Document 99OD9nGqbL4n9n0KBEkOa9x77

DownloadRandom document
. SRPT 636 AR226-1527 Study No. T-6316.9; DT21 Fluorochemical (FC) Levels in Naive Rats Final Report, Revision A January 09, 2002 IInn--LLiiffee EStnadrtDDaattee::JJuullyy288,, 11999988 Study Location: 3M Strategic Toxicology Laboratory Corporate Toxicology 3M Medical Department 3M Center, Building 270-SB-314 St. Paul, MN 55144 RECEIVED OPPT NCIC Study Director: Deanna J. Luebker, M.S., Advanced Research Toxicologist 3M Medical Dept. / Corporate Toxicology 3M Center, Building 220-2E-02 Saint Paul, MN 55144 Ph: 651-737-1374 FAX: 651-733-1773 2003 OCT-6 PM 12:27 Sponsor: 3M Corporate Toxicology 3M Center Building 220-2E-02 St. Paul, MN 55144 . Research Client: 3M Specialty Chemicals Division 3M Center Building 236 St. Paul, MN 55144 } TIF 1280 Page 10f23 : DT21; T-6316.9 FinalStudyReportRevision A 01/09/02 Purpose of Revision: `The purpooftshies revision is to incoalrdatpaavaoilarbleatodtateeon the Naive Rat Study (T-6316.9) and the rat chow/fishmeal analysis. `This includes data reported in the initial final Naive Rat Study report written by Corporate Toxicology in 1998 (1), a summaryreporton the liver PROS levels written by 3M Environmental in 1998 (Appendix 1), and a summaryreportofthe liver PROS levels and rat chow/fishmeal analyses written by 3M Environmentialn 2001 (Appendix 3). Study Background: In an attempt todeterminethesourceof low-level PFOS body burden foundincontrol rats involved in some 3M contract dietary studies, a comprehensive plan with the following objectives and responsibilities was designed: Ohbjeoctiuarv1eeas-oTfotihiencvnuesrtrigegnattedpioetteanrtyisatlusdoiuesrcoensopfercfolnutoarminiantaetditoenstwcitohmipnotuhnedsstuadty Covance Madison. Andrew Seacat was appointed study directorwithMarvCase as alternate. Jim Wolters, 3M Environmental, is responsible for coordinating and conducting direct air monitoring and wipe samples. OPbFjOeSctsieev2nei-nTcoondtertoleramtisneiniftchoenttwaom-iyneaatriodinoetfafryeesdtuidsyloefadNi-nEgtthoylthFeOlSowElevels of conducted at Covance Madison. Andrew Seacat was appointed study director with Marv Case as altemate. Objecti3v-e To investigatethebackground serum and liver PFOS levels in naive ratsofdifferent age groups from different sources. Information on the various diets supplied by the different vendors is to be obtained. Deanna (Nabbefeld) Luebker was appointed study director withMarvCaseas altemnate. `taOibnjteecdtfieve4de,-eTxopoisnuvreestiingartaettrhoeopmossosirbialcitytohatmPRbOSoifebxonptohsa.uMreatrisvsCitaesomemwinnagsfrom appointed study director. 3M Environmental Analytical Laboratory was deemed responsible for chemical analysis of samples gathered in objectives 1-4. `The study to examine objective 3 is complete and is the focus of this report. Once data addressing each objective are available, reports of the various studies will be generated. Report Summary: `The purpose of this study was to assess "endogenous" levels of fluorochemicals (FCs) in untreated Sprague Dawley rats of three different age groups acquired from three different breeders to determine what perfluorooctane sulfonate (PFOS) levels, if any, were present. Each vendor was contacted to provide information on the feed provided totheirrats while at their facilities. Levels of PFOS in the rodent feed supplied by the different vendors and in fishmeal were determined. . Page20f23 * DT21; T-6316.9Final StudyReportRevision A 01/09/02 `The liversofmale and female untreated SpragueDawley rats 6-8 weeks old, 10-14 weeks old, and approximately 9-12 months old (old retired breeders, ORB) from Charles River, Harlan,andTaconic Farms Laboratories were examined for iver PFOS levels. Male rat liversfromCharles Riverand Taconic Farms test animals showed significant endogenous levelsof PFOS that roughly correlated with age. Livers collected from the oldest group of `maleratsfromTaconic Farms contained significantly more PFOS than any other group in the study. The liversofthe female rats from Charles River and Taconic Farms contained very consistent levelsof PROS, showing no correlation with age. The livers of test `animals from Harlan did not contain PFOS above the limit of detection (1S ng/g). Based on these data, PFOS had bicaccumulated to a much great degree in male Charles River and Taconic Farms than in female rats from the same vendors. This difference may have been a result of PFOS being released in themilkand/ortransferred in uterotothe pups in females that had bore and nursed multiple litters. Female ratsmayalso more readily excrete PFOS through urinary excretion thanmalerats. Results of the vendor feed/diet history survey revealed that fishmeal wastheprimary ingredient in feed supplied to `Taconic Farms rats and the Sth listed ingredient in feed providedto Charles River rats. Fishmeal was not listed as an ingredient feed supplied to Harlan rats. Detectable levels of PFOS were found in samplesofthe chow fed to both Charles RiverandTaconic Farms rats. NoPFOS couldbedetected in chow provided to Harlan rats (fishmeal free). Analyses of fishmeal (six types arising from a minimum of 3 kinds of fish) suggest that it may be the source of PFOS in the chow. `To definitively make this conclusion, analysis of theactual fishmeal incorporated into each of the chow samples analyzed is required. Another possible source of PFOS is the paper coating used in feed bags. Further information on feed packaging may be gathered in a future study. Methods: `This study was performed in the 3M Strategic Toxicology Laboratory under adefined protocol (2). All in-life procedures were approved by the 3M Laboratory Animal Review Committee (3M LARC). `Thirty Sprague Dawley rats, fivemaleand five female fromeachofthe following age `groups: 6-8 weeks old, 10-14 weeks old, and ~ 9-12 weeks old (old retired breeder, ORB) `wereordered from Charles River, Harlan, and Taconic Farms. Each vendor was asked to provide the name of the feed provided to their rats, name and location of feed vendor, feed ingredient list and information on feed packaging. All animals remained in their shipping containers between arrival at 3Mandenthanization. No food or water, other than that provided in the shipping containers, was furnished. Within one hourofarrival at 3M, rats `were weighed, grossly examined, and euthanized by CO,asphyxiation. Sera and liver `were harvested and sent to Kris Hansen, 3M Environmental Laboratory - Fluorine Analytical Chemistry Team (FACT), for PFOS analysis. Liver specimens were analyzed as described in the Experimental Section of Appendix 1. `Sera samples have not been analyzed but will be retained for possible future analysis. Statistical analysis to detect significant differences (p<0.05) in liver PFOS concentration Page30f23 +* : DT21; 6316.9Final StudyReportRev0i1s/0i9o/n0A2 between age groups, sexes, and vendors in the Charles RianvdTaeconric Farms rats was `performed using a one-tailed, homoscedastic T-test. The rate of change in PFOS levels (ppbiweek) was estimated by dividing the change in PFOS concentration by the number of weeks evaluated (approximately 38.5 weeks). Rat chow from eachofthe vendors and fish meal (six types arising from a minimumof3 kindsoffish) were analyzed for POS concentrations as described in Appendix 2. Results: In life data including body weights, liver weights, and liver/body weight ratios as well as liver PFOS concentrations can be found in Tables 1-3. Detailed resultsofthe FC analysis, including graphs and a full data table, can be found in Appendix 1. Liver PFOS levels in CharlesRivermale and femalerats at 6-8 weeofkagse averaged 43.04.07 and 66.6 19.27 ppb, respectively. At 10-14 weeksofage, liver PFOS levels inmaleand female CharlesRiverratshadincreasetdo103.0 21.33and 79.9 12.06 ppb, respectively. Liver PROS levels in Charles River male and female ORBs were 145.0 +1242 and 67.8 + 29.63 ppb, respectively (Sec Table 1 and Appendix 1). LiverPFOS levienlalslHarlanratswerebelowthemethoddetectionlimitof 15ppb (See Table 2 and Appendix 1). Liver PFOS levels in Taconic Farms male and female rats at 6-8 weeksofage averaged 60.2 12.21 and 73.0% 12.29 ppb, respectively. At 10-14 weeks of age, liver PFOS levels in male and female Taconic Farms rats had increasedto92.2 +2275 and 75.7 + 24.40 ppb, respectively. Liver PFOS levels in Charles River male and female ORB were 327.0 115.37 and 65.6 + 27.24 ppb, respectively (See Tabl3e and Appendix 1). `The average rate of change in PFOS liver concentration for male and female Charles River rats from week 7 toweek45.5 was estimated to be approximately 2.6 and 0.031 ppb/week, respectively. The average rate of change in PROS liver concentration for male and female `Taconic Farms rats over the same time-period was estimated to be approximately 6.9 and-- 0.19 ppbiweek, respectively. Results of the T-test are included in Table 4. The change in liver PFOS concentration between age groups in male Charles River and Taconic Farms rats was significant at all timepoints (p <0.05). Livers from CharlesRivermale rats contained significantly more PFOSatall age groups than did livers of Charles River female ratsofthesameage group. Liversofmale Taconic Farms ORBs contained significantly more PFOS than livers of female Taconic Farms ORBS. Livers ofmale Taconic Farms 6-8 week and ORB rats contained significantly higher PFOS concentrations than did male Charles River rats of the same age groups. Page dof 23 : DT21; T-6316.9FinalStudyReportRevision A 01/09/02 VendorFeed/DietSurvey ICnhtaerrlneastiRoinvaelrInrca.t,s BarreenftewdoPoMd,IMSOL.79PRMatIafnededMoisupsaeckDaigeetdsuipnpplaipeedrbbyagPsMIcoNautterdiwtiiotnh a papercoating Intemational material produced Inc., are as follows: by 3M. The feed ingredients, as listed by PMI Nutrition BgrHoAu,ndfiysehllmoewalc,oaml,fawlhfaeamteamli,dcdalniengmso,lassosyebse,ancamlecailu,macnairmbaolnaftate,prsaelste,rved with cyanocobalamin (source of vitamin B-12), biotin, DL methionine, calcium pvainttaomtihnenAataec,etfaotlei,cdaic-iadl,prhiabotfolcaovpihne,rcyhlolaecceatlactief(esrooulr(cseooufrcveiotfamviintaEm),inthDi-a3m)i,n, `mmaegnnaedsioinuemdoixmiedteh,yslpordiimuimdisneloelnibties,ulnfiictoet(insiocuracceido,fpvyirtiadmoixninKe ahcytdirvoictyh)l,orsiidliec,on fdeirorxoiudse,ccarablocniautme,iozdiantce,sumlafnatgea,nzoiuncsooxxiiddee., copper sulfate, cobalt carbonate, `HTaerkllaadn,rMatasdiarseonf,edWHIa.rlTaenkTleakdlfaededLMisa-l4s8o5pMacokuasgee/dRaitnpSatepreirlibzaagbsl.e DIitetissuunppklnioewdnbyatHtahrilsan time, however, ingredients, as whether ornotthese listed by Teklad, are bagsarecoated as follows: with a 3Mmaterial. The Teklad feed sgoryobuenadncooiml,,csoomybgelauntemneamle,alg,rocaulncdiouamtsc,arwbhoenaattem,idddilcianlgcsi,umalpfhaolsfaphmaetael,, Db-raecwteirvsatderdieadnyiemaaslt,siteordoilz(esdosuarltc,eLo-flyvsiitnaem,iDnLD-)me,thviitoanmiinne,EvsiutpapmlienmAe-natc,etnaiatcei,n, c`maelncaiduimopnaentsootdhieunmatbei,surlifbiotfelcavoimnp,ltehxia(msionurmcoenoonfivtirtaatmei,npKy)r,idfooxliinceachiydd,robcihotlionr,ide, cvoiptapmeirnBsu,l;fatseu,ppzlinecmeonxti,dec,aclaclicuimucmaribodoantaet,e,combaanltgacanrobuosnaotxei.de, ferrous sulfate, `TTacAoCn#i3c1.Faisrpmascrkaatgseadreinfead"TcoAmCme#r3c1iaRloldyeanctcDeipettasbul3peplpileydlbaymiZniaglteerd Cpaop,erGabradgn"e.r,ItPiAs. uinnkgnreodwiennatstitnhiTstAiCm#e3w1h,etahselriostrednboyt Zai3glMemraCtoe,riaarleaiss ufsoeldlionwst:hesebags.Thefeed gfriosuhnmdea#l2, yseolylboewancommea,lg,raolufanldfawmheoalle,ocatosm, wghluetaetnmmiedadll,inggrso,uBnrdewwheorl'es wdrhieeadt,yeast, soybean oil, salt, dicalcium phosphate, ground limestone, vitamin and mineral remixes. RoFed edPFe OSAn nalyt ses Page Sof 23 Le DT21; T-6316.9Final StudyReportRevision A 01/09/02 PMI Lab diet, fed to rats obtained from Charles River contained approximately 18 ng/g PFOS. Rodent dietfrom Zigler, fedtorats purchasedfromTaconic Farms contained approximately 12 ng/gof PFOS. Tekladrat/rodentdiet, fed toratsobtained from Harlan (fishmeal free), didnotcontain PFOSabovethe limit of quantitation (LOQ) (see Appendix 2). `FishMeal PFOSAnalyses Six types of fishmeal arising from at leastthreetypes of fishwereanalyzed for PFOS (see Appendix 2). PFOS was detected in 50%ofthe fishmeal samples analyzed. Itis not known, however, what type of fishmeal was incorporated into the various rat chows. Therefore,itcannotbedefinitively concluded that fishmeal is the source of PFOS in the rat chow. Analysis of the actual fishmeal incorporated into the chow is required to provide a direct link. Conclusions: Basedonthesedata, PFOShadbioacctouammucuh glreaatdtegreeedinmalerats from CharlesRiverandTaconic Farmsthaninfemaleratsfromthesesamevendors. This differencemayhavebeen a resultof PFOSbeingreleasedinthemilkand/ortransferriedn utero to the pups in females that had bore and nursed multiple litters. Female rats may also morereadilyexcrPeFtOeSthroughurinaryexcretionthanmalerats.Theliversoftest animals from HarlandidnotcontainPFOS above thelimitofdetecti(o1n5 ng/g). Results of the feed analyses revealed detectable levels of PFOS in samples of the chow fed to both Charles River and Taconic Farms rats. No PFOS couldbedetected in chow provided to Harlan rats (fishmeal free). Analyses of fishmeal (six types arising from a minimum of3 kinds of fish) suggest that it may be the source of PFOS in the chow. To definitively `make this conclusion, analysis of the actual fishmeal incorporated into each of the chow samples analyzed is required. Another possible sourceof PFOS isthepaper coating used in feed bags. As stated in the results section, 3M suppliespapercoating to PMI, the `manufacturer of Charles River PMI chow. It is not known, however, if Harlan and Taconic Farms feed suppliers also use 3M material in their bags. Further information on feed packaging may be gathered in a future study. Page 60f 23 DT21; T-6316.9 Final Study Report Revision A 01/09/02 List of Tables: 1) Charles River In-Life and Liver PFOS Data 2) Harlan In-Life and Liver PFOS Data 3) Taconic Farms In-Life and Liver PFOS Data 4) T-Test Results (p values) - Charles River and Taconic Farms Age, Sex, and Vendor Liver PFOS Comparision. Page 70123 DT21; T-6316.9 Final Study Report Revision A 01/09/02 [Body wt(g) iver wt/ [PFOS Liver Conc. (ng/g or ppb), [bodywt [individual _|ave [stdDev craresT 1 1 TTTTT T | river R1 [c8wks | 171.7] 830] 0.04 "3085 43.0] R2 o8wks | 179.6] 830 0.04 488) R3 o8wks | 161.5) 7.05] 0.044 426) R4 le-8wks | 151.6] 6.60 0.04 39.5] RS o-8wks | 166.8) 8.08] 0.048 411 R6 [F[6owks | 173.7] 8.69] 0.050] 549] 66.6 R7 [F [e8wks | 1683 7.13) 0.042] 62.) Re [F [6-8wks [165.1] 7.46 0.045] 65.4 Ro [F [68wks | 1417] 491] 0.033] 99.6] RIOJF _[6-8wks | 1507] 647] 0.041 51.2) RIM [10-14wks| 524.3] 10.55 0.039) 100.0} R12M [10-14wks| 367.9 12.66) 0.034] 140 RIBIM [10-14 wks| 356.7] 13.10 0.037] 96.8) Ri4IM [10-14 wks| 358.5] 13.23 0.037] 878 R15[M [10-14 wks| 365.6] 13.65] 0.037] 904 [CRi6[F [10-14 wks| 226.1] 10.49] 0.046] 722] 799) lor17[F [10-14wks| 199.5 6.32] 0.032] 939) lcR18[F [10-14 wks| 203.4 6.13 0.030] 71.4] ICR1s[F [10-14wks| 196.4f 7.14 0.036] 922) jcR2o[F [10-14 wks| 209.8] 7.08] 0.034] 696 [CRzilM `ORB | 4062] 9.75] 0.024] 131.0] 2 cream |orRB 3423 10.09 0.029) 133.0) lcRza[m [ore 395.1 10.83 0.027] 151.0) |cR24[m [oRB 3637| 9.24 0.025 149.0) |cRzs[m__|ore 460.2] 1393 0.030) 160.0} [CRzs[F [ore 3942 12.70 0.032] 1190] 67.9) lcrz7[F [ore 4125) 16.09 0.039) 67. lcR2sF [ORB 4829) 14.80 0.031 45.0 lcReo[F [ore 485.3) 14.96 0.031 55.5] lcRsolr_jore 4242] 1134] 0.027] 53.0) "ORB = oid retired breeders [* Outlier- not used in calculations. [Method detection limit (MDL): PFOS = 15ng/g or ppb Page 8.0f23 : DT21; T-6316.9FinalStudy ReportRevision A 01/09/02 [AgeGrp. [Body [Liver wt(0) [wt (g) PFOS LiverConc. (ng/gorppb) individual _|Ave [stdDev 1 T_TTT T AT [68wks | 198.4] 9.45 0.048] IH2 6-8wks | 201.7] 9.34] 0.046] [Ha 6-8wks | 2034) 850] 0.042] [Ha 6-8wks | 2039) 838 0.041 IHs 6-8wks | 204.2] 9.17] 0.045) [He |F_[c8wks | 2143 7.62 0.03] 7 |F [68wks | 2080] 7.19] 0.005] He |F [68wks | 2128) 7.4] 0.004] Ho |F [68wks | 2003) 7.30] 0.05] H10 JF [6-8wks | 2090] 8.08] 0.039) [FT 10-14 wks| 300.6] 10.69] 0.036) [H12 10-14wks| 307.9f 12.33 0.040] [H13 10-14wks| 304.0f 11.28) 0.037] [H14 10-14 wks| 209.6] 10.09) 0.034 [H15 10-14wks| 306.0f 11.38] 0.037] [H16 [F [10-14wks| 237.7] 6.65] 0.028) H17 [F [10-14 wks| 241.1] 7.20] 0.030] H18 |F [10-14 wks| 230.7] 7.14] 0.00) H19 |F [10-14 wks| 236.3] 8.54) 0.036] 20 |F [10-14 wks| 2334] 7.33) 0.031 [FT [FORE | 470.7] 17.00] 0.036] [H22 ors. 4628] 14.50 0.032) IH23 ORB 446.6] 15.55 0.035 [Hoa lore 4582] 1452 0.032] [Hes oRB. 4789] 11.19] 0.023 [Fs [F_ [oR 337.8] 10.45] 0.031 He7 [F [ors 3262| 1027] 0.031 Hes [F [ore 2857) 854 0.030) Heo [F |ORB 2862| 9.01] 0.031) Hao [F [ors 306.9] 11.00] 0.036] 1 1| MDL| <MDL| <MDL] <ML| <MoL| <MDL] MDL] <MDL] <MDL <ML| <ML| <MDL| <MDL| <MDL| <MDL| <MoL| <MDL| <MDL| <MDL| _<MDL| <MDL| <MDL| <MDL| <MDL| MDL] <MDL| <MDL| <MDL| <MDL| <MDL| MDL] <MDI <MDL| <MDL| <MDL{" <MDL] |* ORB = old retired breeders [Method detection limit (MDL): PFOS = 15ng/g or ppb Page 9.0f23 DT21; T-6316.9 FinalStudyReport Revision A 01/09/02 meme [FARMS [Body [Liver PFOS Liver Conc. (ng/g or ppb) [ 1 T1 1 TT | wt(9) |wt (9) individual |Ave [Std Dev. F1 [6-8 wks 2002] 9.64] 0.048 63.6} 12.21) F2 16-8 wks 202.4] 10.18] 0.050) 63.0} F3 16-8 wks 184.1] 9.28) 0.050) 47.7) F4 16-8 wks 187.5 10.26 0.055 49.2 F5 16-8 wks 1836 9.34] 0.051 77.5| F6 |F [6-8 wks 201.2] 9.73] 0.048 67.0| 9) F7 [F [6-8 wks 189.9 8.40 0.044 89.3 8 |F [6-8 wks 1725) 9.40] 0.055 78.8] 9 |F [6-8 wks 207.9) 10.28) 0.049 73.2 F10|F [6-8 wks 199.5| 10.54] 0.05 56.6] F11 [10-14 wks| 454.3] 17.97] 0.040| 86.5] 22.7 F12 10-14 wks| 334.6] 13.07| 0.039 54.7] F13 10-14 wks| 459.9] 17.65 0.038] F14 10-14 wks| 407.5 14.1 0.035 F15 10-14 wks| 317.8] 12.75] 0.040} 84.9] 119.0| 86.2] F16 10-14 wks| 214.4] 9. 0.044} 52.9) 75.7| 0 P17 10-14 wks| 226.1] 8.94 0.040) 71.5) F18 10-14 wks| 216.1] 8.4 0.039 72.6 F19 10-14 wks| 241.0) 11.21 0.047| 64.4] F20 [10-14 wks| 246.5] 8.5 0.035 117.0) F21 "ORB F22 JORB F23 JORB 687.8] 561.2| 456.0) 22.22] 18.24] 14.96] 0.032) 0.033] 0.0: 151.0] 441.0] 379.0] 327.0] 115.3: F24 F25 JORB JORB 525.7) 17.91) 586.6] 18.24] 0.034 0.031 390.0] 276.0 F26 |[F F27|F F28|F [ORB |ORB |ORB 281.5] 281.4] 247.5) 19.56] 18.81) 15.65 0.069] 0.067] 0.063] 59.5 65.6] 4 105.0) 71.9] F29 |F |ORB 289.5) 14.95 0.052 63.0] F30 [F |ORB. 338.7| 17.58] 0.052] 29.0] |" ORB = old retired breeders [Method detection limit (MDL): PFOS = 15ng/g or ppb. Page 10 0f 23 DI21; T-6316.9 Final Study Report Revision A 01/09/02 able 4: T-Test Results (p values) - Charles River and Taconic Farms Age, Sex, and Vendor Liver PFOS Comparision [Vendor| `Age/Sex Group Comparision [658 [10.14wk [6BWK& [68& [10-14wk [6Bwk& [6-8 wk [10-14wk [ORB 10-12wkla ORB |oRB |10-14wk |s ORB |oRB 8 6-8 wk |& 10-14wk [ORE charies onl 021] 04 00 River Taconic} Farms | oz8l 030] 007 Vendor Comparision 025 0.00 [male[Fem __Ta ooocoml somoome oom | Chartes [68 wx [10-1awk [ORB& [6:8 wk [10-14wk |ORB& River |s 68wk|& 10-1awi{oRE |s 68wk |aaw10k- lore vs Taconic} 0.13 0.37 Farms TEST - one-tailed distribution, homoscedastic Page 110123 % : DY21; T-63169FinalStayReportRevistas A OOO Ip,TosicobopyServicesReport foxSadyNo. 63169;DT21. Pe(s FC)Levelt fnNatvoo ras.Sepn t,1998. 2)3M MedicalDepartment, ToxicologyServicesProtocolforStudyNo. T-6316.9;DT21. Piuor (FCo ) Lec velsh inNe aivm erai ts.Jc ulya ,19l 98. Page12023 . - Signatures: Prepared By: Deanna J. "a Ms Study Director Reviewed By: 2 2TZ John Butenhoff, PhD., DABT Corporate Toxicology Management (Inika Boned AndrewSeacat, PhD,, DABT Senior Research Toxicologist DT21; T-6316.9Final StudyReportRevision A 01/09/02 Date aud /, 2003 Date (/9/2%~ Date Page 13023 00902 : DT21; T-6316.9FinalStudyReportRevision A Appendi1x 3M Environmental Laboratory: Fluorine Analytical Chemistry Team Contact:KisHansen FluorineAnalyticalChemistry Team so Building2-3E-09 Studyof PFOS levelsinNaive Rats `Summary report Experimenta Summary ifferent sInuoprldecrstwoearsseesQs"enudogeanouasnn"alleyvtzeeldsfaoorfPPRRlOOSS.inTtherseteadniismtailnsc,ttahegelisvoefrsroatfs nwienertryreaptrsfersoemnttiehdrnee thegroupof animalsreceivedfrom eachsupplier:6-8weeksold, 10-14weeks old,andretiredbreeders (> 14weeks). Thetestanimals,receivedbythe ToxicologyDepartmentat 3M, were sacrificeduponreceipt; tissuesamplesweredelivered tothe3MEnvironmentalLabforextractionandanalysisby FACT. [P Cle River |RR aigh:NC [PPuna [L10L10A[Rdo [11] Supplier Location wks `male:female TaconicFarms |Gernantows,NY_[TAC HT|__| 10 | do| ti] *3Mis/was asupplierofpapercoatingmaterialtoPurina Mills, Inc. Curritiesnoatktnolwniyf3,M suppliesmaterialtoTEKIador Taconic Farms. AnalytiLciavleSrusmammaplreyswere homogenizedandextractedusinganion-paringreagent.Theextractswere `analyzed quantitatively using high-pressure liquid chromatography-electrospray tandem mass spectrometry r( eportH .ThP epreL sencC aenodre- avbalsueE antceedoS vfeortsM huesraknS neoxwtnM rafcltueS odrcoucr) hveem.icAanlaclyotnitcaamlidneatnatilssaanrdemaevtaaibloalblietienswtahesfull `ascebrytinaspiecntieond. Results Summary RatliversfromCharlesRiverand TaconicFarmstest animalsshowedsignificantendogenous levofePFlOSs. Liverscollectedfromoldestgroupofmalerats from Taconic Farmscontainedsignificantly `morePFOS thananyothergroupinthe study. "Thelivers of testanimalsfromHarlandidnotcontainPFOSabovethelimitof detection(15ppb). PFOSlevelsintheliversofmaleratsfromCharlesRiverand TaconicFarmsroughlycorrelated {`whietlhathsetaPgReOoSf,twhheialneimtahelsa. ,Thraettiirse,dlbiveerdscsolmleaclteedrfartocmotnhtaeiynoeudtngeehsitgmhaelsetractosn,ce6n-t8rwateieoknsold,contained "Thelivers ofthefemaleratsfromCharlesRiverand Taconic Farmsweredeterminedtocontain `vaerymcontsiiNsynottelhnziteleesvkdedlnyso.owfnPRlOuSce,oschhoewniincganloscomoarmirseanlswaoirttmhiaaogpenl.es wer deified nthe lve samples Graphicalresultsand afulltableofresultsareattached. Page140123 > DT21; T-6316.9 Final StudyReportRevision A 01/09/02 `Currently,methodsarebeingdevelopedfortheaAnaplpyseisnodfil1xowlevels ofPFOSandethyl-FOSEalcoholin samplesofchowfromeachsupplier. `SEaxmpperliempentral eparasamptlesi,HPoLCn-ES-MSa:loqn-puaireingeoxtruactsion `Analyte isextractedfrom asamplematrixwithanion-pairingreagent (tetrabutylammonium fhlyudorroogcehnemsiuclaflast.e (OTnBcAe))thienaanipHo-nc-oTnBtArplaleidriesnvfiorronmmeedn,tt.heaTnhaelyctaetiiosnitcrarnesafgeerraetdsienletcotiavneloyn-tparogleatrsorangiaonniicc:: solvent (ethylacetate),dried,andreconstitutedinmethanolforMSanalysis. HPILnHCPaLnC-d,HPaELnCa-SlEiqSuMMoStoMSfS:eFxotrradcettiasileidnqjueacltietdaatinvedwoparsksedthrough areverse-phaseliquid cthortohmealtioqguriadpmhoibcicloelpuhmans.e,Btahseedaonanlyttheeiafsfrientiatiynoefdtfhoeranaalchyatreafcotretrhiestsitcaatmioonuanrtyopfhatsiemien.tFheocroelxuamnmrepllaiteniva,e: standardsolutionPFOSmay eluteat 10.5 minutes.Retentiontimesbetween astandardPFOSsolutionand theanalyteextractedfromgroundwateri thisanalysiswerematchedtowithin 19%on theHPLCsystem. FollowingHPLCseparation,ESMSprovides arapidandaccuratemeansforanalyzing a wide rangeoforganic.compounds,including fluorochemicals. Elecatnironiozatsionptecrhniaqueyus,ed primarilyforthedetection ofmolecular ions,isgenerallyoperatedatrelativelymildtemperatures MoleculeEsSarMeSiMonSizaedd,dpsoassniabdldyiftriaognmaelndtiemde,nasnidodneotfeccteerdta.intytocompoundidentification.Asin ESMS,a `charaprcimtareyironissseltecitecd. However,insteadofsimplymonitoringtheprimaryion,inESMSMS theionisbombwitahhirgh-edneregygdas.As aresultofhigh-energycollisions,smallersecondaryionic fragmentsunique totheprimaryionarecreatedanddetected. "ThisioniFofrreaxgammepnltee,dfionrtPooRtOhSer(iCo1nFs;ssuScO5h)aasna8l0ysaims,uio(nco4r9re9siposnedliencgtteodaSsOtxh)e,c9ha9raamctuer(icsotricrepsrpiomnadriynigotno. F505), 130amu (correspondingto CF;SO5),180amu (C;F.SO5), and 230amu (CyFSOy). Eachofthese: secondaryfragmentsisdetectedandcanbe sedtodifferentiatePROSfromothercompoundsthatmight havethesamecharacteristic 499amuprimaryionbutdifferentchemicalcompositionsandsecondaryion fragmentationpatterns. HPLCsysCtoelmu:mnH: ewleSetrietKs1-e100PyLiBqaesutiadcstChCkr1oo8macantoolrguermadnph 2X 100mm, umpartiscilze FSloolwvernateA:: 320.00mMmianmmonium acetate: , SoSlolvveeanttBG:radient: 4Me0t%hatnoo9l0% B in 8.5 minutes. Holdat 90% Bfor 3minutes HRoeltduamtt4004%0%BBfiorn|1mmiinuntuet:e InRjuencttiimoen:volume: 10 uL. 13.5 minutes ElecTtandremMoasssSppecrtroametyer MicromassQuattroII APImass specirometermassspectrometer MassLynx3.1software Page 150f23 :: DT21; T-6316.9 Final StadyReportRevision A ous Conevoltage: 3060V Appendix1 Collgiasscioeorgny: ~~ 40eV. Mode: electrospraynegative Sourceblocktemperat1u1r5eC; DPersiomlavraytiloonn:temperature: 249590C Daughter ons: 80,99,130, 180 Electrode: Zspray QualitycAolnltarnoallsysuemsmwearreyconduciedwith amoderatetohighlevelofqualitycontrol.Duplicatematrix spikeanalyseswereconductedforoneanimal fromeachgroupof animals.Exceptasnotedin theresults table,recoAvcearliiebsrwaetrioenwcihtehcinktsthaenadcacredptwaabslaernaalnygzeeodfe8v0e-r1y250-%1.0samplestomonitor instrumentaldrift. `Quantation wasbasedonlinearregressionanalysisoftwocurvesbracketingeachgroupofsamples. `QuantitationofPROS wasbasedontheresponseof3-4daughterionsoftheprimaryion. Results Seespreaattadchesdtohtheisreepotrt. FACTmembersparticipating: KHansen L.Clemen HM..EJloihenfssoonn G.Langenburg R.Wyme SL.AH.eSimmidtahh! Page 16023 Fo 0 ppaaaE aaa D Po eE ke ee ] E Wfiwl iEE iElAiO nnwadnC nAny| PEOlHi [ pillteE sbmeie dmuedne nd|] i Pl He EE e it|h rE opd es1i Lil hpi adi ems BW RD :: 3 i ! 3 z g 3i | oo i | i|i Fg al 8 i | fi g3 if 3 Is 2 :2 2 = TEEETTEEIEINE! rr vonsiansosSosasown So iHEi fii i: 11 $f ii Hai HiloigiHdiH ia ike 133 i HH 23 i f :2 : z 2 i : _ i |E EAs 2 8 } : s2 i ih EEEREE i I UONE.UBUOD SOd 1 | | : 8s [2 3,48 za gz tf8 lEEs:ind li Hii iEI |Ei HI ik Hn sled! wv jin i } i : | ol aiE z 5 3: ;i . 53 gi Eiigzgi d i: H4by) fekaih pf BHE Ma i I:: CE bk gs 8 8888 t HHiitt {111 82:51 i Crm HIE 832345 . DT21; T-6316.9FinalStudyReportRevision A 01/09/02 Appendi2x SUMMARY OF NAIVE RAT/RAT CHOW/FISH MEAL STUDY ANALYSES Conducted by the 3M Environmental Lab (prepared 03/01/01) NaiveRats (aTnaikmaelnsf,rtohemlisvuermsmoafrnyirneeptoyrrtatissfsureodimtnh1r9e9e8d.i)ffIenroenrtdseurptpolaisesresswser"eeqnudaongteintaotuisv"elleyvaenlasloyfzePdFOfoSriPnFOtSes.t Threedistinctagesofrats wererepresentedin the groupofanimalsreceived from each supplier: 6-8weeks old, 10-14weeksold,andretiredbreeders(> 14weeks). RaPRtOlSi.veLrisvferrosmcCohllaerclteesdRfirvoemroalnddesTtagcroonuipcoFfarmmaslteersattasfnirmoamlsTsahcoowniecdsFiagrnmisfciocannttaeinndeodgsiegnnoiufsilceanvtellysmoofre. 'PFOS thananyothergroupin thestudy. "The liversoftestanimalsfromHarlandidnotcontainPROSabovethelitofdetection (15ng/g). PROSlevelsinthelivers ofmaleratsfromCharlesRiver and TaconicFarmsroughlycorrelatedwiththeage: oftheanimals. Thatis, liverscollectedfromtheyoungestmalerats,6-8weeksold,containedtheleast "PROS,whiletheold,retiredbreedermale atscontainedthehighestconcentration. "TcohnesliisvteernstolftehevfoefemPaFllOerSs,assfrhomCohnaorwlcoeirsrReinlvaetrigaonnwdiTtahcaognei.cFarmsweredeterminedtocontainvery LimofiDtatsa: or`iSgcrieneanlisngufmomraorthyreerkponrotwdnomcuemetntastabteodoftEhltat-iF"ONtSoEoe-tOhseHrk(en.og.wPnFflOuSoAr,ocPhReOmiScAaAlc)ownatasmpienrafnotrsmoerd.meTthaebolites i`nwetrheeidleinvteirsfiaemdpilnetsh,etlhievearnaslaymtpiclaelsLanOaQlymzaeydinontthhiasvsetbuedye.n" sHufofwieciveenrtt,boasseeedeoxnpetchteeldevmeetlasobofliPtFeOleSvoeblss.erved (Basedonthe 2yearsEt-FOSE-OHfeedingstudy,PROSAAlevelswouldbeexpectedt0beapproximately 9%ofPFOSlevels; POSAconcentrationswouldbe expectedtobeapproximately 5%ofPFOSlevels. reBlaactkicvaellcyhuliagthe-dd,otsheee2xypeeacrtfeedecdoinncgesnttruadtyimoansyoofrtmheaymentoatboplriotveisdaeraennaecacretphteab1l9e9m8oLdOeQlo.fDtahtisaflrowo-mletvheel exposure.) SpikerecoverystudieswereconductedforPROSin atliversandwereacceptable. Matrixspikestudies `conductedforotheranalyteswere, forthe mostpar,acceptable. RatChow Ratchowfrom 4separatevendorswasinvestigated.Twoofthesourcesof atchowweredeterminedto containPROSabovethelimitofquantitation. NIH/PMILabdiet,fedtoratsobtainedfromCharlesRiverwasdeterminedtocontainapprox 18ng/g P`RaOSp.pSrmaollax1n2iimnmagl/adgioteftfePrFloOmySZ.eiTgleekri,afderdattioroadtesnptudriceth,asfeeddtforroamtsToabctoaniinecdFfarromsmwHaarsldaent,edrimdinnoetdtcoonctoanitnain PFOSabothevLOeQ. Liomftihe tDatsa: Pa21g0fe23 + DT21; T-6316.9Final StudyReportRevision A Appendi2x 01/09/02 `Spikerecoveriesstudieswereconductedoneachtypeofchowtestedand allresultswereacceptableinall cases(77-98%). TheLOQforPFOSinratchowisapproxim2a-1t0engl/gy. Fish Meal `There isgreatvariabilityinboththesourceandtypesoffishmealavailablecommercially.Thisvariability complicatestheanalysisof fishmealandtheinterpretationofdataconcerningfishmeal. Fishmealsusedforanimalandfishdietare typically generatedfromwhatare referredtoas "industrialfish". Industrial fish, including menhadenandherring, areusually quitehighinoil content andthus notfit for `human consumption. Approximately90%oftheworld's fishmealisproducedfromindustrialfish. Fishmealisprocessedinfactories ordirectlyon thefishingvesseland resultsintheproductionofseveral `separatefishmealproducts. Afterthe fisharecooked, aliquor(il,water, andprotein)isseparatedfromthe `solidsby"pressing". Thesolidthatremainsafterpressingiscalledthe "presscake",theliquidcomponent, oilandsolubleprotein,is"stickwater". Subsequenttopressing,theoilisseparatedfromtheremaining `componentsofthe stickwater bycentrifugation. Afterfurther distillation,thisfishoilmaybedirectly incorpintooarniamatl ediedt.Theremainingstickwaterisevaporateddownto athick syrupof 30-50% `solidsandmaybesoldas "condensedfishsolubles". Thesyrupmayalsobeaddedbacktothepresscake anddriedandsoldas "wholemeal".Presscakewithoutthesyrupis soldas "presscakemeal." Aol fthl ese `componentsmaybeincorpino toarniamatl feeedd. `AccordingtotheUniversity ofFlorida CorporateExtensionService,goodqualityfishmealaverages60- 70% protein; the oil content ranges from 2-15%. Fishmealisincorporatedinto foodfor avarietyofanimalsandfishincludingfarm-raisedsalmon,poultry, andcows(particduailraycrowls)y. Inthis study,six typesoffishmeal,arisingfromatleast 3typesof fish,wereanalyzed. Menhaden travelinlargeschoolsand migrate upthecoast eachyear. Theyarefoundinwarmer,near shorewatersandintheUS,are fishedprimarilyoffAtlantic Coast. Menhadenconstitute 98%ofthe fishmealproducedinthe US. ' Capelin,also aschoolingfish,spendmuchoftheirlivesoffshoreinthedeepwatersofthe Northern Pacificandthe Arcticandmovein-shoreonlytospawn. The habitatfordifferentclassesofherringismuchmorefarrangingthanthatofeithermenhadenor apelin. Differenttypesofherringcanbefoundfromthe NorthernPacificwatersoffthecoast of Canadaanddownto thesoutheAatlsantticecorasnt.Likemenhadenandcapelin, herring aresmall, `schoolingfishandthusare targetedforlarge-scalenetting. `ProteinConcentrate (type offishmealnot specified) |( <LaOQppr3nog/gx ) | Omega Protein FAQ (type offishnomtse pecaifiled [Mesb~s~donF[i6s1m0eat| Page22 0f23 : DT21; T-6316.9FinalStudyReportRev0i1s/i09o/n0A2 Appendi2x Matrixspikestudies wereconductedon asingletypeoffishmeal (menhaden). PFOSspiiknteothde `menhadenfishmealwasrecoveredatapproximat6e6l%y. Matrixspikestudieswerenotconductedforthe remtyapesiof fnishimealntesgted. `The LOQ forPROS determinationinthsefishmealsampleswasapproximately3.5 ng/g. Sc ummo arym of tp he3oneon fthit sstus dy: Ratswith RatChowusedby |Rat Chowusedby Vendor VenodfRoatrs_| endogenous PFOS?| Vendor Contains PFOS?| Containsfishmeal? Fe] ww re . Becauseitis notknownwhattypeoffishmealwasincorporatedintothevariousratchow,itcamnotbe definitivelyconcludedthatfishmeal ithesourceofPROSintheratchow.Althoughindirectevidence indicatesthisprobability,becausePROSwasonlydetectedin 50% ofthefishmealsamplesanalyzed, `analysis oftheactualfishmealincorporatedintothechowisrequiredtoprovide adirectlnk. `Other variablesaffectingtheraspriortoshipmentto 3M (suchasPROSlevelsinwaterandinother `componentsofthefeed)havenotbeentested.Tothebestof mymemory,this chowhasnotbeentestedfor the potentialof EFOSE-OH transferfrompackaging. `Shouldfurtherworkbeconductedonthetissuesamples, a lowerlevelscreen formetabolitesandother knownfluorochemicalsi recommended. Thisinformationwouldprovideadditionalevidenceconcerning theoriginofPFOSidentifiedinratlivers. `The motivationtopursueanyof theseadditionalinvestigationsdependsonthecorporation'senduseofthis data. Theorisgtudiyobnjecativle: ...todeterminewhatPFOSlevels,ifany,arepresentinSprague Dawleyratsofthreedifferentagesfromthreedifferentsuppliers"(MedicalDep.protocolfo study # T6319.9)wascompleteduponissuanceoftheEnvironmentalLab summaryreportin 1998. Pa23g0fe23