Document DvGRqjege7aZRmgKnqE9wGmG5

DownloadRandom document
ARI26-0232 MUTAGENICITY TEST WITH T-6357 CORNINGHazleton SLELRN flan 5p - hh Sol IN THE SALMONELLA - ESCHERICHIA COLIMAMMALIAN-MICROSOME REVERSE MUTATION ASSAY FINAL REPORT AUTHOR Timothy E. Lawlor, MAA. PERFORMINGLABORATORY Corning Hazleton Inc. (CHV) 9200 Leesburg Pike Vienna, Virginia 22182 LABORATORYPROJECTID CHV Study No.: 17387-0-409 SUBMITTETDO Building 220-32EM-02 3M Center St. Paul, MN 55144-1000 SCTUODYMPLETIDOATNE April 1,199 CHV Study No.: 17387-0409 000573 Lof 30 `CORNING Hazleton QUALITY ASSURANCE STATEMENT STUDY TITLE: Salmonella - Escherichia coli/Mammalian-Microsome Reverse Mutation Assay ASSAY NO.: 17387-0-409 PROTOCOL NO.: 409, Editio4n `Quality Assurance inspectionsofthe study and reviewofthe final reportofthe above referenced project were conducted according to the Standard Operating Proceduresofthe Quality Assurance Unit and accorditnog the general requirementsofthe appropriate Good Laboratory Practice regulations. Findings from the inspections and final report reviewwerereportedto management and to the study director on the following dates: Characterization of `Tester Strains - 02/14/96 Draft Report Review - 03/16/96 Final Report Review - 04/01/96 02/14/96 03/18/96 04/01/96 C. Orantes S. Ballenger S. Ballenger wu Jbl, Quality Assurance Unit CHV Study No.: 17387-0-409 c00574 #/ fre Date Released 2 CORNING Hazleton STUDY COMPLIANCE AND CERTIFICATION `The study was conducted in compliance with the Good Laboratory Practice regulations as set forth by the Food and Drug Administration (FDA)inTitle 21of theU.S. Code of Federal Regulations Part 58, issued December 22, 1978, (effective June 20, 1979) with any applicable `amendments. There were no deviations from the aforementioned regulations or the signed protocol that wouldaffectthe integrity ofthe study or the interpretationofthe test results. The raw data have been reviewed by the Study Director, who certifiesthatthe evaluationofthe test article as presented herein represents an appropriate conclusion within the contextofthe study design and evaluation criteria. Study Director: sl Timothy E. Jawlor, M.A. Bacterial Mitagenesis Genetic and Cellular Toxicology 4196 Study Completion Date CHV Study No.: 17387-0-409 3 CO0575 TABLE OF CONTENTS `CORNINGHazleton Page No. IL STUDYINFORMATION..........oiiniiiniiiiiiiiiniiiinennninn7n TL MATERIALS ANDMETHODS.........uuiiiniiiniiniiiianiaiiiinnn9. IV. RESULTS AND CONCLUSIONS.........ccouiiniinnniiniininnn.. 23 Vo DATATABLES ........cccuiiiieiineinnmiiiniiniiiieiiiieiiaenennn 26 CHV Study No.: 17387-0-409 4 COGS 76 `CORNING Hazleton SECTION I. SUMMARY INTRODUCTION AND CONCLUSIONS CHV Study No.: 17387-0-409 5 C0577 CORNING Hazleton SUMMARY A. Introduction At the request of 3M, Corning Hazleton Inc. investigated T-6357 for mutagenic activity in the Salmonella-Escherichia colilMammalian-Microsome Reverse Mutation Assay. This assay evaluated the test article and/or its metabolites for their ability to induce reverse mutations at the histidine locus in the genomeof specific Salmonella typhimurium tester strains and atthetryptophan locus in an Escherichia coli tester strain both in the presence and absence ofan exogenous metabolic activation system ofmammalian microsomal enzymes derived from AroclorTM-induced rat liver (59). `Thedosestested in the mutagenicity assay were selected based onthe results of adose rangefinding study using tester strains TA100 and WP2uvrA and ten dosesoftest article ranging. from 5,000 10 6.67 pg per plate, one plateper dose,bothin the presence and absence of S9 mix. The tester strains usedinthe mutagenicity assay were Salmonella typhimurium tester strains TA98, TA100, TAIS35, TAIS37, and Escherichia coli tester strain WP2uvrA. The assay was conducted with five dosesoftest articleinboth the presence and absence of S9 mix along with `concurrent vehicle and positive controls using three plates per dose. The doses tested were 5,000, 3,330, 1,000, 333, and 100 pgper plate in both the presence and absence of S9 mix. B. Conclusions `The resultsofthe Salmonella - Escherichia coliMammalian-Microsome Reverse Mutation Assay indicate that, under the conditionsofthis study, 3M's test article, T-6357, did not cause apositive increase in the numberof revertants per plateofanyofthe tester strains cither in the presence or absenceofmicrosomal enzymes prepared from AroclorTM-induced rat liver (39). CHV Study No.: 17387-0409 6 CO0S78 `CORNINGHazleton SECTION IL. STUDY INFORMATION CHV Study No.: 17387-0-409 7 C00579 `CORNING Hazleton STUDY INFORMATION A. Sponsor: 3M B. Test Article: T-6357 1. Physical Description: clear amber liquid 2. Date Received: 01/16/96 C. TypeofAssay: Salmonella - Escherichia coli/Mammalian-Microsome Reverse Mutation Assay 1. Protocol Number: CHV Protocol 409, Edition 4 2. CHVStudy Number: 17387-0-409 D. Study Dates 1. Study Initiation Date: 01/3019 2. Experimental Start Date: 02/0496 3. Experimental Termination Date: 02/21/96 E. Study Supervisory Personnel Study Director: Timothy E. Lawlor, M.A. Laboratory Supervisor: ~~ Michael S. Mecchi, B.S. CHV Study No.: 17387-0-409 3 COGS80 CORNINGHazleton SECTION III. MATERIALS AND METHODS CHV Study No.: 17387-0-409 9 C00581 CORNING Hazleton MATERIALS AND METHODS `The experimental materials, methods and procedures are based on those described by Ames et al (1975) and Green and Muriel (1976). MATERIALS A. TesterStrains 1. Salmonella typhimurium `auxotrophs TAS, TA1T0h0e, tTeAsLteSr3s5t,raainnsduTsAed15w3e7reasthdeeSsaclrmiobendelblyaAtmypehsimeturailu(m19h7i5s)t.idiTnhee specific genotypesofthese strains are shown in Table I --_---- - TABLE" I.TESTERSTRAINGENOTYPE. S hisGd6 hisC3076 hisD30S2 TAIS3S TAI1537 _TA--100 TA9 LPS Repair a wrB fa wrB R Factor . +R In addition to a mutation in the histidine operon, the tester strains contain two additional r`emsuutlattsioinnstwhehilcoshsoenfhoanneceoftthehier esennzsyitmievsityretsopsonosmieblmeuftoargtehneicsycnothmepsoiusnodfsp.arTthoeftrhfea wall mutation dleifpiocpioelnycsyacicnhcarreiadseesbaprerrimeeratbhialtiftyortmosctehrteasinurcflaacsesoefstofhcehebamcitcerailasl cseulclhwaalsl.thoTsheecroenstualitniinnggcellalrgweall ring systems (i.e. benzo(a)pyrene) that would otherwise be excluded by a normal intact cell wall. `The second mutation, a deletionofthe uvrB gene, results in a deficient DNA excision repair dseylsetteimonwehxitcehndgsretahtlryouegnhhathnecebsiothgeensee,nsailtliovfittyhoeftthesetseer ssttrraaiinnssctoonstaoimneinmgutthaigsednesl.etSiionncaelstohere1quiBre: the vitamin biotin for growth. tShterasiennssiTtAiv9i8tyoafntdhTeAse10s0traailnssotcoonstoamien tmhuetaRg-efnasc.torTphleasmmeicdh,apnKiMs1m0b1y,wwhhiicchhthfiusrtphlearsimnicdreases DinNcrAearseepsasiernpsoitliyvmietyratsoemuctoamgpelnesxhiansvobleveendswuigtghesthteedmitsombaetcbhy-rmeopdaiifryiprnogceasns.existing bacterial CHV Study No.: 17387-0-409 10 CO0582 CORNING Hazleton hTiessttiedrinsetrianindsepTeAndSenacned(pTrAo1to5t3r7opahrye)rbeyvefrrtaemdesfhriofmt hmiusttaigdiennes.deTpeAn1dSe3n5ceis(aruevxeorttreodphbyy)btaose ssuubbssttiittuuttiioonns.mutagens and TA100 is reverted by mutagens which cause both frameshifis and base 2. Escherichia coli described by Green `The tester strain and Muriel (1976). used was the tryptophan auxotroph WP2uvrA as dIenfaidcdiietnicoynwthoiachmuetnahtainocniesntithsesetnrsyipttivoipthyantoospeormoen,mutthaetgeestneircsctoramipnoucnondtsa.inTshaisuvderfAicDiNenAcyraelpaliorws the strain to show enhanced mutability since the uvrA repair system would normally act to remove the damaged partofthe DNA molecule and accurately repair it afterwards. Testerstrain WP2uvrA is reverted from tryptophan dependence (auxotrophy) to tryptophan independence (prototrophy) by base substitution mutagens. 3. Soou f Tesr terc Strae ins a Salmonella typhimurium Bruce Ames, Department of `The tester strains in use at CHV were received directly Biochemistry, UniversityofCalifornia, Berkeley. from Dr. b. Escherichia coli National Collection of Industri`aTlheBatcetseterrias,trTaoirn,reWyP2ReusveraAr,chinStuasteioant,CScHoVtlwanads(rUencietievdedKifnrgodmotmh)e. 4. Stoo fthr eTesa terg Strae ins a. Frozen Permanent Stocks ovemight cultures, adding DMFSrOoz(e0n.p0e9rmmla/nmelnotfsctuolctkusrew)eraendprferpeaezriendgbsymaglrlowaliinqguoftrsesh (0.51.5 ml) at <- 70C. CHV Study No.: 17387-0-409 n 00583 CORNING Hazleton b. Master Plates frozen permanent stock onto mMiansitmearlpalgaatresapwperroepprrieaptealryedsbupyplsetmreeanktiendg weiatchh 1t)esftoerrSstarlamionnferlolma a atmyppihciimlulriinu(m2,5aung/emxlc)e,sstoofehnissutrieditnhee, satnadblbeimotaiinn,taenndanfcoerotfesttheresptrKaMin1s0T1Ap9la8samnidd;TaAn1d002),for Escherichia coli, an excessoftryptophan. Tester strain master plates were stored at 523C. s. `PreopfaOvermiaghttCiultournes a Inoculation Overnight cultures for use in al testing procedures were inoculated by transferring a colony from the appropriate master plate to a flask containing culture medium. Inoculated flasks were placed in a shaker/incubator which was programmed to begin operation (shaking, 125 = 25 rpm; incubation, 37 2C) so thatthe overnight cultures were in log phase or late log phase when turbidity monitoring began. b. Harvest To ensure that cultures were harvested in late log phase, the length of incubatwiaosn determined by spectrophotometric monitoring of culture turbidity. Cultures were harvested once a predetermined turbidity was reached as determined by a percent transmittance (%T) reading on a spectrophotometer. This target turbidity ensures that cultures have reached a densityofat least 0.5 X 10 cells per ml andthatthe cultures have not overgrown. `Owveerergrreomwonve(sdtaftrioomnairny)cucbualttiuorneswmhaeny tehxehitbairtgedtec%rTeasweadssreenasicthievditayntdowseormeepmluatcaegdeants5. &Cu3ltCu.res 6. ConfoifTrestm erSa trat inGi enoo typn es the dayoftheir use in tTheestmeurtastgreaniincciutlytuarsessayw:ere checked for the following genetic markers on a Salmonella typhimurium 1) rfa Wall Mutation demonstrationofthe sensitivity ofthe`Tchueltpurreesteoncceryostfatlheviorlfeat.walAlnmaultiaqtuiootnofwaasncoovnefrinirgmhetd by CHV Study No.: 17387-0409 2 CO0584 CORNING Hazleton cseunlstiutrievoiftyeadcishksctornatianiwnainsgov1e0rulagiodfocnrtyostpallatveisolceotntwaaisniandgdesde.lecSteinvseitmievditiyawaansd daenmaonntsitbiroattiecd by inhibitionofbacterial growth in a zone immediately surrounding the disk. 2) pKMI01 Plasmid R-factor tester strains TA98 and TA100 by demTohnestprraetsieonncoeforfestihsetapnKcMe1t0o1amppilcaislmliind.waAsncaolnifqiuortmeodfafnor `anotviebrinoitgihct sceunlstiutrievoiftcy adicshk cstornatianiwnainsgov1e0rulagiodfaomnptiocpillaltiesncwoanstaaidndiendg.seRleescitsitvaenmceedwiaasand an demonstrated by bacterial growth in the zone immediately surrounding the disk. 3) Characteristic Numberof Spontaneous Revertants vehicle controls that are characteristic`oTfhtehmeearenspneucmtibveerostfrasipnsonwtearneeoduesmornesvterrtaatnetdsbpyerppllaattiengin the 100 pl aliquotsofthe culture along with the appropriate vehicle on selective media. b. Escherichia coli 1) Characteristic Number ofSpontaneous Revertants `vehicle controls that are characteristic`oThfetmheearenspneucmtibveerostfrasipnosnwtearneeoduesmornesvterrtaatnetds bpyerppllaattiengin the 100 ul aliquotsofthe WP2uvrA culture along with the appropriate vehicle on selective media. 7. TesterStrainMedia a Culturing Broth Vogel-Bonner salt solution (Vo`TgheelbraontdhBuosnendert,o g19r5o6w)osvueprpnliegmhtenctueltduwreistohft2.h5e%t(eswt/evr)sOtrxaoinisdwas Nutrient Broth No. 2 (dry powder). b. AgarPlates Bonner minimal medium E (VBogoetltoamndagBaornn(2e5r,ml19p5e6r),1s5uxpp1l0e0memnmtepdetwriithdis1h.)5w%a(sw/Vvo)gealga-r and 0.2% (Wh) glucose. CHV Study No.: 17387-0409 13 C00585 CORNING Hazleton c. Overlay Agar for Selectionof Revertants Overlay (top) agar was prepared with 0.7% agar (w/v) and 0.5% NaCl (w/v) and was supplemented with 10 ml of 1) 0.5 mM histidine/biotin Solution per 100 ml agar for selectionofhistidine revertants, or 2) 0.5 mM tryptophan solution per 100 ml of agar for selection oftryptophan revertants. When S9 mix was required, 2.0 mlofthe supplemented top agar was used in the overlay. However, when S9 mix was not required, water `was added to the supplemented top agar (0.5 mlofwater per 2 ml of supplemented top agar) and the resulting 2.5 mlofdillted supplemented top agar was used for the overlay. This dilution ensured that the final top agar and amino acid supplement concentrations remained the same both in the presence and absence of S9 mix. B LivrMi E Reaction Mi " 1. SH9omogenate Liver microsomal enzymes (9 homogenate) were purchased from Molecular Toxicology, Inc., Annapolis, MD 21401, Batch 0623 (42.4 mgofprotein per ml). `The homogenate was prepared from male Sprague-Dawley rats that had been injected (i.p.) with AroclorTM 1254 (200 mg per ml in com oil) at S00 mg/kgasdescribed by Ames ef al, 1975. 2 59Mix `The S9 mix was prepared immediately prior to its use in any experimental procedure. The S9 mix contained the components indicated in Table I1. HO TABLE II. $9MIXCOMPONENTS070ml IM NaH,PO/Na;HPO,, pH7.4 010ml 0.25M Glucose-6-phosphate 0.02ml 0.10M NADP 0.04ml 0.825M KCl/0.2M MgCl, 0.04ml $9 Homogenate 010ml ------------------------------1--.00 --ml C. Controls 1. VehicleControls absence of $9 mix. Vehicle controls were plated for all tester strains both in the presence and The vehicle control was plated, using a 50 pl aliquotofvehicle (equal to the CHV Study No.: 17387-0-409 14 00586 `CORNING Hazleton maximum aliquotoftest article dilution plated), along with a 100 pl aliquotofthe appropriate. tester strain and a 500 pl aliquot of S9 mix (when necessary), on selective agar. 2. PositiveControls `The combinationsofpositive controls, activation condition and tester strains plated concurrentlywiththe assay are indicated in Table Ill Tester TABLEIIL POSITIVE CONTROLS Cone TStAai%n S9+Mix TA98 TAI0 + TAI0 TAISIS + TAS} TAIS)? + TAS}? WP2orA + WP2wrA Po2s-aimtiinvoeaCnotnhtrraoclene pe2rp5lpagte Z2nitrofluorene 10g 2-aminoanthracene 25pg sodium azide 20ug 2-aminoanthracene 25ug sodium azide 204g 2-aminoanthracene 25g ICR-191 20 ug 2-aminoanthracene 250g 4-nitroguinoline-N-oxide 1.0 pg. a Source and GradeofPositive Control Articles 2-aminoanthracene (CAS #613-13-8), Sigma Chemical Co., purity > 97.5%; 2-nitrofluorene (CAS #607-57-8), Aldrich Chemical Co., purity 98%; sodium azide P(oClAySsci#e2n6c6e2s8-I2n2c-.8)p,urSitiygm>a95C%h;em4i-cnailtrCooq.,uinpoulriintey->N9-o8x%i;deI(CRC-A1S91#5(6-C5A7S-5#)1,7S07i-g4m5a-0C)h,emical Co., purity >99%. 3. SterilityControls a Test Anicle by plating a 50 jl aliquot (the`sTahmeemovsotlucomneceunsterdatinedthteesatsasratyi)cloendisleulteicotnivweaasgacrh.ecked for sterility CHVStudy No.: 17387-0-409 15 00587 CORNING Hazleton bo S9Mix agar. `The S9 mix was checked for sterility by plating 0.5 mi on selective METHODS A. DRosaengefindSitnudgy determined in o`rTdheertgoroawltlhowinthhiebisteolreycetfifoenoctfa(cpyptrootporxiicaittey)doosfetshetotebset taretsitceldeitnotthheemtuesttagseynsitceimtywas assay. 1. Design and WP2usrA both in `tThheepdroesseenrcaengaenfdinadbisnegncsetuodfywSa9smipxe.rfToernmeddosuessionfgtteessttearrsttircaleinwseTrAe1t0es0ted at one plateperdose. concentration of 5 me The per ptleasttea.rticlewas checked for cytotoxicity up to amaximum a Rationale is generally representativeofth"TahteocbysteortovxeidciotnyothfetohteheterstteasrtteirctleraoibnsseravneddboencatuessteerofstTrAaiLn0T0A's100 rceoamdpialryadtiisvceelrynhedigfhrnoummrboeutroinfe esxppoenrtiamneenotuaslrveavreirattainotns. pTerheplEastec,hegrriacdhaitiaocnosliofesctyetortsotxriaciinty can be ``aWnPd2tuhuvsr,Aaddiofefserneonttproasnsgeesosftchyetroftaoxwiacliltmyumtaatyiobne tohbastertvheedS.alAmlosnoe,llthaetcyypthoitmoxuirciiutmy istnrdauicnsedhabvyea mteisxt.arTtihcelreefinorteh,etphriessweonucelodfreSq9uimriexthmatadyifvfaerryengtretaesttlyarftricolmetdhoasteorbasnegrevsedbeinttehseteadbsinenthcee of S9 mutagenicity assay based on the presence or absenceofthe S9 mix. 2. EvaluationoftheDoseRangefindingStudy per plate and/or by a thCiyntnoitnogxiocridtiysiaspdpeetaercatnacbeloefatshaedbeaccrteearsiaelibnatchkegnruomubnderlaowfnr.evertant colonies CHV Study No.: 17387-0-409 16 CO0588 CORNINGHazleton 3. SelectionoftheMaximumDosefor theMutagenicityAssay a No Cytotoxicity Observed the highest doseoftest articleSuisnecdeinnothceytmouttoaxgiecintiyciwtaysasosbasyerwvaesditnhtehseadmoesaesrtahnagtetfeisntdeidnignstthuedy, rangefinding study. B. MutagenicityAssay 1. Design `The assay was performed using tester strains TA98, TA100, TAIS35, `TA1537 and WP2uvrA both in the presence and absence of S9 mix. Five dosesoftest article were tested along with the appropriate vehicle and positive controls. The dosesof test article were selected based on the resultsofthe dose rangefinding study. 5 -- `The tester strains were exposed to the test articleviathe plate incorporation methodology originally described by Ames ef al (1975) and Maron and Ames (1983). This methodology has been shown to detect a wide rangeofclassesofchemical ``mmiuxta(gwehnes.reIanpptrhoepprliaattee)inwceorrepocroamtiboinnemdetihnodmoollotgeyn,atghaertwehsticarhtiwclaes, othveertleasitderosnttroaianmainnditmhaelSa9gar plate. Following incubation at 37 + 2C for 48 + 8 hr, revertant colonies were counted. All dosesofthe test article, the vehicle controls and the positive controls were plated in triplicate. C. PlatingProcedures `mutagenicity `These assay. procedures were used in both the dose rangefinding studyand the Eacatcihvaptliaotnecwoansdiltaiboenlaenddwidtohsea.cTodhee w$h9imcihxidaenndtidfiileudttihoensotefsttharetitcelset, taerstticplheawseer,etepsrteerpasrteradin, immediately prior to their use. `When S9 mix was not required, 100 uloftester strain and 50 pl of vehicle or test article dose r`weaqsuiardedd,ed50t0o 2p.l5omfl$o9fmmioxl,te1n00seullecotfitveestteorpsatgraairn(amnaidn5t0aipnleodfavte4hi5c2leCor).testWahretinclSe 9domsiexwwaass added to 2.0 ml ofmolten selective top agar. After the required components had been added, the CHV Study No.: 17387-0-409 1" 00589 `CORNING Hazleton `mixture was vortexed and overlaid onto the surfaceof25 mlof minimal bottom agar contained in 215 x 100 mm petri dish. After the overlay had solidified, the plates were inverted and incubated for 48 & hr at 37 2C. Positive control articleswereplated usinag 50 pl plating aliquot. D. ScotrheiPlnatges Plates which were not evaluated immediately following the incubation period were held at 5 + evaluation could 3C take until such place. time that colony counting and bacterial background lawn 1. BaB ctea rialckgrLao wnu Evaln uatd ion `The conditionofthe bacterial background lawn was evaluated for 1e0vitdheenvceehoifcclyetocotnotxriocliptlyataendantdeswtaarstircelceoprrdeecdipaitlaotneg. wEivtihdtehnecreoevferctyatnottocxoiucnittsyfworasallscpolraetdesraetlatthiavte dose on Section. the data tables using the code system presented at the endofthe Materials and Methods 2 ComtingR Coloni `The numberofrevertant colonies per plate for the vehicle controls and all plates containing test article were counted manually. The numberofrevertant colonies per plate for the positive controls were counted by automated colony counter. E. AnalysisofData `were calculatedF.orThalel rreespullitcsaotfetphleatsiengcsa,lctuhleamtieoanns arreeveprrteasnetnstpeedripnlattaebualnadr fthoermstianntdhaerdDadetvaiation `Tables Sectionofthis report. EVALUATION OF TEST RESULTS Before assay data were evaluated, the criteriafor a valid assay had tobemet. A Criteria For A Vali The following criteria were used to determine avalid assay: CHV Study No.: 17387-0-409 18 00590 `CORNING Hazleton 1. TesterStrainIntegrity : Salmonella typhimurium a rfa Wall Mutation cultures exhibited sensitivity `To demonstrate to crystal violet. the presenceofthe rfa wall mutation, tester strain b. pKMIOI Plasmid culturesoftester strains TA98TaonddeTmAo1ns0t0raetxehitbhietpedrerseesnicsetoanfctehteo Ra-mfpiaccitlolrinp.lasmid, pKM101, . Characteristic Number of Spontaneous Revertants cultures exhibited a characteris`tTiocdneummonbsetrroaftespthoentraenqeuoiursemreenvterftoarnthsispteirdipnlea,ttehwehteesnteprlsattreadinalong with the vehicle as follows: under selective conditions. The acceptable ranges for the vehicle controls were TA9 8- 60 TAL00 60 - 240 TAIS3S 4-45 TAI537 2-25 2. Tester Strain Integrity : Escherichia coli a. Characteristic Numberof Spontaneous Revertants culture exhibited a characterist`iTco nduemmobnesrtorfastpeotnhtearneeqouuisrermeevnetrtfaonrtstrpyeprtpolpahtaen,whtheentpesltaetredstarlaoinng. with the controls vehicle under selective conditions. was $ to 40 revertants per plate. The acceptable range for the WP2uvrA vehicle 3. TesterStrainCultureDensity oftester strain cultures`wToerdeemgornesattrearttehatnhoatraepqpuraolprtioat0e.5nuxm1b0erbsaocftebraicatpeerriamalreanpdl/aoterdh,atdheredaecnhsietdy 0a.t5arxge1t0lebvaecltoefritaurpbeirdimtly. demonstrated to produce cultures with a density greater than or equal to CHY Study No.: 17387-0-409 19 00591 CORNINGHazleton 4. PositiveControlValues a Positive Control Values in the Absence of S9 Mix mutagen, the mean valueof a pToosidteimvoencsotnrtartole tfhoartatrheestpeesctteirvsetrtaeisntserwsetrreaincaepxahbilbeiotefdiadtenletaisftyiang a 3-fold increase over the mean value of the vehicle controlforthat strain. b. Positive Control Values in the Presence of $9 Mix (59 Mix Integrity) To demonstrate that the S9 mix was capable of metabolizing a tpersotmerutstargaeinnitno tihtes mpurteasgenecneiocftfohrem(Ss)9,mtihexmeexhainbivtaeldueaot fletahsteapo3s-iftoilvdeicnocnrteraoslefoovrearrtehsepemcetainvevalue ofthe vehicle control for that strain. dAenmoancscterptaatbeldebpootshittihveeicnotnetgrroiltyoifntthheepSr9esmenicxeaondf$9thefoarbialistpyeocfiftihcesttersatienrwsatsraeivnatlouadetteedctasahaving mutagen. 5. Cutotoxicity A minimumofthree non-toxic doses were required to evaluate assay data. B. Criteria For A Pesitive R were evaluated Once the criteria as follows for a valid assay had been met, responses observed in the assay 1 TesterStrains TA98 TA100,andWP2uvrA For atest article to be considered positive, it had to produce at least a 2m-efaonldrienvcerretaasnetsinpetrheplmateeaonftrheveeratpapnrtosppreiartpelavteehoifclaetcloenatsrtolo.neThoifsthiensceretaesseteirnstthreaimnseoavnernutmheber of revertants per plate had to be accompanied by a dose response to increasing concentrationsofthe test article. CHV Study No.: 17387-0409 20 C0592 CORNING Hazleton 2. TesterStrainsTA1S35and TA1537 For atest article to be considered positive, it had to produce at leasat m3-efaonldrienvcerretaasntespinetrhpelamteeaonftrheveeratpapnrtosppreiraptleavteehiocfleatcloenatsrtolo.neTohfitsheinsceretaesseteirnstthreaimnseaovnenrutmheber of revertants test article. per plate had to be accompanied by a dose response to increasing concenirationsofthe RECORDS TO BE MAINTAINED All raw data, documentation, records, the protocol, and the final report generated as aresult of tfhoilsloswtiundgy wsiulblmibsesairocnohifvtedheinfitnhaelsrteoproargtetfoactihleitSipesonosfoCro.rnAiftnegrHtahzeloetnoenyIenacr.pfeorrioatd,letahsetSopnoenyseoarr `may elect to have the aforementioned materials retained in the storage facilities of Corning Hazleton Sponsor. Inc. for an additional period of time or sent to a storage facility designated by the REFERENCES Ames, BN., J. McCann, and E. Yamasaki. Methods for detecting carcinogens and mutagens `with the Salmonella/Mammalian-Microsome Mutagenicity Test. Mutation Research 31:347-364 (1975). Brusick, DJ, V. F. Simmon, H. S. Rosenkranz, V. A. Ray, and R. S. Stafford. An evaluationofthe Escherichia coli WP2 Mutation Research 76:169-190 (1980). and WP2uvrA reverse mutation assay. Green, MH.L. and W. J. Muriel. Mutagen testing using rp" reversion in Escherichia coli. Mutation Research 38:3-32 (1976). Maron, D.M., and B. Ames. Revised Methods for the Salmonella Mutagenicity Test. Mutation Research 113:173-215 (1983). Vogel, HJ, and D.M. Bonner. AcetylomithinaseofE. properties. J. Biol. Chem. 218:97-106 (1956). coli: Partial purification and some CHV Study No.: 17387-0409 21 C00593 CORNING Hazleton BB ACTEA RIALCKGLR AWNO EVALU UATIN ON CD ODE ``Tmhiecrcoosncdoiptiicoanlolyft(uhseinbgacakdgirsosuecntdinbgacmtiecriraolscloapwen)ifsoervianlduiactaetdiobnostohfcmyatcortoosxciocpiitcyalalnydatnedst article precipitate as follows: CODEDEFINITION 1 Nomal CHARACTOEF BRACIKGSROTUNID LCAWSN A healthy microcolony lawn. 2 ReSldiughcteldy Aincnroetaisceeaibnltehtehsiinzneionfgtofhtehmeicmrioccroolcoonlioesnycolamwpnaraenddtaonthe vehicle: control plate. 3 ReModduecreadtely Aincmraeraskeedintthhiennsiinzgeoofftthhee mmiiccrrooccoolloonniyeslacwonmpaanrdeadnto the vehicle control plate. 4 REexdturceemdely Ainncreexastereimnethtehisninzienogofftthheemimcircorcoocloolnioensy cloamwpnaarneddatno the vehicle control plate. 5 Absent A complete lack ofany microcolony lawn. 6 PrOebcsicpuitraetdeby Tevhaelubaatcekdgdruoeuntdo bmaicctreorsiaclopliacwnancda/nonromtabceroascccoupraitcelteyst article precipitate. Efovlildoewnicnegopfrmecaicpriotastceocpoidcetetsottahreticcoledeprnecuimpbitearteusoendtthoeepvlaaltuesaties trheecocrodnedditbiyonaodfdtithieonboafctkhgeround bacterial lawn. sp PrSelcigihptitate Nhootwiecveearb,lethmeapcrreocsicpiotpaitce pdroeecsipniottatienfolnuetnhceeplaautteo,mated countingofthe plate. mp PrMeocdiepriatattee ``Twhoeuladmionutnertfeorfemwaictrhoasuctoopmiactperdecciopuinttatiengo,ntthhuesprleaqtueiring the plate to be hand counted. hp PrHeecaivpyitate pTlhaetelmaragkeeasmtohuenrteoqfuimraecdrhoasncdopciocunptriecnigpidtifaftiecuolnt.the wExhaimcphlhea:d4tmopbewcoouulndteinddmicaantueaallpyladtueeobtosetrhveemdatrokheadvaemaonuenxttorfemmealcyrorsedcuocpeidc bteasctkagrrtioculned lawn precipitate. CHV Study No.: 17387-0-409 2 00594 `CORNING Hazleton SECTION IV. RESULTS AND CONCLUSIONS CHYV Study No.: 17387-0-409 23 C00595 CORNINGHazleton RESULTS A. TestArticleHandling lots 336 and The 337) test article, T-6357, was was used as the vehicle. stored at room temperature. Deionized At 100mgper ml, which was the most water (CHV concentrated rsteomcakindeildutaisoonlpurteipoanriend,altlhseutcecseteadritincglediflourtmioendsapcrleepaarrecdolfoorrletshse smoultuatgieonn.iciTthyeatsessatya.rticle B. Dose RangefindingStudy thedose Doses to rangefinding be tested inthe mutagenicity assay were study conducted onthetest article using selected based on the results tester strains TA100 and of aWrtPic2leu,rfAroimn5b,o0t0h0tthoe6p.r6e7seingcpeearnpdlaatbe,sewnceereofteSs9temdainxd(tohnee prleastuletpsearrdeosper)e.senTteend dinosTeasbolfeste1stand t2.heTphreesseendcaetaorwaebrseegnecneeroatf$e9d minixExapseerviimdeenntce1d73b8y7-aA1n.ormNaol bcyatcoktgorxoicuintdylwaawsnoabnsdernvoeddeicnreeiatsheerin the numberofrevertants per plate. C. MutagenicityAssay data were gen`eTrhaetemdutiangeEnxipceirtiymeanssta1y7r3e8s7ul-tBs1f.orTTh-e6d3a5t7aaarree pprreesseenntteeddiansTmaebalensr3evaenrdta4n.sTpheerse cploautnets (sTtaabnldear3d),deviation for each treatment and control group (Table 4) and as individual plate m`Tuhteagreesnuilctistoyftahsseayd.osTehreandgoesfeisntdeisntgedstwuedryew5e,r0e00u,se3,d3t3o0,se1l,e0c0t0f,iv3e3d3o,saensdto10b0e tested pg per in the plate in both the presence and absenceof S9 mix. tIhneEnxupmerbiemreonftre1v7e3r8t7a-nBts1p(eTrabpllaetse3wearned o4)b,saelrlvdeadtawiwtehraenaycocfetphtaeblteesatenrdsntroaipnossietiitvheerinincrtehaeses in presence or absenceof S9 mix. All criteria for a valid study were met. CHV Study No.: 17387-0409 2 00596 `CORNING Hazleton CONCLUSIONS A`TshsearyesuilntdsiocfattehtehaSta,lumnodneerlltahe-cEosncdhietriiocnhsoiaftchoilsi/sMtuadmym,a3lMi'asn-tMesitcarrotiscolme,eTR-e6v3e5r7s,edMiudtnaottiocnause a pporseisteinvceeionrcraebasseenicnetohfemniucmrboesromoaflreenvzerytmaenstsppreerpaprleatdeofrfoamnyAorofctlhoerTMte-sitnerdusctreadinrsateiltihveerr i(nS9t)h.e CHV Study No.: 17387-0409 25 00597 `CORNINGHazleton SECTION V. DATA TABLES CHV Study No.: 17387-0-409 26 COCH98 `CORNING Hazleton is 1 PT -- Test ARTIOLE TD: T-6357 Exes 1730471 DATE PLATED: 04-Fab-36 VEHICLE: Detontzed vacer DATE count: 07-7ab-96 -------------------------------- TAL00 REVERTAVES PER PLATE variate SRERVEaRTCtTansGRsOaLolRnooDn AREVTEARTTTiens yomLREaaRnoonn (50 p1) Sout daoriegin 97 1 1s 2 102 1 as 1 10.0 o 2 us 1 53.3 12 s o 3 66.7 108 ' a + 100 108 2 os 1 533 " 1 102 1 or 12s ) 06 2 1000 156 : 0 : 3330 1a 1 10 : e s000 m 155 r 1 e 10s 1 "quant so se iy ementrs srotae--nt -- To Ai as psr istts 0 totetvae377rmpereenettsette CHV Study No.: 17387-0-409 27 00599 `CORNINGHazleton mos 2 DosE RANGEFTOTNG STUDY Test ARTIS 1D: 7-357 [Er ---- DATE PLATED: 04-Fab-56 ------VE-- NICLB--: -- Deton-- ized -- vater----------DAT-- E co-- ur:--07---eb---96 -- Vesuve RaVERTANS PER PLATE papas E soitne a svAELbnAmIOlN e sTaetne saEtaan .00Ga(vsehh)icle 1 3 u 3 Test Arotiecle 1 ' 2 + 10.0 26 1 1 ' 3.3 n ' 1s 1 c6.7 n ) 1s 3 100 1 2 2 : 333 2 : 2 1 cr n : is 3 1000 n \ n 3 3330 1 2 1 3 e s000 r 1 : r ws : Tr Stn Sas nity soto Jotun T--N--N -- 3 = mederacely reduced TES a CHV Study No.: 17387-0-409 28 00600 CORNINGHazleton TEST ARTICLE ID: EXPERIMENT ID: DATE PLATED: DATE COUNTED: T-6357 17387-B1 14-Fab-96 21-Feb-96 MUTAGENICITTYABALSESA3Y INDIVIDUAL PLATE CROEUSNUTLSTS VEHICLE: Deionized water PLATING ALIQUOT: 50 yl -- comes mee awe wasn muon woe ----------------eeeeeeee TAIOO TASS 2-Iu-saisntonmonmcchheraacceennes 23..53 ppaa//ppllaattee eee TTAAIOLOS ssooddiiuumm aasritddee 22..00 ppalpalatcee * Ba+ c=kgrnoournmdalLawn Evaluation Codest 2= altanely reduced = alighe precipitate wp = m(ordaeqruaitzeasprhaencdipciotuantte) 3 = moderated reduced Pe = h(eeaovqyutrpernechtaincdacceoune) CHV Study No.: 17387-0-409 29 0050 CORNINGHazleton MUTAGENICITTYABLAESSA4Y RESULTS SUMMARY TEST ARTICLE ID: T-6357 EXPERIMENT ID: 17387-B1 DATE PLATED: 14-Feb-96 VEHICLE: Deionized vater DATE COUNTED: 21-Feb-96 PLATING ALIQUOT: 30 pl mum me ie mon mw wen _---- W41030335 a3snmiimnoossnntthhrraacceanne 13..53 ppaallppaattee "THB125u3v7eh 23aanniimmoossnnthcrharcaannae 352..03 paallpptieantee TTHhI6s0 saaottitoonn assuiidtee 2+.o0 fwapripeieseee fWPaeuvek benteeoquinobine Nooxtda 21..00 w1a/rpriaeceee A[=pxtcreeney ceded or = lhe peecipiente Tpe ayttr cats up = sCoedaeurarteesprhaacdtpistoamsse) 5 == nCohdeuccuarteadlbyycpadrveccaidpice [SstoGnosnpeobseihvaindincyoun) CHV Study No.: 17387-0-409 30 C0502