and each animalatthe scheduled sacrifice retained for possible examination. were SOtnaltyisdtaitcaalcAolnlaelcytsedeson orafterthe first day of treatment were analyzed statistically. Statistical analyses of animals. were not done on data collected for Group 3 due to the small number 2 002427 _-- CovaMnScTMeT6e362w299.s252s62 wOenieg-htwsa,yraenctaallysbiosdoyftveamrpiearnacteur[eA,NpaOlVmiAto(yWliCneorA, 1o9x7i1d4a)s]ewacatsivuitsieeds,taonadnacloynzteininuiotuiasl body clinical pathology values. hLeetveernoeg'esneteistty(oLfevveanreia,nc1e96a0t)p w<as0.d0o5,netrtaontsefsotrfmoartivoanrsiawnecreehuomsoegdetnoeisttayb.iliIznetthheecvaasreiaonfce. sAigNniOfiVcAantw,aDsundnoenteto'nt-ttheesth(oDmuongneente,ou1s96o4r)twraasnsufsoerdmefdordcatoan.troIlf tvheersAuNs OtrVeaAtedwagrsoup. comparisons. wOenieg-htwsa,ywaintahlyisniitsiaolfbcoodvyarwieaingchet[sAasNtChOeVcoAvar(iWaitnee.r,Al1t9h71obu)g]hwLaesveunes'esd tteosatnfaolryvzaerbiaondcye ahdojmuosgtemneenittryewmaosveddoneext(rsaeneeaobuosvhee)t,enroogetnreaintsyf.ormIfattihoenAs NweCrOeVusAedwabsecsaiugsnieficcoavnatr,ilaenacset Squares means ttest was used for control versus treated group comparisons. For each sex, Group 2 was compared with Group 1 evaluated at the 5.0% two-tailed probability level. (Control). Group comparisons were RECORD RETENTION tAhlilsastwuddyatwai,lldboecuamrencthaitivoiennd, trheecosrtdosr,agperoftaocciolilt,ieasnodfsCpoevcainmecnes-Mgaedniesraotnedfoarsaapreersiuoltd ooff f1inyaelard.isOponseityieoanorfafttheretmhaetesruibamlsi.ssiAloln roafwthdeatfainsatlorreepdorotn, mthaegnSeptoincsomredwiilaladnedtearnmiorniegitnhael copy of the final report will be retained by Covance-Madison. (W2istahpipnro1pryieaatrea)ftferrosmutbhmeisSspioonnsoorf'tshdeefsiingalnereespo(rt3,MalElTo.f t&he,afAonriemLeynttiicsonIendc.maatnedrials Pathology Associates Intemational) (Andrew Seacat, PhD, 3M). will be sent to the Sponsor 21 02428 _-- RESULTS Dose Analyses Results of analyses provided by the Sponsorare in Appendix 7. Results of the dose analyses will be provided by the Sponsor. CovanMMceTr62e329m9.5s226s2 Clinical Clinical Observations observations are summarized in Tables 1 through S; individual data are in Appendix 2. All animals survived to the scheduled sacrifice. clinical observations. There were no testmaterial related Body Weights Body weight data are summarized in Table 6; individual data are in Appendix 3 There were no apparent test material-related effects on body weights. Food Consumption CFloiondiccalonOsbusmeprvtaitoinondast-aAa.reM.s/uWememKalry)i;zeiinnddiTvaibdulael1da(tSauamrmeairnycloufded in the individual clinical observations in Appendix 2. `There were no test material-related effects on food consumption. Rectal Body Temperatures Rectal body Appendix 2. temperature data are summarized in Tables 7; individual data are in There were no test material-related effects on rectal body temperatures. 2 002429 _-- CovanMIcMTeTa6-3e6292s-92s52s62 `BSluomomdaHroyramnodninediAvniadluyalsehsormone analysesdataare in Appendix 6. Estradiol and triiodothyronine analyses data are illustrated in Figures 1 through 4 (Appendix 6). sTthiemruelawteirnge hnoorampopnaer,enotrttehsytrmoaxitne.riaTlh-reerleatweedreefnfeotaspopanreesnttrotneest, measttreiroila,lt-rheylraotiedd effects on estradiolor study, itis triiodothyronine at 0.02 not possible to determine mg/kg/day. Given the conclusively whether low number of there was a test animals in this fmaetmearliealg-irveelnat2e.d0emffge/cktgo/ndaeystwraedrieolnuomretrriiciaoldoltyhylroowneinret.haEnstthroasdeioolfltehveelcsonftorrotlheanmiamlaelsanodn fDeamyal2e9gainvdenth2e.i0r rmegs/pkegc/tidvaeypwreersetunduymevraliuceasl.lyTrlioiwoedrotthhaynrotnhionseeloefvetlhsefcoornttrhoelmaanliemaalnsdon `vDaaluye2s9.; Throiwoedvoetrh,ytrhoeniirnperelsevteuldsy fvoarlauneismwaelrsegialvseon c0onosri0d.e0r2abmlygl/odwearythwaenrtehenucmoenrtircolally ahniigmhearlsongiDvaeny22.90cmogm/pkagr/edadywwitehrethneuimreprriecsatluldyylloewveelrscwohmiplaerterdiiwoidtohthtyhroinripnreelsetvuedlys for levels. Serum Results PofFsOeSruLmevPeFlODSetleevremlindeatteiromnination provided by the Sponsor are in Appendis 5. Results oftheserum PFOS level determination will be provided by the Sponsor. HCleimnaitcoalloPgaythaonldocglyinical chemistry data are summarized in Tables through 15; individual data. data are in Appendix 4. The Pathology Report contains adiscussion of the Administration ofPFOS had no effects on clinical pathology test results. RCeeslullPtrsoolficfeelrlatpiroonliEfveraaltuiaontieovnaluation provided by Pathology Associates Intemational are in Appendix 9. 2 002430 --_-- CovanuIcMerT6-e362w29-9s252s62 Results of the International cell proliferation evaluation will be provided by Pathology Associates Liver PFOS Determination Results of liver PFOS level determination provided by the Sponsor are in Appendix 8 Results of the liver PFOS level determination will be provided by the Sponsor. Anatomical Pathology aInncdid17e.nceIsndoifvimdaucarlodsactoapiarceainndAmpipcernodsicxop5i.c TobhseerPvaatthioolnosgyarReespuomrmtacroinztaeidnsinaTdaibslceusss1i6on of the data. There were no test tissues examined. material-related macroscopic or microscopic changes in the organs and CONCLUSIONS 4Inwceyenkos,motlhgerueswmeornekneoysaptpraeraetendt wteistthm0a,t0e.r0i2a,l-orlrat2e.0dmegffPecFtOsSo/nkgc/lidnaiycaloroablsleyrfvoartiaotnlse,ast pbaotdhyolwoegiyghftisn,difnogosd. cTohnesuomnpetimoanl,eraecntdalobneodfyemtaemlpeetrraetautreedsw,iotrhc2l.i0nimcagl oPrFOanSa/tkogm/idcaaly aanpapleyasreesdatnodhcaevlel plroowleirfelreavteilosnoefveaslturaatdiioonlsownilDlabye p2r9.ovDidaetda bfyrotmhelSivpeornasnodrsaenrduPmaPthFoOlSogy Associates Intemational, respectively. 2% 02421 -_-- Covance 6329-222 aM3TMTe6w29s5s6 SIGNATURES --_---- Patricia K. McKee Pesik, BS, LAT Study Coordinator Covance Laboratories Inc. Peter J. Thomford, PhD Study Director Covance Laboratories Inc. F-- re ---- Date Date = 0 2432 _-- CovaMnIcTMe 6aT322w99-s5226s2 REFERENCES Dunnett, C. W., "New Tables for Multiple Comparisons with a Control," `Biometrics, 20:482-491 (1964). SLteavteisntei,csH,.(,e"dRso.bLusOtlkTienstestfaolr,ECqhu.al2i5t,ypopf. V2a7r8i-a2n9c2e,s,S"tCaonnftorridbUuntiivoenrssitotyPrPorbeasbs:iliSttyanafnodrd, California (1960). i`nWiEnxepre,rBi.meJ.n,t"aDleDseisgingna,ndSeAncaolnydsiEsd.o,fCShi.ng3l,ep-pF.ac1t4o9r-E2x6p0,erMicmGenrtasw,-"HiSltalt:istNicealwPYroirnkci,ples New York (1971) SWeinceorn,dBE.d,J.,C"hA.na1l0y,spips.of75C2o-v81a2r,iaMnccGer,awSt-aHtiisltli:calNPeriwncYioprlke,s iNneEwxpYeorrikme(n1t9a7l1bD)e.sign, 2% 02433 -_-- CovanM MceTe6T32290.5s 2262 PATHOLOGY REPORT SUMMARY m`aTxheipmuarposteoloefrattheids sdtousdeyawnadsltoowperrodvoisdee dleavtealsfotrodbeeteursmeidniinngaacnhreosntiicmattoxeidcity study and (0PFaOssSe;ssT-t6h2e9e5f)f,ecotnofcrtihtiecatlesetnmzatyemreialle,vePlesr,flhuoorrmoooncetsa,neaSnudloftohneirc sAecliedctPeodtbaisoscihuemmiScaaltl `parameters. Atedsmtimnaitsetrriaatli-orenlaotfePdFmOacSrohsacdonpoicefofrecmtiscroonsccloipniiccalchpaantgheosloignyttheestorrgesaunlstsaannddticsasuusesed no. examined. METHODS m`Tahtreereiaglrooruaplslyofvimaaclaepsaunldefaetmaaldeosceynloevmeololgfu0s (mcoonntkreoylsgrwoeurpe;ardemcieniivsetdetrheedvtehheictelset, glarcotuopseh),ad0.t0w2,ooarni2m.a0lms/es/ekxg, othfebloodwy-dweoisgehgtr/oduapy (hmagd/tkhgr/edeaayn)ifmoarls2/9sedxa,ysa.ndThtheechoingthr-odlose `group had one animallsex. tBrleoaotdmewnats(cDoalyle-c7t)eadnfdorohneDmaayto2l9o.gyInanadddciltiinoinc,alblcohoedmifsotrrcylitneistcsalbcehfoermeisitnrityitaetsitosn wofas cmoalclreocstceodpoincDoabsyesrv2a,t7i,oansndwe1r4.e Trehceoradneidm,aalnsdwteirsesuseascrwiefriecepdraensdernveecdrionpsfiixeadtoivneDaas y 30; hseppeactiifciepdablmyitthoeylprCotooAcool.xidSaasmeplacetsivoiftyliavnedr wfeorredectoelrlmeicntaetdiaonndoffrPoFzeOnSfocrondteetnetrm(ibnyattiheon of fSopronmsaolri)n.foSraemvpallueastoifolnivoefrp,rotleisfteesr,atainodn cpealnlcnruecalsewareraentcioglelnec(tPedCNaAnd; pbryesPeartvheodloignyzinc bAossnoecimaatrersowIn,telrunnagt,iolniavle)r,. kMiidcneryo,scpoapnicrceeaxs,amsipnlaeteino,ntseswteesr,eadnodntehoynmuasdrfernaolms,alelyaen,ifmaelmso,ral Results of clinical statistically. pathology tests for the control and low-dose groups were compared 2 02434 -_-- RESULTS AND DISCUSSION Mortality All animals survived to the scheduled sacrifice. CowvaTnIcMeeT6-3w6229s-0252s62 Clinical Pathology Individual values and values for hematology and clinical chemistry ests the resultsof statistical comparisons are in Tables are in Appendix 8 through 15. 4. Mean aDbanoyrm7a.litCliiensi.cal pathology test results indicated no obvious group or individual health cDhaeymsis2t,r7y,taesntdre1s4u.ltsAdamitnhiessteractoliloenctoifonthientteesrtvamlast.erial had no effects on clinical Statistically significant differences low-dose groups were inconsistent for clinical chemistry results between the over time and between the sexes. Several control of the and. edxihffiebrietnecdeas swterroengsidmoislearretloadtiifofnesrheinpc(eis.ep.,retsheenhtiagthD-daoyse-7a,nainmdalnsodniedonfottheexdhiifbfietrneontcaebsle differences for the same parameters). Day 29. Administrationofthe test chemistry test results at Day 29, material had no effects on hematology or clinical cSotautnits,tiacnaldlyhespiagtniicfipcaalnmtidtiofyflerCeoncAesofxoirdaesde wbleoroedicneclolnsciosutnetn,tnbeeuttrwoepehnilthceousretx,esmoannodcyte aelxkhailbiinteedphnoospdhoasteasreelawteiroensshiipm.ilaSrtattoisdtiifcfaelrlyensciegsniofbisceanrtveddifafterDeanyce-s7.for triglycerides and Anatomical Pathology oAfnattheommiaccarlospcaotphiolcoagnydfmiindcirnogsscofporiceaocbhsearnviamtailoanrsearieniAnpTpaebnldeisx156. anIndci17d.ence summaries 2 002435 _-- CovanMcTTe 66a32200m.522s62 t`iWseseueks 5e.xaTmhienreed,wearnedntohemraecwreorseconpoicmaajnodrfdeiwffmeircenrcoesscobpeitcwefienndicnognstrionl tahnedotrrgeaantsedand animals in incidental the and incidence unrelated of to any finding. All the test material, microscopic observations were considered _-- Robert L. Hall, DVM, PhD. --_-- Date Diplomate, ACVP Clinical Pathology --e `Thomase E. Palmee r, PhD Pathologist Date 29 002436 -_-- CovaMnMceT6T 632995s 2262 (COMMENTS ON THE DATA Vdaatraioinusthmios dsetludsy.of Bcealccauulsateodrsi,fecroemnptutmeordse,lsanrdocuonmdpouftfeorr ptrroungcraatmesnwuemrbeerusseddiftfoeraenntallyy,ze svlailguhetslyinfrsoommtehotasbeleisn o(ct.hge.r, mtaebalness,,fsrtoamndianrddidveivdiuaatliloyncsa,locruliantdeidvidadtuaa,l ovralfureosm) mstaatyisdtiifcfaler analysis data. differences. Neither the integrity nor the interpretation of the data was affected by these Some tabular data were compiled using Excel' Version 7.0 software. `The summary condition was tables for observed clinical without observations regard to the indicate specific the number of animals for which nature, severity, reversibility, a numberofincidences/animal, othe length of time the condition persisted. Only observations tables. other than normal are indicated on the summary clinical observations `Theday of initiation of treatment is "Day 1." 30 02437 -_-- 2 CODES, ABBREVIATIONS, AND UNITS General Codes and Abbreviations Codes for Clinical Pathology Abbreviations and Units for Clinical Hematology Abbreviations and Units for Clinical Chemistry Codes for Anatomical Pathology CowvanITcMeTe6-362s29-92s5262 Note: STohmeef,olbluotwniontgnleisctessosfacrioldyesal,l,aobfbrtehviisaitnifoonrs,maatnidonunmiatsyabree nueseeddebdyfCoorvtahnisce. report. 31 02438 _-- WK N Mean; MEAN CAM SD; S.D.; STAND DEV; STANDARD DEV; sd NA P UNSCHED DISPATCH MIN [= General Codes and Abbreviations CovanIcMeTT6-e362s92.9s25262 Week. NAruimtbhmeertiocfmmeeaans.urements in a group. CSotvaanrdiaartde-deavdijautsitoend. mean. Gfrroomup 2thmeemaenanisofsitghnieficcoannttrloyldgirffoeurpent (Group 1) atp #0.05. No value; Present not applicable; not present. Unscheduled. Obsmeordvualteioonfstthreandsaftearrceodllferctoimonthseyisnt-leimfe:to ntehecrnoepcsryo.psOybsmeordvualteiofnosr arreefedruepnlciecadtuersionfg Mitnhuetela.st in-life observations. Observation. Animal T Death Codes: Terminal sacrifice. 32 002439 --_-- Ns QS/QNS NR FS sc SH H SL L st 1 NF u DT/DOT DB I] TE RE EE SE PC PD PI PL PA co HB PLASMO NO AGG FR UTD NO COAG Codes for Clinical Pathology CovanmMcTeT-6e3622w99-s2526s2 GENERAL CODES No sample `Quanity not sufficient No repeat (sample Fibrin strands volume not sufficient for repeat analysis) Sample clotted Slightly hemolyzed Hemolyzed Slightly lipemic Lipemic Slightly icteric Ioteric Animal not fasted AUnnismchaeldduileeddo/mnotreistbund bleed Died during bleeding `TTeecchhnniiccailanerjruodrg(miennsttrtuomernetpeoart tteescthnician error that results in supnialclceed,pteanbtlrey odaftian,vea.lgi.d, duantaac)ceptable instrument output, sample sRpeeclolridnginegrreorr,roirn(correrceocrtdeddatien)correct data, .g., wrong number, Entry error (incorrect Sampling error keyboard entry) Platelets clumped Platelets decreased Platelets increased Platelets large CPloaltoerleitnstearpfpeeraesr waidtehqutaetste Heinz bodies observed Plasmodium No aggregation Fractious Unable to determine No coagulation 3 02440 -_-- CovaM nIcMeT6T -36229.9s 25262 Codes for Clinical Pathology (Continued) RESULTS NOT INCLUDED IN STATISTICAL ANALYSES ``SHaemmpolleyszfedrocmlianinciamlaclsheamtiusntsrcyhoerducolaegduilnatteirovnalssamples APcrtoitvhartoemdbpianrttiiamletshr(oPmTb)ogprleaastteirntthiamne5s0(sPeTcTo)ndgrseater than 110 seconds Bleed times (BLETIME) greater than 30 minutes (CODES FOR BLOOD CELL MORPHOLOGY Tpohiekifloolclytoowsiinsg (sPcaOlIeK)w,aspoulsyecdhrtoommaesaisau(rPeOtLhYe)d,eghryepeocohfraonmiasosciyato(sHiYsP(OA)N,ISaOn)d,toxic neutrophils (TOXNEUT): Scale Degree B Normal for the species 1 Slight 2 Moderate 3 Marked --_-- 4 Not ape plicae ble Presence Not present Rare Few Moderate MMaanyy 34 002441 --_-- CovianMceT66a322w9-5s226s2 Abbreviations and Units for Clinical Hematology Test Red blood cell count Hemoglobin Hematocrit Mean corpuscular volume MMeeaann ccoorrppuussccuullaarrhheemmoogglloobbiinn concentration Platelet count Mean platelet volume Reticulocyte count HAebisonlzubtoedryetciocuunltocyte count PErryotthhrroocmybtiensetdiimmeentation rate Activated Thrombin partial time thromboplastin time FiAbcrtiinvaotgeedncoagulation time PFliabtreilne/tfiabgrgirneoggaetniodnegradation products Collagen Adenosine diphosphate Alpha 2-antiplasmin Bleeding time Methemoglobin Plasma hemoglobin EMsyteilomiadt/eedrmyytehlrooiidd/reartyitohroid ratio White blood cell count DifNfuecrlenetaitaeldbrleododblcoeloldccoelulntcount Corrected white blood cell count `Segmented neutrophil count Band neutrophil count Lymphocyte count Monocyte count `Eosinophil count AnBiassoocphyitlosciosunt Polychromasia Abbreviation (Units) RBC HGB (E6/UL (G/DL) or X10%0L) HCT (%) MCV (FL) MMCCHHC(P(G%)) MPLPTV((EF3L/)UL or X10/L) RETIC (%) HREETIINCZ ((%E)3/UL or X10*/L) ESR (MM/HR) PT (SEC) PIT (SEC) TT (SEC) FABCRT((MSGEC/)DL) FDP (UG/ML) PAGG/COL (%) PAGG/ADP (%) ANTIPLAS (%) BMLEETHTIGMBE((%S)EC) PLA HGB (MG/DL) ME RATIO EST M/E RATIO WBC (E3/UL or X10/L) NRBC (/100 WBC) COR WBC (E3/UL or X10/4L) N-SEG (E3/ULorX10%/L) and % N-BAND(E3/ULor X10"L) and % LYMPH (E3/UL or X10%/L) and % MONO (E3/UL or X10%L) and % EOSIN (E3/UL or X10%L) and % ABNAISSOO((E13/2U3Lo)r X10%L) and % POLY (-12,3) 002442 35 _-- CovanuIcMerT6-e36229s-925262 Abbreviations and Units for Clinical Hematology (Continued) Test Poikilocytosis Hypochromasia Howell-Jolly bodies Basophilic stippling `Toxic neutrophils AquAteyopuiscawlhiltyempbhloocoydtecesll count (right eye) `Aqueous white blood cell count (left eye) PAbObIrKev(i1a,t2i3on) (Units) HYPO (123) HBAISBTOIDPY(1(21.,32)34) TOXNEUT (-,1,2,3,4) ATYPLYM (1.234) REYE (WBC/UL) LEYE (WBC/UL) 002443 36 --- wCoTvaneIcMeTs6-362s29-02s5262 Abbreviations and Units for Clinical Chemistry Test Glucose Urea nitrogen Urea Creatinine Total protein Albumin Globulin Albumin/globulin ratio Total bilirubin Direct bilirubin Indirect bilirubin Cholesterol Triglyceride TUorteaal nliitpridosgen/creatinine ratio Phospholipids LHoiwgh--ddeennssiittyylliippoopprrootteeiinncchhoolleesstteerrooll Uric acid AAlsapanritnaetaemaimniontortarnasnfsefrearsaese Alkaline phosphatase S`oGrabimtmoal gdleuhtyadmryolgetnraansseferase CLarcetaattienedkeihnyadsreogenase Amylase Lipase Palmitoyl CoA oxidase Calcium Tonized calcium Inorganic Sodium phosphorus Potassium Chloride Magnesium Zinc Strontium Tron Abbreviation (Units) UGLNU(M(GM/GD/LD)L) UREA (MG/DL) CTRPERAOT(G(/MDGL/)DL) ALB (G/DL) GA/LGORBA(TGI/ODL) TBILI (MG/DL) D BILI (MG/DL) IBILI (MG/DL) CHOL (MG/DL) TRIG (MG/DL) UN/CREAT (RATIO) TLIPIDS (MG/DL) PLIPIDS (MG/DL) HDL (MG/DL) LDL (MG/DL) UA (MG/DL) AST/SGOT (IU/L) ALT/SGPT (IU/L) ALK PHOS (IU/L) GGT (UAL) SDH (IU/L) LDH (IU/L) CK (UL) AMYLASE (IU/L) LPICPOAASOE ((IIUU//LG)) CA (MG/DL) ION CA (MG/DL) IPHOS (MG/DL) NA (MMOL/L) K (MMOL/L) CL (MMOL/L) MG (MEQ/L or MG/DL) ZN (MG/L or PPM) FSER ((UMGG//DLL)or PPM) 7 002444 --- CovanIcMeT6T3e6292s-522s62 Abbreviations and Units for Clinical Chemistry (Continued) Test Excess iron UTontbaoluinrodnibrionndbiinngdcianpgaccaiptaycity Percent iron saturation RPleadsbmlaocohdolcienllesctheorlaisne:esterase Brain cholinesterase Caudate putamen Hippocampus, Frontal cortex Cerebellum Bicarbonate Serum hemoglobin Serum bile acids Fecal bile acids Average fecal weight OFescmaollabliilteyacids (calculation) Electrophoresis Albumin Alpha-1-globulin Alpha-2-globulin Beta globulin Gamma globulin LHiogwh--ddeennssiittyy lliippoopprrootteeiinn InsuVleirny-low-density lipoprotein Adrenocorticotropic hormone Cortisol Glucagon Triiodothyronine Thyroxine CPraencarteianteick-isnpaesceifiiscoeanmzyylmaesse BB MB MM AEbXbrFeEvi(aUtGi/oDnL()Units) TIBC (UG/DL) FUEIB%CS(AUTG/(D%L)) CHEP (MUML) CHER (MUML) CHEB (MU/ML) CAUD PUT (UMOL/G) HIPPOCAM (UMOL/G) FCECROERBTEELXL((UUMMOOLL//GG)) BICARB (MMOL/L) SER HGB (MG/DL) SFBBAA ((UUGM/OMLLI)L or MG/DL) FCC WGT (G) FBA (MG/Day) SMO (MOSM/KG) EALB (G/DL) EA-L(G/DL) EA-2 (G/DL) EBETA (G/DL) E GAMMA (G/DL) E-HDL (%) E-LDL (%) E-VLDL (%) INSULIN (UUML) ACTH (PG/ML) GCOLRUTCIASGOOLN(U(GP/GM/LM)L) T3 (NG/DL) TP4A(MUYG/LDL()UL) CK-BB (UL) CK-MB (ULL) CK-MM (ULL) 002445 38 -_-- CovanMcTTe.6a6322s90-25s262 Codes for Anatomical Pathology DistributionofFindings Focal Diffuse Multifocal MICROSCOPIC CODES G1 rades for Severity oMriAnimmoauln-tthe least amountof change that can be observed with the 2 light microscope Slight - less than average amount of change, but readily discernible 3 as abnormal Moderate - the average amount ofchange that is expected foar 4 lesion Moderately severe (marked) - a marked amount of change with 5 pSoesvseirbel-e 2logsrseoatf afumnocutnitonooffcthhaenagfefewcittehdpcreollbsabolreolrogsasnsof function of the affected organ cell or organs and frequently involves large areas of the 002446 39 | mary a Sine,scion 5 +hor arm ee a8 =S ea PSSe RL I WS re ne 5288 @ " 228 &aS SEARRT R S Ea 2 ga58 ee Ro ores. 3, Eman,on cto mans 1 238 aa " re TrRa rum -- zz ig . seasof snrvee.os g88 BB B i BoH k aa. 8 4 H hoo Hi now. " 223 8aa Id macy of Rectal ety erat Sua (1 REE ERS Se ere men 2 8a a a ww moe xt om NWT aie NOW 82a8 ier our 288 . aJ | 50 whee wie reves or TAR trans 3 SA Ee reo Gn NRW gm me me 8BGa st Show afi BS ATR Wh. WE mR ve we oo we ag588 2 228 a23 5 The oF BR ED SE Me vem wen ee eee ae 3 35B: " omy hires emery She we mTOR WR a me me 8 80 5s | --" Tu of MEOEE MP ESL Sven me em we 28228 * i mary of chiens crmssy ana Sher SR Sa EN UR om om mu She WROD 88 a@2 5 aBt TE RL ni mre sero 288 a>a 58 g 2 3 Thee SR She a Th SEOVE asi ne se MA wm mm Se WR 322 daag " 8 2 8 Dhow Se ME Be whe Si 8388 3 88 33 @ 8 8 id " See ot Cessme wn S8 3 os 38S 53 w 88 33 @ [ER 2 a58 a 6 ST SRnye Flow SMa EOE OM WmouE oS. mom 8883 32 o | 3:3 N ELT rp-- Doe we EE Bo wb Se 3 a58 3 n 8 3 3 mary of Cates maces ote 332 3I5] hw Be ME Bu whe Se 288 2 Bho SE Sw ZEOVE 8% wR 2. mom 88 82 7s | omy ics coming Shoo TUT VEDI EE Sa me mm our 2338 2 8 2 2 | | Ti ST Tr Em proc ero hee oh Sw BOVE OM mom om Er 28 a@a Ed Sle CTE NTETOMTE WL ELS. mE ume eam 238 a Shaan wi SES Be wha Sh 23: ?B3 0 Slee SR Sa EROUR Mw wm om EO 2 aI8] 3 5 || Hare TET MET NATE mmm, me ume ro 238 a]|] 2 Shoe Se WR Ba whe 83 3a 8 macy of Clntens cmiotey oa ET Te, PRT Sr seo Shwe Sh Sa BEOVE SA um omy om Sh mn 83 R@Q 8 $3 8a@ ss Shaver wn RL dn eh Sn 88 &a 8 seyst rome tie || em S gyn es TtR weeg Se 88s g wo Tow ER 882%& 288 B2 0 2o EEESC 3288 J. PfPiEi 88Q morioe @|] tee or --- Covance 6329-222 M3TMTe-6929s5.66 APPENDIX 1 Protocol Deviations Protocol Protocol Amendment No. 1 Protocol Amendment No. 2 Protocol Amendment No. 3 Material Safety Data Sheet 92 02499 -_-- Protocol Deviations CovanIcMeTT6-e36229s-0252s62 Protocol. Group Designations and Dosage Levels. Dose levels were 0, 0.02, and 2.0 mg/kg/day. The control group (Group 1) was to receive an equivalent amount of lactose in gelatin capsulaess the total material administered to Group 3. The total material was 20.0 mg/kg/dayforcach group; however, the low- and high-dose groups were to receive test material triturated with lactose (1:999, ww, and 1:9, ww, respectively). Actual Procedure. Because the capsule broke during dose administration, the following animals (Group may not have received the full 1 male) on Day 1; Animal No. amount 105367 of dose (Group preparation: 1 female) on Animal Days 2, No. I05350 7, and 14; Animal No. 105344 (Group 2 male) on Day 7; and Animal No. 105369 (Group 3 female) onDay2. Protocol. Observation of Animals. Rectal Body Temperatures. "Beginning 2 weeks before initiation of treatment, rectal body temperatures will be taken at approximately 11:00 on two days/week (Monday and Thursday). Actual Procedure. Rectal Day -14 and between 08:17 body temperatures and 08:40 on Day were -10. recorded between 12:50 and 13:30 on Protocol. Serum PFOS Level Determination. Frequency. "Before initiation of treatment (Day -7or-6), andprior to treatment on Days 2 (approximately 24 hours after the first dose), 7, 14,and 29." Actual Procedure. On Day 2, incorrect blood collection tubes were used for the cleovlellecdteitoenromfinbaltoioodnsfowracsliunsiceadlfcohrecmliisnticrayltceshte;mtihsetrreyfotreest,s.bloRoedmaciolnliencgtesdefrourmsefrruomm PclFinOiScal chemistry tests was used as the Day 2 sample for serum PFOS level determinations. In `addition, whole blood (approximately 2 mL) was collected from a femoral vein of each animal before treatmeonnt Day 3 (approximately 24 hours after the second dose). 002500 9 -_-- Protocol Deviations (Continued) CovanIcMeTT6-3e62w29-9s25262 Protocol. Additional Blood Collection. "At scheduled and unscheduled necropsics, blood (as much as exsanguination." possible, up to 20 mL) will be collected from animals at the time of Actual Procedure. Additional blood was not collected from Animal Nos. (Group 2 female), 105365 (Group 2 female), and 105369 (Group 3 female) 105364 Protocol. Postmortem Procedures. Tissue Preservation. "The following tissues (when present) from each animal willbe preserved in 10% otherwise specified, for possible future microscopic neutral-buffered examination:" formalin, unless A(cGtruoaulp P1rmoacleedsu),re1.05F3e4m4oraanld 1b0o5n3e4m8a(rGrroowupfr2ommaAlensi)m,a1l05N3o4s5. 1(0G5r3o49u3panmdal1e0)5,351005366 (weGrreounpot1efxeammalien)e,damnidcr1o0s5c3o6p4ic(aGllryo.upT2hifsemtiaslseu)e wiserleistiendsuwfiftihcietnhte;atphperroepfroiraet,etcheosmemteinsstuses in as the pathology data sheets having been examined. for each individual animal. Summary tables do not include it These deviations are not expected to have affected the results of the study. 02501 % _-- Protocol lof 18 Counce 6320222 mews C02502 95 Covance 6329.22 -_-- Tem 2 9% ee 002503 Covance 329222 _-- Tews 3 002504 97 Covance 6329222 _-- mews 4 002505 98 _ 5 WirCoveanIcMwe 6T2s699.25s262 002506 9% Covance 632922 _-- MTews 6 002507 100 Covance 6329222 _-- rem 7 002508 101 -_ SiCT ovane 3cMeT6-w36229-0s25262 8 002509 102 -_-- Covawn3ciMeTr6-362e29-0w2526s2 9 02510 103 -_ SiCTovaneIcMeT6w -36292-s 025262 10 02511 104 -_ 00 CovaNn3cTIeM6Te3-269w2-02s5262 u 02512 105 _ 12 CovaSnIcNMeiT6.3T62e92-9w252e62 106 002513 TCN ovanIcMS eT36292.925262 13 0251.2 107 - 14 mCoe vTeM 6Tm3.2092.92526 002515 108 -_-- CovanS3cMeiT6-r3622e00-5w2.26s2 15 00251 109 _-- CovaNn3cTMeT6e-36292w-925s262 16 110 002517 -_-- TCRovaTnIcMeeT6-362w290-52s.262 17 C0218 11 -_-- CovanIcMeTe6-362v92-02e5262 18 02519 12 -_-- Protocol Amendment No. 1 Page 10f2 Covance 6329-222 MTIeMTw-6s29s56 13 02520 Page 20f2 0t CovanMceTe 623200-52262 14 002521 _-- Protocol Amendment No. 2 lof2 Cove 632922 ures us 002522 -_-- Covan3cMeYT6-362e92-025s262 20f2 116 02523 Protocol Amendment No. 3 lof3 CovanMceT3e299-52262 i 002524 _-- 0 CovanIcMeST662e92.9m25262 2 002525 18 -_ 0TCS ovane IcMeT6s -36292.s 025262 3 119 002526 -_ Material Safety Data Sheet Page 10f6 ee CovanIcMee T6-36220-925262 120 0025227 --- Page 20f6 0 CovEanMceeT6e3e2290.52262 121 002528 _-- Page 3 of 6 Covan3cMeiT6-362e299-52s.262 122 002529 -_ Page dof 6 00000 R CovanIcMeTR 6-36229-025262 123 CO:2530 _-- Page 5 of6 e[ wee-- rs 1 002531 -_-- Page 6 of 6 Covance 6329-220. wrewss 125 002532 _-- wirCoveanMcwTe 663s2209-s52262 APPENDIX 2 Individual Animal Fate Data Individual Clinical Observations Individual Rectal Body Temperature Data (C) 126 002533 2283 a4 RRLRESe ol a833 & os oH ots ore iosraison srone Kio ner. 2 88 a&a 129 I ROTA EE eres v1 ERS Src acto nr: 3 2283 aa3 130 3 8a88 Bl gS 3a8 m2 | 228 aaS 153 g RB 134 iit caioyneer 5 en 2&8g 8 1s 288 28 16 _-- MrCoavanMwcTe .6s36290.s52262 APPENDIX 3 Individual Body Weight Data (kg) Low 02544 aa cesen enpoe sre cto [SN 82S aaa 138 via soe vei saa ha 8223 saaq 139 -_-- Covance 6329-222 M 3M TT -629s 5.6 APPENDIX 4 Individual Clinical Hematology Data Individual Clinical Chemistry Data . 140 02547 wie ae me we an VOW Wome mmm wm Or 3 rae eels 0. naseti meray 832 3aa ro: 3 onetevets 8 onagetits morgrtny [I settee ferme eee 822 58 0 wine yr Gon 3 oete 003 ms ek 50 una tics marin an 38 a ws Geet 00 onts rey 832 aaa In | . | jo 1 Done Leva 0 `Dosage Unit: manasdny Grow: 3 Dose Levels 0.02 DosageUnit: maskadey et3 Dose evel: 2.0 Dosage Unit: mararday a883 8a us han 1:74 Co : : : : : ' ies mn 882 a 16 tTRt nemensom nm s W ae hy - xe Ee Group: 2 Dose Levels 0.02 Dosage tic: maskadey : : : : Group: 3 Dose Levels 2.0 `DosageUnit: markarday : a88 ai wo Ss [A -- et il 08 i at Cod tn 20 sr g28 ee 148 To ee oo oo } rope 3 ova tev 6 [a -- Go3 tose eral 10 sae ics mney 823 gaaa 149 man ate on VO WOROT MN. TC mh Gro 2 so tov 0.03 age niesany 822 Jaa 150 rir mm Group: 1 Dose Level: DosageUnit: sakasday J Grow: 2 DoseLevel: 0.02 Dosagevast: sarmasdey : : : ! : ! Grow: 3 Dose Level: 2.0 Dosage Unie: marg/dny ! 8882 aa 51 reves or } Gro tone eve -- . Grom 3 tore tev 0.67 onsets monartny 003 Dots evel 20 buen wits soar 232 aa 152 rr } Groups 1 Dove Level: Dosage tac: ma/rasdey EE ows tas 28 mae mts mr 28&8 82 15 ! et mens imi Grow: 2 Dose Levels 0.02 Dosage Unit: mg/kg/day : : 388 82 156 i Go ees a ms an m3 net 052 ne is rr rm es 0 vantis mi 388 8 15s Grow: 1 Dose Level: 0 Dosage Unit: mg/kg/day rs 01 owns carat Grow: 3 Dose Level: 2.0 Dosage Unit: markasday 3888 a8 15 So ! ! ! : ST Se Group: 1 Dose Levels Dosageunit: saskasaey Co ns tris 20 ove is min &822 2 15 et toi 6 oe es ren G3 na 20 oe mis sare 88a a 15 mo wie ra wt eee im ns res 0 eaetis sat a883 8 1 a SE Grow: 1 DoseLevel: 0 `Dosage Ueit: markardey Cot rom 00 en mis mer Sa oT Grow: 3 Dose Levels 2.0. `Dosage Unie: sakasday ! : ! : 8822 28 1 ! Gro 1 toeva0 sae niesmain Grom 3 tose eal 0.03 ons nis morartny mee veh 20 one tts manny 2233 aa3 161 re rs Grou3: DoseLevel: 0 DosageShit: sarkasday Sr Grow: 3 DoseLevel: 2.0 Dosage Unit: mariarany 388a 2 : ; | i Group: 1 Dose Level: Dosage test: manasa or nt es 1 ove i arr 3 tos 20 ae ts morn 8 &3 @ or 3 oe es 2 ae issaat oo mans 20 nis mtn 83 4 ot Group: 3 DoseLevel: 2.0 Dosage Unit: moska/day : ; ! ! ' 822 N 6s 28 a& 166 [i 3 res 1 ne is ain om1 tis 20 ns ar 8 &34 0 Grom 3 Dose eve 0.02 Deen ies mbar 322 a a 168 | | 3 tos1.2 sise rey ' 8 a34 i wot tes8 an ismri 3 we 30 sn is sir 8 &3 mn Grom: 1 Dose Level: Dosage Lait: markgrday Co Grow: 2 bose Levels 0.02 Dosage Unit: markadey ! 3 tas 0 ove is i a83 3 m Grom 3 tosetowels 10 ons cits sahara 328 ae3s m | ee RE 0m 3 Dose wks 20 nen nts maha 832 32a ms C3 Doanberks 002 menetits maar 822 2a ms [A et meme in Grom: 2 Dose Level: 0.02 Dosage Gait: makasday ! : : : : Group: 3 Dose Lave: 2.0 DosageUnit: merkorday : ' 888 a8 ns 238 a@& 6 meme smi Grow3: oseLevel: 2.0 Dosage Unit: mg/kg/dny ' a228 28 m Grow: 2 Dose Level: 0.02 Dosage Units morkarday : : ! ! 3288 8& mm 28 19 238 &J 150 | ot sre | Grow: 1 Dose Levels 0 Dosage Unit: me/kaiday To Len .23522 pd | rer n> tes2 sise meer 38a 8 wn i A, onan ties manasiny G00: 3 Duttev 0.08 oan nies sry 38 Sa@s 183 } Grom 1 omen tow 6 fp Grom 3 tose tev 0.03 congenic: rnp 822 2@a 184 APPENDIX Individual Animal Pathology Data Covance 6329-222 IMT-62056 oss 002592 238 a 186 | mn apces sren cna sre eso noe 3 882 %a4 157 228 a& 158 2 3 189. E8aS IN]Y 190 | ps em | op ce i. 32.22i om arms once sr rece susan sco noe. + 832 3Ia] 192 = EEpt a EE, 832 8Q 193 82 8BR 198 888 8 195 I | omgr psse otsn se sro ns 82888 196 3 88 2 10 _-- mrCoeunIcmMeT6-3s6229-0s25262 APPENDIX 6 `Summary and Individual Hormone Analyses Data Figure 1 - Mean Estradiol Data - Males Figure 2 - Mean Estradiol Data - Females Figure 3 - Mean Triiodothyronine Data - Males Figure 4 - Mean Triiodothyronine Data - Females NOTE: This appendix of the report contains information supplied by Ani Lytic Inc. and has been reviewed by the Quality Assurance Unit of Ani Lytics Inc. ~ 198 -- CORS05 Grow: 2 Dose Level: 0.62 Dosage Duk: markarany : es it on i 8882 32 1 [RA ne SETHE TET Tne megs oman oes io 0 i Gre onton 30 tse nes sarin 88 38g 0 mRet CeREnRE TR aTi ORR meee oes ei 10 i 388 28 on and Eedividunt lorsone Noises uta es ir eC ow Ed rd Owe eels 20 mua niesary i 222 g = Figure | `GRAPH- Mean Estradiol Dita - Miles: 228a23 13 20 Figue2 `GRAPH- Mean EstrDaatad- iFemoalles 38 a8 = EY Figure `GRA-MPeaHn Triodothyronine Da-Mtalaes 28882 25 Figured `GRA-MPeaHn Triodothyronine Da-Fetmalaes 228a23 26 --_-- MCovranMecTew-6362s209-2s5262 APPENDIX 7 Dose Analysis NOTE: This appendix of the report contains information supplied by the Sponsor and has been reviewed bythe Quality Assurance Unit of 3M. 02614 207 -_-- Covance 6329-222 M3TMeT-M62s9566 Dose Analysis (to be provided by the Sponsor) 002615 208 -_-- CMovranMTceTe6e3w209-5s226s2 APPENDIX 8 Serum and Liver PFOS Level Determinations NOTE: This appendix of the reportcontainsinformation supplied by the Sponsor and has been reviewed by the Quality Assurance Unit of 3M. 002616 209 _-- CovanWIcMeiT6r-362e92-s925262 Serum and Liver PFOS Level Determinations (to be provided by the Sponsor) 002617 210 _-- CovaMnIcrMeTT6-3e6229w-02s526s2 APPENDIX 9 Cell Proliferation Evaluation NOTE: This appendix of the report contains information supplied by Pathology Associates International of Pathology Associates and has been International. reviewed by the Quality Assurance Unit 002518 21 -_-- CovanMcreT62e3290s5.26s2 Cell Proliferation Evaluation (to be provided by Pathology Associates International) 02619 212 (PZ?) A Pathology Company of AScsCisoeornpccoieraaAtptepisloincIanttieornnsaItnitoenranlational =F EpOmeesy. CELL PROLIDFERRAAFTTION REPORT +-WEEK CPAOPTSAUSLSEIUTMOXSIACLITTY(PSFTOUS;DYT-W62I9T5)HTIPN0ECR2FY9LNUO5OMR.OOLOGCUTSANMEONSSUALFtOSNIC ACID COVANCE STUDY NUMBER 6329-222 PREPARED FOR: BUILTDOINXGIC2O20L-O23GE-mY02S, E3RMVICCEESNTER ST. PAUL, MN 55144-1000 PREPARED BY: PAT1H5 OWLOORGMFYRAENAD'SESSROIMCCIIKLA,LTEMCSDOUIR2N1TT7,E61RSNUAITTIEOTNAL SEPTEMBER 30, 1998 TS Warmes Ml Cour, ute 1+ Frederic, Warrant STOTT GO SIT 002520 `CovDarnacfet CSetluldyPrNoluimfberearti6on32Re9p.o2r2t Page? CELL PROLIFERATION REPORT SUHLFVFOENIKC CAACPISDUPLOETTAOSXSIICUIMTMYSOASNLTKEUEDEYROWSI;TTH62P9E5R)FILNUOCRYONOOCMTOALNGEUS COVANCE STUDY NUMBER 6329-222 PURPOSE mIoahsteeerapinaulrdpoolnsoewcreiortfidcatolhseeenslztevuyedmlyes twleoavsbeles1,u0shepodrromivoniancdeehsr,doaantnaidcfoottrohxedirectsieteylremscittnueiddnybgaioanncdh0eesmtiaicsmasaeltspesdatrhmaeamxeftieamerutsm-otoaleratsed (CpTPhraiRseOgSdreep,oprctah,veeseuckbe.mliCtpatropelsdiuflbeeyratPTioaoxtnihcofiiltnoydgiySngtAsusdsayoncdiwaiitntethserPpIrenerttfeamltaiuotrniooofncoatrlaCn(oePvAaSDnu)lcfetoonSittchuedAysctiNuddoyPmSaoproons6ro3rs5,9-30M3,5 Rkeagbuiolrsaat:tiosoTrtn6yus2d,9yP3rPa)awcteiineceCcy(onGnodLmuPoc)tlegRduesgiunMloacntokimoepnylssi"aa.nsceAsltwliatfshopretthchet.sinEofntTvhiilereotn4ams0ek.nsotaafslstohPcerioatUteSec.dtiwoCinotdhegpseinogefs."pForcrtro2io2onnn0 applicable amendrmte7n9t2s,.issued November 29, 1983 (effective December 29, 1983), ang wiiany MATERIALS AND METHODS Tissue Collection for Cell Proliferation iraTnenwpdonroeaensneeinamtnaailtmsiapvleepresrsaesmxepxilneoicnfontdtohrseoellgigvrreorou,uppte3s1t,(es2t.h(0rmemaelgeaksngiiomdnalalysy))paewnredrspeeaxsnacicnrreidafosisceferdoagmrnoeeusapcf2hou(ar0n.iw0m2aalmegw/ekEgZ/fdooatcy)) pbSrploeolcciikff,eicraa2ttiifonoSnglrsim.cdaeell,liTnnwi,usacssupreopbcrleeospcsakersdedweafrnoedr tehHem&nbEesdhidepevpdaelduatttooioPpnAarIaaffnfodirnsiebmclmtouicnoknoihnibgsytaoncCdhoesvmtaiancicaneli.n"g"pdeeFrsrpaarcmottoeiccnogtl)i lear antigen (PCNA), amarker of cell proliferation. Immunohistochemistry for Cell Proliferation S{faaocpnteairortnrsosoStfanpPdalurasar,fdfFiiinms-mheuemnrboeShdcidiseetndtoitcfihisecs,muiePsciatwltesrmbeuertcghuhot,dasPA5w)eurmteo Standa aennsdurpelacaeddheosniopnosdiutriivenlgy used to stain issues for pcrhoacregsesdinsglifdoers BONA (GALL mrSeeecttahigoondersndfwoterOsrpteehrreeiadqnteucitiunerbgceatdtPefrdoorcwetidhtuehraaevimfdooinrno-cIbilmoomtnuiannlopkaeinrstotixobicodhdaeysmetio(cPaAlCBNCStAaKii(tn,iDnAlgoKt(O#S,POKlPo-t5##170001706),..PPAABTIriNeof,ly,AK1t74i2s3s30u))e soeycttihoenschwreormeacgoeunnte3r,si3to"andioinfaemdtihwneiotabhnethniezgmieadnti-onaxenytli(ibDnoA.dBy;coSmipglmexa.CPheCmNicAalexGproe.ssilootn #in1c8eHllSs2w0a%e,eaossee) Cell Proliferation Measurements s{3Tte0haa0seit0npi2ehn0re0cprea0nttoaaccgiynetaeorsfciepnlrlo1sl0iofffeirtealhtdeisnpgoafnccellrilevsears(,paproelrilfeaeansritamta5iln0g.0iLnAedyenxde,iggaPtIci)evlewsacsoofntdtreohtlertsmeiisdnteesdw(mabasylesiscnocariniaind)ge,datiolsreatsst g un and consistedof study tsse that was not incubated with the primary antipeds, 002621 CovDarnacfet SCetluldyPrNoluimfberearti6on32R.ep2o2r2t Page3 fhlFoioirsrttlociyemvlolroppfrhootllaiofigenriiacntgic,ohnapnergvoeacsleu.sastiiCnoenglsl,apnrsdolliidsfeeescrtawiteoirnoeninwfgi,arsstptohpteeennrqtuuisaaelndtpaiatftilteoedmwsamtaofghniigcfehileclraultmaiarognnpir(fo1ifc0fa0ot)iaotnitoo(rju<d5g;e Iusssseedr oayndc4ya0l0uXatifnogr ttehseteHs a&nEd evaluated for cell proliferation. psaindcereparse)paasreddescrfibredom thaebosvaem.e Htiissstuoemoblrapchkeifonuy ewaochr 122e0r0sX corey Statistical Analysis Due to the small sample size, statistical analysis was not performed. RESULTS Cell Proliferation tihnedilivviedru,alteasntiesmaalndcepllanpcrroleiafseorfaticoonndtartolaaarned ptersetsmeantteerdiailn-tSreecattieodnaInTim(aTlasblweas1).simCiellalrproliferation in Histopathology tiShetechtiimhomenumsnafotrosxotymaliitnhneedasnsadlimdceeoss.tiinsIsnu(deHiv&bilEdo)ucaklfsoarunsihemidastlfoopfraitnphdroielnopggsairacarteeivopanrleuosafetniPtoCenNdAtio-nsfAtapacpiiennlededintshl1eidiesntweerrperesttaained tToSiufisgns/vguklegee/sdsaeaycn)td.iopanansndocfrhleiiagvshe-rfd,ropsoaemnc26r.e0yaosmi,igna/gnkdga/dtduealstyte)fstefrmreaoalmtem6emnyotongukrneogyuspadsruelwptermreaeselenevtiamnlogunaktcoeendytsrhoials,ntldloogsiwiendgaltoelcyse.ec(tBoia.o0nc3s ctoenrfmoiunnedecttiwhohenestwpheaecsirfoiscrtiantioynteodmfowtrhipethhPoClhoeNgmAiactsoctxhayialnniignnegsaonwbdesreeerovsoeicdnc.uirnrtTihhneegseipnautnrhipemosaslees.toisfsuteisswehviaclhuamtiaoyn awlaess otro `tTwehshetiiccrhuelwsauorluttlsidsssauhleotsewreftdrhoemtihnamttaerlnpeoremstoiagtnnikiofneioycfsantthorecPhtaChneNgAelisveswrteaarinnedinogpbasinnecrtrvheieasdsstiutndisyes.iutehser ftrhoemlifveora, lpsan`cmroenakse,yso,r DISCUSSION i(mInn0od.nst0kh2aeemypgsr/,eksgea/nndtdasytt)hu.edyal,invdcerhliagpnhrdolpiadfonescreea(te2iao.sn0owmfagfs/eKmgma/eldaeasyum)roegndrkoewuiyptsshifanrfteohrm flcoiouvnertrr,woletees(kt0sesmogan/nkdsgt/pudadanyyc)1r,eadslootowufrdmaoamseleee bnidoltoogmiacasatsleepsdasrmtaamhXetieemfrfusenc,ottlooeftirhnacetleutddeestdcomealslteeprraionaldlifoleronawtceirrointd.icoasleenlezvyelmsetloevbeelsu,sheodrimnonaecsh,roannidc otodxeicritsyesatusd)y pTahnecrreeadsi,dansodteatpepremairnetdobbyeparocleilfeprraotliinfgeirantdiivceesrewshpiocnhsewetroetshiemitleastr imnataellriaanlimianlst.he liver, testes or SUMMARY iinnctrheeasperdesienntthsetuldivye,r,cetelstpersoloirfepraantciorne,asasofdemtoenrkmeiynse.d by measuring the proliferating index, was not 002522 CovDarnacfet SCetluldyPrNoluimfberearti6on32R9e-p2o2r2t IL TABLE 002623 `TABLEC1O.CVEALNLCPE RSTOUDLYINFO.E6I3R2N9AM-O2T2N2IKEOYNS en [EEE p Animal Number [11--00mmog/tkagi/doaayy C(oConntiroal [|mT|tioosssiss0|| 2-002 mofa/day 2-002 mafoiday Low dose) |__|losses| (Low dose) | M_|105347| [2---02002mamkaaktalidaayy(ia(Lnowdodsosee))||_u_||l1o0s5s0e45s| [i1=--00mmootkggiiadsayy (CCoannttrool) Tr T+ "108565 | |" 1osser| [[22--00022mmaafngaiioonayy ((LLoowwddoosses)T||+ + | 105364 T tosses | 92--02002mofkmgalfdaaidyay (Hi(ghLowdodsoes)e)||F 'F_[|"i1o0s5s376o9|| Index Liver. index Testes Index. Pancreas ozs 0.087% | ssopmoneT|amsomaoen ]| 0.056%| ie.sw 0.00% | du.s% | esaon | |"sssow | 0.106% | 0.026 | 1t6r.e5%%--T|esesea0oen--|] 0.000%| 0.000 | tia ha samen--] saser--] 0.000% 0.003 | Na ha ener] saeer--] 0.146% | 0.000% | wa nA | | eozow | socom] 02524 } `CovDarnactet SCtluldyPrNoluimfberearti6on32R9e-p2o2r2t APPENDIX I 002625 `CoStudvyNuambenr 6c329.e222 Individual Anidm-awleeHkistCoappastuhloeloTgoyxiFciintdyinSgtsud-yMale Monkeys |E NumE ber| | S|] Paar -- Individual Animad-lweHeikstoCpaaptshuolleogTyoxFiicnidtiyngsSt-udFyemale Monkeys rem os Number oS oss Tor J) Toor TNosignificant findings | Nosinificantfindings |Normz----------, |Nosignificant findings] [No sianificancfincings----| 00R5R6 Cormaet CSetyPotttenienrgr III. SIGNATURE PAGE 4-Week Capsule Toxicity Study with Salt (PFOS; T-6295) in Cynomolgus Perfluorooctane Sulfonic Monkeys (Covance Study Acid Potassium Numb 222) er 6329- `Submitted by: PAIProject Manager: cer THE] Sandra R. Eldridge, Ph.D. Loop Date PAI ProjectPathologist: Carolyn Moyer, D.V.M,, Diplomate, A.C.V.P. nei Date CORGR7 . `DCraftSoCteuldvyPrNoluaimfberenarti6o3c n29R-e2pe2o2r.t IV. QUALITY ASSURANCE STATEMENT 02628 DO] . ala 4 PAatChooloomgfSycp iAensceasApoplcniciatay iotn eIsnteIrmnattoenerlnCoarptoiraotinonal She fc] Cell Proliferation Report A4c-iWdeePkotCaaspssiuulme STaolxtic(iPtFyOS;udyT,-6W2i9t5h) iPnerCfylnuoormooolcgtuanseMoSnulkfeoynisc Covance Study Number 6329-222 QUALITY ASSURANCE STATEMENT f2{Pe8arbooleoesitoMrnedecAeorgnradctmyoaof.nCthoTeephrnedosLjppaeaobttcohihroiaalostonogbsryeyareuPeniptaIosnrcstpiseca(tnGedLacPac)unrreaagtueluartotifooncsbtyirotonhmoufPgtAaIeiGssudlebtiyyshAesseucr2.anEcesrUfanoill(oAAwYiUn))g performed and repareg by the Cc puteato oof Inspection Q086//2274//9988,09108,10/98 08/27/98i08/08,10/98 Phase Inspected DSLatrbuaedlyGiDenagltaPraonfdorRaeiloanteFdapDooycsumentation DatetoF_iMnadinnaggsemReenpto/rted Study Analyst 0086//2276//9988,00/10/98 08/27/38;08/10/08 Ree QO Budasp QualtyRoAssseuAr.aBnicsehoApuditor DegnanienTe1000 Dee 0R629 3M ENVIRC DNMENTAL LABORA' [ORY Protocol - Analytical Study Quantitative Analysis (PFOS, T-6295) in Cyno of Perfluorooctane Sulfonic molgus Monkeys Following Acid PotassiumSalt Administration ofa 4- `Week Capsule Toxicity Study 3MET & SS Study Number:AMDT-041598.1 In-Vivo Study Reference Number: Covance 6329-222 `Test Substance: Perfluorooctane Sulfonic Acid Potassium Salt Sulfonate) C,F,;SO,K"* (POS, T-6295) (PotassiumPerfluorooctane Name and Addressof Sponsor: 3M Toxicology Services Building 220-2E-02, 3M Center St. Paul, MN 55144-1000 Name and AddressofBiological-PhaseFacility: Covance Laboratories Inc. P.O. Box 7545 Madison, WI 53707-7545 Name and Addressof Analytical TestingFacility: 3M Environmental Technology and Services 935 Bush Avenue St. Paul, MN 55106 Dateof Approval by Sponsor: Proposed Analytical Initiation Date: Proposed Analytical Completion Date: 4121198 7/15/98 7/15/99 Author: Glenn Langenburg Study DireCi # fate ford 4 Principal Analytical Investigator @ LBiolsical Firs Sr r efor ee 0630 3/5/55 Date , 10 Purpose TmehtiasbsoltiutdeysisindecsyingonmeodltgouqsuamnotnitkaetyisveolryadlelyteardmmiinneisttheereexdtePnFtOoSf.absorption ofPROS and varioms 42T.h00iCsRFsEtRuGdpUyaLrtwAil7Tl9O2bReaYncCodnoadMpupPclLtiIecadAbNilnCeaEccucrorerndtanEcneviwriotnhmtehnetaElPTAesGtoiongd&LaSbaofreattyory Practice regulations pSrOoPto'csola)n.d methods (see sections 8.0 and 9.0for specific SOP's andmethoSdersvirecleast(edEtTo&SthSi)s 3.0 TesTMATERIALS 3.1 T3e.s1t1, CoAnntarloylt,icaanldRReeffeerreenncceeSSuubbssttanacnec:esPearnfdluMoartoroicctaense Sulfonic Acid Potassium Salt 3.1.2 (GFpSOK" (PROS, Analytical Reference T-6295)) Substance Matrix: Cynomolgus monkey serum and liver tissue 3.1.3 Atinsasluyet(iCcoanltrCoolnttirsoslueS,u1b0s5t34a6n)c.e Matrix: Cynomolgus monkey serum and liver 32 Sourceof Materials 32.1 322 AAnnaallyyttiiccaallRReeffeerreenncceeSSuubbssttaannccee:Ma3trMixI:CPC/oPvCaPncDievRiessieonarch Products (The 323 sAonuarlcyetoifcatlhCeomnotnrkoleySsubwsiltlabnecedoMcautmriexn:teCdovinanthceerRaewsedaartac)h Products. The tissue was from a control animal, 105346. 33 N33u.m1berTeosftTseasmtplaensd Control Samples Number Dose Level & PFOS T 3SMeaxle | Onlly by (mg/kg/day) oe EE 7 Vale | Onllyby E Em]EEErE E] 3 Orally by Collections! = Blood predose (6 days fom dosing), and _ = BLilvoeordtipsrseudeosoen(D6ayda2y9s. From dosing), and +_ = BLlivoeordipsrseudeosoen(D6ayda2y9s from dosing), and Bd coToml sie sWI TyCova, eri i+e odLeivseriSsFsuRe oBn DTay 29S.STor 34 ICdoevnatnifciecaattitohneotfimTeeosftcaonlldecCtoinotnr.ol Samples. Test samples will be identified by 02631 2 35 rPeusrpiotnysiabinlditIyodefnttihteySopfonMsaotre.rials. Characterizationofthe test materials isthe 36 SctoanbdiiltiitoynsofofRaedfmeirneinstcreaMtaitoenriisatlh.e TreessptoinnsgibfiolrittyhoefsttahbieliStpyonosfotrh,e test materialunderthe 3.7 aSmtboireangtetCeomnpdeirtaituornes.foArnaTleystticMaaltererfiearlesn.ceAnmaaltyrtiicceaslwriellfebreenscteorseudbsattaonrcebewlilolwbe stored at approximately analyzed. Test -20C, until and Control esxatmrapclteisonw.ilAlbllerexetcreaicvtsedwialclcboerdsitnogretdo nominally at 4C AMDT-S-10, until 38 tDiimsepopseirtiioodnaosfpSepreGciLmPenrseg.ulBaitoiloong4ic0alCFtiRsspuaersta7n9d2.fl1u9i5dsfwoirlsltubdeiersetlaoinngeedrftorhatnh28redqauyisr.ed 39 aSsasfoectiyatPerdecsaauftetiyonisn.foRremfaetirotno. tEhxeeMractiesreicaaluStaifoentwyhDeantahaSnhdeleitnsgfkornitvheessfuobrstcaunttciensgutsheed for sshaomuplldeamlawtraiycsesb.e wSoafrentywhgleanssweso,rkpriontgecitnitvheecElnotvhiirnognmaenndtaaplprLoapbroiraattoerhy.and protection A4.n0imEaXlPsEwReIrMeENadTmAiLnis-tOerveedrgveilecwapsules orally, daily (7 days/week) for 28 days. Dose levels oF thPiiFsgsOhu-Sedsoiasnmetphrleeescspaewpcsetuirvleeelcyvo)al.rlieeBcdtleo(d0oa,dtt0s.ha0e2m,ptlaienmsdeow2fe.0rsaemcgcroi/lfkligec)cetb(eedDtaawtyere2e9n)g.uglraSoreuirpnastea(rcnvodanltlsriov(les,reeltio3sw.s-3u.d1o)s.e,Liavnedr 2s2hi2pfpoerditnof3orMmaEtiToAnSrSegaforrditnhge tahnealiynt-ilciafle ppoorrttiioonnoofftthhiesssttuuddyy.. See Covance e were Study #CHW 6329- SaTpphpeercotspreroriamaetaten,rdya)lniEdveStrIhteMinSssa(unMeaSwli)ylz,ledborevoietaxhtEerlraecactpteprdroosvpiprariaaayntIeiotoneniczphaantiiirqiounneg/,MmfaeostrshPSoFpde,OcSotrraoonmtdehetorrthymee(rtTfhaonddeams Mass `metabolites. luorochemical L5i.v0erEXtiPsEsRueIaMnEdNTseArLa-wiAlnlalbyetitcaarlgetMeedtfhoordansalysis. Methods are available for extraction and sTaanhamelpylmseeitsahnooafldfyslsiuwsoi.rllocbheemvialciadlastefdrofmorsceyranoamnodllgiuvesrmtoisnskueeyvamraitoruiscaensipmrailormatotroircecson(csuerereantttalcyhwmietnhts). SoDmadwawyes 0000000000000 cDoantcaenwtilrlatbieonroefpofrltueodriadsetpheermtiilslsiuge,raomrsin(mogt)heorfcPleFaOrSly dorefmienteadboulniittse,paesraupnpirtoopfritaitses.ue,Quoarntasitaation 3 02532 rEweyilgelrreabsgeseispoeanrnafdnoarslymtsaeindsd.uasridStndagteivcsiatlaiitcbisrouantssieoodfn, cacuorntvcheesn.dtirTsacthrieeostneisocnfouorrfvtdeihsfefweiPrlrelinntbcediopdaelteInrvmeisnteidgautsori,ngmlaiyneianrclude. simple statistical tests such asStudent's test may be applied to se groups. Ifneceseary, determine statistical diffsence. NinoclfuisniaolnrienpotrhteiwrilflinbalerperpeopratrfeodrfCorHtWhs6s3t2u9d.y2.22A.data package will be provided to Covance for 7.0 MAINTENANCE OF RAW DATA AND RECORDS 7-1 TachceorfdoilnlgowtionAgMrDaTw-dSa-ta8.and records will be retained in the study folderinthe archives 7.11 7.12 AStpupdryovceodmepsrpootoncdoelnacned amendments 7.13 Shipping records 7.14 Raw data 7.15 7.16 Approved Electronic finalreport (original copiesofdata signed copy) 72 1S0upApMoDrtTi-nSg-r8ecwoirldls itnoclbueder,etbauitnendotsenpeacreastsealryilfyrobme the study folder in the archives limited to, the following: according 7.2.1 7.2.2 Training records Calibration records 7.2.3 7:24 SItnasntdraurmdenOtpmearianttinegnaPnrcoeceldougrses, Equipment Procedures, and Methods 7.2.5 Appropriate specimens 8.0 REFERENCES 8.1 82 AMDT-S-1, AMDT-S-2, Chemical Solutions Tracking and Standards Making 83 84 AMDT-S-3, Personnel Training AMDT-S-4, General Lab Documentation Systems 85 86 AMAMDDTT--SS--65,, GGeLnPe-rraellaLtaebd RDeoccourmdesntation Systems 87 88 AMDT-S-7, AMDT-S-8, GLP-related Archives Records 89 8.10 AAMMDDTT--SS-.190,,GSLaPmpPlreogTrraacmkainndg RSeyssptoensmibilities 8.11 8.12 AAMMDDTT--SS--1152,, LAanbaloyrtaitcoarlyMPeratchtoidceVsaalniddaDtaitona Management 813 8.14 AAMMDDTT--S$--1167,, QAunaalliyttyicAaslsuErqaunicpemeUnntitSystems Documentation 002633 4 8.15 AMDT-S-18, Routine Calibration Checksof Balances 8.16 AMDT-S-20, Daily Calibration Checksof Automatic Pipettors 8.17 AMDT-S-21, Annual Calibration Checksof Automatic Pipettors 9.0 ATTACHMENTS 9.1 9:2 FUFsAAiCCnTTg--AMMn--a21l..y0s0iAsEnxUatlsryaicsntigisooHnfPoLFflCPuFoEOrlSoecchtoerromsiOpctrahaleysrMiAannsiLsoivnSeiprceEcFxtltrurooamrceottcsrhuyesmiincgalHPSuLrCfacEtlaencttsrforspormaLyi/vMeasrs 9:3 FSpAeCcTt-rMom-e3t.r0y Extractionof PFOS or Other Anionic Fluotochemical Surfactants from Serum Using Analysis Using HPLC Electrospray Mass Spectrometry 9.4 SFpAeCcTt-roMm-e4t.r0y AnalysisofFluorochemicals in Serum Extracts using HPLCElectrospray/Mass -- 002634 5 3M MEDICAL DEPARTMENT TOXICOLOGY SERVICES EOcc:TJEohE Nn SBA EuRtenThoff From: Marv Case Subject: Covance Study 6329-222 Date: 27 July 1998 On 22 July 1998 when I was at Covance Madison, I reviewed the microscopic liver tissue sectionsofthe monkeys on the 4-week oral rangefinder study of PFOS (Covance study 6329-222). There was no evidenceofcompound-elated effects in the liver even in the High dose animals. Our toxicology consultants had asked the question whetherthe high dose monkeys had any evidence ofliver necrosis or any other microscopic evidence adverse liver effects. The answer is negative. C02635