Document 6R8m2d4zE7jjEk33VdkkM4Z43

N23144 I . -1 '~r Pacific Paint, Wall Paper, Picture and Art Good* Trade 11 THE MASTER PAINTER A Monthly Magazine ior Painters Co. in the south. This company has a fine, large sales and Decorator!. room at ;kW-.`J7 E. Second, where a large stock of its The wgn painter untl find riif June.'itttmlwr ot this paper especially attractive. The editor. A. Ashmuit Kelly, gives wwe practical suggestions in the shading of letters, proving jbal sign writing is a science as well as an art. W, L. C. spcafcs\a one who knows, in an article on the. finishing of oak floors. 'T-itho: poue and Its Uses for Wall Finishes,' an article by R. S. Pern*, lays hare an abundance of inside fans about llthojionc that would be of value to the paint man and the decorator. Some thought is displayed in an artioe on the selectirtf of wall paper, proving that in the choosing of wall coverings it is not necessary to trust 10 guess work and inspiration, but that a few moments of cool consideration of the location of the room, the finish of the wood working, and the desired tone of the furnishings. The article is rcolctc with valuable suggestions, and should lie read by every* member of the trade. paints and varnishes is carried to supply quickly the needs of the retailers. G. M. Hickman has purchased the hardware and furniture stock of the Orland Mercantile Co., and will occupy two sales rooms in that company's building, which are being remodeled for his use. "He proposes to stock up aud carry an assortment fully adequate to the requirements of the town. W. G. Hess, Pacific Art Co. creator of things, new and exclusive, at 3116 South Main Street, does a good business in framing, pictures, etc. Mr. Hess is an ex perienced and proficient artisan, and promises us some PRACTICAL DECORATOR. articles upon picture framing, store and window dis- One of the articles in the June number of this paper worthy play^ond publicity that .will be of value to our readers. of mention is on `'Varnish Troubles.' Not only does it give the direct causes of the majority of difficulties experienced by the / C. S. Neal, the factory superintendent of the Acme wpflaahikincithnegrthienpseeealpitnproglyu,ibntlgeustvtianmrgna,iyshpb,inebhuootvlienirgtc,ogmifvaeet.stenaTishnegwecalalnudtsheesblroiesfmtecerhidniipgepsianbgrey, ,,'WAn.geLle.s,&insCp.ecWtinogrktsh,eolof cDaleptrloaint,t Mich., is in Los with the purpose of explained in a lucid manner, and in snch a way that their pre so perfecting its facilities that the output shall be in vention may h< easily effected. The 'Tract:cal Decorator" Is all respects up to the standard of "Acme" quality. at this time offering a prize of fifty dollars, to be awarded ro the practical painter or decorator who will furnish, before July 2.1th the'most helpful suggestion, in any part of the trade for the benefit of the painter. Only members of the trade are F. B. Whipple, the district manager,, is well pleased with the increased volume of trade at the several branches under bis supervision. eligible to the contest. Each person sending in one or more suggestions must send vvijh the same the price of one year's . The Whittier-Coburn Company has a fine estab subscription to the paper. The winner will be announced in lishment at 443 So. Los Angeles Street, and carry a the September issue. stock to supply all the requirements of -the trade in THE TRADE IN LOS ANGELES Baker-Bohan Paint Co. dos a retail business at ISO East Ninth Street The California Wall Paper Co. has a fine stock of goods at SIS South Broadway. The McClellan Manufacturing Company has a nice showroom at 406-08 South Los Angeles Street The plant of the Spokane Paint and Oil Co. was destroyed by fire on Jane 12th, causing a loss estimated at $100,000. this territory. This branch is in charge of H. F. Whittier, who states "that conditions are fairly satis factory, those in some sections being very good indeed, the hay crop having been better than usual; both city and country growing more rapidly than ever. Yes! I believe there art always good things in Association." South Coast Paint and Color Co., Inc, 3006 So. Main Street, in business six months. Manufactures Sage's mixed paints; a high-grade price paint that should retail in this city at $2.00. Has put on. the market recently a flat wall finish paint, "Creamalba" with which the painters are highly pleased, they-say,' . Hiram W. Wadsworth's store at 113-16 East Colo rado, Pasadena, is a credit to oar trade, and shows onr complete lines. Pacific Wall Paper and Paint Co. does a whole as it does not turn grey in the sun, and is most sani tary 'for interior use. Frank A. Sage: "Doing a nice business; big competition. Paints are sold close enough to be sure. We are. nulling to look into organization.'' sale and retail-business, with salesroom and office at P. H. Mathews began business in 1883 when this 812 South Broadwar. was a town of 12,000, and has seen it grow to a ciiy W. A. Emtrick, representing Pratt & Lambert of over 400,000 people. He has kept up with the pro lishes, called upon the Los Angeles trade recently cession, occupying a four-story building, 90x165, with nd finds business picking up. one of the finest salesrooms on the Coast, and * very F. H. Jones, manager of the San Diego branch of comprehensive stock. Manufactures the PHM mixed paints, and jobs Carter white -lead, P. & L. varnishes. Acme W. L. ft C. Co 1261-57 Fourth, tells me He is m fa^m of city a going right ahead, and trade is increasing accordingly. a Fyific CoAst Paint,' Oil and Varnish C--lub, to be affiliated with the National Association of which be W. W. Walton, manager for Southern California is/member. r ' of John Lucas & Co, paint and color makers, Phila delphia, Pa, reports very satisfactory progress since The Acme W jite Lead . nd Color Company suc opening the Los Angeles office, 934-36 South Main ceeded the H. R. Tibbetts Paint Co. on the first of Street, in January. the year, and has installed upon two floors of the The business of Uhl Bros, shows a large increase this year. The display rooms and sales floor of this firm are the finest in the West. The stock of high- > grade goods is more comprehensive this year in re! spouse to the local demand for the best goods that ere fctnade. large four-story and basement building at 339-45 E. Third, a completely equipped factory, and makes a full line of mixed paints to supply its California and Arizona branches. The manager, H. R. Tibbetts, says: "There is more bailding in this city and tributary country than ever before. The outlook is excellent, altho competition is very strong and prices extremely E. T. Soderstrom is kept very busy looking after low. Association is very good if the trade can get. Ithe rapidly-increasing trade of the Bass-Hueter Paint together." '_-__ a -- ..wty T i--J---- : ( 0007-SWP-043165 i b ilm i'i nfcfJti'i-iit 0007-SWP-000126321 *rSM-rH ''. 'T'n p n * * - w V?/*7 .' H. R. Tibbetts, manager of the Acme, is in the East; , ril! visit the home factory at Detroit, Mich, and also is i going to New York. Will return about the first of | November. ; fc>.TSlfrr At the factory of the Acme \V. L. & C. C., Los An geles, all the raw material anil formulae for making practically everything in the A.-O. line have been re ceived and they are in position to supply stock in any quantities required. The Acme "No-Lustre" wall finish is made in small quantities and as the stock becomes depleted, this fresh, newly-made quality dispenses with ordinary tendency of such products to settle, because there is nothing to hold the particlesjn suspension. & Tibbetts, local manager of the Acme W. L. orks of California, will return from his Eastern ' trip about the first of Xovember. j i. v -- - - . The Acme, White Lead & Color Works is about to move its branch at Toledo to 144 and 146 Summit street. The three-story building designated as the new home of the company is how being entirely remodeled and the ' ' -I Ph?). 1*8, ^ a.:-'*: llv jtcnur VWiiic Utiii 4 Color Works is V a. "; about to move its branch at Toledo to 144 N and 146 Summit street. The three-story ; j building designated as the new home, pf the company is now being entirely remodeled and I the three floors will be arranged to esfiedsny " jrot tfie requirements o the^business.-. ' y -sss ttrir* tItnf*e-mieL, ` -v%m largoi/ >t' ate.rt . i.reallM*: 'ot.a.-.raj.wr friend* tanLflnd ble'pfoiuctfc't- VAiH.vtMprnM --/ g -;.vf;. -S, . rs ~i v? ^ ' SlmSv^al'V^VftLlC - ......- 'T ^ ____ _______ ^t-*Aarav ----- --- 4 *'.'Oolr 'wrlt*.itar r.ujiT ytEPHESEXTAiivE-e?::.' "i'-t '-^4^n otmooK ortnowric jspwct ; ucipa? ynnaa-ta-Chajf lubtf^^Urtn gSgqgQ! Sgf^, S&JgM"SS5S%iiS Ur 'T. R.'Briefer o( Detmll, Mlrh na. ir,ntlnx the Aetna White Lead A'Color Work*, th larjrt mu. utaeturMa. hilba, waHd^-`bf Quinta, ^^y^BaWtahaaii by Acma Oa., t^i _* iiaratwl 'ifjrpii UMMb at Hlaam-ymaam ;;vie. !-:#*ravtri^ vanuahah. aUuaV.ud ;<ituimtfi^taVtn tUa .city.'tMlaVr 'arrurlnf .with -Bala Haasr'* V'* -McAtu,; thalr elatritmtum,.'f.r thla taAVa ' boetiuaa. ,yn thaaa I- line.. -v,,; Brlafey laTerr.o'otlmlatlCaat0 ra.a;|.ail.irritnwi:awata Jpa * outlook ror aaaaiwf tmalnaa/la.all n * maa Ihfe ra*r, ~bufae hla o,tnlone an tamtiou nude "on bfa trip Cram ik-^yr^bW Detroit iothe ooaat -Xij.. ; . "^Xha fact that Bale .*IfeAtea.ham -* % ^StSEs^sSm ' taf tbAJVMw- t,, dbttblad. thW,g-hualiMM A>a t'quUtrOafeliaa darW-tbapaat h*Vil;dtiplioafed.'eleawbore t`vary USty ftgaadjviaeah.tacjlm/M^.my ML_ j*a!tr;.--< y#*?3Sg 0007-SWP-000126322 r-.-_.Aw .t*t- * ^ TFT j&S * :'HU pjt'-'/'Z' -:m Hp. rci5;;55;jsii^tg^ifa4^t pSuaernf bsotomCur'Tlikvddt 'ifag \jrj iiCr^^bi- of Clus W? Nanfcjpf tlfaC! uiL'tu^tfa* tlmil*, .-KmIi ifM electedj . Tw*atT: jrer~ago1 X*fc. hlntfCat| .to-W-jC.;PortnV/trba;.fu braking' gm\ "ineitt u l-ifi.lwokj ef <lm: Ue !. 1 fi gMli-in-eirf.T'hi- nr. .- <s j* viV'iftie* ame- Vrr I- .wM*l IV *.r.lj I ***_ Unfc an* *UI r^foton Oo. uf 'yfcarij*gjip' Nash of tae r)uu majiufaeiarlnf aten< 7.Jr7r -------^v- J&e'cenHhiK;tiM`iory Jj'.r1 Moving !mlkr prweper* 'C; "r-Vh-Mi I, i...tu * :'* V' er. he win rhaai rrcetcet pUekunt from I . : r. gjl-'J*"! Tire of iki tin mMrraMitot Wch tl . ,im- . *$!>*. ** ^blgS&Uf* ,pablldlr.announcement* 'for'ti^Jortlx fmhu' Arm vulit* jinlnU iBd.anlihMjrk.i.. ,*.. .jfag ' 1Tbt lor ,oo_ IhlEut SI4ol btr (^rk,i>lock(i<tA(iu>'':a|T(r. before .-with; Acm^piUitk,sli4v^!rBll>e;M4 the' Tjxiafig"iJ weh j.tw:are^Ueinr *07. uiiai' la lcii^TwraiohoSiLqrr:'^ Aoon that hi*.become mlire4iadJi.iilghttj from'"Be *a be'.fwtTek .Jb eoSof or ilipeifafiiSj erttli;r*il-':'Arana/ tailHj' lji>rof.*iBt.7^yeij * ' ` W Lae, bK. i*<* tb: irettOphi^S^i^Si^SSSrTMSbn^ J - - h,'^ngo^Ta^eoia -.. iM iB'V^nafkoiM.haeto WBBmBm jg^pTTr-7-' ' -] INSPECT PAINT FACTORY. The senior class in chemical technology of the Univer sity of Michigan, accompanied by Prof. E. E. Ware, was entertained by the Acme White Lead and Color Works recently. For this occasion the paint factory was decorated with the college colors, college songs were rendered by the Acme chorus and a rousing welcome given to the class by the Acmeites, many of whom were former University of Mich igan students. After a detailed inspection of the factory and the proc esses and materials of manufacture, luncheon was served. At the conclusion of the luncheon an address on the chem istry and manufacture of paints was delivered by Prof. C. D. Holley, chief chemist, and an appreciation of the need of technical chemists to the maufacturcr was expressed by President William L. Davies. ,.--; mix il-. . .. -JWSiC Bra R. J. C. Jodge\, who h.a..s....b..e..e..n....w...i.t.h....t.....j he^ /jj ~ " ': Acme White lead &Er Color WIVorklrs* Co. iofjL-j------~-------------------------------------------------------------------------------------- * " Itbe pact ttn years as traveling auditor, has.tjt j A'CMEi (been advanced to district manager of allKi.. \ manager of aU^,, To aggregate business of the Acme White Lead .nul> '. Soutbem California brandies, with Hcadr|&vl Color Works for May was a larger volume than in any other! v Quarters at Lo b Angeles. His invitation for all% month in the history of the company. Every branch showed L Palestine boy* to call and see him whenever} an increase over the same month in 1912. The total busi-| there is open to aft. ness slnce'the first of the year shoa-s a large increase ask&&3 -t- I ^z^raisssii jcomjfaired with the same period in 1912. A quarterly divi- p; j id* ` ' 0007-SWP-000126323 M ....I':*- aS. Tfcmni* N1 FrillInn U d Carnal Ummm Caaaj * !* * y 0,-1 o-j^tagspgs^-sj; T1HGEcaentJaiM4Uotodru. Cnos. fbit&Fohrra.n*d* fin tmf *>** * 'P*'* ** cuccitirr, tnpmtmrtfit. pnntuiaa. pr* tkm vnwfarM cWJ ot trui&ul *mion llo. PjWw *.*" MoTt anabmlf tta wfa of *,,,*, i4 At terf *"" ammlfaa fcj *c latum sf *e *- nvmacr. It mil bt tea Ina But hWt >Aa IM AC Ml from inaer- .ka <U Mncn] emim*t)Oft W WT ID W BOB* uw D" * iimiag drpartaKiH *d # * J--tiea. |fooi tn mntmeaU mm ww W* Bar U the Go mI Motor* *rt been leaden In Web ** **' dorahutinc the show is* fct ram* trio, wbe ondentand We betf pnw euktbeMt* bp a walk Wo|b We and ban been **"*H^*"* Gw4. On dumtia floor yotfiKl lb* trj mt* bttjtoo. Thj "`J*** . Etpcfc bolding * bMbf poulio* *T prod** <U rtotit of Mnf lb* total tb^e muu- poiax* lot tw(*< *>' ** g?*" fotwtr b&troM. To tht ri*l o{ Iran Ac tafSMe a ""g"TMIS Ike Btkbpoa fed the OlbioobhiBk- tiocrrioi inn cooJtrvttMni. Tbt hg at* foortecoth annul bow to We porehesinf desortonnt playa *nj2"* Hfclk, wd wkaW hM reached a dewd- ant pact we orfsmianoa. berng m opaasat of fArnwt and floSW that povtani to toyLtftw.0>t<t0^ team aotbfac to be deftred. Farther quanAitS, eaab&if *e ra*TM *V don We Cadillac, one of the > wpineerii* depertwnU * * "* *** _ ^ .talked of care of We pear oo aceoont tatbod of eoootrowco at a mtpmu* of We edeotifie progress it wpceaeeta expense. wtocb ntanaWl/ pn * **" ud w distinct idwumwt ia BOtor* ig sad an adreata** to (be ear wntrocllnn,, The Oakland Bee ia for be b aUc to.W * W*b*f a*aU woaa We auk; one of We popolar Kadiem price own* to (Wt prrtii; axdraso priced can. serf Wowfag ofteof tfan. Aaotbei fceportM* *?**%" We seed aaodds of We yrar-o afode- We cVwayal trai bbontny. Mgt ^ WreMoaaoigv roadsdov whh a eadtbk of material i* carefaltf an*J7d teWe imtk or ndriah daoi H* ftcWgW wcettafao^ w<* ^ _a.. aAm+r .U. MfWi|W tfld BfC^f Ut ftlirri, W With Ukthetwo^pdefoMfosyora. The ant <wnpat .. Marinette cJl* exMMted oatbefnt It *KH he ra <* * *>re bakoar oad repreaeot* We beat feature* We luoeaioa* of We central inaejutM* . fofpwaiy wWlri W the Raiokr and m soW Wat WejP*^*^ WddL Tha Cutercar We erelWaaowai twy U rnprW We hdp 4 1 Irktioo-drJw ypsJ leo Won on Wfo ancc pvt*, and fcr^a yWod flow. i Wat We pmeat ataadard of We General The bewe sftm of We General Mwovs prodact too beai waWcd. j < 0007-3WP-043X68 0007-SWP-000126324 ACME WHITE LEAD AND COLOR WORKS. .. '*> I > 1 : "-*v < * '"TAjp;| .jfV % r, n**Sj^5iK -VSffKubl XsfcvT 1r4m-i ci*vV vi --'* ? -^Tf*3 rc.'crs.ia ,* 1 Awcog the concent* that have hem `pnoMMatly identified with the history Detroit i* that of the Acme White [ L*d ft Celor Wsdts, masafactumrs of riini, Colon. Vsraishw, Ewraeis sad Ftauber of ad hiads. The botinet* vti ohliibrd in IRt ttf occapic* the plant shews in the accompanying tthntrttion, ThisJbeildiaf carers an area of sixteen acre*. Employment U given to tin workmen. The product* of the house are sold throughout the Uaittd States and many itwia cmmtttes. One hundred and seventy-fir* trawling sales men represent the Company to the trade. Their trade-mark ACME QUALITY t Icaown to the trade as among the best Branch factories arc looted at Boston and Los Angeles. The officers of the Company are: William L Davies. Piaslifrirt; H. L, White and Thomas Neal, `Ykw-Frof* dots; M. W. Ncai. Treatarer; A. M. Woodward. Secretary. These gentle men arc wen and favorably known and have dan* mods fen make Detroit a great industrial center. - -&Lji ,V -S3 t r / .-----_;--------- 2x<,,gli:a>------- '-^f%SZFi STORE READY FOR OPENING V-.,. . . / STORE SPRING OPENING. " 5r"g3 Central false* Qtaae.Ca. JUte Vlaa * v '/ The Acme White Lead and Color Works, Birmingham . v.Tkhihu.' ':?>* Ala., branch, 2015 Third avenue, have sprung1 an innova- -.'anntaatr bwun. tbs *-- Fatal fli (HM wnrsar na I UM Hun. Is mngr lor the* epotag/ himwri *lik a p*_^--, v ' ;ton, following the general progressive policy of this com* O.-T.'phny, by having a spring opening, whkh was in progress .* : . .all day last Wednesday. .>*. . Sfeptaf ( .TAT* * Gmiity.^psiiwi1 vminiL ataiae aad flaltamb* rW*~ daw An f tba aarenf preda *. V*. . It is quite an Idea, as it gives to the property owner v .!^. j/, housekeeper and home beautificr an opportunity to see tht . the tan .WhMs load mmi Cti Vv.** / ..practical application of Acme Quality products. The win- * niTenVfveufMitaadtMMa.ai'arwa,nWd<Wekdasrt`nhth*rwi.Ms.e,MsBntliatnHrt*Huntk,t*s.fBMayidiPiman*>miiuaHn v ^.%U,dows were very beautifully decorated with their product! and vases of roses were scattered around among the cans, The interior of the store was also decorated with vines and aula an* Sfnnvi W tvs ta tbs, 2.roses. \ Souvenirs were given to all ladies attending, also sam- -y-i.^--.rsawv T^Al-'ple cans of Acme Quality Vamp-Lac. I- fwciloaa**ewjnwMrtSsiaaCnatbiTannlSeSaasaa'.wa*aarttnt aa&EB&jm .ssrdsfflegMF* 'Editsr MAas(e*a Petal sad OB DtsUc*:-- , * Vs ui vsty b k I fatsrcstsd Is, ssd spprvcUCs, the ssrvks As! vmftass-r- "itr? ' AS j "iths "A F. O. D.M Ui bees mdcflsg ss Is crMtiag sa latsrsst la tbs \ I,4sv uf Kscs Pslst, sad grs*i*r laitrsic la hb Fslat P*p*ifisc, by tbs -'vstdi dalcr. i At this time ws ars psrtfcaltrty iafsrssted Sa the *Qsu Vf sal T$-*5'.,PiUt Upn.Csaipifs Idsa ss ctsecfvsd by yea, sad ws sis wiWsg asw sscsitsta WHAT UfPOltMAHOir ABD ASSISTAlfCB WB KEOHl i. '^SOPPLT YQV lisa lbs stalst sf Vs*blagMa ssd Orsgca THAT UU >*i. KlfABLB ALL OF VS TO GO AHEAD sffsctlvcly sad iatshi(SsiSy with compete* tar ISIS. - C. )W^Sr(rKlk tb.TS.T fz amiina KnifMhiniif Omp, " ippointrf he CW . .. u-jut-- Ijeti ui .< Ft shall bs plssscd to bs sf wbatavsr ssdstaaes ws'esa la id, awaUtag ysv r*irfy ws arc, 'ACICB WHIIB LBAD A COLOR VOBK8. (Stgasd) B. X. HOAG, Dtabfei Mms c s t Orsgss and VaahlagMn Bparhss. m 0007-SWP-043169 0007-SWP-000126325 ` -V.J CIVUIG AWAY ROSKsI S\ t lH|<.l(nnU DSi^u mi 1 .. 1 Ladle#'at Opaiilfial'>*J'7>'t; i1 -'..`- 'a TbiS^dUu Paint'**# Vaynigfe coa i ' J >' r WAT U htviac (U prlog h mb v la _ I la* TM U u manual affair C MM ? war NmlTi awl U amr fall* la ij * > UMt a brp ank at pMpl; **pd i . i staBy tba ladle* wb* In tbca* motor . llnMUiiiaiQih iatmalad lakauM v koM paloU m they ar* la tb* iprini . r,,. . I itjlf*. Tb* Indian* lor* baa tba pain ' ' ; and rarolab biutaew owa la a (la - aratMo aal oat#** aotaaly ta a (taan tiMa bat to tb* bom* 41r*et->i* Tbi . ,, - -, atava hu cajayad a. viry gucottoXiir * - v -- * growth at baala*** and U ia*l #*- ' mitoa raqulramenla tb* bwliain* U at araaaal aaderrolar aileratfoaa; la-v dudia* a baadaoaa put* Pin Croat! * iAlteday*# apaala* Itoaarar t*#w*U-fa . MMUisr tta.jadM* wttb/MaBtixu ' ' . r * !M.niii rMirMrflWyW-,' Vm * buying *f mj lady** ff*a> . bumi ul'wiai *urfU ai Out u bmt X tto;.totamd.af*ar a* wait nra*4 iatrM4V lb* bamatoU h lmta*avn-batav**V*r Us eUlaeboo, raftie'r*, * ' Central -Pilot * OUa# Cm.-at CadHae agaarwbatin' Wtruwai p--ta--j.-a-r-f.*f.*wi4a*9iii--r1iatrm*--mln*rttaMwaV*a4rS*aa--p-lwaib-ha-*aasWl-laUt'--ralilfb1jhMt1(u'aapMllatytlAas4*outiaAna*-al a-*-at--*-ft-lra-alsta*bb4iwtag---Md-p__to_M__u_ff_w__a_tn lam* crew* of p*o*ld..wto aluafeg. Saab lair aouriac tV tor* *u pntM with a* mi -ai mavamir and vtrlritf nayhi, at - TmM esbuaOlrttaaart uInbb*lMor. Cuar rr*dlifoel***hiaangte)a* total lb* torn* *n iwtotii ` iS^i _K__aJutaTiLu*. a .MWI >_ 4 A Slaaa < i*moabmatMatutbaat "_r**.MM....EM...T.(t-a.fief*l4totoo*aw,*bMiwBltl0laM*4totwbfan .'5.; * l { j> : \ ''z - *-*" <' >?.: <*r S-'j'Z'Zx: -' - I ta^ *^JM(Unlac ipjt at tb* lh mv.um_Z_i_M,_'_tf_*u_L_n_..,"" U *" , T* 1I*# po w nI*IIWttobl>aail`t_''_**_o_4. l_i_B11_*p*_Mw"m* tBRatrtltraliMfalr. to ha<l from tbclr efforta, r^x-tialJv wierr ara nralture. liaan. vomtvitrlc flaialicd. Aew* Wbttt lrad A Cdar W*rk*. 41| Furth ilrtrt 5. anauunr* ^r. .Ipnl ;2%flfk?. *aid|la*avl*iie* for twminwr. all touw'trti.vra *r r*jKr airarr* W rail *n ibrn far /if iafomalioa on wbatvia am ai'J b i* uae tb? - |.ro|<-r pa<at s(*h. >MW*4. *f` T1,lli*b 18 |N>t ,,ie ^ub- Full jiftraulioB of'lb* novel #.,,.> iar will --- a I-" i FOMtnflB !kll * . pa *apb if lot* yitirfl - t ? fcei>ra aa wile! a mb vrrtitcnrat. -. ^ r^,-j-/3W ?5S?1 '-is-'. ` I SPRINCOPEK?Lr(|* ItHw*cai tVi***n>i*f*nWdlall*Fa*iw a**a. *. i Unitiir* |1 Tsrir :** rititoidy <* Ur i *.- rjfrf*.| tf aijr ald h UltM* i> ,* iirlu* tf mm* Li<rrr: in |b* *i..*r krrpn n.1 hr ill? itoa (bar nl (larllhahar I'a.m f w*r i*p** i*m iMt-y to1 m* KtdfNr* at il.i birtin b< it>* l*if* m. intor a* |*r* wta iV* tl-r ri**tar* a big ffli at "?* IM M NVI1 Mail. Wt m..*a I| day,lime tbr ptur *aa w}lb',m*a awl worn** a^ am ttoir i*'ir*pwt *b* ** itln** la *n.iM dat*Mr*ilaaa nlarto or rtb' bl'toa fw ihrm. Tto lal'ti n nH uj|i`t(n *e !.* a*d rara 4f uuj iik b'.aln prorMa* far ihr on5***!TM . Tb* a^rlm la* apptwarlai* Air aa vpanlua at tin* Mpd, tar All A* iito Im* too** MMn >*A tamlMpria m.nltaaM*rlr UM.v mVV boaMll ',,L*i3cs^r:^ tonordikm. li.taa1.!! TUbi*l*aOKlri,|Lfett,NC)i--aaiea\ Of'CinwBhn*aapmbaairgf."5 *prnlw* *1 Hit Cart Oraham**" wi iwiiMllt*aatof,NfIrtw>*MTaiarnafiiaaladWi-Ma..at.nt.io.a.^.rM.r..lt.nou..i.ao.I.ha.'.r.am'Vlwaru* m-,*M?fJ** :pm*auk"r Zto.*aUf*l _____ .. bR .^paiwr. bad *ilMr'^oaa* drew . A(r; l bM lobap, ... Viib',r*aaa and1 i bring .dan* bf i _____ 'n*f ai lb* .. -- r-_-^.ai*al#.J^ba ladla* Hitt. Htoi&|toa an itoalrn a*d | H^aaMpDMf. e**4a banilai by . ----- --diantouto --j** # [B** ii.b kar.iH* *ui>< fc iwi." Tbla la ll.*: . - ---------yn` -AjMb--*-a---y--v-*-- I 1 fp rf- ,/j . ^ 7* * 'J `1*. . 1 S^ir ialmnoblrMa^rrBaai) _ l~ Qaii+otU* ;2ie Co.. - vr/j. .. QEobUfcic Squint bfrtiiiftaUrlc n* jofirn^e' $ri%jaftrtcr0ff* J:. , * . -I *'*-- ' M ~ TIianr'B V nnilii -worth aatlaf la taragrapb fren 1b# Jnekaoa.MldL.PatrtaA:-- j*i. htirA^aff-'bcx | .j/Litil Tb* Jackxoo Mat and Varnlab Company V*- m bar* Its aaaaal opbaiac to-day. A / {.. ^ nzad raw wtU bg glm aaeb voaua who -/j &'t t~J2^afi rnn>aimc4famteiijiRb ^o>* 'dfin;`,(ie S^enat ^srm Slnpreidbefl, bd*Bd* aad tciaplea of da ftrm'a Tana mad !}*& SRiTeit^ ufra^tAl^artcrij-opie. athoftl* Ittaratora win to banded oat. tta firm aat bR ^E^ouftimntl . ecnmfhjlttn favm. a baadCal at da fiowoim to tb* e* rettardap aftoraaaa and Uwlr jut be aaca to ta appradatod. la Patriot Ibeatrty ri'a form*? _ ` Acd 'daaimb jbe ^icUfjbuu^^wt. MefdBevfiu|ctfl nn caraatloas wan (Im away, bat thli ^ -j ' rrar instead o< haadlac cut iftnrtr thatwill`/- uifm^twciniBS^.bieT bcr^iebeieri * * P* bat a day. oat will ta glHa that *ii Hast Ur ywua aa a aeatwlr at a ylaR to, . ph* gtorq oa Bnatb Madaalo gtra*Lw ' , 9fpne^ Cfii&IH^^ iffi'xfcti * "* I frilifR`ale^nmf$tc ffuM I brn flk&nzB^^bd^Wcf^id I.M, We rongt^tourtat. 0007-SWP-043170 0007-SWP-000126326 @*a # / r "J* ' WILLIAM L. DAVIEs"lNJUKfl>." 'jriycamfTtffixp l-HTT. Wh . L. Davies, president el the Acme White Lead 5 *";. jSs Color Works, Detroit. Mich., - 5 * . r*1' iitjtuivhik erouieFFmlire* i. i . > , jpHt a ccalortiUc nithi it ibt 1 *. . Woodward avenue, where he was taken alter the accident.' ' A thorough examination will be made by Dr. P. W. Pah ford to determine definitely the injuries, h is feared Mr. IDiriei* right hip Wuc may te fractured. Mr. Davies and G. C. Hutchinson, of the General Mo* ion Con were eroaatng Fort street toward! the Fctinwltr, State Bank when a car of the City Taxicab Service Co, bore . liV hWal Mat Sa haa -down on them. Mr. Hotehiaaon jumped, but the taxi taw-erred to the north bide of the atieet, striking Mr. Davies sand hurling him under an auto standing at the curbing and * tlieu crashing into tile machine. |* Joe) L. Stockard, snndu-iaw of Mr. Davies, witnessed^-*' `the accident, but did not know who the victim was until he \ [inquired of M. J. Marphy, of the Security Trust Co., who' was assisting the women of the ami*tnlereulotis exhibit in- * * first aid work. He at once took charge of the injured piani' fami tw ti*w'tpwM< i JV* pM MB. MHlwl hr * tpS--Mm UMl MMM UM aWn*^dt>Bal<Wrt*,i'3ll>-,3 .. &--*S}M.M*WI rl SaaTr`x=r.:-, -M-M---hE^XiCSi.TW<WpC*>SrBSn7LCM*rWkSBud) V. __EWirum^WTAk uMp'm**.m** r>>1 aSiw^lfcuthB*. * S^H?*l|iii?iSr"l'r {l'"1 m5a3w*tuSttm. J w lM>KM*i 1 Br<imuMn,Ma--Muipi,inkMmMwham* m-m,11 . ^ IMTtWu m**ur*-*e*mi <sr*arftsiSyt-il aaaws^ss. pttjhimm*r.WC.*5*5u Bbk.jt'MifmS*' minurr * i- CENTRAL PAINT A GLASS COMPANY EXHIBIT. Fittin ' *V * p Glass Company!* ' store, 36 was opened for;' . {the s.pring_ . of "Acme Qual-i*^. ity" paints, vafaishes, aulas and finishes. Window divj* jpiavs of the sercra] products of the Acme White Lead and....... [Color World, which this store handles exclusively, werej ' tunefully arranged and the management issued an invita-! Ition to the citueni of Detroit to be its guests at the open* brig. Sowtsir cans of Ysrno*Lac stain and flowers were7 given to the women. !' I "Acme Quality" rarnish, Vamo-Lac, floor paint and] atonic paints were especially displayed in the several win*!'- Idows. Paints and finishes ol all kinds, products of thef* Acme works, were shown--everwhing for outside and tside work--"the kind that will male the old home and the " fold furniture look like new," in the words of Manager Jack- lHatt. b-- -v ] Large panels of woods done in different status and k- iishes formed a part of the exhibit These gave the prot*r~?` jpcctire customer an idea of what eaa be done by the use* iof ''Acme Quality" goods. Artificial roses of various hues? jand colored crepe paper formed the interior decoration onp *" : nil walls and shelves. Mahoney's "dog cart" was a feature pf the dispby. ,{T\ (STERN MAN WIlX'fiANAttk sPbKAfJE fiTObfe.; j, N* H. Boies, formerly connected with the Acme White' (Si Wo/JTM Ertroil IM| c Hc mo he.a-*~~c."- re S3? -- rl PPt v *> ^*3^ taking charge of the branch at that pobiJ g* LoZiS *Ml **uWl*fcmeB* * the local eoaeem loeatad^r.' I.i W Post street, known as the "Red From or Acme*' RHka - .*' fitfUamy Paint Store, announced its annual r-;-r -- --J,...- Milch took placo lui Sai.rdav. Souvenir ' ; iw b io the (tdiet, ,ko free aunpfen njVSTSS?- Lr^Srht.ia* **> > been . vholetd. .tore: nauntdai. bwwl.ia.lt.hr.te-thddhoioni,uiSspeokoanneSescinocned**_"*".> si^-i ACME COMPANY RENEWS FELLOWSHIpT j_.j- The White Lead & Color Works, Detroit, has renewed i-' i its fcSOO fcBowabin in the chemical engineering department , By [of the university at Ann Arbor. Hkh. * gp:. ^ ISrasryr-! |tt------------- STk Mou mvHai iJIuuuiMMap*rbw* "ami ' * in i }t. |er&ga gjar^ja-TB llaays^SSarfv-u-.s. swtSwk-kyj l l M*Mt SM a puMt yUllU 0007-SWP-043171 0007-SWP-000126327 `W?r.7 _ w o o d ;- v ij c .p b c t o r >. k c a s o x * "ioAixrr -t a in t h a a l f a c t t r - i?2Uiiiiiivu c o x w x b b c up,;- ,i rr -* . -..A, f v- 1 V 5". T--v: fr 'AA.VHIMi. Mick, Ma t 6--Stale Llglry ud Pood lacyactor ^ame* W. Ilrhfi* ewoiniH. the itanjAa Jit ihd K cUla, lo. hpy "Ut.s Oe^nr/.'lulcrwi^ qpit* tad lotir- tbrnky m\w |. m>Be7 uMtnriM; quality, lie .usbuuU the * following. "One of Ibo -fair bills urged by, Ihm driwriw^at-that failed, of;jvW \.$S age.la-the last,; legislature' wao^tfcc pala* '"I - I* , *'itrodacad' Jkj hnm'n VV| * a ,, 'if sfiila by a ?ii ! a , 'inrrfa:' .' jBBl rl lr` tlr iwik* IT uas re 'l|p{**riri i" :!.# n,-.r .ire is mo af " S|falia mI iif mi! "wwvix! ; 1"ij cuta, an i I ppOaltlnn y rui-a * 5* peW. *n. # a 'I >prTtt!l This SlV !U !!(. -p of'n^ai jf'M nM.f.1 a.a.i* -..'4brt of , **. . rmpoiiti^ ^*7 %r ..* p`iw.,i.wi, - os' --^ma, hilt 4 ^ *. . a. io*ndi .' * 4*fS:it r aaa vh ir *'^ * a a4a ham Llie `od it a . ii ! 'ud vitk Ps atari *'S ; >, an. Much Pf*R! la a.* --e a a* r . a ig .budc I'H'Plf ' k I ifiil ,'| 1 a1 ta. :ttha psflfiay v: afiif ,11 .av. la' bfth- run** >af ,1U aliotiId- atlrnulot*.' (bo, -out*1 *'ml*hi* own" pe!r!a'' No slot Boo ti pitMlucid tbaai `fhaK.iu.ailr . ,V a r .e a* . id v&lb bif Of" Wf U ;! 1 * (! mo***1 a ? * * - a*air a-w Mn wfcfia i-- iar pound. a* i . .oiilalmfiaappf, ati irtlall foorr`<| ronli si- * allmiv Oaa hunrti HI iNHindaiif abl^a f *vV. oad,ia|iad. altlt afo gsDioiii uf UnVf -iVsiv. foodvBilwill, Oiakr r'd r i o<ia opj f ^ Ipti'ieuilllUlxbhlUftV lfaflpr PS a . a. a 1'Jii :sXV-J r* jgafaturo would* emit a ir h l tl.lt par cation. On* gallon uf lag ahotiM .br. u-<i foi' orroim rnat-' Oo' of Iha Chfrago nia'Q wlr boyora charge* |j ft* prr gailou for , . oriHd' pplal raaiH far uaa .aiutibrr |L4l pv. golliic; ptu iha frrjfftii raiaJ 1 itn.Cbietfa, Tba r.onourcfr ranj wnilirbififtf Uir local miniham i mLMi,NUiN ftilniilf at- a Imr i<oia '."THi dfoirliamf.*will* funnan' mi 1 4puU*lln e<ali)5 thr or ' Inru-.A 0,1,1 no brnudr] } " - SPl"1 A*nW* U- H l.-4.dral S|. . n ewifwd, w .1. poo.e. * i- [ef.dir y..ru.Vr nnoriu ml le f lfc O.H.. of oll.jTh. Vrwilu rri- - ' f f<| * IM(bt for .haul . ( m3' v" .tiWI n-r poond. .lilrh nvie * -Jt*** '** * ' POIUI mat ohout ft " *"11 eollon. .o >n.!i..< >t uf 11 me br:(ailtan noil nre.r - ,.lh *. " ;.-?. i> i m 1 i vvV.i; -r'jfeftv-..;. Detroit Muwftetonr Objath Statement of State Foo4-^: I ' . Inj>eotor Helmt.rr:j;. `r SAYS COKS0KEB WOTTED. , LOSS BTiOWM .KIXIirO -o-e5rrie--d----'--p--r-ar the aarf Of pvre.Maaeed oHV^SS -,k iwuat of tvrpnttAi .* iTP^Ws bollevi : ".JsKBttpmafS IMfl IV". : , -i . I In. Buying Trom BepnUUo Sim Pnreheier it Anurtd ef Qaei-V 'S' utee . fer-: Hte_ 7etn. A /. '< .. ''vKv. State Fod toapeetor frasa W Uelma'a statement, of Ksftdsjr ad* vislag: oB&stt&tfi - to busr^lasradr*; ata ijid-. aabov (bclir':(>wa->`pa^>iM^ laauriar purity tad ooDpmr.lo.**V' jaotad to bp. f,.frftk, BopdoS* proaUa&t of. thft . Boy4oU" Bvotbo|- ,W|)tU LMd *. Color oarapanp,'. *t Detrelt^yi::^TT^'':,i` *" *, SBELMEIP IT' i, "It la a ' latq* dalo'for tbs faod laipietor to augftit to tbo coaauqi'-' r.thot ha- uao ivkUy puro loaid'j and break It up'hiraMl^ eoM Mjr.j Bopdoil Tusxtfay.-. aftornoott.^^-bjBuaabor-** of paint'.-aakBiifbolurdra hart beds la bUalooaa hill.r mo < tory, and- only la vary raeeot yaaro baa tboro baaa any iflittiM, aa to th parity of palota r "**"^"ralata Arc Kor to BaWa.-*J' '-^`,**1 " - v . ' BIC MANUKACTDKER5 POINT OUT / INCONSISTENCY ES IN 1I1S 1 ! : *AovicPm-' l* "Hdtai Made" Produet' Not .So Prae> jl^V'tiicfeble a# State-Official -"FalftU afo aot id be'-'^taa' Tbty tN ia bo ftppllat on tbo ourfaoo of la aalraato otruetaroa and ibpets to sv-; -'r ` ' protaet that... aurfaco. and`If; tin uatrar to preUettd orltb ft ft^aataa bo haa notbinq to toaa, wbll# bo deoa loao K' hia own- ralxlar* af a--tr.l.e.AO--y p--u--r-a---l-o--a--d"ta,ady.- oilv' c:.lvva\a Ra-` ............ - - ___oratamd 'why bft. Btlraa aboald racoaMBand tba aaa at jtrtotiy para land m oik - Ko naka ao^-rofarttaea to. tba 'coat 'at- braab- lac VP -tba? lari ln oil. aar- to tba. quoouod. of th* ; ooaaumay'-'alwaM... nraag a-parfaci ahada arban tint-? . Uur: zwr-to tha dincoltj^-of making - a aaoand oatcb .of- ,tba- axaot akada,? :`6tsie ' DMryC/aad'* Food-- Inspector Fauoo. `W', Belas,, Is* u, oftofal - bvl- latln * raeantly, . la offodt, . told eos- uudem* to'buy; motorola `and raaka Itbalr dw: paints t*--nsauxa purity sad eooomy.'V JSe. Hohao also, ro- f^rrod W tbo fallnr* of paasago ot tba. .s puro point-bnX'lntfudaceOi by ftjciontr 3deNsagbtoibvasd attrlbuto^ <tbo foil*; sro'.lo^, eartals ausijufadaraiv, of sdand LsluU. **ar - fT- ,* ' -r:i, '.-'nfa'.nrlUirr vpaoood ipr 'ouiqwrtiid * "la land la oil ruarmatood to ftrO , tbo* oTMdmant of !m propQfeod las;" aayv parUeular faartbU of. oarrieo7,(.... Ia It caaraalood.aot to; ebalkr fay* tharo fftnp aaauranao j to lha aiaonat or lima any* ena ptlour - will* pvt In ihe.bteablDg ap.-of laori? . . .f.iv^.vibS*.' Oiia( uf our* afBoaro^ was ihiafit' rdjPT of ` iha lf|!l Bfe, onggaaiM mt > tain isodlflcaLiana which;would tiara ,MMoot palntarv proftr to bay tbolr aid mad mlr Ii la fbtla nwy abopa t a palntar feu to* go to tba lob (ainmdmbrnorork.1 ip no load bought by * ibo lo polag to gal In ^ urangtbcned*ft<sad broigfbt>1t mora ls Mno wilhValrallaivloilNatlon In* other alciaae * - *il lo Mil llalara'a tutdwliid doriml Unto oiNffe to prelaet him In'eaar Mo turn d<t not pvt the aamr *r<nt boblad breaking up-Jlho / load, oa ! ibjtfcyrou)*, *?. Uml ifcop.MV . *. * MaaifftrtaM niiif te'1 Gaaraaire^ j. - lo proiant tlra Inlaraala'qf.'omiauwera ' > Wo Uilvih. .howorar/'thal'ba' hao'gmo a step toe farMfv&baUx WUlni-tbam that oooneeny abd puHtJ^wdald'W !*- rarad hr mixings thoLr. otwT poiati.y^ .Inia ih'o* oil'ior afamd.r blgh-giad# 1 *t 1 "Ir raecna1 ta'rig. th^-'I t- "'-i.*- raanofacinrod. salat Is sold at fair srloo. sud b gaarmnlaad not io walk, crack par part for Booyaaro to oucb guarasfra la glyan by ih* K% of conmiaifRv^thi ______ ________ Indnotry abould ^hsra^bpaa':%ra tboi^ uughly luTaaUBktad-by Mr.tSolrao. bW fora ho rlitunOy-made * rsceaaaoanda^ ns issblng raady mlaod palatal asiorlaia pro carafuily oaiacind an4> ffraisnd Id koaoy machlnarr. gtvisg; s *. porfaet paint af unl/aro fehada. ftlwift. as lha caoftuuar can buy < lllos (hot esaiaasw :gaatraBr VfttH, `jwniilt thkr bbt fetMtato^'alk* |lag lliefr eoW3i paiata^''.'Th#'`arf;f v palnMnahiagte han ; nmdaAJ oobnbeua s^y-qsBUgr. VttpplaraaatlBg .U with I l ftuwra^ ^^^evhtuwy^.f.wbani tisr ossstltln. wlm ns wsrlstlos) ^sSi'iJ^******^'^ j WuJv .. JUo 1 A' jcutiasraara mixod oil'and }* -------- m ka At '* 1.! m "1,V5 * M5.-J i. c-u~ V i`*l Ii;*- 0007--SWP--043172 ?l 0007-SWP-000126328 On '.'tt -jrt:;of1_ maaufaetUrtn ,te- hypaotU*>ou>fY *' n Mata vVfc'l belief ' that ^tisir1 -'products'w*r{ superior to the-Thaod- ,jmade*artlela'>hitt tnaunoertonably U di to th^^tet .Utt tMt product* r.apryaairhMtu^dWattnct adrantey* -over bMU-dnufterudo-giothods. v _ > O ifta :' ."Prepared .pejBts urt -. Offered by pash atmifMluwrwit iun>- a adtutaucfatt,'<lwiiMi y v<u Dvnu,< - i4'r4 ntntMr.dt other maatH llutuiwi, wWUl rtiauir MntiMti-tJuit Jdfc shade la -a |aw 4at itNlt and tha htndinta mdetfhe >rifld 'to la*, 'WM jtinMltr result# `Ifli f mry.jihf.vlnwo-4praparad,^paints m-ac,*eetune ati wloti in val by buMurtftimctlcol pointers-Vad -deeor- etorsVao-ihay,.repoaotat icoamw hi' -compered;jmh the'cHme" end-labor j>.tbhffrCe--MlTt--n.r-.-yMte^g-fawfTMlaalei >;,tohrea -.malaetee.r,iaolfs-fLr. 1 ^r-rt--pisnllTfar giw^fftnrv-^fnf ihr PAlatv .ir'-dictnUir, wbo/d*eirae , to secure ..spade! hede^.er to .maty itublvw ifMr Hha finishing *of ' sur- teeae Uut demand special treatment.' TtuM'mn.InTi spent- thelrdlree at hinri&|i .how.'-te. eanhU* these -mai tcrials to`produce satisfactory la it nuootUa.to enppose- that -.-the] InexjHxlenoed consumer. can .properly] accomplish- what It has-, taken. -thdeeL b m jtaia;to;iran^c:^l9M **Jt aseme .'to''be vtbat 'Mr,';Hel(B* might ahout.'as>wall -.have rseom-' .mended to conaeznen -gnneraJty .'that they secure the material! 'for-'the doth lo- the clothes that they wear ; (a they dll a laatmi or- so -ago) aa ?to rteommend ghat.each jcoamuner -be hi# own -paintttahor."---u tf-i*: * v ' - J.:.Vna& ; Bojdell stun* says.of Ur;;Ks|res*s.-,statements: "Is thiM any-guarantee -as to the amount of time, any.-sne painterwHl put- on tha Iwratlnf up of lead whan one considers .that, moot painters pre- ler;t* buy their-awn toad mixed up In fbelr own sho*ft>^5v-- fc ' "In the - staking -. of - ready>mlxM pUau materials are carefully selected and Anally (round In heavy machinery)-. clrtoff a perfast palnt'all the time w tjnuorm xBase* 'ibahiAf U'Tofs&BWIoB the consumer to Jbuy any tWBtitf'ln .waste and .'mhttnue on- Us-Job cron jtiao e tbne wfthoutany-voriatiep.of : *'&' i-*r " ff.frfikv.T life ^ * -f fa* 'sfC- 10MOTED > T0 sfitAKAflEEl III .Hava Charge: of bhicaca j ^.' ' Branch.';- .V & V Ruet From Cierkjto^^ 'i**. ' Ma" ria--gei:of .a"B. raf nch < V " ` /.`ii'/J SL '"J'-Y- ..m I3M lirf v?s*? vI-- ': i - /.fl -?ii *Si_ > >WHIS--Sw--rjeasawoil . `, & :,^xHivXHWk.^. ' L* A. X>oinhus, * teooanlslnf the .opportunities lh the palut;^n . varnish bualasa;'.he entered-yttfi employ-of :the-Acme wblCs-'xaad At Color works as dark -in -January ..of 1101. *. In l#V ho* wu .traadter^ .rad as sales eotcsapsadsiilv.lo tbs . 7 r.Chtcexo branch, wharai also aetlnr In the' sapaelty-el a*s(scanf ie''the manacer, he became thoroughly echueintaa with e-h^rffa prosortlea of -the Chian trade,*:> Acoeptlny .the Poelton ^er^..- head - - correspondent at`the heme oillIce In Detroit In llll, Mr. Xtonahua re mained in that pealtlon. aedae .also as special resrcMtstaUV* until' hie , . recent promot<n to the management - of the Chiee|re' brneh of -ths Acme . | White Lead * color work*. . , . ,j j.1 * ' "ij>* -`i-.r* -wii*-*-*- * ^ -1 - ' Vi."jc iK>.s'Airvs. V*:.'*.' ***** * . r vf .^ L. A. Donah j o rairrrd the employ - ^f vtfca .Acme'.:-Whlte r.Lesd . andJC^lor Vodceito;lNb_and 'thiciixh .contihuid .prtfmotfons bo'-baa risen, to the 'to>V' [jl^efi^b^oc^appoSLtel /mari*jrer-o<-the iimxnpeny*M,,jSUcs'ro branch,1-Prertpos |V ^hlsSassoclatlott'1tfitij' -tha^iMm IVtlte l AJ -*shd Color Worked TMa" imnaiib# was -with `one of the lavys raJlraad compaadsa. ** , raarb.^ J-ly-JW "W m 'net^ WHm'tiuie^JUQr ' BMAtKectursf-pUtdaff out a hlah-crads , rpaltr .who 'does'not tlioreitfh4to nte Bneesd Olb which la the ww^place 'Is bought-from a MhsbU*srneMr;i>*r. Hebne refers Ttb'-tavurtour .bUs. ojhta .Is raa,"ud Mla itstoadMeo-tlut M the paint maaufnctujwrr have to oofts tod --with wiwii 'the^eoewatr ptiN ehaecs elh and .to "be"fully-protected on this poinv the tMt ef. paint should eseertala -In:socM^wnywhose 'oil ha ,ls huytnr aadyWhero the 'dealer-heogbt . tit,sued* If^thte-ta doM'and ho.hade . [ It te purshseed .nn a paint eoneern,!/ we are almost posit!vs that ha can lb* assured of .purs linseed'oll/V > . --TMi. ' " " 1 yf * s''y.'d., ' **-<* `v- * * - j ** r. f'-', } *'* ' "* * ?l , ' -. mr*`. ' . *'** v'- r f -/-I-. rf 'J' .'**.* Iii-.: - ^ **5t *- 0007-SWP-043173 `aii-'v 0007-SWP-000126329 * **-*: Our aggregate business for the month of May represented the largest volume tre have done in any eingls month in our history, but branches almost without exception showing a very gratifying increase over the same*month in 1912. Our total business since the first of the year shows a decidedly handsome increase as compared with the same period last year. The regular quarterly dividend was paid June 1st. . :& i 0007-SWP-043174 0007-SWP-000126330 ACME HAS NEW CHICAGO MANAGER . L. A. Donahue has be_e__n__a,p,p--o--i-n--t-e---d- -m---a--n--a*g-e r *o-f the Chi-y.-' *' cago> bbrraanncchh ooff tthhee AAccmmee WWhhiittee LLeeaadd aanndd CCoolloorr WWoorrkkss,. ooFf PDetrao<it*. Mif-r. Dno--n--a-*h-u- e entered th e employ of the Acme t - v n.**. r 5;j\Vhite Lead and Color Works in 1905 and through con-1 - --------------- i. vuvd 14* i/U*' UIIU 1111 tinned promotions he has risen to the top. Previous to his association with the Acme White Lead and Color Works, /Mr. Donahue was with one of the large railroad companies. _ 7-J6-/J filANCTKNlfl F0R;t:j 1 /nrp-hiriim DUMMmm , Ba ^pieaed/dat;today? ' OWo- All _ Worker* A '' 3>ajrf. Ontlag. . Aem*. Vut* * ^iL^*4c.A:iC^Je<^.Wpeka.~iriti, ;bpia';a . p^pteoW* Saturday at Tlufa Bb&e^aad /Sf.*1**! a r mm ie ei*#d ,eii i %:.* a 'kti* the TecwpanW Tfm* . **i p . #- a ttnr*Toa<lfc* rival*.* ' -* ^ _* J f 1 Ksi* p i > .ifraMa farpt jea-T ^iii'aiii arealnf famu' iad * 'Vin 1 *av> Ms otdt.br UM cnJ*-' 1 r ip.rn, m e| fM norcl a* oMtett*. PJng; m\;eolcr^; raca--tka Jk 6trirt determination end e*tcblo'i of creriou* oolora for Oir MM aed- girl*..-. With Uli u zepptJen.'aUj * rateime*"o. color* or* palate wj fc MiiImh of any kind Vitt M taMo^' ' D> ti>< tWi.fSaUX 1 teruub K' irtll ^ruli'iust -aeban^lnthfl tug of 1^, irar. runjuet iulsotJn tbo differ* K- BOt rees end ocou?roa aoidwcii' son-j,, rj bhnraa isy,fnpkr*.la-t)w ptaaK- ili Fellas Ins are the wnimliieesi C. * t.*f n Nil, thelridao roroplioii, ifvlha frHktertln. lickrte Mid <**> *: *r- t(, krAI'amiiRainiiiL . William Tlieil * P-, ;ho)r*ian. O A Mini, t. a Uevka, J* Itehrrl lrS. & A. Jewrll., ErcJ! 11 Mwitff. R. ML SHios W, nonrft, It . Kruk RrnKli; i i ml Jamas lUrrli. 7 rUiiu. John Iilur, W, Jlairott, .K 3R Kft2'fCFlognb4iMNMat..lVl. Da X, Rifles.," P5f. lAitsstorlrt- M. nf lliiar, iobn llarrioi'flfoc* "Janiee - I? famea KMilr.|, H'llllun Xsi1, Kanlt 5 MuilOU II. N`uU M. floaidlM. E > . auck U. lufe Tatliol. Hat- I'l nr Walk's*. Andrew Wru*l . * - P . Mna*ap for. i bakolieJi factory in. 1 Wall 1 k,'.CL tyirelt r. I,'*. K SmI Itarrlif Ik, Kf .I AK^|L|.'iCr slwbi,aUEr&ftZbfa.flEUMr Sionka lff<ilrlf0u1a-1. rr floaytaam- WNlWrratf* It*, f. Iliad L MSkrf..Uj J/lltletoiaf.tt>lt. fte*a -----1-- " g 7- JdT"/3 C0COR RACES TO FEATURE 1 ACME EMPLOYES' PICNIC *4 r t J Color raeet, Jto determine which boy of-jttrlitB the quickest, sod most maCehlnk ~66UiH, will ~b4 * ono o-JtiV.thMti'pxcniDa ieatunN of the b t jpjenle to .fc^ flren;, Saturday, 05 B kstBiaac, tor o d s Iq t 'u of tike Acxno fe^aTJCCdlor^jrodai^jUn. em-. *^iBaeFroaVrtuttfo' ajjjwnaao-j ?/the pleakC but f&e comp*07 Jr; la the fan asdr eldis down day ao eTBrybody can v There- wllUbc * number el. 'contests for-prta*t.7 jofleera. and forepen .^ot the kl'.wlll all be present for the Bea, altfcouph.no raterenee to ____ Ji vll) fce allowed' to.tntarnipi the immosements of the .day:' They ^Hat la one of the laryut paint and | Tfeciah factortea in tha world.. [ .. '> - " BIG PUTINS SATDBPAY:>- |Aetna E__m__p_lc__T_E. _B<d.1 ' -.`JE-4. .;T6# ptiealc; ofT tha dmpteyee at Umf Uiema 'Whlto LMd A.Ctotor votica.. win: be^J^ld tomseWw -at^"--Bob*-l-Ay,/TTtias MUUff,. pl^-wQI Valaaa^aU-dk^aalllleovwrfDS^^Aii smkI thALiii................................... rtrorV maeta . ________________ _______ _ aln, yarnea. and aeateece bay ->aaa uraafed by tha eaapl^rca thaataafraar sa n IM uovd''--* - m *v--oh1--rad' b"e* - ,v f4^*fOfi0ff. tObiae?boanr*!.l aeand -*nitrHts ^jeWWUltbk.._tk_l4-. rcae aKeepftoa,iaH i^enmea fce-'oalefa ar. psiau^orrbaabieae y ' . l .c - JUaUvi leh.Si>M I., th, SSm!S?" ------------------------------ ---^3;? ........ r ^WATKINS COPS EASILYJ0 . . 111 pirw Aou TiAuj Tt&m OnJj To! ,ate.' H1U; 'J I rTh# ofAee feres of -& Aesas Whtta ^ Lead and Celer Work* defeated the Hctory Item by the jeer* of 21 te XT*' Huny Waikiaa, pitcher and ia*nater of the oOee Uto, amaebed s hosoa nm over (he center deliler4* head with tha bun full 1 the tfckd lantec, practically Ukliic the caau.Whiteyj ZsUcr. of the 1o m<V iru hammecad'wit > Ua. lot wWW Wetkiae aUawad. -but 4wo nlta/ ' /f/J f"CrX. Donahue Ha6 recently "risen'f0 i---joffice of manager of tbc Acme White Im49 end Color Works of Detroit. Mr. Dcuuhoe^l Jib s been in the employ of that comp for about eight years, and his value hai l jaroTed by hia continued pronmtions. ' VfA? 1 The Lincoln Feint and Color Company 0jS Jetneoln, Xeb., hes transferred u\' ; 'property to the Acme 'White Lead and Coicr Works of Detroit, Mich. The transfer really indicates so change In the owner* skip of the company. A couple of yean ago the* Detroit corporation purchased approxi mately all of the stock of the Lincoln com-. pasr and since then its officers have brt& in __ charge of the business. The transfer is made for the sake of making more c o brenleal the management of the financial j aflalrs of the corporation. -A/k- [ ''is `7 0 mm.o vriorrwon* yoinee;- lS^i^l5rWiw"22E4:: -- __ wi niiTTir----- : .W iisk: rS-Voouiunnecrr xo* ten irnST WptoMp of'im^ 3*. ' *..Cv I" _____ a deleglaloa 9t jimparty o*n- *- WieirfayibatUttt'^dBs.made the trtpu bito/ieeti&iFof-`th*. d^Was-tbe. ath-: `latfe^preemid^sf.lf^eTiBtn'1 TMqi aiora ttjaa^.ajprtsM-owtt<jLS j C.- asaatal^aiufrj /SaSSjf'b*t-Ati)la;tviiutrU th* Mlfhbttrhood tbe/Ae&M:, White Lead A Ceter. worteCjtetaahd `eoMen .eeauelttee -on abort* MotxUr aaalart' parBilaaiao' ertasr straa. to U---U---^yiln>t-B*dMini..fj..-.'-.il*a. ^'M --oi t*f-u--ae--t--t -a" aaa.'of;th PMWttoa eoonxilttae.aui Uibfc^lterUa-;Mi-te leharsf tmie^I:etdrlfUailidm- ubk'd^fffear.C ;aW^U^haJ^*K:-Bamc>a?y?_i>.- m: 0007-SWP-043175 0007-SWP-000126331 '.jlpjl^SXtthjho/: -tfxAts O/u^^y- jgrfjs -iOt.1 -. . ! "fl!Ss:i'_ . .*K - -- '- CV~* :iasUE-OF. ' ' v- j StocuoMen/^oi ' Acmey`.'White Lead i Color' World iui-`r. ; v. - j,y *h .^Ul1- - * szctrEiriEsVTd -BEnran^ I 'rtinxsein yroEBTEDKiss - ':-`h'gr'r A-orap-b-BsBc"fAn, w-il--stererau- -'TiialenaiisoffoMr-o-D-n-ee--vy-e^--l--'t .J* au*Jt-kVe. V^jCb_ftj_i mTk. ost_t^e' i.U$'&/t*i', * *. J-a-,* J r-,,> .+ f *|i. lUiekkoMrri .of |k Anne -.White l<eei!a>h ceierl.W.orkb'.nf i*n siiproval, Salanlav (it theVUn Cor s' ItfOMM Iviuv af bunds U'Jth* compani. V\.V* ' > ** " . The^eiidi will be 11.yen a. I per 'eeRt'jWftpIaf cured _by; a>:mortiace covering ;a!a-;^infarAdi:dbro^rtl of the company*/Tb*' Security* TrubS company rlU'*bavtrvstee' under, full mortgage. .Interest dates wid-rh* 'January 1 sad 3triVkl oarii V yhs bond* . will be dsfrd . Juir.^* Ml*, end (be>,Hral of the eenei&rlU' mature Juif i. mi. ^*UaV ^ Pniseen Je kiglalarli'!; '..-j^Tne; bondlas^,,^faajra:.;Th jKe^^cli5JrmAqf'.dlL^the-,'aoiDps 1%nance committee, raSerita'a step have looked- forward -* 'for i time.* *]^ a .no* little 'uitotoetloa ! myself and other officersw oC < < 4eoapany (o ot. UteYa-yoretele/Bfr o*r. In" WhlejRi-Vttr.' }(Mihe!dera rend thte aet^d,^a!ad-lt.repcks `for tBeir eoadBenoe In the wdaedfr | BMt kttd ^uii$nr.df*eiiF :be>i'aeaii| r rresre aco'&fe "dsteriauied' {,' eor- kwlsMolnit'*lie!V''Ud fsie^ ' - 1 thMt. trtvanef'.be > a^lMvr to&tienaV tocar-h the! ptla|-|s4 e^rkleh Js. dasUT. - YheL^--......................J*4~a*.-A our boslaese,; about M din ___ ____ . . whleh* OTery Mjetlea -ot the eeuatry ie tMreuU)r:ceirmd.vis the be* #evldenee f onrSeaeeeed olaJth4ai [four^yeaia ' 'ktWy'basliieds'.ksji VU* rereeeed Jd^rer seat and *n `tha-las* year .M.'Mr.'diet'^u end Ju>e . were the larfeat jaeathe ii in.- . tory. ;/. . * *W`hare'eenie te a`eair I- s . biulnees.'career.where we sate Utaed what Weket pot ? d > Mere , tvfere U he>een*a ease nf, fnrl oping delda -feeulrcd to eompletc. our eebein*' 'of . distrIbullea.' ' Fa JQ ivr, ji*vl*pmaU v imu c i m n*ir;'i(JdMi Jl.'* -*f-in--u--r. "dJ t** carving* araoU.W- f iDUir^tT uM retirement ef besds & tote dividend ,ep*o Rk, v* -bettor* ow reasoning: l*. iteto *** ts .b* **d. used*,.emalnir **** degree! uttrf m dtbir at eongui or iht id'''ilweeikt.ln**Ulotdosbtseimdnpdley** :. *uadme-r fcfcb wlll'raak* te' fu)' ,t# year w r**r/.unUl it ey*- iV*itd*tt.^Tu Imu iiim at jt vttur ,a*M c #w IDImi `ib*4U ... msMtfiC*. ^aadietreagrkeawj*.* '-'h& r^ .Mr.- and.Kr*,-' M. J. waatu sad ` t >rdaughters, the Misses Ada and Helen ? * Waugh, expect to.go to Lake Okobojl June 1 to spend the summer. Mr. .Waugh will retire (mm business the *llrst or June and win be' free to travel **wlth* htB fajnlly. In the fall'Mr. and * -'j Mra, Waugh and their two'daughters .`- will -go tbmd to spend- two iTuh. . .i'Thelr home* %at . Serenteenth khd G i:'strets wilt-be occupied during their absence by the PI Beta Phi sorority. Lincoln Paint .Co. i;r ^TransfersjJProperty v i i.;.to;Retroit Firm --------- , s ; i-,, lu . a - A Cj -V nh-.:i.- al.M i r.a r-rd kli,lii a mh v iI'. V 1 TrA e. i^ ih .t j s ; vnrrnrr il: *tm a* nr Vfcii"e ;# ! * < i. A* , * If* * Mirh ' Hr<*Birs.1s| uuirrr;`.*pivKPfa" t.ai s1 o' ss*r nmvf) .g p^pr"* was *.*^i a i'*ii ' '* iIJ* J Ka C0`.i.:y rjr-b i.f |^- jlrds**- f,.' '"T.. s'.J af.lhv same nMi i Ur-1' *r*m we ! t'kr res! fiuir, run IV1 * ' " *"- if <>- ...t Milrty /t ot lot 1. block- BS.'Lincoln, ffirf Jot. 1. to .-1, ioelu.i\-., V^Uncolo |foui<l oonm.rtT'*-j-. butmiyuuin, - tdhulcs In lb. own.r*hl. -bf th. eompany. A cojplc of yw.-.^o tko D- trelt corporation pucohnwd^oppraxl- A-trix all -of ,.tbs tot*-^ir.tllk-TUn- , *oln -company o44olnoo<r(hm>`'Ho'br- r.'f.Tfcbitm `Af tko HI tchollikWualncfooaT. t3hk.-oA--atkra.-ar.ffn-hr.lioldmSardios Sat con-rrtlkut dCJb.; mOnubtnaat vof th. flund1 t'l jiaal`re . ot.'.tllc^p^tiKiratlon. ----------------- -s.fei^ssa"fe Ga s r*]wm04r<nk 4Aem*4ftraii*,jii*da! to Celor lit. wtoHdtr./ja ma(diBc/Ha''toRnii at |MM,l,*fe*nl**-s--.th* amrlti rTreai. eemsanr h ` creates. readers tfi< ftemi at 4 pat cent -MrieJ gold Weds l* be Sm*d W to* Mopeej, .*!** the mortgage *ser*e, tut exempt. Is Xk:bJ-` " /f/3 i ;%Ap.i>qi30irmo h k l d d is k a s c OK.WlilCH SEUTIVES MAY !; ' `-S "*RECOVER.1 .*. .%. * * . T- ? *ML>* f f A blc jSUto.fafJie^ In dednlng plisr [OonsUlutes .^brceimtlanel -^Blseeers '.tomeh.under the wiiployM* eon:* ------ brC' yes'terday Twhen.ltRedded.that.-fasd potsoalng - 9jr WHIHM MnH|miNMii>M mb mmm--m mm '..IfM$be..v^ektm had-been, crashed M tUmaeblnerr .or^htown bp :Whlle^,work- *;-Ib * a Vpowder/^ factory.'Vv.'The *ras , of- Mrs. tAu|UMue 'A'disiiie '^sge'nsl the Aiaoi lean tlld Ijesd d , Color Works beesuse -of the doe:1! / of her. huthani^ wes-Uie Bret c u m * -df * this."fasthre'.th .bf^daelAeit'^j-V; ` : * Hit fmasi eontended -by -theijesd. obn-- - -kmnjr^ihatt'lesd;.'polsenlogl Tla fX^dtoH- .deec^Hlte ihnep$oonla i^dtphtherls^1 for ..whieb 'the ,`mpieyeral'afe^e^;ye4 -apgnIMel.-VThe t -facie :;W*re" odmit- -bid &hat^AdausAad werhed/fatTlhe -ij^.-i.=.^ai.->abothiLSf aorW-lhat )>eri'M-`fald\'0n>Mrtda'l^ul'rbo(sealBs . (pom^SIwhlch.-Vhe-.ll: died'Vaboai'^two j |aeaths.^pffa'>:iiavtBg''. ibif-*eoaf^anFs jo^c* ifor. n. wookn -.r pkilnnak-<m -^B.MTM'ADd tiM mai^ttr.^f ;tli.>oar4 {jMPo-r - wKk --'kor. ft U.|OoaM.rto e. x*th*th* thaC;th**`eompany. wU/rcarcy jfearty--'to a' -urgs hnmber'Vof jeueS p^wUhliTlbe atace ef MlchikW^^ ?* ,t ;Sil.pkYfiAdo.-w.thhge.Uyr*. tJduaefmpoetahnaedAresudl V-soaannd*'.pfleiaalpsrBUt mkpi f btrhheo iyiumEn^e^ofobA Btampbea ' ' ireeUrdar`aftemeoi.*fittejl.--TM ceppfayad tr-Uf ZMiok ContfU Btaae .'Boltliig -MUU/--rec^vm^CSU2 ~}*m Injorlee .ta. Xhelr. udoF^QMObr44 3iU ,H.vu if years old/*.:TlMfciaw. dees hastuprevide aeempeneattepWey death 'Ml' In the * esse 'of- -ihuee. > derwndent -ea :th . earnings .f. the CaaA ass. !?* . lu the. tefemhphen as( :the-fady ed- l*|48 depeadsau wees k k b s '-younger ;mreUM,.aBd : efstera -irWrMidj.tbtor^ :3>i - - --ttlltkr...... 0007-SWP--043176 A:,2FWSle 0007-SWP-000126332 8 b'r! ami Color Works. Mr. Donahue was ivilh one nf the : large railroad companies.________ ____ .-- ... . --v The Lincoln Paint & Color Co.. Los Angeles, lias liccn incorporated by M. W. Neal. A. M. Woodward. It. L". Judge, H. A. VVicland and E. 13. Temple. ---- - ------ - ciiipiovees'l .engage in the outing without loss of pay. Games w Waved. while contests^of various kinds were promoted aiid! - . . ...souvenirs of the occasion .distributed, one of the novel cot^L tests being a color race--tlie correct determination aniu matching of various colors--for the boys and girls. Withf this one exception, all reference to colors or paints or bust ness of any kind was tabooed, and the officers and fortmerf pulled just as hard in the tug of war. Tan just as fast in | ^different races and acquired, as much sunburn as any e plovee in the plant. Following were tbe committees: C, S. Neal, chairman re-1 OFFICERS OF THE DETROIT FAINT. OIL ANDkifrW-i ception: Martha Martin, tickets and baggage; general ar-l rangeroent, William Brett chairman, G. A. Allen, I. VARNISH CLUB. ; .. Beebe. Robert Irwin, S. A. Jewell, Emil Mundt, R. M. Xi|.| Jacob H. Hatt, usually known as "Jake" by his friends'*----- son, W. Roemer, Frank Smith; games, James Harris, chaii and others, was born at Wauseon, Ohio, about iorty-two|sp,]j 'man, John Adair, W. Barrett, F. Condrin, H. De Pont. I years ago. The first fourteen years of his life was devoted to keeping his parents and teachers busily engaged in im-:' parting knowledge which he made nse of in many ways. _ Eggley, E. Fishpool, F. Gutenberg, M. Hager, John Haixiil Ivor James, James Keating, William Koch,, Emil Mundul B. Neal, M. Reardon, E. Slack, M. Straub, Louis Talbot,] *- - , Watkins, Andrew Weilzel. c-up for basebalL'factory team: T. Wall, 3 b.: C U- jnirch,r.f.;B. Neal, s.s.; James Harris, 2 b.; E. Egglev, 1 h.*j -----!E- Zeller, p.; L. .Steffes, c.; L. Sawtelle, c. f.; E. Goru, 1. fj i1 ' (Office team--W. Barrett. 3b.; P. Bissell, r. f.; R. J. StickneyJ i;,; ^ !s. S.: H. O. Ellis, 2 b'.: P. R. Beasley, 1 b.: H. A. AVatkii ! ' jp.; G. Haigh, c.; D. L. Rank, c. f.; W. J. Haywood. L m - J. H. Hatt, President. ?C$fa`C*Brfcs.| j "If! His education in the public schools ended here, and at that I r.^l early, age engaged in the hardware business. After a period of twelve years he was obliged to seek outside employment because of ill health. After traveling through Michigan for a time in the interest of the Penin sular Lead and Color Works, he -joined the Acme forces where he still remains. The Acme White Lead & Color Works has leased the building at No. 209 Wood street for a long term of Jake baa sold paint for thirty years and likes the garnet^. J years. The Acme company is at present located at 240 o much that he thinks he may continue for thirty years !&T. I Third avenue and, will remove to the sew location as sooa as the interior has been remodeled to' suit .thfpaint com-. , Name Jake; parentage German; age 42; disposition--well, a-kipany. be is a trifle hard on the bit. but a small rhild can drive K'- ' nv-N' 0007-SWP-043177 0007-SWP-000126333 , i get rid of the job. He was one of the organizers of thCj . .y^'r ob and has always taken an active part, in its affairs. Prior to the Acme White Lead & Color Works opening .' . Jj-""., its Salt Lake City branch Mr. Sconberg was sales manager, traveling salesman, store salesman and stenographer, andjjYV/ even office boy for the Calmer Paint and Glass Company, s-^Sr.' who were predecessors of the Acme Company in that ter- ' . ritory. He has spent about eighteen years climbing the ladder, and he says he is in the "paint game" to stay. That ' he has taken advantage of his opportunities to increase the . business of his company is an assured, fact or he couldn't hold his .job.. It is said for a narrative of Mr. Sconberg's, faults he refers every one to his friends. From these we t-' *C" .- have been unable to learn anything which the subject ' T p' '*uggests. Mr. Norman S. Runvan who had taken charge of the fe Acme White Lead & Color Works branch at Birmingham has been returned to Cincinnati and will be local manager from, nowon. ... i - r N-I <rn I .j-mmmf.--fm, ' S'V ' " \r. sQ&SS? V-.- fs ' - vs*-i,v4__&__ _ * ' ,, 29 5 ; V '. .j ' 0007-SWP--043178 0007-SWP-000126334 I te: XiM:- y AUfyi Safe, l* * *:r*...-* * STUDENTS VISIT PAINT FACTORY. V?-"'-' -&T About forty students from the class in chemical technol- |iTXu-l ogy o'f *th* e TUrn-i!v--e--r-s '--ity -ocf Michi--gan, --unJd--er the `instrruccttiioonn .(*} *.iyj of Professor Alfred H. White, visited the facto'riyj of the '' F Acme White Lead & Color Works, Detroit, last Saturday and passed a profitable and interesting day in the inspection j.-.wuch,ra.j-.ac V- ; of the various departments of this factory. Points of special interest to the students were in the dry . : color plant where colors and tinting materials of all varie- -? -faff:{ . ; ties are manufactured by chemical methods. Another point ; of extreme interest to the class in chemical technology was the trip through the lead products factory, where while lead, red lead and litharge are manufactured fnim the metallic lead by processes which are'distinctly out oi the ordinary. -m-'l -- * ' After inspection of the factory a lunrhcon was served, 1 ."i. <w< * .:X itbS4'~^7i college colors, college hongs and college yells being much I ^ 'rin a 1 ... ; r-r.-T 1--:-------- -------------.-- ................. . . , - -!-- -'inrw J I '.r: .rvif v .j Ct E* ' /t T" SPRING OPENING OF PAINT STORE. Tulips, jonquils and sample cans of paint were given away promiscuously to 5,000 or more persons who attended the annual spring opening of the Acme White Lead and Color Works, 1008 Houston street, Ft. Worth, on April 4. A spring opening for a paint shop is something new but it "took" very generously. Persons who failed to visit the Acme Saturday would not believe that paint cans with the aid of a little green bunting and many flowers could be utilized so artistically to beautify a shop. Cans--anywhere from gallon pails down to half-pints-- literally formed an inside coating for the shop. The dif ferent sizes were arranged to good advantage. From the ceiling hung the bunting. The idea of holding a spring opening, as explained by Manager A. H. Berry, is to get the people interested in things that make their homes pretty as well as to give them an inner knowledge of the different paint prepara tions. People who have been taught to make themselves look pretty were given an education Saturday on how to make their chairs, floors, dressers, washstands, houses and other home facilities look neat and shiny all the time. "We take great pleasure in following out the rules of the company in holding a spring opening and last year our large supply of souvenirs and flowers gave out. We arc surprised with the 'large and eons.isten.tero.wds today and believe that it will be both beneficial to the people at large and to the company," Berry said. The Varno-Iac given away as souvenirs is a combination of varnish and stain. Six clerks were busy all day showing visitors the differ ent parts of the shop ami explaining to them the different grades of paints ana varnishes. (More such spring openings would help those who hold them. [Ed.]). |o0c007-SWP-043179 .'r *y-- 0007-SWP-000126335 *- - "3Tip Acmr Quajjty I'ami Company, of Topeka^ Rac^'npt to,be 8 ounlour by ilip miliuiPiy p*:aMrthment* in the Karins capita], held its spring opening on April 35. The store was handsomely decorated tor the. occasion, the window displays being partial larly attractive. All visitors were shown through the store, had the good qualities of Acme quality paints explained to them and were presented with floral favors and free samples of Varna-Lac, about enough to reflnish an ordinary chair. T. R. Jones is man ager of the company, which conceded nothing to any of. the Topeka retail stores in the success of Tits spring opening., , _ . ' Suggests May For Pafnt-UpWork "* A F. R. Dougall Says Entire Month Should be Utilized. The following letter, from F. R. Dougall. director of- _ C-- Sfc. sales of the Acme-White Lead and Color Works, Detroit speaks for itself, and needs no further comment. We earn estly ask all our readers, either on the manufacturing side HAS SPRING OPENING. The spring paint opening- of the Acme Quality Paint Store at 628 Kansas avenue^was a popular event oi Topeka people last week. The store'was prettily decorated, the win dow display being unusually clever. All visitors were shown about the store, had the Acme Quality explained to them and were presented with floral favors and valuable or the dealers side to read this letter and digest its contents --there is food for much thought in it We are convinced that if the dealer would submit his views to his manufac turer, either by a personal letter, or through the columns of the trade press, the proper plans could be worked out so that the Clean-Up and Paint-Up campaign would he a bigger business builder than ever. samples. - Detroit, Mich., June 12th. 1914. .___ ________. ~ -il ` "------ TT1" Paint, Oil and Drug Review. To the Editor: I have read with a great deal of in fi'~ j .V - terest your comment on Clean-Up and Paint-Up in your issue of June 3rd, My impressions are as follows: . ACME COMPANY DECLARES DIVIDEND. Directors of the A.cme White Lead and Color Works of f Detroit have declared the usual quarterly dividend of 1J4 per cent on the company's preferred stock. The company's - business is said to equal in volume that of the similar period last year. ____ _ 1st. What we are interested in is getting the public started to Clean-Up and Paint-Up. 2nd. We all know they can't finish work \hus started in a week or a month. 3rd. Why would not the whole month of May be even better than the 1st week fn May for the time set for starting the Clean-Up and Paint-Up work. 4th. There is no question in my mind but what if is essential to have a definite time set whether it be a week T. r.ru'.ii.'. or a month. The entire stock of the Acme Paint Co, which was involved in the fire which swept the company's place of business some 5th. The greatest drawback in the past has been getting people.,to start this work. weeks ago, is being disposed of---what is left of it, rather--by A. 3. Effron, who purchased die salvage, and is selling it. at wholesale and retail at CIS and 514 Race street Mr. Effron opened a number of packages of ready-mixed paints, apparently damaged by water and smoke, and found, he states, that the goods 6th. I believe the public is taking a greater inicrc-t in their homes and in making them more attractive than ever before. 7th. I believe the automobile has helped rather than : had not been injured in the least. Taints, varnishes and brushes are included in the sale, which is being well patronized by bargaiit- seekers. ______ .________ ___________ retarded this spirit. 8th. Any means whereby people can get around and see other beautiful well kept homes helps instilling the wish to make their own homes more attractive. 9th. I believe the Clean-Up and Paint-Up campaign jgyv.- r . . .-** i> .I hi', tiirffwrr-wf t has been the biggest boost the paint trade has ever had. li- Shoemaker & Busch, druggists, of 115 Arch Street, recently 8&` Let us push it along. - .i began the handling of paint in conjunction with their other lines or drugs and chemicals and are experiencing a steadily increasing f. business as the result The .company has been devoting its win- - * dows to the display of Acme Ready Mixed Paints, of which they re now earload buyers. This gives, the druggist a new line of * ` Yours truly, F,, R. Dougall, Director of Sales. Acme White Lead-ffc Color Works. ! .* mmewrcwhHanMdiisiee anda tnhe paint mnuaunwufnaecitnurert anotinher outlet `for hbis * ' - H pprroodduucctts*.. ^ ,,' *........................... :' j -Tv The plant of the Acme White Lead & Color Works, ; Birmingham, Ala., was recently destroyed by fire, along ' with a paint and glass establishment, a furniture stare, and ;. several other small buddings. The loss amounted to about - 8200,000 for the lot of buildings. Another large fire was raging in another part of the town at the same time, which made it hard to handle it V. N. S. Runyan, manager of the Cincinnati store of the j Acme White Lead & Color Co., has been able to keep the business of the store up to the mark, by vigorous personal work, which keeps him hustling all the time, regardless of excessive temperature. The Acme organization as a whole will keep moving at a rapid gait up to July 1, when arrangements-.are made, as usual, for the regular vacations allowed the various members of the force. VXl _. ;lr . ..| %-~r. *"1 0007--SWP-043180 0007-SWP-000126336 X. \ . * W&i"*. -? `.r cvKi Mm ' :_;__^'' > *4im.v*v 'Pr J in t e r s ' In k A JOURNAL rOK ADVERTISERS II Wt list Street, Kw reft CIV *-3"* 'J 4 J, . ...ACME CO. PAYS DIVIDEND. ' j. j j -: Directors o( tbs Acme White Lead A Color I .'" "tlTL- I r Works, of Detroit, at a meeting last week de-| " '... ;iJ Glared the usual quattetb dividend ot 11-1 ......... 4*Q f per cent on the company's preferred stock, i | Vtx. LXXXVI Me w Yo k e. Fe b k u ak y 19,1911 Vo. 1 -- ' .v/''y <4Th. company's business la said to equal In] r<fc:3-. volume that ot the similar period[ last pear, in "ACMEQUALITY l 4 contrast with reports which- indicate that In I -SiCiCSyr;J ' other lines business shows a ehrlnStagi' to j about <0 per cent of normal. i S?*^'s THOSE two words are the bade name and bade marl: j of a line of paints, enamels, stains and Tarnishes. But they have come to mean far more than scientifically com' pdunded mixtures of pigments and their vehicles. * w** of jSui ot "wMbiit"niie"for l-The Acme advertising has shown die home-lovingand home- 1 : Sad^'cSlor^rks^prtsStca'" 'proud housewife of limited means the easily available magic | of the paint brush. Thousands of homes throughout die country have been made blighter, more attractive, more taste ful, more sanitary, more enduring, more economically main- ___-------------- a ring to j., .v Charles Stonge, on May 7. Hr. Stage, who j has been, until recently, the Acme Com- .j pany's grinder of auto point, resigned to take -.VU** 3.'- y. charge of the grinding department of the , . j-Standard Varnish Works at Staten Island, ; tuned, by the "home missionary work" of Acme Quality. S. Y. He is a native of Detroit, and well known in that city. Many concerns have advertised paint as a product, but the .J Acme 'White Lead and Color Works has been a pioneer in .advertising punt at a principle. We count it among the prized privileges of our forty-four years' experience to have assisted in carrying the uplifting message of Acme Quality to American households. ' 'Zi'Jjti&K V N. W. AYER & SON Philadelphia New York Boston Chicago . ... . .. . . j . .. ; . .TF& RING IS ASSOCIATES* GIFT. As a farewell gift to a fellow worker with a record of 20 years of constant serv ice for one firm, the employes of the Acme White Lead A Color Works presented a ring to Charles Stinge, .on ICay 7. Ur. 5Cange, who has been, notS recently, the ' Acme Company** grinder of into' paint; resigned to take charge of the grinding department of (he Standard Varnish Works at Staten Island, N. Y. He is a native of Detroit and well known in that city. rsTSSE^g^imzm. *54* ' WLr .' un.O -- i-'. ../ijLss.str - >- /..... -**; .12T.23 The plant of the Acme White Lead and Color Works, i of Cincinnati, O., was recently damaged by fire to the eat- is >- .T C- W, Johnson, of the Noehrll!# bnaeh of tbs -NAcidmberlWi)*biFceeinLot.wOs ial n4d color OUm eeriu. writes: *TW dub win nudm tbs L j tent of 125,000. Practically the entire stock was destroyed. -week of April 13 to IS "Cfosa Up end Pitot Up'* ' The fire was of unknown origin, but investigations are be- Ltajt-fjgjl *+wepeoikmdIottota our ptu to which fiesta tort thf cirapo%* wffl rapieaent ever? with* pelat - ; ing made, as it was claimed by the policeman on the beat hoses In the city, as well ee other tinea, j -This- that be found a rear door open, after the fire was discovered. The fire had extended from the first to the fourth floor will be heeded by * bead ot 3* pteou, Piero are being mads to beoet the aopu* Uueufk the mrioue ehooaele, with elty AotiMlthf.''ntuta* 3 fore the fire companies arrived. that aad dbo aewpasw po-epemdec.r^. 0007-SWP--043181 0007-SWP-000126337 F. R. Brill, of the Acme Faint Company, of Topeka, Kan., was one of-the paint men of that city to make a jaunt with the Topeka Commercial Club -to various sections of the State on a special train. Mr. Brill carried souvenirs of all sorts and distributed them with a lavish hand. The trip lasted for five days, during which time the trade boosters :i covered about 1,000 miles, stopping at all of the larger cities, dinwt r- 1 -so-/>* M. G. Heins, district manager for the Acme White Lead & Color Co., with headquarters in Birmingham. Ala., was in Cincinnati last week, looking over Manager N. S. Run yan's Cincinnati store, which he_fouml doing an excellent business, as usual, under the management of that energetic ~ paint man. Mr. Heins, has had -plenty to do during the past few months, not only in handling the regular run of business in his big territory, but in adjusting the losses in volved in two fires which the company suffered in rapid succession, at Birmingham and Cincinnati, respectively, after years of immunity from this sort of damage. The Cincinnati fire occurred in March, and shortly after, on April 3, the Birmingham store was gutted by a blaze which did $27,000 damage. The losses have been adjusted, how ever, and the Cincinnati store is itself again, with a new fireproof warehouse, while a new building for the Birming ham store is being erected on the site of the old one. Mr. Heins' duties have been rendered somewhat less arduous recently by placing the St. Louis branch, which he former ly handled as a part of his territory, in charge of G. S. Simmons, who made an excellent record in the company's Toledo, O., store. P/r.,^ v-Hl/uy -t ~/<r -tu 4trtarty..illvitfead ot'l l-ipr o mT asassaKara zxi2!*i "z&rtftl COURT DENIES DAMAGES , r FOR INDUSTRIAL DISEASESj HlrnoMlda*" .Compensation. Act Do m ! J Wot Apply, to Illness, but ] .ij * 'Only Itno Injur!**. 1 " 1 i*asl**.:f.-Mlciu, Juillyy. , ttoov-Eir. bftfM Uli$nP lil,.vUh ieectnoij>At)m)^ 4O*('Ul{TTlMViTa*M*r *'iwMakoaOorWkMS^'UaaiMNMr*k&*. tnkinojtt'tahnfst*ttlUlcllh*adimlnIt*oUcor mo-f: pcnM-tlanubdCT; tho tehl#*n. in'auirtWa.lLOclAeof.Uv,- s$MsrdlRf..t* ***?? th Sets**:' typreai* OouaU ffwiii' a>eiaU2L'' vu. A tfsl3atmas--.<:-Iwnfhtehns -componoatioa from.*,, manoraeturlar- com-w**.-' omptoro. of S^Sffisssire^iSssi nSarfSe'seiour >*!a2i2Sil!Si5gJ5; News Notes Boiled Down. Fire did approximately P5.000 the stock sad building ot the Acme White Uad and Color Work* branch la Claciaaatf, b. 25. plan* were immediately completed for taa * I resumption of basiceas. /o - 7 - Prank H. Dug*l, sales manager of the Acme Whit* Lead ft Color Co.. or Detroit. Mich., was bore tor several dare last week renewing tone Mr contracts. 0007-SWP-043182 ' W SBIBW fi . i f -" 0007-SWP-000126338 I .'i-jHfi' *, r; . . :i.-j^nj^0ibst - * -- ' v.-Your Aim Must Be High. iHe Holds Customers. . . '1 oS-u-c--c-e--s-sj _iniyKTMn.ow.le.dge. '' T.isS s te-': . 'j . m j ; - j x. H. raHER. Jukaoa, hOh- - Mr. FUhtr writes, . "I -preUsy S eUrtea my ew*r In the petal huel!------I elveye bed the reed bee TM. . my bonnet. The petal bwinees tookeS : ajlnrlw to me. 1 fell that I bed the cepebUlty r sorroundlw the propoelttan In KX*d ehepe. promotin, the belt interest* of the house I become elllad with end. el the seme time. TOT owe future. I worked herd end dftlrentty determined to win out. end em heppy to sey thet I euooeeded. E- htheulpssteeemwhinolethloet. "IIle"".bJj3unJ2f.3*?h? JHTere lukewem end MttaOed with whet comes your inf with went IIITM frort. you ere oe the rued thet vent nSnFinckgi^vIf-.-woinll pthuet oytohuerotu*t <oUf ytohu* hru*Yn our eye pMlcd for every possibility. Hdt&x* u p your mind to turn evejySe J im law tfU-wU? ejowltlsfc . pJthw^ewvnj#imyMaouueetieMaaroUe- fc*rfbctvtlco*trwmheyni eAebrleivetoa . SS^taS iwSf** euetomet* thet taelrlntorSte-would he well eervod i end e tbrieinr huetaej* Wtojr it thw would take my tip end tie up witn.e. :Sr#b"S?si.S s*"^SK! telt enthueleetle end OU.Unrf Ett. o*E5taWKj ?c5.r7rndi iinkhwuSdo^iLng. Ustrrucbkustinheess 1* E^1t{? j j making rapid profJSTTelm i treat my eMtomere In . ^SfJh?le/thn^rruSthmet. thTehyel-wdiall rveemryemebedr argy to deserve end WUin their pW' | ranuti" _______ _______________ 1.-7--]*? S' '* I Stopiores of the m**m- White-Lead Ift^Cotor wofks.wm go theb1 *" 'anal ixeonien today to Bob-La. the iboat tsavtag toa foot of Baton street at l:S, Oreat pnpweUou have made for. the affair. .Hors thaa<g vema ara 4wa oa the PKjgrain si races, and ,as a will be.a baPoow ni u mslsa.ay vfrot. Weilraaa:. a.rtoraaw injiiri .tf;^ cempaay.4-WIUlam firsts te_ shatrnma --- ---------------- -- *" J. H. KAXT, :~"Vl Detroit* NIch. ft Ur. K&tt* ut U at the head of S. W. NEWELL, } the Central Paint ft Vsrnish Com* i: t` pfioarnytU.h1eBwhppicsah*slt. csSeiUaxieey/WreaaUrhs)e.| fe1mF1er9em1rlwoonueasyevtdov that he wse for nine years with the . i Acme White Deed ft Color Works. 7 with which house hi made a oubetan- . `i tlal record, lie writes: "After deyot- \ ing practically all my life to the sale of paint. 1 became thoroughly con- viewed that the only sure road to sue- . : > cess la laid lines. I had out along well-defined a wide experience on the I -; road end during the past six years In the city or Detroit as manager of my 1 own enterprise, the Central Paint ft - Olaas Company. It matters net vhether you are a oley salesman or a territory salesman, unless you are wall eauipped with the neeessarr am- munition and ambfitoR. your efforts J to succeed will be futile. Ysu must 7 be backed up by m line you can talk *i with enthusiasm sad positive eonvlc- tloa--oris that you can boost with a I right good will, and without fear f 1 contradiction--cue that nothing can . -! shake your confidence tn--one that i acts on you like aa Inspiration. Fed- j log absolutely confident and sure of Fort Wayne. Ind. After an apprenticeship of nine .'ears la the factory and on tht road *i nWloor rkthse, Aeme White Lead ft Color Hr. Newell eight years ago S entered business for himself. He l writes: *X believe to be a sacecasful paint salesman It Is essential to have h an intimate knowledge of paint, ind i its uses. I served my apprenticeship i In the Acme Company's various fas- | torlee. After I felt that my educe- 1 tion wan completed, X traveled mi the i road ror them for a number of years. a 1 felt that the celling of painE warn * my calling In life, and decided to em- . bark la business on my own hook In Fort Wayne. Indiana, where I am ' still located. Hy business Is growing appreciably every year. I believe that my success can be attributed to hav ing a thorough knowledge of the proper goods suited for various pur posse--always being able to teteUI- gently recommend what to use, and the best way to uss it--always having sufficient stock on hand to lake aare of all demands promptly--treating my customers sad prospects as best I `your ground, you can't help but be able to engender the same unwaver* know how and giving them every pos sible care and attention.* . Ing confidence la the minds of ehs many you ara desirous of miking your customers. It means painstaking effort* early and late. Tou must take an honest pride la your line. Tour aim most be a high one. I have been 3M successful up to my most sanguine expectations. Hard work--good ma terial--Cals treatment--earnest ce-op eration--always bring success ~ i -y.v'V OP THli'^AClCB White Lead -works took a- holiday fiotarday at^Bnla .Blaaa-eJ Athiatl* lured the day.wg/^b?^-------------------- ?A# the lariial'pkaiesf the A<___ yesterday,thi, r r*vn>*tloiMt >l5iM?iku*- *TwPirfaiBosidihsat iu l COMMOS 0tf OXB POINT, PBE-] ?tnxaxb nMJti s e s s io n ah*v wi,kM. ho ths'lMnlt l-- Inhup pMuresT. -<h*.eadMs"r In, t saalhes-patsS *a l),*-'ua *, whU. thl artitarred es e9l h held with w aHer if U, --fthheltheepr'rj aTahr.ecnareh"reaM-uCht*s9irelr--e .lispnilrrt.bl : Aire, .PabUo jjmtwre ! |J 0007-SWP-043183 0007-SWP-000126339 I : * rV La. >. '. . We v are also showing three ads. of the Acme Quality Paints which appear in December publi cations. Tlie two ads., one beaded "Costs Little," and the other, "Don't Wait," ap- pear in farm pub hIWwfeMt-nMiA:i. rtSZLS^l Tr2f=s $o*murt j.^rsES: 40h' - rn:*2-f- *<** CrA'-. PROMOTION IN ACME SERVICE. ; The Acme White Lead and Color Works, Detroit, Mich ' inounces Pittsburgwht. tvbor-a..t.n.h..c.eh- .tr,aTUdhceeaatcnnhnaaonnuggneecehimnietdnntieeismmaaasnnafaogcleelommwe-s,n-.t:.t *o--fii.H*il*a.,' The interests of our trade in the territory tributary to Pitts burgh Branch will hereafter be in the capable hands of E. B. ^Our'fnends will find Mr. Sovereign a gentleman of pleas- inbc manner and one whomththeeiyr scuagngeesnttirounsst athnedirthperoirbbleumssi-, gl ness to with the eonfirf*---- " lications of gen- eral distribution throughout the entire coun- try. and the other in the Saturday Evening ; Port and the monthly magazines. C Manufacturers of paint, perhaps more [ 1 ! mote than any other line, make a special point of assisting the dealerto roakeT.!.. sales, and the dealer who does not take >i advantage of these helps is missing a ' great opportunity. For example, the j. Acme White Lead & Color Works, in . sending these examples of their ad- vertising, state that their general adver- : tising is localized for the dealer by the - furnishing of selling and advertising - few helps, consisting - of personal soliciting . service, a full line of store and exterioi display signs, banners, fence signs, manager .. *- msourgh1 branch is the merited recogni-' tion of a definite ambition on his part to make Acme Quality stand for everything our organi zation intended it should signify --perfect paints and finishes and; perfect service--in his former 1 territory, Central New York, L where he represented us as traveling salesman since Janu- ' thorough knowledge of theanrye,eds19o0f9t.he pMarin. t tSraodvee,regiagnth's- j ered from his close contact with the retailer and jobber, will I enable him to accord our Pittsburgh branch trade every j. courtesy and every help_ to the devdopment of a profitable - -. demand for Acme Quality Paints and Finishes. > ' jsl Mr. Sovereign has the faculty of making friends and keep- I ing friends. He leaves a host of them in his former field and ' ' -^| | we believe we make no mistake in predicting not only the con serving of the present high standing of^Acme Quality prod |5?> slides for moving picture shows, illustra- : tions and newspaper copy, etc.--all of these I. being prepared with a view of taking every possible advantage of the national campaign '. and turning it to the local dealer's benefit. ucts in his new territory, hut the increasing to even greater proportions its many friends in the territory which will here after be under his supervision--Pittsburgh Branch. It is with genuine pleasure'that we introduce Mr. Sovereign to present and prospective users of our goods in his new sur roundings, and commend him to consideration for such fa Ill Next month we are planning to publish [ . vors as our representation under his guidance uay ram. letters from dealers, who will tell their ex- ;. perience in'handling advertised brands. > t . V.____________________: ' .. -i't- Manager V \ Kiuiian, of tlte Candnnati branch of the |`7. Acme White Lead & Color Co., returned last week from his \ Los.fi l.illlf (i vacation trip to'the north, on which he spent some time at a> il-e borne offices of the company. "Everybody's feeling fine [ up there," he declared, "Busine^f.is coming in at a great rate, 4 Iv~ L-_. :*7 a nd running away ahead of last year, and there seems to be I -TT1, . ,,:- j i 110 reason to believe that t<his fa__ll_a__n_dththisi; year won't be about -iti'-'' rau *H. best we ever had. Al; least, that's the way they fed about : tS; up there in Detroit." The Cincinnati branch is doing well, tmurr- fff*-; S;"$Sf 1 in spite of the v--the fire and handicaps which it the strike. These, has suffered during the year however, were undoubtedly s largely responsible for its failure to rafik with the winner of i) the recent contest conducted by. the company for the presi- 'S dent's cup, which is awarded annually to the branch making j the largest increase during the period of the contest This a year the honor fell to the Detroit store, but Manager Runyan promises that barring fires and strikes, Cincinnati will be right .... , there next year. ^------ ' WU' -ft't1 'w ?p. Is5*' * ' 1 "* -Vr.. ' 0007--SWP-043184 ' arv.' 0007-SWP-000126340 .a ^^ ry^r";'' , !..j*^r_t'^ ^ 1 ^'.... r~ - ^0*^ --J X ' .' srI Prlco of :Raw' Metenal, '.I* ^^wu^ag'Wjiy'Beyond^- V Ho m\ yjpMSt 'Abto Hit by War Famlno, Sin to'col i' PS5i?pjSnt Soalcr. ^ '!$' t,v ~TssWm ^C pafbt "bas gena ^ajp, tll: v3ig itiU' hjihet W.U 'tht ny^birfi' ttotinr ,<iqwbi U vfll.ka mafa.ktnAr af ' at kaf prieia^V^fc-jWteadwarn of the* : Aon* White *1^*4'A Color'Wbrks styi'sa. asd .ba;toiowa;rr * >. JY.%rS : M^,Woodward raflactir* aya vpoar^.b**uUfiil.painting -daawiag a runs* ife&ftajf.'fo* ray* * on'wood*. Balds, and rlvae**it.wa'.tax artlatitetl- . (y..gorgeous Croatian,.:.* symphony of titling^jjoipro". bljoded.*o. .porfoctly that'tbsr,gfcvlsbtid lo'J*r*,k w 'calm-. ** big to* *Mara^aJad. si grain tattoos,* rad,.- radlstai'. and pal* groin eue^bcntOrd ^yofsterina. ; > , r-'.vB-s;s*>bc-t m ' Ww* M-..%**5r^a*ya*.<*.7. '"': ' .TThojUDrfd's. 'iyBog*.tbr ! should j go o^'t*"t)bcaM'^wvnnrf':)SOta who' .pro-, duos such Works' st'arVVroaosd Hr. Woodward. "`Dsar 'knows they. hare a hard enough time Jiving up 1& tfalr I^tfa-kuprfcer ropatatioc. ^n chU.eaua- .try'without having .thaprioa o .tboir. fa,piv*Ji((fe$ijhow.gifob'Pdtet has beadJtiosd '.fivj*rt*J.hut. It '.caHalalr bnb'.g^;^^iaar/<^'tfai7fK(w^>:*^ * ihotttobtffrChiinU -dor wjmoture' such WfahciteifcBPi&k of tna paint to* ~>ddia^m^^Mir^^at^uwar Vrt^f^Sph^t>t^fa*<S^fa^it;.aar prjcajf-tha'wiir-.fMps.upL^At prassaC avor'wfahtul it help puttfca artiste'in tbalr .pursuit, of .art and gtMsuro, -all paint manufacturers ara scouring *wa zuohats foy.^thias./ehaaiiieaSL..grylBg teTr%Ca supplyrCacfra ubwira U ttd* than ov*r. ..Until wa-know Juot what suopilM wo can got, It 1* Impossible, fa ar iat how:>fah pefeM wUi ga or hem goon ara unu lM coeipaUad' to [kon^atwh'viQiouV first grada'cal`ara,. *H^u mC1^o danst^^v.* ;aa, at.BstgMinaafc ; .Thsiat!# isapcglifani' oCklifeliMti )a ail thin .TtuPipplf tf .original Bass* brandta vrlUyJV k. jra^ahsafit -Is Iss^ 1/rV ffalnl'mafiprtal*, kNCit!Nl,'e*lh;<eelwv | 1 - ] LINCOLN PAINT AND COLOR , i,1 .; ifa,, |ut Mn Mnfttlly pi|Mi) fmin {< ctkhhLaahtUuK<Ht jM^IHUiIrMl*I imn M>wm- OCHIL PaaIidnIt KicStllI . ' I XriJntttgg ttepoivi.' ,Con<lHinw!, tfcvsa rr : f poiU show; *14 OaM!T*mW!i(ana>mdbAamb]amHgfi~sf-VsinamauisMlJdi.'al*M UoSrwitSrllhMaitaT).sn'fP-..aMi{nrr-ra. I1 - - J COMPANY Lincoln, Nebraska October lb, 19U. Editor Montana Trade Journal, . Great Falls. Montana. 1 Dear Sir:--When the writer travel Rata a i<hm! 0ntan, ! far l*rmr , Hf'MC.'j '.. ' led for one week in Montana last Hpaltrr AcrarOlai I* rrpnrta tins* iSis : .W.u mu kata kata soM w* atiwr,,jKg.j - i i spring wilh P. J. Kelly, our western ,tmm*mA'+mM+mhnmJ.`*KW S'/ L . > J- hlsm MnaC iwyartara ka* satHng 111 ..._.* I . -t^h' ? ] representative, he learned more about PUpgar <a* haoiK ihu ata iwerialsg *ri<( * 'fatianuas., .. ' i- . -1 '-> -...? ; the greatness, the resources, facilities, >*rharyfas Uauaa^c Bilnwv af hs*yr#s "] - / productiveness, and future prospects ,Uu Uni Hbliw ihu, iwr Mu m *W of Montana in one week than he had i^nsW'Yniliat at fa nods wpari 1 v- .-. -. J learned before in ten years. He learn 'Yrtn.-fahsoniis. fnsn Rffriadwm, : kdQi>tUla.ulalfta-aPgu"praalUBnu--gtlMuanaiWaffmMflCnaaars*oia*rtgmMla'd*;*0! . d.v?. a ArfS, i ed to respect Montana, to enthuse over her. as he never had before. He ImoMOrti tti.iMits iM iIlia to] /'-"v.-f'- i found the most optimistic, enthusi fawn* famaxil.lsr Ua.kiwr'et Om r r *. , KSSSS?; ,1'-".^- w *. 1 f aKiciaaiat from aar MiWt and MkUr Y -* astic. up-to-the-minute class of state "boosters'* he had met in the west' I |ia hnr bn iMi Cauin imiUi 1 af gomaailr gisia tn known u IN k Lace reports of the wonderful crops ;4luat` m.`tir-UoUI aft* oaak ga a? hl,j - being harvested in your state .this vosarrtay at r.*u- - *.. yiear,! njure at present prices, an ^OMnshar, wfairh ~mM 'ac^ttHdlfa. Uih ana arila fck>nr.V , # vW 'S ^.1 Celnormous income for your farmers,. MCalMnw-Maalsrs haa aliaadr'falwi t*i m o K. and It will, ki|hi I . ,?^ ' ~, * great revival of business for your ,|B>|iwrmiii t o * ar.AUiunai uinarrt in i intHa tffeava fan mb allLiii a waft* * merchants and a glorious period.of mfepara hi Uaeaad lor th km ij lanairfd * UMnaMiHaiSL.*. *. * *i prosperity for all your people. _ IrSaofatfa wlta Ump haa n<nd < *hr ['>MM silbiioo((tlan'Mfar'.`baw* \yowi .* . - . i mc S la Pa a*N *4n ti* n...y. . '* The opening of the Panama Canal is sure to bring thousands of Europ liO'nnf faM -- UasartaNy A^fkelC*lMT ean farmers to your doors to take . vAaSat 'mfad Dansoata to aoapru acalQ. rha farjnar naw hmalahc faan krld 1 f up homesteads, and open up large tracts of comparatively cheap but *QMolie ana AMUhar ntmsmi lrfacs 1 |io u in*. * , s' richly productive taad, who will take the first opportunity that presents to "> . ` 7 /^Lejrtf get out of the war-ridden --uropeau countries, where the burden of takes X. \ sj'-y- will be unbearable for the next ten years, and come to your grand west ACME MEN MEET ern country where "life is worth liv ing." T. B. Dougnji, director of sales Acne White Lead k Color Works, spent three days is Cbi* esgo fast week eondueting a sales convention Jj of the salesmen connected with the Chicago g branch of tha company. There were about twenty salesmen present}] S who cover territories la Indiana, Dliaois, |- Wieeonan, Iowa sad Kortbcrn Xichigan. Ifc A. Poaahne. manager of tfco Chicago | branch, Was the chairman, and he kept the boys on their tip teee throughout the three We predict an enormous extension of business in all line in Montana during the next decade, and we ad- ; vise all merchants and business men to be alive to their opportunities, to | carry plenty of stock to supply the ; demand, and to everlastingly "boost." Sincerely yours. Lincoln Paint and Color Co., A S. Dougall, General Manager. days' session. Haas were laid for 1915 business, and it was the opinion of the convention that out* ^3 look for holiness the comisg year was good. Mr. Dongall left immediately after the eon- ,. . .5 veatiea for a trip throughout the Southwest,, * p( making St. Loess and Kansas City on the way!. / "* Acne; Wtlte'ieii Co. 'Cain, down. Ha will held a convention of the . , Texas sales organization of the Acme White Tba 'itatsmsnt.^r^ViM*.Aetna White Laad.-AjOator watfcMfer th* rw> anding Ka"v. "A -- ---------In* of j| Laid It Color Works at Dallas before be re* : - faMBA tt4 Mt The uuti -aae '1 ^3 turns to Detroit. 3**3 at*, imuuusn afc.J mt v * .aaO^NorpfaaV mi "SSbSi '"* -ntmet i 0007-SWP--043185 '4% 0007-SWP-000126341 W ' >' ^ . .;.. t * x.-.< fettjaijsSOTggrtf .y-X . jjfcwg'Kie^r 1 w S- : "* r p ? .------- , 95,.*** twentr-aith ' -4 umlrOTWTvoi*h*; OetahUMui^at - at thf Cantrml Paint * OUu Co.. la tbo ottr knack of the. acme WhK* ZMlilcOolat Wort* K Kiw TV^ornkU^ of tbo bniook eora, Wedomdair renin, niortalnW U employe. >1 hi. hom^-a Tylor o o u im. Among tho -' moot* v Ckuloo .lk IhulMi, ropnooatatte. of f. q. Fiuhoo'* Bone,iActnten,' Booton, Uua,' oak A. q ,'aoacT: paant nuaegtr-el tho ssn VtSwLiisrr / Ti if - .'V ' * *r. vs t- A, :VV f , * MvottAVi ~~- VWr-PmMral.- Ocmtnt^. Tafafr,A. i <' 6eWbor. Jl-^ x s s It s j s s j V of ltiL CedtcsV Point Jk IrOliu Co, wm H la tfci^alty brooch of Ikr Afr i*!lia'Load Color . I works, vlto honor of this, ooMfloa T> " "A K DoofilL'' Tieo-pxeoldoat*/ at %bo oomwiy,. nUrUliiitd tbo--19 ''am* ploys* *t Ua homo. It Taylors/rs- :Amof tha foooto war* Cn>*. Xadeser Gsstrel'Paliit.'d^liaa Oja English, reprsi{ka*tlr* of ? C Fushaio A (ferns, brush iasnufsctur- ora*. Boston.' aa4 i; D. Ucair; son* ana ^edulpped!; i^lth ^an. automobile. nl m*ngag of tho voralab dspart- F. R. Dourail began' bis paint sad meat.. Aoaa Whlt* ? Ltad; 4 `Color earnl2i .'career.''*#.1'the'' compaays works,.'1 .. . c' j first, represonfawUTe, and, in sMltWa ..^ho Control Point fcCiissa.Ca, bs- to,` )uibic ice-Dre*|d*nt"of . CtU.^Cen ran huslnm In tho bulldinir ot tbo tral.' Is also, director of sales for serduiut; wra.- of : Congress nod the . Acme White/ Lead . A -.'.Caloc ItliM'itrMtiHi Fjtura ifo nod has 'wenut*; '' saade' only and epove; and that to Its .^After-dinner speecbes were made present, location; at CadiUacL spuspe. bJi^ Mr.-; Dou'rsU., Mr.` -Barlis^'.lfr. Tt^-.teintonr' Is teoalla*4 to* Detroit. Uoirs; and sdso by/J. SET BatL*'the' aM~ While, It., beean 'business, with Bganagsr.; of . the.; Ceatrhl Pi^at d nljf. QPSj; atjawMBt. Itls nay . fta largest exclusive pedatf yaralsh'nEui CHsiss: Co.^: Wide and means' were else.:proposed far further extension of bushnese and/'lncrteelad wOes-of Agar -Quality Itp* of .yalnts* eiir Ji?;ois.lian<s maniiSd rrerraulte bhcnse.; *, u.., j v ,t i ^Jiyj *. ^ * i',' ~*y.T` k .: f`rr JO ; .. < x-.. I^r ' PITTSBURGH PAINT CLUB MEETING. jj: I -St: :i-T' The festivities were presided over by President Edward " hompson. Short addresses were made by E. B. Sovereign, ; . i'ittsburgh manager of the Acme White Lead and Color --, Works, and W. T, Wood, of the John Lucas Company, who both discussed in an appropriate manner the topics of the day and past accomplishments of the Club and its aims and ideals for the coming year. The reports of the various committees were then heard.__________ _________________ r'&i&t and means were considered further to sziond ths icooesnV httstoesso The Central Paint A Q)ut Co. be* can. business Oct. S. Un, n \ the building at. t>e northeast roomer or Congress and' Bates streets.'-* Dufnr the SB 7oarsthe; company has, mined only:ne*-to`Its pruext location. II Cadillac equajne. Tbe company's ter,rttorv Is confined to Detroit. Zt bo* gan b io In m .with only one salesman end now employ* six. each'of, whom equipped w,f.tjniarn s u"to*m---obHeLsai.- _ Vlee-pruldent/DbuKaU hersn^hls* career as, tbs ' company's flret ealm represeotaclve. He also is dlrectar of sale* for.the Aexno White Lead a OBkr.^rW..._______ _ /a -*2J -/"f CENTRAL PAINT CO. - >l OBSER...V....E...S...A` ~NN* I*Y. *ERSARY Ooto^r Jl'wu/Ute tvcntj-Uth u- nl.MStry^rpf;,. th'* Caitiii Palal aiain' comp.q j . * whIch 11 Che cltjr bnoeh ot th. A^me.White Lead aad Color WorVr.'v1? honor..of this occ. lon-P., H. Doncell; vlcetpiesMent of th^ company; entertained the 19 em ployee " connected. With.; the': branch In hle.tipmei^Nor' 99: TayloMiVe: Among ttie.'ieata'- trere Charted; B.'. Enillili, repreiehtatlee* '"Ja C.'. Poehee A Bene, r brurt : manntacturen. Boeton. epdii-'i Dj Hoag&i;*eneral;' manner vilehgdeiw^rtnvi|fty Aeme^ Whit?, atr the hdrthi55tned'Of, Congre; andr.Bete*t^S;yeef'..**<<,,'ejid ,ha mado.'onlr one moTjSthat fa it. prea- WfS toc.tlop^Ko/9lrC.dllIataQ<c *n After-'dltuet-ipeediee e>ere;.inade by:' MtWDoug.lt'MrjKlEnglUlw? Mr. Hoigr:. and alaofhjK the genial manager of>the-t54ttrali Faint a :aiau, tjwgMbgi^sa^jg^- n,. .t /. -V'^r .' iUMty ' yjr \ ' "iVoe-vv; 0007-SWP-043186 . ' * - -** .* S- ` ^7 - . Aw.b e>Tf-`. 0007-SWP-000126342 , *% :. 'A*-, ^-v-y/ - ' J-f'rr&fc- *^rsS5&r- ry/.z -'~< ISfigpT ^sipl Carl Graham'Paint & Wall Paper Co. have a largest :' *Jr A5 double store, one side ol which is entirely devoted to wall *h~- paper while the other side, the basement and large outside1 `oC^Un C6X%cun^:.*ni*ruhimf;th+~19, Ui booM^/fl- Tajler tpj ThLCit**t' PXnt :*b4 QliM'Co.< acot-m*hl4i>_MM>C4*kkv*aftatcMairp/ITdjf..tifn^CbuiWUgliaiwi . aiJesterXS.jMr* *gw;rb+'| quart, 7* T -<dg>t> I IU Carrltorr to^^Wa*nltoaMgo<^ warehouse is taken up with his big stock of paints and `il Siass. This company handles the well known Acme brand' - r of mixed paint, they also are subscribers of the Pa in t , On. *; a n d Dr u g Re v ie w . ~ \'i ?\k Sl.'r^8' i-.ys V' -'Si 1 rxi f<b r rfiliilniidifi y.Kr i PeiaiQfr'Ka jrj^ot^Ahigt^rirs^ >8n3 JrtibTXeM Whlto XmM * r: OyoMlorT^i^fitlfcif.'\t^iw5-pu5dttof.,-;wTkr^n-tuauietd>? Qa^.T'P, tAtm ooxcEur h a s rwanTT-nmi AiurnrKaaAET- la brarr&oc* *1 (he twemty-Mth uarrw**T at th* Mtehttshwent of th* Onlnl Briat at CHu* 0a, which i* (h* rity taueh * tha Acria WUta lad. A Ooler .Wotlu, V. I Dougill, vterpmMaat at "lha irameh eaaearu, (fadMaday avaalag aataitaiaad 13 ewptayia at Ua hama, 33 Tafiar'anaaa. *" 1 (ha faaata wm'Chutw J&jBagttah, *tPr**tattT at 3.0. Paahaa A Bona, bruab aamAwtuan, at Bottom, ICaaa, and A. D. H*gR gaaanil maaagor at (ha vaaalih daPMtaest Ana Whlta Lead. A Color Work*. Attar dloaac talk* van aiada by Nr. Dvniall, Mr. Kacliah, Nr. Haagg'aad Haa by 3. Hatt, wsaagar at (ha CastraZ Palat A Qlaaa Co. Ways and aaasaa warn (aaaidand fhrtbar (o ariol the aaaeataH bntiraai. The Caatral Mat A Gtaaa Oo. bafaa bori bet tl, MS, la (ha baOdiag at the eorthaut aoraar elCeafram bad Bata* Mraeta. During th* tw*aty-(r* year* tfaa tompaay kaa aaavad aaly oaea--to its praaeat beatiaa. X CadUaa aqoara, lha company'* ACME ILLINOIS SALES CONVENTION.' director of safest Acme White Lead & Color , _ in Chicago last week conducting a salesmen connected with the Chicago , There were about twenty salesmen present who coyer ter- "- ritories in Indiana, Illinois, Wisconsin, Iowa and Northern . ~-V-Michigan. vjwf l . A. Donahue, manager of the Chicago branch, was the i chairman, and he kept the boys on their tip toes throughout the three days' session. ~i3g( Plans were laid-for 1915 business, and it was the opinion //t/-' of the Convention that outlook for business the coming year "`.-'i was good. ' '' i" Mr. Dongalt left immediately after the Convention for a trip, throughout the southwest, making St. Louis and Kan- . sas City on the war down. He will hold a convention of the ' ,~f , (Texas sales organization of the Acme White Lead & Color ' .< Works at Dallas before he returns to Detroit -rr`^r .*> ' /j ; ___________________________ The demonstration of the decorative possibilities found . in the Acme White Lead St Color Co.'s "No-Lustre* .flat j wall finish continued in Cincinnati during the greater part of last week, and Manager M. A. Runyan will cover most of his territory with the demonstrator. . .... "'PiAC!'." IT n.y VV * - .^yn . IX'I -- 1 1 * * "TM "" -.w;. A ,,;t id S' ~`-r E. B. Sovereign, manager of the Pittsburgh branch of. the Acme "White Lead and Color Works at 209 Wood street,''] J reports that they are taking inventory and preparing to put in three carloads of stock which Arrived here last week - and some which is expected to arrive in a week or ten' days. He states that business' with them is as good as' ' y can be expected and that -he has no fear for the new : r year. Last week their West Virginia representative sold one carload of stock to the Williams' Hardware Company of Clarksburg, W. Va. ` This concern is highly interested in the "Prize Hunt" contest which the business men of lower Wood street is conducting. In this contest, eighty thousand numbered --`i cards were sent out to the people of Pittsburgh and out- j lying districts. The idea is to have the people holding S these cards visit the various merchants in Wood street and hunt for a number corresponding to the one they hold. Prizes valued from five dollers to fifty dollars are displayed in these stores with numbers attached. Mr. Sovereign is? contributing as rewards to the "Prize Hunters" a ,nutn her of sets of their products. i & "MR "ilA.". '-i. !" 0007-SWP-043187 0007-SWP-000126343 Moat bead*?* have that happjr way of glW-i* Id s by the aye wlthoat your realising that U'ef a benday that make* the ttecL You ft the l '7 effect without peeing the mechanical construe-; V tion that makes It For instance, note the Lin*? j coin Bara and Roof Paint ad. You would pass ,vj Tr:'n -' i ^ thin ad without ever noticing that four illf* t f^z :'r j ferent bendays were used in tire illuatratlon, .V one on the broad aide of the barn, another on *%;* end, another tor the alio and basement of ' '^Xjv'j ^*fn and another for the walk* leading; down to the rite ot the ad. *%-. ^^ ssytri.'r f^.S- When white on blatfc alnca are used so much, ^ white on a reverse benday comes as a welcome _ . relief. The Lincoln Climatic Paint ad la a | good Illustration.'! This ;ad ftu all tlie fcdvan- | _ tagee of white on black plates, yet it is free p from the harsh plainness of the solid black, p Only one benday was used to make dive border and the curved panel.behind the on and the maps. No. SO? benday was aped&ed to run behind the maps, with a reverse of the same y [Headay to form the border and lop panrl - '" *J&`_ J,'. . i'm -Wi'1 -SP| THE ACME CINCINNATI SALES CONVENTION* F R Douffall. director of sales, and 5. Xseal, superin . tendent of factories of the Acme JAhtte Lead & Cok>i\$ Works spent part of the week m Cincinnati, comluctmg-Ji the sales convention of salesmen connected with the Cm-:|1 cinnati branch ol the covnpauv. All the territory and city 1 salesmen were present, these salesmen representing terri*----^ in Ohio. Indiana and Kentucky. M G Heins, distnet manager of southern branchc chairman of the convention, and all the boys were very-J much interested in the topics brought upfordiseus,ionand with the prospects for a fine, full year in 191a. Messrs Dougall, Neal and Heins left immediately after the convention for a trip throughout the south and Hum m l Oallas for a convention for sales organization of the Acme# White Lead & Color Works at Dallas. r.^t The Pittsburgh trade greatly sympathizes with C. IV. Fallen, store salesman for the Acme White Lead & Color Works, who dismissed his duties here during Christmas week to attend his father's funeral in Seward, Nebraska. Paiatrd Bum Meaal Belter 6e4t At Year Beakl pjagor^trssstisr | Lincoln CUmatte Paint I vS*s'.;W G. C. Henderson, office manager and credit man for the Acme White Lead & Color Works in Pittsburgh made a visit to Detroit, Mich., from the Wednesday before Christ mas until the Monday following. / j-f.yV.-Y' LINCOLN Bara l Hoof Faint :a."!S -tag I E. B. Sovereign, manager of the Acme White Lead & Colors Works at 209 Wood street, Pittsburgh, Fa., spent the 3d, dtb'i and 5th of January in Detroit and on Ids return reported cou<j I";., ww *y ' ditions there very good.' He said the railroads were placingJ good orders now. ` TS*sdKiMr'-i- meg; Iw , I /? . V."O IV", I '-Xv.'ilS 1 belie** Hut with th* exception ot the cotton grow ing section the purchasing power of the country people ie not impaired and that the temporary condition of these Motions would not Justify the discontinuance ot advertising of merchandise that will sorely be required with the return of normal conditions. Europesn situ ation is bound to result in an abnormal demand for American product with residling benefit to every sec tion of the country. I believe that fanners are buying practically everything except such merchandise as may be particularly allied to city or town life. A K. Woodward Acme White Lead Co. Acme Sales Conventions. F. R. DougsJI, director ot sain of th Acme White Lead A Color Works, Detroit, conducted three annual sales conventions during the past month. on [n Chicago, oaa In Cincinnati and the other In Dallas. Salesmen covering live, middle western states were present at the Chicago meetings and the sales organization covering Texas gathered at Dallas. - l/.<\ >*X' ' *r t 0007-SWP-043J88 '$ V- "t'.Hi / 0007-SWP-000126344 PITTSBURGH TRADE NOTES. (Special to Pa in t , Oil a n d Dr u g Review.) During the holiday season particular effort was put forth by the Pittsburgh trade in' the way of window displays and store decorations which resulted in bringing forward the most artistic and striking arrangements known in years. One of these which by almost unanimous consent carried off the palm for attractiveness, throughout, is the Acme White Lead aqd Color Wprks, now located at 209 Wood Street, Pittsburgh, Pa. This branch of the Acme White Lead and Color Works of Detroit, Michigan, started in Pittsburgh about five years ago and has been increasing its business each year steadily. This year, 1914, E. B. Sovereign from New York, took charge as sales manager, and since then has reorganized the branch entirely and for all the war talk and quiet times and extra work ol reorganizing and rearranging the plant, etc, the business shows a nice gain over last year. This concern, which recently moved from the old building at 230 Third avenue, have put in a retail store in connection with the wholesale and factoiy end of the business and are enjoying a very satisfactory business in the new department It is considered one of the cleanest and most up-to-date paint stores in Pennsylvania. - Manager Sovereign's motto is "Neatness, Promptness and It is not customary for exclusive paint houses to decorate I for the holiday season but you will note from the pictures v I1** that the Acme Company in Pittsburgh believes ..'4 in being right up to the minnte at all times and shows ; Service." A ti 1 Jit% .j}'.-: i r',V* ~:`y 1. t "> -Mf il 8. . .! I -iiVI -i - iTlfv J r-i 2 .-4 'A *. -s' Private Office and Duplay SoMtL'^'V^ , Attractive Acme Window. ,-y equal degree of taste in arrangement the whole year through _ The window display consists of a decorated Christmas ireel 'The new organization consists of the following: E. B. /jw-with the bottom of the window covered with cotfonJfSSuu Sovereign, sales manager; W. C. Risher, salesman; J.CR. via glistening smaltz to represent snow, with numerous suggest Murphy, salesman; H. A. Heck, salesman; C. H. Ford, sales V ! five gilts to the paint trade such as Acme Quality brushed^ man; R. L. McNeil; salesman; I. L. Johnson, salesman; j? -I paper hangers tools. etc., scattered here and there among' Chas. McFallen, store manager; G. C. Henderson, office i ! the cans of Acme Paints in the window, also the large sign;' manager and credit man; Wm. E. Schurer, order and price ' j wishing all a merry Christmas. clerk; Miss B. MacGregor, stenographer; Wm. A. Darling, I Also note the interior of the store is thoroughly Acmdt shipping clerk; Geo. Darling, assistant shipping clerk; G. A. Quality as to stock and through the store are built fivelarge| Suck, city delivery and packing clerk, and M. J. Cronin, pyramids of goods of the Acme manufacture with live'jot^ watchman. ted palms or ferns on top of each, making in all a i.vajg pleasing and cheerful appearance to all who enter the ever ready Acme Quality Smile and Scrvicc.. 0007-SWP-043189 0007-SWP t it J - / izL V- a.. nobody outside ef the .. farm-impkmeta tia bn graded up" to the fanner so pet alstently is the manufacturers of ACME CO/S PITTSBURGH CONVENTION. (SfMciiU to PiUNT, On. amo Datro Renew.) paint And nowhere else ire the On Saturday, January 16. the Pittsburgh branch of the genera) effects of "trading up** so plainly -visible. Vf'eM-painted buiWings and fences ire a den of thrifty but it is not the easiest Acme White Lead & Color Works of Detroit, Mich., held its annual salesmen's convention in the salesroom of the company at 209 Wood street, Pittsburgh, Pa. The`room thing ia the world to detnonrtritt 'jfi ' was profusely decorated with advertising matter and help- that ti Js real economy to spend money for paint. Vet persistent r!as' efforts have succeeded in per I'?# suading an increasing number of farmers each year that paint U a - ` <*,, -j ful suggestions for the dealer. The greater portion of a j large table was occupied by samples of the numerous prod- } acts manufactured by the company. Demonstrations ol . -_ enamels, stains, floor, finishes and concrete paint along with protection as -well as an ornamen- < tatitns and that an atmosphere of prosperity is as asset. And the moment.the atmosphere of pros . ; ; the Acme Quality Decorator System, were given for the 1 . - I benefit of the salesmen. The meeting was called to order I by E. B. Soverign, general manager of this branch, after , perity is crested, other needs fol j reviewing in general the business of the past year and the j low as a matter of course No- f prospects and policy for the new year. ; body that 1 know of has evei k - > stopped to investigate the effects I of a coat of paint on the wants of " ' ***& - F. R. Dougall, general director of sales of the home office, slopped in Pittsburgh to attend the convention. He was on . a household, bat it is sot ineem- * his way to Detroit from a visit to the Boston factory. siderable. New curtains, nev 1 carpets, refinisHed furniture, are } 2skr.lv to come into the house to ' make the contrast with the exte M. L McKenna, assistant general director of sales, ddir- r ered a talk on business conditions over the entire country, but the Pittsburgh district especially. 13*" nt': kss striking. . Then the bam - G. C. Henderson, credit man and office manager, delivered r Iik Av shabby is comparison, and more paint would. bel8..sJXhfi btigr . fcjr.-*.* --v gy vre drive to town m might be K&- ,;j:nirV improved to advantage, and Dob* J a very interesting talk on "Credits and Collections." ' The salesmen displayed a great deal oi enthusiasm dur ing all of the discussions. bin should be clipped. Even last j* ^ At the afternoon session Mr. Soverign outlined the com- I winter's suit of clothes begins to i ~ . pany's advertising campaign for 1915, and compared con- ; look seedy. There's no limit to J the "tradme-up" habit when * it T once gets started. . Advertisers in almost any held i; . ;r-v . ,, . ^ ` i' i structive and profitable advertising with innumerable worth- ` less matter that always fails tD produce results.. The c o d - ( vention closed with a luncheon served in the convention might study with profit the meth- ,.r room. Twenty covers were laid. ; I^f#* P ii i' Bated Bern Mean Better CWBAt Year Buk Mimnejnaiiei aWnMMaMoimS. |MpNsS&*nt LINCOLN Bun md Roof P&lnt ` %SS&5&*g!~ f / *?7 /t~ N. A. Runyan, manager of the Cincinnati `branch of the ' Acmfr White Lead & Color Co., with supervision over a - , considerable' territory in this/section, is'Enthusiastic; over- . the results which have followed the Work' of H. G. Peter-1 - - '.son, the demonstrator of the Acmewall-decoratinglme who j- ` r- -. has been traveling-out of Cincinnati for .some weeks.-<He|l - . 'accofrjpanies the various salesmen/ staging demonstrations;. , in- the towns `wHefe they stop, and thus lutes the-business^. -*1*' . no for Acme dealers in splendid shape.. A. D. Hoagg, ager of the company's varnish factory and department, was \' - in. Cincinnati last vveek, en route to the various Southern 3*^.; points wSere there are Acme branches and dealers. r . '^^V' *, >SiJ ** a nuiun t v t at Tficciu rocor*. h ods of those who have success fully- advertised to' the fanner ' with thrift as the basis of tbeir . copy. But the thrift appeal does sot mean simply hammering away upon the idea of cheapness; sor J forever claiming that these goods .' are better than competitors'goods. ,, IVhea you tell the fanner that , your machine "`unites the good points of other makes at halt the * cost" he discounts the dsim : ............ about SO per cent, hut ash him to i', u>." ' ."divide the cost by die years they f :' hst." and he is willing to con- aider yonr proposition dg. Be is conservative, true, but he is perhaps move teffiir with the idJe__a_o__f__i_n__v_e_s_t_m__e__nat a .___aLth.e..a.v.e. r- XehbhigaveeHayld nun. good* ArtBaenh to farmer*, l I the `h*9U ol. thrift, ut pretty' if* to be i\r y:- **t -3^ PITTSBURGH NEWS. . &*>'.. TOW" "Busma is very good,", said E. B. Sovereign, of the . Acme White Led & Color Works. "The demand, keeps us on the' jump to fill orders! An extra man was put on X,AW. last week and we expect to add a few more. Prospects for summer business are particularly bright" . Mr, Sovereign is one of the most wide-awake business men in this city. For Easter week, he bad everything re- | painted and re-decorated in white and li^ht blue, no-lustre ` finish. The trimming of the display window for Easter was in the same color. Mr. Sovereign personally demonstrated the Acme Qual ity Decorators' System in his display window, showing tyiji'jf-. v; beautiful blended "Tiffany"' eeffffects, *land'scapes, "trees, "flow- era, etc., and attracted a largge ccrowd to the window all day. rfe?:^; 0007-SWP-043190 0007-SWP-000126346 f Ti *"T'f:?.'? - *j M' ,- ' N. A. Runyan, manager of the Cincinnati district of the' ' Acme White lead & Color Co., left last week for a trip into : Western Kentucky alter business, and reports' from that section that things are looking up in pronounced fashion. The territory included in the Cincinnati district is much favored by economic conditions just now, being in the heart of the agricultural section. j F- K- Dougall, director of sales, Acme White Lead j& Color Co., Detroit, says: 'I believe the "Clean-Up' i and Paint-Up" campaign has been the biggest boost the paint trade has ever had. Let us push it along" V3 'i-. y^S'.. 'l ' r'rj Speeding Up the Acme Organ- 4- ization Carl Graham, the distributor for the Acme White Lead & Color-line, had a "Clcaa-Up and Paint-Up" campaign of m ";V| ' cv 1 -- ) (Written for the Rev iew .) his own. He Idvertised a grand opening day Saturday, -- I . The entire selling organisation of the' Acme White! the 10th rnst., for new kinds of paints, enamels and decora f jLead & Color Co. is deep in the second annua] "shooting I tive articles, and his beautifully and tastily arranged store c-contest"^ held by the company, in which high marks ini was crowded with customers--all day. n*P* of volume of business are the targets aimed at, C -W*. i . -- j^yS-.and extra effort the weapon used. For the sales force, iv.-- t,le contest is merely preliminary to the prize-money con- ':::'."test to be held later, while the various branch houses of '.the company have as their immediate incentive the pos- .session for a year of the president's silver cup, with the N. A. Runyan, manager of the Gncinnati district of the .-'.[name of the winner engraved thereon.' ' Acme White Lead & Color Co., is not saying much, but he is S3. The cup was won last year, the first of the inter-branch ) in high hope that he and bis force may land a good position contests, by the Minneapolis store; but from present in- : in the annual contest among the company's branches for the - dications it is in a fair way to change hands, as the first President's Cup. Last year the Cincinnati branch was vir -- bulletin of the contest, issued last week for the informa- tually eliminated from the running by the carpenters' strike, . ; tkm of the organizaton, showed the Topeka store leading, but as far as this season is concerned, last year's poor business "with a percentage of increase of 13j, closely followed, will be rather a benefit than otherwise, as the standing of the ..however, by the Birmingham branch, with a percentage branches is computed by their advances over the' amount of of 13J4. Next in order came Toledo and Portland, each ,,business_handled the previous season. So far business has with 13 per cent, Dallas, with 12yi per cent, and Nashville,|- been excellent, Mr. Runyan states, as he found conditions in .- with 12}, showing how.dosely they are bunched. It is a ' western Kentucky and southern Indiana and Illinois, which . race which wonld drive a baseball fan crazy with exeite- territory he recently covered, all that could be desired. `ment if the contestants were players in the great national -game instead of in the equally exciting selling game. The contests in the store race are judged, as indicated, by the extent to which they exceed their marks of last ^.year; while the salesmen are handicapped, as it were, by , ... .* . ?.:j,~s=Tr3j;v^ ' -: quotas indicating the company's estimate of the amount of "^business they ought to handle each week, the excess being Messrs. R. N. Young, E. A. Gignac, W. H. Behenna and --credited to them at the rate of one point for each ten] R. S. Keuhn of the Acme White Lead & Color -Works in `dollars. The weekly bulletin issued to the salesmen bears Detroit Mich., are in Pittsburgh installing a perpetual in-* --;a target, showing the exact standing, on-this basis, of j ventory system in the Acme branch here. It is stated that -. `every member of the force, the "hits"--or mis$es, u the i this system will greatly facilitate the operation of the Jicase may be--being easily traceable to each man bydie j entire establishment -`^number it bears, by which reference can he had. at once'to :5,3 the salesman and his full record. . Sales Director F. R. Dougal evolved the plan/'and.the ?yy enthusiasm which it has aroused in the Acme organization " i\;indicates accurately its success as a stimulus to the.'forc ' j It may be stated 'on good authority that although 1914; so ' E. B. Sovereign, manager of the Pittsburgh branch of the ,:'.iar, has been a dull business year, the comoany has found | Acme White Lead and Color Works, reports that their -gits business considerably ahead of that of .last year.'aiid I new perpetual inventory system is in working order and tfithe manner in which tne organization is kept up to?the 1 they are well pleased with it, as it greatly facilitates the tfmark right along is undoubtedly largely responsibleyfor I handling of orders and the keeping of stock. He also re .-..'this. C'; ports that business is very good and that the increase in the price of paint did not hurt a little bit as he gave all of his customers- a lew weeks' notice. That ever optimistic E. B. Sovereign who manages the Pittsburgh branch of the Acme White Lead & Odor Works, again .reports*the past month as having seen more business transacted than any other month in the history of the branch. "April was my record month. May surpassed April's mark and June made May's receipts look smalt," said Mr.`Sovereign, awhen interviewed by our correspondent. ` 0007-SWP-043191 0007-SWP-000126347 c/fSl m The April Prize Winners Winner of the $35 JOSEPHINE B. LINCOLN U3Z North Harvey Sl , Oklahoma City, Okla. THE AXtYERTXSKhtENT r'GurxmV*: t:^i^f.iiaw IMfr5y75*>tZs5&yj > THE LETTER I md to teak tint I m oyat ia ny bn far pot ef teal aad a brwb--bat I him *mw mwtiwid ibiapradMtj U uj wn oka* ntw m art utk. aiaatkaavoallbatak lewd ten te. So. ifvraReato P^fttlftK'oU funitwi aad ten. tea Uui ten Mid d- im'imnmi hyew April inum wafr rMftied to aitmt the ftUeetea f te tea p>i>ln, - And than wb* h*a kd dUteNr { iwfciac ft dateft ft* ts ateteft ftUift. *tefc. paint at euuari akuld fee Bead far the wk bo d- tested, wg to ytkriartr iaieiwL Ha* k u idtvtkMl tel effcra, Ml oa|y Ida*> fiftft w to te be* steity cf pebt to bo wad, but it trie el In* bwtlfti pitted for yar aid sad bmuete (N, ft Ptetiac Grids te ocher ft tnote so H Deenfttka. A portal wiB bring Ue bote w my afliton. patio TOtfc ft ftkaer it te Auatmtiooe. Brnaa vilh te lore ef te elaeo ud bnstifid oil aft eon bn*rim of |ut> ht te hied. Afto friifcwilw, te porcb fiimtart. te. Bute te te te* atop* te atoK tar te doom. "lit i Irij-1~f-T`*H wrti nTI fin i mmrnfiil filnrin nf woefc by kr <nra ritol Thai odrcrtinmwl teihi tet btef. Finite. to raaa. it aoi wwkj H m fkj, vto te Rftullr an juat vkl ato Amt Pairt Canyy aim laeppcrtuiitrfieryatirSOKStTmdanto ranMani te tear, at te aaaa tint pkete within roach at al te ftftMNHuy bfararite, without ebip. TbafflaRraten--d torioipof teAaac Mat od<nr- tkaml ite ate a bis appeal to warns emtio* is kraAnte to patai, xiftvftftat*. *ft*te tnateva. aad y Acne. Tkft te fafnantea cnrtaimd km te kwt- iafi lanpldovalb aucytkaftaakt U-ptet anl ter. Aft adnRteftte tet mte (Ua appeal k* nadar. aad tka rim aridk Uanliaa U wytaKaa tel &m.. dealrt efyaaadaas ki amaftBaba* Ua pupcas ud tel vkt te Acne Mat atertiaanaat doaatote Mart octant, Joftoaaw B.Iwcom. a: ^CeCfC*?C<2e20^?t:eo fc:* If..^W^- muoh ftikMdkUoii Aft ts- lie **2t*Sf tvr*. Attimctko b. KrtM r ftowMij* ^ Intereotlnr. trmdo mrk p u u Iu -mu Aid h'CufflUbliu oiavftftzMnt .fop tbs WlU ' touts dTa tha trip'osl SJ boot- Tte conmdttoft of .fttnplarea ehsrift of - Ued ftonwthl to tte d*7v of Bsteft ___________ .{siterm studsrd tlmoL. ~?VC4*S? ' . r-;; y. ^ - ss- j 'OFFICE MEN NOSE OUT-?' ; ^ ACME'S FACTORY TEAM Oflteo nms of tte Aetna Whit* Laid - mod Ootor Works nod out tha.tso. lory tesn, M to XS^ yoaterdsr at tho sanu^ ontins of tho mploya st Bok Blsne/lclatitf. Beora:. ............ * * * ; it84m)ri' (t* o it im ........<i i iii t i nIU.W jr , Mipr .........n : l r 2 -m o o-i" u a : -- --------- --^ 7_->y- sjr yynrY' .. "t--: v_ r.. -om<* Taim Captorwe.Swfttfral ' of OmT Acme WJUU tmii tt Color work* held tbotr aaiHial wtlac aft tedft tolwM, fU. fMiun of On day. bctarite, sMiMd'hkekU ctm hoiwem tte.Oatoe>ftftd Paeury uini, mVlto QAb s U to. 1*.' - So o t * hy to3s*at ,,* " Xaaliisa . I a t ft I f , :-. " Ptllarfaa OOw. Sebulta. Wttblai a*ft tela: raotory, kbntdt aid .0*1 Sfttulto A.** .mrstMoft , XmI. Kite-- oB Dsvlft ft. Off SchBaUt SL: ft<Ci' KftSi i. b u m on bajia . oC.Bahnldt.i.;., ^Wvs eke Emplerta to p Hh IiC v-Tte sssosl plenle'of Uw (unployei of .-the' Acmft whito Load- yd Color Worlca will te hold Saturday mt Bob*' . La:-.* A full pramn of immanent^ ermoaincttvekblmrr ttUe oomromBetfteo. taeanx-abUoottte*, .oInr** .: cludlnr "thoraugMwM roeo* for or- - Aeorft of thft cemponr. which la cooo- , Inr much apeetiUtlo* `oft H !* m hiro.. Attmetlvo oui" * *1 te prortdod for-tho oi>` ,M < intertMtinre tmdomo h i> nt.rt II mid Sn farnisMiif r x it ***<* < it. ilaf ; loltoU*fet-<, fBoo^okt*-, dIMurtinh#t - d*o.orh *i.fif. 5 o' . Bfttok otroot mt B arm.* riaturdmr.>..;*| ' r*VN**.*a* ' . ... THS AKKOa Xo PICNIC' 6p ~OTE ^tmjUOTOft -of thft Aftmo. White aLad A Ooiar-workft;WllL bo hold Sftiur-' d*y At Bob-La. -A fttU procrAca of t inuniMBliL ooflaprldiiuc 14 oveatAl hftft bftiiarrui(w.'by th.fftiMi| ywrmnlUAO,: ladudloor m- thoroadh^i Brad roop' *** oflloftro of tho oon^i 1 U cftularnvcb opaom-i * -j Ita-- ftzmet amtnro.- Thol _______ .'ter* tho dock if tha J * -Tteofodt-djolao fttroftt.ot**. R* --- ,* -; bft^V "-"to "tiaej.Jji lift1.' .. tiw. i :i of. J)ttl(iii `""'iwfteiiVTjmJ. Saif- plw*nn^> toll. reM.x.1 lil* T W>poi *)y nniT Hi* iM'.rfis ttfiirKleulmlfir. Him. hr, frtHui* V^'-it'S'-!>lie* "sv! ItTmTi'K lieuctiuUIy, toM^jr| IHWftW*-- 0007-SWP-043192 0007-SWP-000126348 STENCILING WINDOW DECORATIONS How to Beni Your Stendl and How to Mitre* the Pattern; An Elective Decoration for Flac Surfaces and Panels. . ^ i- HE art of stenciling is as old as sign should not only have outline but the T painting. * It >a almost necessary 'ties and bands of the stencil should give it when an exact reproduction of a character. pattern or design it desired. By Color is the next important thing. Avoid Us use the display men have unlimitedstoropn g raw colors. This is the first and portunity to show individuality, not only most important rule. Neatness and clean in drawing and designing, but in execution. liness are also very essential and your tools The same stencil can be executed Lfl an as well as stencils should be clean and endless variety of colors aod treatments kept clean. Yon cannot expect a pure and this alone adds to tba charm of the white if a trace of color is left in your work. stencil brush. _ Through the kindness of Acme White Stencil brushes should be cleaned in tur- Lead and Color Works of Detroit we are pentfle or benzine, whipped out so that enabled to show you these photographs and no moisture remains in the brush and thus give you these instructions that show how be ready for the next job. To set them in to do the work. water softens the spring in the bristle, and worked sideways or leaning, the bristles will slip under the edge and make uneven, rough and unsightly marks. Your sten ciling should be as keen and sharp as print. When using a Urge stencil, as on Figs. I and 2, push-pins firmly pressed in will hold the stencil in position, while with your left hand you can follow up, pressing the sten cil tight as your brush travels. In work ing the stencil brush do not use a long stroke as in painting; The color should be rather rubbed out with a quick, short movement, as, for instance, when using an eraser. See that your stencil is complete, no dots or markers left out, before remov ing from position. ^C Fif. I /*/. 3 Ft* 3 /v. 4 The first thing to he considered in regard if kept in anything, it should be raw lin It Is far better to use two itendls and to stenciling is design, and one of the seed oil, but this requires a cleaning ia use one for straight plain surfaces, and points in a good design Is simplicity. The turpentine or benzine before beginning a' 'the other for corners and along casings, design should also show individuality and new job. etc. Some decorators will tack the front character. When the designer of classic In dipping your brush for stenciling, do side of the stendl to a light wooden frame. Greece showed by a few simple lines how . the tendril of the grape-vine twined itself into what Is sow.kaowa as the Greek fret, when the Yiking carved his mystic dragons not dip as if you were going to paint, but rather `moisten the brush with the color. If brush is too full it will blot the stendl, the surplus paint will crawl under the This is advisable only on a long straight run with the same stendl, but it has so many drawbacks, that it is hardly worth, while. Your stendl should, when being on the granite cliff where he held bis edges aod spoil the design. cleaned and wiped, lay iat against a plain "Thing" or court, or when; the American When using the stencil colors straight, or surface. The wooden frame being in the Indian With his repeating triangle de without thinning; lay them up on a piece way will not admit of this and wiping your scribed how bis many tepees looked against of glass, tin, or if you have it, a palette. stencil tn any other way will be apt to the letting sun, the designer told us some Do not squeeze out too much, as you will damage it. thing. It bad a meaning; Meaningless jcrolls and figures tire, white a conven tionalized subject from nature interests. not need it in large quantities for stencil ing. Finish one stendl at a time and when you have gone all around the room with, How to Bond Stncil for a Garner A good many display men use an extra;* or duplicate stencil for this rather than the for instance, (A) take up and finish all of (B), and so forth. 'In using two colors on the same stencil In the same setting, you r. ; ^*5 should wipe the stendl dean, especially on the front side, between each setting. It is Important to follow instructions ad vising that colors be wiped while holding the stencil in place* See Figure L Wipe v-.- carefully so as not to injure the stendl. Pk.6 ) Ft* 5 give an effect you cannot get in may other way. The color will become transparent, one used for a Bat surface. Do not force J The design should adapt itself to the showing the underground through a thin the stencil in an angle or in h corner. Take lpeculiar technique of stenciling. The ties colored film. This adds a certain richness an exact measurement, mark where stencil or hands necessary should be, not hidden, (but placed where they will form a part of (the design. A carved moulding or a piece | of sculpture may be used as a motif, but I the ties and hinders of the stencil must be I to 'placed that they in no way mar the torig*l foes Of the design. A Bower de- to the color that ia very effective, ' How to Hold SUacfl a*4 Brush * A small stencil should be held hV. hand. See illustrations Figs. 2 and 4. Ifon will no tice that the brush is held almost at a right angle against the work: When should bend and lay stencil. faee up on a fiat board and put your straight-edge, yard, stick or a ruler over the .mark. Slipjrour hand under the atracil, hend h geatly'up? wards, press the Jold firmly to a right angle and it will slip in the corner nke and sm n 01 tH n Vj* 0 1 OT I r o o 0007-SWP-000126349 ;3gv; 73^'-;, %*****.Meti&SSSk&Vi ' Kv. .'<' Ra^ i**i _ -$ : >-'s%iy|a yr'S/ff - / i. -H't&'JSt'M i** `, j* *' *"* '* - * ` , f ., II ie B! ;; ------. . -i'^T * Tha.siilb annuil oprtog opening, of ^ tho* JUm* . Quality', salat *re. ,h* Mcdsrvtf Mala and Oiaim atrrrts. <> t^-.vUcm today. - Ae ban beea.au- . )'' -'* * . .** fe WMltaer favors no mu or his Vuct.. new. hot weeping shies 414 ifaot dampen the ardor of hundreds of pern , P>e who accepted (lie invitation of ttw Indiana fhtinl & Varnish company (o attend its opening. April in. The store uses this method as one war to adver tise the Acme duality of paints and Is Manager' Sam Newell's Idea of Iteep lag In popular touch with the public. Free samples of the store's goods were given away and each lady visitor re ceived flowers as souvenirs of the oc union. iiknm f thi9 non iw h m ifitra. 5SJSJLSW3ISW1 wiii^a?!h^^i "KS. thSSKT'SSw new* decorating sratem by which -of h Sts TUtoy Meads. Prtntrd .BjiM.i ^rd,ewrT*lady visitor, sosvenlrs Ip 4 MWwhlte and pink iu o o o ^Tv nhtr wtth row, l> will r#c#l>.. iut* a*rtlty ;rQulr4 ' Mrlml to ItaJah wr wutasm 'the ptil' ye*m this : V,-n 1.nr| af, n fln j|y. rfttfcor thill ' on wwtur uii JuArtwr frs plans to . SmStrSU to *S*f"Si>2S[; .imii affaMft to M flhwhM from (W* gfr.S*&&? "r-JTggj *f-/6 ~/t T " * % )> -/ ?/r DISPLAY NOTES Members of the BtrmmrHam local were re. ecntljr treated to a splendid demrasiretm by * representative oi the Acme White Lead ' C"om*pa*noy,8*w1hUoieshdeifwfeerdenhtoTwiftfomvbletnfdKet,olo&r* 1^mdtfround work. Thi* woe fuloved bo n Dutena'^~o*u*iptippeerr.. ^ '1* JsU*J /- / -/ f*.s' Adds' New. Blrsctora. - > '- ~-vi'- f-?K >-' safsSasw;,- "KS1^tV-iSeta-h?S|t"-w*g>iqfrliodiipflACr.^.Tiw1rrWoWI^'1d*u .M--m---ii-(-D-I1--.ltI.oTl::n...*fDas>o.gol'ilo:rlSa.iws\snTt*a.B,-Ml''s--._;-:-. Vmi'lT *11. * "h *1 a*rl*i>''*g'/' V**`,%a *"} StUv P nnmril hWWT,r^o*^'S . * ' ***' * Hr. *' $C*t Ou_tt_u_rnftCbauc _ _______ ---40*100 fiitar* I ,, t&m&A ---- j^sS^ { of whtch.opft .1 Kat-deporauew iwaUa wraahahlol.flnhdt.^.: rireer pspsrc'siajr sn^iai, ;iapia propping *'3?i....... ^iprwaieBl dsmoodlra<lonv,ojpjM) ntWriAtme.' Quality dseoroiorw sjmfanr Is naansd to bp pulled off during |So dorv.Tho Aemu syotsm l*fclol'od DL bo tho laot word In Aoroullnn Ifss*. anl la and vvroolt below any' In rnnSr*. i.r of eisenp^iv'i>\.. ' " , d-ho- VnonAwl * arvsn*ed-A(.to. g[to sAiplwbnna'of eornlog otnln^nf men vlolloni ul Ih"?'.""US:?"*1 bided tfogifUeJafl^jewy,fn"i*V; i^d-vir jya.'^gn&Sja f.n;i:im" t r^/k/ut-z.-K yX& m & **r.h~ '.V.iv^rrv^.'V r-:.' '8.' - - M2" nr.-; J*! = ' `<r :?n. ..l^S 0007-SWP-043194 `a- '" ' - :YPiB3|Knp^ -- '/r . iC'.s'A-V* ." Wj < Y/3s Xn g h i.i:s t 'KADe n o t e s . ---- ---------- : - ar, J* (Special to Pat x t , On. a n d Dace Rnnw.) 3E3j Employees of the Acme White Lead & Color Works, De- The Los Angeles Faint, Oil & Varnish Club held its tMtroit, were entertained by the company, Saturday evening, annual meeting on Saturday, August 28th at the Cahuenga r /.December 18th, at an informal^dance given on account o'f the ' Vista. Ranch, Hollywood. The meeting was well attended i,dedication of the new advertising department of that cou- and the spirit prevailing was most enthusiastic. The elec T|cern. The dance program included 18 regular and six extra . tion of officers of the ensuing year resulted White of the Acme Lead & Color Works in Mr. H. G.. being elected idances, all being named in honor of. the numerous officials of the company. The grand march started at 8:15 o'clock. [ president; Mr. H. R. Tibbetts, vice-president; Mr. Byron **' t i McNulty of Mathews Paint CO.; -treasurer, and Mr. A.J.' : Tweedy ol the Tweedy Company, secretary. -nr :. - Lead * Cbtor Works report an exception! / . ^ i-- -------- jSlsWB00 y-r, CINCINNATI TRADE NOTES. )?_ 4 (Special to Pa in t , Oil a n d Dane Hmw.) Mr. N. A. Runyan, manager of the Cincinnati branch of m $*SWFv .- - the Acme White Lead Sc Color Co., and of the surround ing district, left Monday for a trip over his territory in Kentucky, Illinois and Indiana, with the special object of ; visiting the company's jobbing connections. Mr. Runyan : reports fair business in the general lines, with extra good demand for the decorative goods upon which the organiza1 tion has been specializing for some time past. * - -rV"-` -------------- - ggmm-v PAINT MAN LECTURES AT CARNEGIE TECH. It ' Mr. E. B. Sovereign, sales manager, Pittsburgh branch d yof Acme White Lead & Color Works, gave a lecture before 3 I iSgthc students and faculty of the Carnegie Tech Trade Schools i$9on February 23rd on the manufacture of paints, varnishes , --`and finishes, showing stereopticon views as to how the raw materials are secured and the processes of manufacture, ,h` etc. | '/jj The Carnegie Faculty were so interested and well pleased Mr. Frank Dougall, general salesmanager of the Acme " they have asked Mr. Sovereign to give them another White Lead & Color Works, is at present on the Pacific `similar lecture on the treatment and painting of walls and! Coast. -nceUings and flat wall finishes on Wednesday, March 1st. I"" //-- /a .g-> d~. ... : The Pittsburgh branch of the Acme White Lead & Color ' Works of Detroit, Mich., reports that business is very good ; with them at this time, but there is plenty of room for im- provement. There are a large number of orders coming in every day, but they all seem to be small; everyone is just ! baying what he needs, and being very careful not to over *U ss'tt,oo cc kk>. ---------- ,,g ' . ,VV"" -F. ->* According to announcement made the end of February rt' | .'A H. Berry has been named as sales manager of the Acme afr White Lead & Color Works, of Dallas, Texas. Mr. Berry Kis well known in the paint industty of Texas, and it is be- * * lieved that the business of that company will be increased ->k-th,Le-*.dJdJi.tVfa----o---fiMllr."Br>--S---y--"--t-o- .'.t.hTS, rc^ " jarjgr~'?' Y&s' p'V'' - of! I e D TT-----11 AC..I.. rniMMr (nr rfiN Amu* White I ^^ F. R. Dougall, district sales manager far the Acme White 1 .Vfc/-.* !w Lead & Color Co., was in Cincinnati last week looking over ' -- - *-"fi_Li -------------------- in-- fatcijc the situation, and immediately following his visit, Manager j Notwithstanding heroic efforts by Manager N. A. Rtin- 4 N. A Runyan left for a trip to' Western Kentucky and Jyan and his competent staff of salesmen, directed at the task] Southern Indiana and Btinois. [.of piling up a sufficient number of points to win the regular lispring contests for the "President's Cu d "-of the Acme ?v* ..r. .- I. .V'-jf , . i -i ; * '"jiij'tf'htVehiCrtr:i-n-Lc:ei-na'rndr,a.tv&_i bi-Cr_--a-_o-n_-l-_co-_<hr mCios-se.Md...r.f-..irsiRvtuup-nul-varaacnen buisy aainuffowerwimmecnudotcUthhIeaKst. '.t - f^-S'Tlie Cincinnati branch has turned in consistently imprbv4 1 "----- -- --ing business and although the force put in herculean effortsj "( In the f"uture J. 51. Kile will fir the order and price rlrifc a it just failed to dig up sufficient new business to land the] ?! for E. B. Sovereign, manager .of -the Pittsburgh branch of tbe Acme White Lead & Color Works of Detroit. W. E. Scheuer, who formerly held that position, will be assigned a territory on the road for that firm in a few weeks. When talking of business conditions, Mr. Sovereign said: "The past year was certainly some prosperous year for this branch, in fact it was the best year this branch ever enjoyed. Orders poured in in gnat numbers and profits surpassed anything ever seen in the history of the Pittsburgh branch. ---------------------- --- ------ --------- . - wKT-rv?nTlsrE Si - c Dr, C. D. Holley, of the Acme-White Lead & Coloif yWorks, of Detroit, was a visitor in Chicago on Monday! rpf this week. ........... -l 0007-SNP-043195 0007-SWP-000126351 -- s-."^/-'. e*A* ISE thow * obSiS priolnr IaMtrmcD7fou,MivinIeI or ( per csnt 'eumoanr BurohkMd Ii.sia *r uV^^|I , -<&;. ' -V Vi ^X^.-V- - ' - - ; .""-Wise, B u si ne ss;fo rl 915 _i: Shows" Suhstantial 'V. Net Profitsxof White Lead iblo*na!?*, tha?t nvml ouu**wn* a inI.-rLWttb* d of 1914. reducinc the VmeunCI ,:V- ;;. & . Color. .'^orftsrAre . M0-kaBd* f the PtthUn is |iJS .; Reserve for redemption of thoJsr $315,625,50 iti'19xfe;t `bon4ds twOa0n9 Idnucrretnacac&dfroyemari*laliidnrt!iH) . .-;.1 ' CGam Over. 1914 * .*s?r^5,r?>**;i!t:s *5$. -%<w ;; Tha unttit report of the Acme [ White; Lead and Color'Works, for;! Oieftaeal jeer esdtaf. Nor Skr4at j:. Issued. chows that while the uacsfi talaly of -Jbuslaens- 'conditions' the early, part of the roar .was such a to show ^decifna ia the.voluins of ivy.., business'dona by-the. company. the later Improreiadnt was'bo treat that ;s$fc the.total volume of bribes* forth* year was treater than that of ltlA 8oudh of materials ud thslr fcltfi I;': prices, however. have somewhat atfeeted**praflts.^v-.- V't * --* . The report of tha.cDxapany shews -r. J2r .^A,,i!?*^,,Uo,6 vu IncroaotJ v.w/W from II0.77t.3l to. ttOMJS.Mll * "'1 COJfPAST CLOSES YEAB. . . Reserys for the bad debts remain*! ' fSt.MQ, acd'reserve (or aeneral pur*' WITH |4$4,420 SUBYLtrS poses rameins J2flj.t49.n. Toul of' hurplua and resorrec. Mtl.iOS.J*, cemparss with rm.su.ll in ii*_ * . . - - -. sr*'* Continuance of the policy -of CoatUnua-:...raUt^oj(^ Buldihg building- up cash resources to en ablethei company to avoid tba'nee^-: '. Caah' Beiomoei.. ta.'.YMoicla ' eaelty of obtaining temporary bak> loans and tbs policy of maintatnlnr'.v . L . tee';jraed*..'; a reserve la edvanee of matuHny '*i- J2? I 'bonds It- la hoped- "at the proper- **`~j-1 -AltbMhh Mivdarji*.^.th?^ aarljr time will: enable. the company to \ resume the payment of common months of the yoor. thilM;wec a r- stock dividends/* Praaldeat Davies saya The company's Puainese i* de* duotlon la volum aftbusiooes'doBe scribed- as in normal volume,, with by. the .Acm* WUt>^IaoaA.*ft Color works, duo t Mndltioiiji;vMUd by the oetloofc for. ills . much mors favofahle tbin a.year *ra>'. , ** .se-v." -. -- * *^--'^* tbe Xqropoaa vnui the.lmsrovoBoat which; como lute onablod1- tito..com:-: - paay toi* ahow* aii^ lacrdaoo' lif burl- - :i aaoe for tfcu yoarvV eompirlima. wlthxiSKA Byd Prooldba.t .WOJUtm L. :V- 3.-/0.......... Div Iia .' ift . ta aBBui . report sebt; net profits for the year, after the deduction ofexpeases an* deprecia oat to etoekluildrs>batvrday. I fat 8^3 Septet|| *Tli Bcarclty and blcbor ` prieea tion of $315,6*5-50 and other Income of $8,2SZ.10.-; The daducfioni tor in-, terest, flividsad* on preferred stock: and reserve for redemption of bonds leata a sarphis at the end of the year of f15MI0J7, .* ^ . The. company btsflxed. assets, in- duding-real,.estate; and^ burnings, prtvtlll&f for. raw materials* eon- ;1.;- ' ' y/:.. taw to1 disturb conditions and ma~' tonally offset profits 'is our. indes- \,' a5. iteftorium ier Sfcnie SB tnr,**- mitievt Davla Mye.sa4dlnc Beak aiiA. Solat SBoztt $at bat Hi. that the company's*^diroetdrs bs*. Hove it wise .to coctloos a eonisxva- I ticrBeTiittn but(5 tJrafiiotf fflnCii tiv pBtiqQ-bvbMdla( financial roBoureoo * and- irrrenivolv .ptuhliut for 'baslncs*,-.-.^'-;.-^.. ^ SJaliieF Bn: !d)afUBen(6t.fuc. Bat; cun' 3Q.. UJobemfier 19IS c^gclaufcjik -`PToaisr! in~oj- v- ; *; Ste^mihatjoBi untaBceitet. - ,r^;v machinery; equipment;.trade aarkA " ttA^od it h>tlhl7l47;`iBiaeii> laneohs- tovestmenta: amounting to' flMTS; cashon hand..and la basks of BOtea uBd" aeconnU receivable of- 1520,57199,..:; racrohan- 9tae ixrreaioried at H4*Mw**Vaad deferr^ charces arooimtiat to $31,* K$a,maldnr .total 'aseeta:.of $5"jy. z u-s&Fia? .. ~ conaitt/.ot *06 laf|`frSLtl' jwrtbtnljBmmlt Tha BMApiD^-'ittoiMi'oUUamt 3nfoIce t Shieget, ]a 5ri&t a in for the jnw.- *b4lay. MMmbw. ) hows sot pTOfim^lntfvt operationa--m---o--u--n--t-l-a_g. to 4--1---i-l-,-l-!-{-.-S---I-, _allte<r. do* BemfelBcn, tsar Bal @cf<Bafi anfangt Bet JJa^ret aBer Bie SSterBSU. adlluUloowUlaollnnlc,eolof-e.fooaptrne'ordaftorinpoprmc-.e-aslaoxumtirometeueereieWtnhiotehdr:.^i franfiftta6ocrf:etori5cBrt tfeieni tmb BeS ier Oefamhim. SaBrcS BeBcu- haa operation, interne wu the compaaya total; tfttB gtafeet'ats itn Ootja^A 9Bate> K- .Tlaciuding- zmieit cnwrprnliso ooft;ifB4i5vba.v0v0p9t.*01 carried eve? from-- tn 'preceding H2aCr.atond dedcctino JI1.ID:J ' Interest amount-: on ; funded '-and , floating'debt. a. balance or hatmanq^Cui{| IjoBe finife offijiareii bid .(BemS^TOtB Bie tjlrofile uitB cine fflcffetung- tiicB eeft erto'artet, .Iwnn II wae avaUable for dlrldenda and reserves in- eemparfson gwiclr- sect.* HTwSff ^{he:.end**`of'*tWpreeedlns Bunb Scie4oi4f<bIu6 ;.nonnnre; S)er- f.Krtr.cV (iflrrlr: - bom 5l tin ~it6ck.; tMMiWO ``Uvi'cmnnioQlJfrrr . , OiirlrB Mrtjn: i.-.l|.'Sily . . y-nllcr nr' ertfefcowlfe. taiSjSlJte&V u4 a. h. tl>t>Wp|nrra kid 'kurvhiiTaccount f SIAM waeSk^broprlated-tb be added to: reserys^xo^.-rhdamptlott^op the cedmarriititeellBir >onds$ leav-. 036,60; Bit-SOwiBaiutt hmrBen $64,. S5jk idiitBqaBIf;iiitB.Bec.!lie[crte 'tilt tkSlAWAkty T*w aiuttw* ourln"t H^ofSO/!M.'4kc>?n4;^dkta, 3OMIlip^tor. 4neUtt9it**. 4LV.tor; -Jimenl :>!varvo*ny,; ud $U*MKT far rMnpUod of konda: Tk"aflteM' or th.~ Anno" r: PrwMmt, -WiUll U Dtrlw; TierptMldnfand ekibmaa flauei eom- mlttM, Thonu Noal: TtenwcaldcBt, A. - JE-' F- Wilt*;-- Mcnurr, .A, X. Wood-wart; 'tnainrtr, M-'.W.'NmI;. uilBta'ct'treMiirar. B. H. Stephen*; dlnetonc wa U- Dartoa Frank, H. Do0(*u.'' C..Ooodloe M*r,yW:. !C Houlud.-Jaiaca 8.: Holdoa, 1C WijT.4 ": NmI. Ttmau.-KMiI. A. B T. Whltaii;,.. |S|(tDiemSiilcBti}eiig ant':80. 916* -- - . ------ S_1 ...J \2.t|L*' beuSa^^Miet, $t&i;420.S7:.>;5C ____ 1A; anlMt iuTtMiN______,, elnlbslax chiefly lfi,:th>'ltefa h;whlSTa.4--i4.7rt4LiB:4CrDCffalnet M^a^abeglifl^tnii $6,706,695.08: ctt"aegdnSjCet Bdrag'Bct SMMSMSJai^xpXd, althong?-< ec-': epunta and* notae roealvabte, Itlt,^ 574.8*. alie ihev a JnCfeasa over Snift^mBni. Ban^l Itrurie loabtenB OB 3eBtBi'uni(.r$3M00':;'iiEBujiii 1714(170.4! the* year bcfore^^Znvenlorsaawers ii^kirtli*B 0*."7^--ag--a)-n-s*t |"i,-- iinb Bclouft fi4 ^^$1,424,800; IIUII.fi fixed:real Mti.*' estate todudingA^pleata! are apprdleed. at Bcr Wefcrtiefoni. jift'; ffinlafung Brr- fdberu Ber.iri i914 gef^affen tonrbfc 4r MS. um .M,71.ur In laeiMlBfaiM tul> j iMrijl |fV $::.<.K)0.:- il:,r JJr! 075'in mlaeellaaeone Jnvestmentk frr frr ("rtt-'lffli-nB rr:-:f i":B |* 1 which , does-ttot appear" in. the 1014 . report.; Deferred- AutL: |tMlL-k Isirk gii)i>|)l,, Bah, wri.u h:nr-i vs.-} , . II, compare. j]r.^!lB;!fr rifclriwr.? Bfr; ., jjaB?\.BBiifs:famJ &. A..B.JWoodward.* je'`. -*? 1 3**'; . -' .'S', ./'AS'if'X t.v". r7"-'<V;": , III, kH*. (dwllrtr*------- ' v-;Bra^2 0007-SWP--043196 0007-SWP-000126352 aauffr. *04,:ae*W;f Uti.luUfe ,#s'.CUr.W9rftf rtanr,hWHiBBUrtw eezaraBUQs Gratae. *d- TlMadiy-. ifojhitns U^OBlMtf AbOUt liTMlA*-; ate-'; alt/ 9*W\ **#-.lfititM-j Mr'Tfaa 'tiuMttan *r*. bl&* Jm*i f^.<aajorari>tla bairof tfca fsetorsvi :J 0007-SWP-043197 0007-SWP-000126353 'ios ANCr.EsfBS5^fcraM^AND JOBBERS . ^TO-IMPROyggrKAPBr;RELATIONS. ,-r.i A'*fe8^0#{i5^ip<J^gS^^^&h w^cr^itallued alf The Acme White Lead ad Color Works; Birmingham; Ala., have a very fetching and'tiroely window, haying taken for ihcir. slogan "Preparedness," of which the papers are full at present Their large window, is given1'over, to a panorama "f of..iheikading manufatfurersand jobber* of Los Angeles on December 30; prcmisedto bring very important benefits, not only to the manufacturing and jobbing end of the industry, j.~ representing the troops of the waning nations? The floor is. covered with sand, .and gravel, and is divided into two parts1 by a lake and winding river. (Formed of pieces of mirror but to dealers and master painters as well, and has the pos- te; imbedded in the sand). On these waters are shown toy battle Ability of far-reaching- results in putting the paint trade in S3 ships and submarines--which may be secured from any toy still better relations, with the public; says'.Frank Reed in PS store. On one side are seen troops of the German and Aus Pacific Point, Watt Paper, Picture and Art Goods Trade, trian soldiers--little tin soldiers several inches high--and i The gathering -was so complete as to be thoroughly repre- i.-. planted in their midst aTe the flags of their respective coun sentative of the industry, and in the discussion of business tries. On the other are the troops of the allies, also with their., . matter* which occurred it was so apparent that each member battle flags, horses, cannon, etc. The. window is arched over l was taking a broad-minded view of the entire situation affect- JJJ with blue paper to represent the dome of the sky, and sus- ' ing the needs-of-the industry, was so inclined to take a , pended from it by wires, high over the heads of tne opposing friendly, attitude toward the opinions and interests of "the TC; forces, are several miniature aeroplanes. At one side of the other fellow" and to place the main object of harmony and. ifc window is a large sign: co-operation above all minor personal considerations that the Pw The Nation's Preparedness--Acme Paints .. correspondent of Pacific paint trade has no hesitation in say- _ I and a row of the cans of paint is- set- all around the base of ing that it was one of the most promising of any of the the panorama. Another window offers suggestions for the dec great number of meetings^and conventions of business men p* oration of various rooms in the house. In the background are- for the purpose of promoting beneficial co-operation which.he shown panels of various colors. One of brawn, with a border has had the privilege of attending. r~ of purple grapes, has a card saying: "Dining room, restaurant | _ Naturally.the subject of credit and improving the credit or cafe." One of olive green, "Library or living room;1' old ; situation came up for primary attention. - A tentative program was outlined by H. G. White of the Acme White Lead & Color Works, and M. B. McNulty, Manager of the Matthews Paint Company. In the course of a discussion every mem pjr '>;ty rose, "Bed room or sitting room?' from each of these panels run white tapes to cans of paint of those respective colors i placed in the front of the window.. The window is bordered j with garlands of gay htied autumn leaves sprinkled with dia- be.r.o.f the gatherin~g .par.tic. ip. ated in a free and frank exchang-e mond dust, while the floor is strewn with cans of paint, varnish,, of information and opinion. The result of the thought he- gjaf: jpiJ oils, together with brushes-of every sire and grade.' - stowed upon this phase of the business was a consensus of team: ~ _. ' _o_p;ini-o__n JthLa.,t-'a. large and had debt e_x__c_e_e_d_i_n_g___o__n_e.C-ha.lf of l.j' - pRsAnPmID pRtISs vE. wWiItThH AACc Mh sE CCOO.. per cent is discreditable to the paint trade in comparison. < Hie rise of an $6--week bookkeeper to the position of ex with other industries, that it is injurious to the manufacturer ecutive head of one of the largest paint manufacturing con and jobber, and in many cases positively disastrous to the cerns in the country was brought about in the recent elec small dealer and the master painter. If credit is too easily- tion of R. H. Stephens as a director of the Acme White obtained it places temptation in a man's way which invites Lead ft Color Works, Detroit. ... him to business- ruin where more rigid supervision of credit Mr. Stephens, then 31,- entered the employ of the Acme.. would enable the manufacturer or jobber to sustain the man of good ability and character who gets into temporary diffe* Works in 1897 as bookkeeper and developed unusual ability as an accountant . He took charge of the auffiting depart- - euWes and lead him back to prosperity. ment and in that capacity conducted the firms financial at-; - As for the intentional "dead beat" it is sufficient to say that at last things are lined up so that he will get what is coming to him and get it promptly. A system has Men devised fairs in such a manner that he was made assistant treasurer, in 1915. Then followed his election on January 14 as a- director with the title and duties of assistant treasurer sna_ which will spread a.net for:our present "dead beats" in a ^He^U the youngest member of the Acme Works hard of way that will have the Bertillon system and finger print de tection lashed to the mast.for efficiency. This system, in its directors. 'His rise has covered a period of 18 years^ preliminary stages .will get into' effect very 'promptly, and already there is a movement,on foot among those who have Z. been encouraged, by past lenient conditions m the industry to -' be a little carries! in.their accounts to get square in the trade .- without a'moment's delay, as'they'appreciate that the effect' r of impaired credit under, the'new. conditions willpot be pleas-. '^`Snt for themf5vK'ii!belicvl''tKai'i.ddriiute separation' of the.:; ...rejj>"dead. WtT; from the,legitimate and'-successful 'man-:? -JKp IgStti -- ------ *' .... Tfc* Am WM4* !** C*lr 1Trtu. cS Detroit, m*lo-~ t*ln* a fellowship la th* University of KWhliu* iritb of for the itudr of problem* oonete4 Tlth the (bcturt of point* and vamUhM. Th* bolder eftbs.fsilewsl ` for lMi.1111 1* JUpIi K .ChriatffltiL '." - .--j-:'. and i'll. , i::An; informal arbitration committee was chosen as'follows; Hi'G.?White, Charles Winkelraan, Ed Jlardley, II. F,, Brin- instooUiiid 1CB. McNulty.; .- J.V - It is the general belief throughout ah'the- industry that the dawn of better times is approaching and tout them will be a-gradnal improvement in trade. The pamt-trade naturally wisha. and expects to derive its. share of profits, from better business.conditions.. .The Los Angeles manufacturers and job-ii'ijfe;'bers., are, showing ari ability-' to co-operate, in work for. the-sp**M DETROIT PAINT CLUB NOTES; ' improvement of trade conditions'which is bound,to be a factor ? (Special to Fa iKt , Oil aim Dane Rrnrw.) 1 llaaImier-ronouimn Amualkninngc Hth.e* revivalIninitt.h-e' np.ainini1K,fVradIeIlnap--ro.1f.i1table-"--J ^ ^ Mr. J. K. Hatt, manager of the Central Paint ft Glass C certainty for 'those engaged in. all branches'of the- industry. Pny confined to his bed with a severe cold. ' ' ' 0007-SWP-04319B 0007-SWP-000126354 - vrr!><? . -ikr r^OgLy t J*rrr.'-.l * a ;_*,-- - s--1 -t PACIFIC COAST PAINT PRICES. . It looks as though a paint oil famine would exist upon gg ACME SHOWS GOOD YEAR. the Coast within thirty days. It will he absolutely neces- E-:- Although during the early months of the year there was" sary for some drastic action on the part of the transports- pJ a reduction m volume of business done by the Acme White tion companies, or this event is inevitable. Lead & Color works, due to conditions created by ibe Euro This declaration was made by H. G. White, manager of fesj pean war, the improvement which came late enabled the the Acme White Lead & Oil Works, in a talk before the company to show an increase in business for the year in Los Angeles division of the International Sales Managers' . Association at the Hotel Dark last week. ... ,, Mr. White, in discussing "How Paint Has Been Affected by the Present War," said: i,\ "The paint situation today is affected by war conditions . primarily, but also by reason of the increased demand, as against an impossibility of increased production in a com- ""' parative time. The general resumption of prosperity has )- comparison with 1914, says President William L Wavies' in the annual report sent out to stockholders. ' _ "The scarcity and higher prices prevailing for raw mate rials continue to disturb conditions and materially affect i profits in our industry," President Davies says, adding that the company's directors believe it was wise to continue I a conservative policy, husbanding financial resources and aggresively pushing for business. brought about a condition in the manufacturing and pro- Net Profits $315,685.60. ducing field which cannot possibly be met with the equip- . meut in existence. J-.: The change in the policy of tire manufacturers, who have turned from white tires, containing zinc, to tires containing -V- lamp black' or carbon, has resulted in an advance in the price T of all carbon blacks from 40 to 60 per cent, and at the same time has overtaxed manufacturers. - This, you will note, is the P result of taking from one line of business unusual quantities ebr -of a formerly well-regulated supply and disturbing normal markets by reason of a newly developed consumption. "These same conditions occur throughout the various - commodities. Oils, which are necessary in all paint ma- terial and which amount approximately to 50 per cent of the product, have been diverted to other than usual uses, i In addition, the paint trade is particularly affected by the ~- .xery-short domestic, crop and the exceedingly difficult con- b- ditions incident to maritime shipments. :" "Aluminum, one of the articles in the paint consideration, has been absorbed in other channels until the price has , risen more than 100 per cent. For the same reason, all metals and mis, and, in fact, all materials incident to the 1* paint trade, have advanced by a greater or less (attest. i "The things, however, which are most noticeable and which are attracting the most attention, are the colors and dyes, most of which are foreign-made and, therefore, im ft possible to secure. The company's income statement for the year ending No vember 30 shows net profits from operation amounting to $315,625.50, after deduction of operating expenses and allowance'for depreciation. A balance of $678,965.86 was available for dividends and reserves, in comparison with $469,147.53 at the end of the preceding year. Dividends on preferred stock at 6 per cent were $64,554 and $159,991.09 was appropriated to he added to reserve for redemption of the company's outstanding bonds, leaving $454,420.27 as net surplus for the year. The balance sheet shows totals of $5,706,695.68, compared with $5,574,830.29 a year ago. Current and working asset's aggregated $9,631,118.45, against $2,514,868.83 in 1944, the gam being chiefly in the item of cash, which is $410,741.63, against $231,932.82 in 1914, although accounts and notes re ceivable, $820,576.09, also show an increase over $745,570.48 the year before. Inventories were $1,399,800.73, against $1.528,365.58. Fixed assets, including plants and real estate are appraised ' at $3,022274.07, against $3,019,718.12 in 1914. Current and accrued liabilities are given as $224,890.38, the reduction in contrast to $256,997.71 in 1914 being principally in notes payable, $39,830, in comparison to $120,172.50 the previous year. Accounts payable were $98,96027. against $74,231.21, and accrued liabilities were $86,099.81, against $62294. "Paintmakers" reds generally arc synthetic colors derived Capital liabilities show no change in outstanding capital from coal tar bases. They are closely associated with stock, comprising $1,075,900 or 6 per cent cumulative pre betisol, para-nitrilincs, etc,, which products now are going into explosives. The yellows depend upon their foundation, for potashes and sodas, which you will recognize as first S. ferred and $2,000,000 of common. Surplus and reserves, $981,105.30, compares with $791,- j 932.58 in 1814. The company's business is described as in j cousins to gun-powder. normal volume, with the outlook for 1916 much more favor- 1 "Umbers come from Turkey, siennas from Italy and the able than a year ago. best ochres bom France, and as a result of the war the supply of these practically is exhausted. With the in creased freight charges there is small wonder that the prices of paint materials have doubled and trebled. If This market was particularly affected by the closing of the Panama Canal. We now are confronting such a car shortage that deliveries of goods purchased are indefinite, and we fear we will not be able to secure continuous sup ./ 7' - ,, .< plies necessary for our actual operations. Our concern has a cargo of dry colors in transit which has been on the ''' :u-- way from eastern Pennsylvania since November 11 last. > ' PAINT COMPANY PROSPERS. 'It looks as though a paint oil famine would exist upon . Business of The Acme White Lead fi: Color Works.Detroit, the Coast within thirty days. It will be absoutely neces-, is reported to have shown a steady increase in volume for Sary for some drastic action on the part of the transporta- j.- . each month of the current year. From unofficial sources tion companies, or this event is inevitable. public in general and the manufacturers universally fondled to the situation, and it is my belief that we v ` ourselves to conditions existent more rapidly ;" las been done before and with less friction. i; California seems to be the last point in the Ir conntry^.tr be benefited by the general business improve- J&i meats but -it is evident tint the change is ctose -at hand, I-predict the greatest business improvement we`ever have experienced within the next ninety days."_______ j- it is intimated the business of the company to May 1 shows a gain of about 50 per cent in volume over its best previous year, without any additional capital expenditures. The ex ecutive management of the company, anticipating a short age of material, some time ago made provision for the com pany's requirements to an extent that has enabled it to handle its increased business satisfactorily. Those in touch with the company's affairs believe it will show for the cur rent; year, a veiy substantial increase in profits over any K&j. previous'similar period. "" "*<*' 0007-SWP-043199 0007-SWP- 0007-SWP-043200 T" . . mMIt'. DRUGS,"OILS 'AND PAINTS _- .** >* . ' ' `a . Fnrther.Investigation. of the Anatnalout \ Dispersion. of Chiu 'Wood Oil. By Dr . C. D. Ho l l ey . In the February issue of Dr u g s , Oil s a n d Pa in t s , the writer presented certain data obtained in the laboratories of the Acme Ta b l e IL Rosin Oils. Smc Mc Gravity Wo. "C. 1. 0.M5 2x. o.wu 4. OJM e. m NuAmdbder TIJ1*LMUS* lus Tiuabir hint M*C. 2aw24> br weieH 2J.7 MO ** Comments of the Trade. ' T. EL Brlsley. mmaser oi the Acme White Lead A Color Works. Portland, Oregon, writes aa follow*, upon receipt of the ISIS "Clean Op and Paint Up" book. *1 think that a general distribution of this book among paint dealers and paint salesmen would hero a tendency to educate us all to the deep merits of the 'Clean White Lead and Color Works on' the ' Number 5 was a kidney oil of medium 'Ahomalous Dispersion of China wood oil as body, the other oils were of rather heavy 'furnishing a rapid method for determining i body, except No. 4, which was of medium Up and Paint Up' campaign and eventually arouse more genuine interest In. the move* | -J----- .----- ,,------ . . ___ . __ the purity of this oil as well as ascertain- '.body. '-" . ing the percentage of adulteration in impure :oils- These oils are not, as sensitive in influ encing the turning paint as the vegetable A. H. Sconberg. of the Acme White Lead t ;L_ Color Works. Salt Lake City, writes! ."I ,m - Unfortunately, several typographical er .oils, additions of 1 per cent having less highly pleased with the effective arrangement rors appeared, which somewhat unpaired `effect than one-half of 1 per cent of the the dearness of the article. In Tables I, IV vpits previously examined. It is evident from and V the phrase "by rotation" should be .a study of the above table that there are V and reeorai contents of the 191 campaign book. I Pave written to a good number of my friends urging them to get Into the.-gazne and will do anything 1 con to further the cause/' .changed to read "by weight." Also in Table 'other factors-which influence the turning VI, numbers to and u, the phrase "with point more powerfully than the add value. <7! Inured" should read "with Chino wood." To determine this more definitely, rosin oil All-of The vegetable and animal oils so' No. a, having an acid value of 71.3, was far examined gave "turning points" with treated with enough alkali to remove the _____ B. B. Sovereign, sales manager of the Pitts burgh branch oi the Acme White Lead fc Color a standard sample of China wood oil within bulk of the acid, and the resulting soap re the. limits of 14 to 17, that is, when 14 per moved by careful washing, the resulting oil cent.- to 17 per cent., depending on the par .had a specific gravity of 0.943 at 25! C. and \ orkfl, recently gave a lecture on the raanufacpeints. varnlahea and finishes before the faculty and students of the Carnegie Tech Trades Schools. ticular oil in question, was added to China an acid value of 10.0 and gave a turning wood oil it caused the inverted (anomalous) point of 21.0 as against the original turning spectrum to return to its normal position. point of 33.6. If, however, the comparison >-',.... /?/>, f -- Petroleum products also came within the be made by volume, we obtain 20.8 as a -is w above limits when the comparison was made against 21.5 or an agreement practically Heal to Head Track Company. by volume instead of by weight Rosin and the products derived there from, however, proved to be notable excep 'within the limits of experimental error, Thomas Neal, of the Acme White Lead & showing that the removal of the add did not materially affect the turning point ; Color Works, Detroit, and vice-president of 5 the General Motors Company* will be presi- dent of the Sijftul-Commerce Motor Truck tions, as they gave abnormally high turning points and, as stated in the preceding article, the writer believed these products should receive further investigation.' This phase . Da ma r a n d Es t e r Gu m. " The add values and turning points of . these gums were determined in conjunction Company, organised for the purpose of con,v| soHdatisg the Signal Motor Track Company >5 and the Commerce Motor Car Co, The new ^company will offer a complete line of tnicfci -} ranging from three-fourths of a ton to five of the subject has now been examined and ; with another sample of W. W. rosin. /tons* capacity - ; the results obtained are herewith presented. ; . Ta s l e III. Vo l a t il e Oil s mow Ol e o -Re s in s . ': The examination of the various distillates obtained in the naval stores industry gave [results m accord with those obtained with' the vegetable oils and were to dose agree ment with each other. Tas l z t Terpentine mi Pine Oils. Wo. etnitxt So. nr. .,i. .,,GTujmijiSwp.lilrMits V'" UK J- vmnriMon.m !* WaoPll AUSXo. Tut*. FoiM C W.o% by weight alt j , Damme ani Ester Cam. } fredact AeU M. Tamfn* poftK MFC. hU*k Oamur ` Staghfwrc Dwmt - tt.j IM V> IBS ' Kster Cm ' Vr.W. Katin 99 0 . The spectrum of the Singapore damar was rather indistinct and the above turning point should be considered only as approxi. mate. It. is to be noted that the conversion lot resin into an ester gum having only one- half, tKe original acid value produced only Inmsiignificant change in the turning point. Meeting of Southern California Paint Club. | 1 The annual outing and election of the South* , era ^ California Paint, Oil and Varnish Alsodictation was held at Venice. July 29, Annual ^/reports were presented .by President HLrlG. White, Acme White Lead and Color Works; ^Secretary A. J. Tweedy, of the Tweedy Com/||pony: Treasnrer M. 3. McNulty. Mathews j.7 Paint Company, Membership in the club was 'y applied for in behalf of the L G. Judah Com- t. >wannyy., represented by Mr. William Hunter. Krwly elected officers lor the coming year [j President, A J. Tweedy, the Tweedy `ComriRany; vice-president. C H. Winkelnun,- Bs- . Making the comparison on the basis of Hneter Pint Company;, seereury. T.. K. F. Hartnell, Patten Paint' - Company; treasurer. | volume instead of weight, the "turning M. B. 'McNulty, Mathews - Paint ^Company; . point" of spirits'of turpentine becomes 15 per cent instead of 14 per cent f.K'jrriecutlve secretary, Prank Reed, Pacific Paint, --`/tjWdl Paper & Art Goods Trade; member " J National Board of Control. H. G. White, Ro s in Oil s . | In the preceding article a "turqing point" ' of 24 was given for rosin oil, however, as I rosin oils vary greatly in constitution, it was I [ assumed that the turning point would fluo[ tuate somewhat .`approaching the-normal ! [ point with very low acid.oils and increasing h to'nearly, that af rosin ' (31) with;.hirWy I' add rosin oils.'-Fire rosin oils from'diBer^ ..ent spurces were obtained and examined. G. N. Malm, factory man from the Acme White Lead & Color Works, made a visit to Albany for the purpose of dem onstrating the qualities of the [. company's products; HulbertOhling Hardware Company cany a complete line of Acme products. 0007-SWP-000126356 gs! '5^: s V.VmV.''^" M Mr. Albert E. Cole, of the Acme White r^TjlTT^^ Works, East Boston^ reports that the good olH ? which he lives, and which he loves so well a,,J f tDW" l? he has done so much, Salem, is fast buildup aft~hh great fire, and quite attractively and satisfactorily m' Cole, being of a rather practical turn of mind ant ni' .*" to platitudes, did not state that Salem is rising thanks.0"1 thC aSh"' fr WhiCh WB tOTder Wm * T heartfelt I *. Ir - 7 - i.; r ,Ia/iae<J' N- A. Runyan, of the Acme White Lead X- rliT^ Co., has been actively engaged of late vvi/h hi.i ' * rounding up the ample business, in sight,'as retailers a^K ln mg m better volume than for some time. Mr wl*buy'i ~ "*~-x.r' rl : / /-f " S.4 ^ PAINT PICNIC ~ ~ ?i?sb"r*h Branch of the Acme White Lead 4 Color* works held its first annual basket picnic on Saturday July 1 *' I This picnic was composed of all the employes of the Pitts-'f " burgh Branch, including the sales force, office force and ship ping room force and their families. The usual baseball games, foot races, etc., were enjoyed to the limit J // - /<T - /&. One of the recent additions to the Acme Whitt Lead &J| I Color Works sales force on the Pacific coast is Mr. Billings,! f formerly connected with the same concern in Chicago. Mr.' | - Billings says the Pacific Coast "looks good to him." 4* 1 r *ir. - \ jbfefacfrg ---- - V,,, j N. A. Runyan, manager of the Cincinnati branch of the J Acme White Lead & Color Co., has been covering his ter-J " ritory out of Cincinnati, including Western Kentucky and H Southern Indiana, and reports that jobbers in the sections! 6; which he has visited have ordered in Handsome quantitiesJ for spring business. Prosperity is very much in evidenced ^ everywhere, Mr. Runyan says, and his customers are get-^1 ting their share of it fl .-Of v, aI Mr N A. Runyan, manager in charge of the.Cincinnati jr br^Aof the AoneWbite Uad & Color Co. is P* U?5*/? pride to the fact that the annual visit of inspectors of the Oluo . Fire Prevention Association, which is made in Cincinnati fojlowingSePaint-up and Clean-up campa.g^ found ht p^ice fcfir* class condition and that He received a dean bill of health. - The Sherwin-Williams Co. has finally decided to have a downtown establishment in Cincinnati, and bst week leased the sfiiith half of the Southeast corner of Sixth andl Main Streets, for a five-year term. The location is an ex-1 cellent one, and the neighborhood is liked by paint coij-j cerns, as the Acme White Lead & Color Co. and the Wu-| son Paint & Glass Co. are in the same block, with Etch" raond Bros, around the comer and two Foy stores within a block. 0007-SWP-000126357 An Analysis of Coal Tar in English for the Layman The foregoing illustration was prepared by John C. Austi1n_ o>f TLos AAnnfgvealfeaas and fifioWrMwOaer/1daefdl 4tao isums by UH". fG^. 1WAihIsi taeA, manager of the Los Angeles branch of the Acme White Lead Color Co. It wQl be found to be very comprehensive and at the same time comparatively simple and easy to under stand. Instead of giving all the difficult technical names. easily understood general expressions are used indicating the cmoIlaovrhs aa mnd*! useas of the_ cLh. e_ m--1icaal d_ne.1riva. At.*ive. AT*eh. e whait. e'lines indicate the logical method of derivation and the relation of the different products to each other and'the" chart'- also shows the actual commercial uses of- many .'of. the' ' products. jr.'iu'-'- . v v1',,- v, vc \ :.c~- s..' ^h a j c s v - v-----y* ' ' 5 ' ^ v , fif Cf s?* i, ^4 *ij! t/d-.J* Ai.---"j T - \C l' j. ^ ; vi- - o-' Z." c r fuss'? -I ? --------' * ^ *' v . ^ s r r r S A>f .* 4W ?tv' - -*/-'Jt-. fS<..-ve,.v'.',, , *1 1; ^ m I 0007-SWP-000126358 --if*/ yti ,4*.- , ..5..." -SAfnV <>r ave Composition of Chinese Wood Oil. at. . By Pt. C. D. Hotter and J. P. Rortns. ______ , __ ~.i. fra.'r - ' - - ' ' Of eight shipments recently examined Olein and oleic ifcii! affect tfieTiirsuiig gave turning points varying from 12 point to a somewhat greater extent than the ht ae> Chinese wood oil is composed essentially of the glycerides of elseomargaric and oleic to 15, and in each case a high acid value vegetable oils as may be noted from the was also obtained, varying from 6 to 7. following table. ite* his wn iity .111his the. old ds. he ion as mg to .he MC* oin > -M in* acids. The glyceride of oleic acid exhibits : The five remaining shipments gave abnornormal dispersion only and in admixture ; mally high turning points, four being be with the daeomargaric glyceride acts solely tween 20.5 and 21'and one 19. Each of the as a diluent. Therefore the . "turning i fire shipments had a low acid value, vary- TABLE n--Traxwe Po in t or Ctrniese Wooo Oil (St a n mu ) w it h Ol z ic Ac ib a n d Ou ik . T. P. by 4- T. P. by No. Kind of OiL Weight. Volume. point." that is die paint when the disper- j ing between 1.3 and 2.r. 1. Linseed oil ....... 13.5 is.6 - > ; 1 : ; sion ceases to be anomalous and becomes normal, as discussed m the preceding articles, depends on the amount of dein present in the oil, it being assumed that the oil is pure. . doer1 was the first to investigate the ratio of oleic and elseomargaric acids hi the fatty adds of Chinese wood oil, reporting 24 per cent oleic and 72 elseomargaric adds. Kametaka- found 14 per cent, olein and 86 per cent elseomargaric glyceride. Fahrion3 concluded that the fattyacidsof wood oil contain 10 per cent, olein, 2 to 3 per cent, saturated fatty add glycerides and the bal ance elseomargaric glyceride. Ware suid Schumann* from the results obtained by the potassium soap and light { ' The action in the varnish kettle of each 1 of the three shipments above referred to j was decidedly unsatisfactory. They were :'j very slow in developing the desired "body," and difficulty was experienced in obtaining s a uniformly standard "hody." jjfhe writers j do not believe that the unsatisfactory be" havior'of these oils can be accounted for , wholly by the small percentage of aduttcra; tion (0.5 per cent, to 3 per. cent.), considj ered to he present, but is also partially due J to the high acid values. That high acid j values exercise a strong influence on the -heat treatment of the oil may be seen from ' the following table, Schumann having asceri tained that the free acid present in Chinese i wood oil is essentially oleic arid. *. Olein .................. 13.1 **. Oleic acid......... 12.0 - 13.4 iz.0 'I Low acid - Chinese wood oils giving a ^turning point of 21 against 13.5 for the ; usual' commercially pure oil must therefore }} contain .approximately 3 per cent, less of eolein; that is, their indicated composition is 495 per cent, elstomargaric glyceride and 3 jper cent olein as against 90 per cent, and *' 10 per cent, for the average oiL As would naturally be expected, these high turning .point oils are exceedingly rapid in their vartion in the kettle, and more than the usual ^amount of care must be exercised in their {manipulation, but properly handled they 'produce varnishes of superior quality. : It is at once evident that such oils permit {extensive adulteration without its being de- 3:3 break methods, as well as from crystallizing , TABLE I--Bh w s i Tes t w it h Ck i.v s s c Wo o s jtected by the usual heat tests. For instance.: out the eheomargaric add, concluded that i Oil (Tc s x ih c Po ix t ai) m Ad mix t u r es . table 1 shows that 15 per cent, soya bean oil he the percentage of elseomargaric glyceride . No- ComtKuitioii. Time. ;can be added, and the gell point be well -or nts 1 a a JCF.noCbna.i*ll.zSttscm.. STIS.oalw<i1,taIusSr)<s. i2M4t1>iJ,-o2A4aWnrs. 4), 1-4. M 4. 1.1.4. tgi gar. CSwic (11141. MS. Out). 1. Chinese wood oil. T. P. J1 8 m. 23 sec. ; s. - - " + 1056 ` oteic acid. 11 m. 47 sec. within the limit of time of 12 m. as pro vided in the Am. Sac. for Test. Mat. Spec ; s- " ** +% ification for Purity of Raw Chinese Wood % present in raw Chinese wood oil varies rrom 90 per cent for the darker to 94 per *; olein, 9 m. 55 sec [Oil. " ' " + M% | The fallacy of the Browne test for deter .Uv cent for the light-colored oil The stand ard oil used in their investigation had : s. " soya oil, 10 m. "*"+% 9 sec. mining extensive adulteration is - again soya oil, 10 m. 3s sec. {shown in Table HI with a Chinese wood ne nt 2 turning point of 15.5, and was reported on i It should be noted that one of the abnor- oil having a turning point of xg. | ats containing 10 per cent. olein. I mally high turning point oils was used in j TABLE HI--Bmw n z Tis t w it h Canltst Wooo its -i ve at he* ch Shipments of Chinese wood oil from im > these experiments. The apparatus and pro- | On, T. P. 19. porters, who purchase from first hands in I the primary markets and test each lot before { accepting, have during (913, .1914 and -,j cedure were in accordance with that prei scribed by the Am. Soc. for Test. Materials ; and was checked against the pure sample | No. Kind of OiL Time. L Chinese wood oil, standard ; T. P. 1M).............................. U m. 10 sec. 1 a. Chinese wood oil T. P. 19........10 m. 0 see. 1915 given very uniformly 15.5 for the 9 tested by the Sub-Committee III in rgis, ,'3: Chinese wood oil. xS lh n>s it er ? 1A turning point -This may be explained by the fact that the various lots as purchased - were settled and aged together in large tanks and any existing individual differ ences disappeared in the resulting blend. It is also possible that climatic conditions were very similar, and therefore the oil as obtained did not' vary appreciably in com. position. It is to be understood that ship ments during die years above referred to were obtained essentially from nuts grown . during the preceding years. During the last two to three months ship: menu have ceased to show this uniformity : cf composition. Their behavior in the var1 nish kettle has sbdwn them to be, either dis- tinctly below average or far superior to any Chinese wood oil received during recent : years. Likewise their turning points have , shown marked variations from the normal i of 15-5, -and varied consistently in accord ? the writers obtaining ix ui. against the aver{age of 10 m. and 49 sec. reported by the .{4, , (T. P. 19 -f-10% Cnsced oil. .11 m. 43 sec Chinese wood oil (T. P. 39 -f- 15% Gnserd oil.. 13 m, 30 sec. ' l committee. The sample containing 10 per .. The writers do not undertake to explain tj?nt.^om.nigrilly_pure oleic arid required this recent influx of high turning point '^nearly 2 m. longer to gel than did the mix- . Chinese wood oils. It is, of course, possible .ture containing-10 per cent, commercially diat the oil obtained from the nuts grown pure olein. Further experimentation has .last year may, because of the abnormal cli j^hown that at lower temperature the retard- matic conditions that prevailed, be of super- :-.me effect of a much smaller percentage of -jor quality, but whatever hypothesis may joleic acid is very pronounced. <fhe advanced die varnish trade should inves- The writers believe that Chinese wood rtigatc systematically this phenomenon and toils haring, an acid value exceeding four Irtvise the specifications in such directions' {should receive an especially careful exami ^!as may be necessary in order to take full nation and if accompanied by a turning ;iadvantage of present and future opportuni- ( point of less than 15.3, will be found to be '{[ties for securing pure oil of the highest j very slow in the kettle and therefore unsat .{-quality, . isfactory. The time required to gel by the jBrqwne test with the -three unsatisfactory (oils indicated a much greater adulteration jthan was found to be ore* 1 ance- with the behavior of the oil"in 0007-SWP-000126359 M -merged'tato. (h'`8tjrna]-Cbmmetea- Motor Truck company,. %Th new company. la Incorporated ' in- New York state .with SIMM aba-fee of nonpar svaJu*.;- The stock will bo ttndarwrltten;ti.*ll'*memb>r of tho Detroit r6took->Bxb4nc wUo taluk t*hMab#par.o-p.oaltlon: wt Ucr;' P Io:v'-rr-snli- >* Tbe- Slgnal-Commcrca-*'' Motor .Truck company :ls wholly Detroit OOrporatlovaotf Str-oBetfa .wtl!-b# Detroit'-mem*Tbarfcaa Neal., icrm- Crly president' and, JaUr chairman pf the board* of diroctbrd oftpe 0b- ral Motors coaepaity, anil'now vice* prealdoni 6f tbaf company,. will bo Chilrnu 'Ol tha,* aew^.Corporaltdh board .And will - direct. Its' potlajaa.! SOtno of tho eiber. dlrectorswlU be' Myron Neal, of Uia-Aea*.; Whlto* Load 4 Color- Work* W. St Parker,' of tbo Mexican' Crude Bobber com-' Arthur IL Buhl, Thomaa- 3. Boaaoott of tho* Aetna' Insurance Company,'1 andi W.! Ki-.Hoaflamd. of Cfalcifo. .'Soversi father men promi nent In.- Detroit- hanking or1 'auto mobile cltrle* alio are in' b* di rector* * .. -rtf . , * ^ i? Output pwtaoaT<j#napato\I4**v' The combination brings irtgrllirr two argaiiiiaUna,maiidraeiurlne'* ""iwlets line of trurha.ttoui a small hi dell*erp Irurk of leas thaN f to heavy duty trucke of . _ IMi ..Bach cCispanj.il said,to >aep Shown | pfaBtianf.Ha irraflt dining Urn leit 1| month*.- It la (he'InUMUn lo.inabe mi* lorlsl additions'lo the pbnli now owned .bT..thd P!iei Motor Tiaek company add 'Co. remove tbe meirttfaCluring btflatv -of tof Commobi; eomany;*froiu->Mdekl*>kBd-. Balmy ^.CdBl^kllfatlp* o&ioh' Jgstat'Metor^ ^ml'^iaiiiufwdd *lu. the. nilrb-j .bCeormbemocdreodcVsKi0ll*; . JemlapofTtos npn/l that other aetoh'Utickkconfsilii would 4 he iBcIttdiS; I#' tola combination w Mh,bj Small I- ttpregu*. tnmu mewt broker,' whu eiog says the re* port.that tho two argaalaslloiis land &r4.iu*fgtd tote. S yi.OOQ,IOt eon- osra.'l*snfaom4t k^.wnm says IkMs- Uhdbrotoed too..stock -of' the MluMbmmirrexetor Trnek eom- paart *m be` offered .tor aobacrlp- Uoii qn/* who* end's*JILJaanad, l>ae'a ai la a*.a*r "- ll la wnintlaod Hal Ibn fnis^Ulo la (' l* use l< :r sn- * . r? far. ihd Hifiial to.n>rMf 1'inor Trnrk rompoiy afiofai --r*raaeil ft.ni*,a.v by lb- afti'.un. of la aeund lb* ouipel m wf.'Jib MTlivr w`*|ilnils - :ee'r a* light dpi'tarr.iiid^iivy I*' *rj inirk* ' * . vjA'fi, # / .... .... ..I.-**-...?*. - Neal waa eleetcd vice-president re-; cefttly to H11 the ' Taeaney created by the rttlNittfcnl rr-oni till dirUlf* it ot Mlhortr Wi C14lilt jirtiMtiit! at tHa rust * oia Detroit National.. tank> of Detroit. who wad tholut .......... t"ir*oa of (ho banklhx Uitor* to to wllhddtl_l# f.rom th. t..O_caeri) Motor's board. Afltr retiring * * president about two j-ura uo. Mr. Neat conlihoed bln eanneotloh with tho company as- a director tad # chilridu of Ua . board .and thb'.exeevtlVb commltto*. '.'rf'jg*- c'^t H^;lEATOS;iMBraCOXM| *5" "wh& ; Tho Acme White Lead and Color Works, Detroit, Mich., has recently developed an sir-drying enamel for use on automobile hoods and fender* It can be used advantageously, the company states, in refinishing marred spots on axles, brake drums, spring dips and similar surface* This enamel is designed to be used by the automobile owner himself. It is entirely practical, the company states, for the almost inexperienced man to secure good results in refiniah- ing hoods and fenders, or in retouch ing marred spots, even though he does not feel competent to attempt the fine finishing of tho body. Acme auto hood and fender enamel U put up in easy-opening cans in 1-qt., 1-pt and hi`pi- sixes. Each can bears complete directions for use. The enamel is furnished in black only. Aj Motor company* to* to* lait.ju yeara has *mb elected^- a director of tbo General Motors oompe^M* Succeed Mr. heat ^W., C._Dnrabt. president -of the Owirtf^Mewt* company,' while tn Detroit^Trlday. annonnoed - tied- 12. 'Virllnfm! has been made general manager of toe OTde Motor work* of l^natod.^ Pobeldlery - of* tbo -General IfW" ,oompay,u-KXf.. . : ~rre= /j- /f-/t ACME EMPLOYES^; ^ EEIJEP BOARDS ^ NAMES OFFICERS1 la Ui ni*l election of tho mj' ployei1' KolleT,? hwoclation of.; th Aeaio. H'Mto.'Leiid '* Color -r-* ;-4i tbo following officer* were eleetM.. Preilicnt, M. K. ATorill: .lco-proA tjdont; Iror ,Jrae; McreUry.' *. : OV*. 1 . ji*5*- traunror,' G. R-' Lorfclns; director*,, it 3: lnrtni J?hn Bhodo. B. M. Kol- PoLot-A. W5 "'Kgl, V *f]|g bfflocTo' have been formally OrapllutloB. '.rl.ln, tru-n inni; : A. ,B.Cole. genorU mM; to- which hc ..hOfr<r< IimIUM* vr-^3: g.r of the.fioiton foctorr of tbdj kln..:mu]t^fl& thi .lh-Jlon'>W: So'mA' deflTerod.: i lnUi*tlng ,d-j ur M'^^thoHae fcevte* 1h unis. averina-VMTM. Devteb was j iual* If yrari eM,, paaolna ; 5, ' 4fooi` on-Boston'*' Inin***'*1, eon!*] Jo b', .1 ike InM o'.l.fmi. c mo e o o bU*. j i*3 her IdihdaP. ' T fit _ __".i j rf Itw: NI1: kt^rf.o.-J' ind,-.truiuf;j . Dem Jee* tbi IflwdC/. . _ NS Wala* Msa. I>tte* rento . *,rT. jt, &' ~ l.wof'lhe Ar.-ncl'WL'il'' lo*d * Co*-: JFi liaCioll In I73, nadrxeal4wl h*r ' her Oeiib." ^ I* sWvrd by ** ' - S%> 'S-' %wt>: epnh* -lit'ellr HW"*1 daugbtp** Mre 1 [ni** Bnuirfel cuisditlone. , ">" ttwofec> am0v.*4.'iDaaan>lo^l1!l>lb*a"i |o,,f. yl*ojJ<nSot*.,v,,tt.j/ ------------ yr*.IAl-.s< lh..*cm. Whir* J-c"1 tlS irel*enc*- Hwuto arreu*^ r-^.; B'edntadajr aflerennn,^*.^ . - -r--" -- ^ - / -/C *S" > IMVITfa .Itawato *L JS1* wwe i JurFr* r^r*-------Thwaotf aa. .NaaL- WHUaai-l- an**laatel lbh|Tsf 'kbMiiil miaao Saw toago u id>W a'rtoca fcniiwf. aftwa-- r, Jiaawll/ g1 ---------...... . . .ft J^vWlULl. 8*|tlM ASSOCIATioS.. v/l%a''Bmpiurers^ * sleHaf association iF3A*nl miu Lead..* Color -yoffc* ha* alartefl JL X. ArerIJI pren- maal Tor'lbs' mexl year. - Other omrers air: Vlr, jwMlilr:C. Ivvr Jawta, | ancretary and l*J- him - ... .> . . .^-4 *" cr L>--r?<rv: V T: TVfV.-iivv. ^ -* :jt - " * * 0007-SWP-043204 0007-SWP-000126360 0007-SWP-043205 Zf/6' . The Acceptability of Linseed Oil.* By C D. Ho l l ey . v`# sieMtttlleOdi and^IIfSreCe'riwi ilUooVtUs.^ .,.* Not only is the paint manufacturvJtotredirom 30 deg. C A preliminary reading may be made! 1 at the end of 1 hour and the final readings at ' foots in corporation paints, but the recent investi Lthe end of 3 hours.and after standing over-nights The ^eciBatwu for the Purity of Paw Lin seed 03 (Serial Designation: D 1-U).** a* adopted by the American Society for Testing Materials, relate to the purity of the'oil only and are not intended to cover the question of qual ity, as this phase has not as yet received die final consideration of the linseed oil committee. The gations of Gardner on house paints are causing ( At the prescribed. temperature, and. With the i various'state paint and .oil officials to regard the stated strength of acid, the foots casfly TcoU*.tc< { question of foots in a serious manner, as indi a compact mass. -Lower temperatures and weaker, cated by the following excerpt from the Oil Re* concentrations of the add cause trouble1 jit the; port for 1015, Pennsylvania Department oE Agri separation and retard the gathering of jfce loots culture. Bulletin 274, page 10:`"According to H. into compact masses.: Under.uniform conditions A. Gardner, excessive amounts of mucilaginous of operation, an oil direct from the filler press' writer believes that the further investigation of this problem is not only highly desirable, but very and albuminous matter' contained in linseed oil7 commonly' called foots,'u unfit for painting pur will give a_ v_o_l_u_m_e*repaedrincegnt.fa3napeurpc ent, and upwards, while a tanked oil, suitably aged, gives necessary, as the question of quality ** at .the poses, as these foots usually coubtin micro-organ only 0.1 to 0.3 per cent . bottom of nearly all the trouble the paint manu facturer has in securing acceptable linseed oil for use in paints for public service corporations and the various railroad systems. The thoroughness .. with which these corporate interests examine their *' paint purchases is increasing yearly, and the gap isms which . .... affect the tile of the punts } Table 1 gives a comparison of aged and us*, aged oils. *' .T in which., such oil* are used." ' Also the experi Table II gives results of tests on oil shipments ences'; ootl=. s"evv'eSraL.l.'?.* .. rnntr&rtintotf ';' as receoiv*ebdr.u.s.Uhisnigngc'olanmipsbtelanccyk.wasertheperpeipgamreedn,t townoe-*. tphaein__t.se.e.rn.rs.i.o..uwt.t.s.inthesss"st*o-oo-rft-,tfho-ei-l-s-s--irt-tuI-u-aA--ttimioon -a-n-n-dd--,-ml,hde. necgcs- .; ,tfie TtWcI-e-.---H-hre*ysrea, oner J --i,-- vehicle. .The pamts were, brushed ......... ...... as evenly, T between what the paint manufacturer is obliged tity el seeking .a suitable means But will bring'.'' Wl"* on So. s and the other .a'weh-dged oil for | to accept as raw linseed oil and what the vari the oil producer, the.paint manufacturer;*TM! the*' ** "* * " ' ous corporations will permit to go into the paint paint *--- *--`L---------- used by them 'is increasing etch year. raent * The basis of this trouble ii die condition of The the oil as received by the paint manufacturer and past year contracting painter, as regards Jack of age and quantities . the frequent presence of large quantities of troubles resulting therefrom, caused the writer time of foots. After having, been aged at roonf. "loots." A large producer of lmseed oil recently to seek a suitable method of comparing.the rtla-; temperature (70.deg. F.); as stated, oils Nos.' admitted to the writer that his normal procedure trve amounts of foots in different raw oils. Noth-; t, 3 and 6 were chilled to -ts*deg.;C. for several was to ship the oil as soon as it left the filter ing was found in the chemical literature that hours. When brought to room temperature again ` presses, no time being allowed for settling or ' aging and a comparison of oils from several was of material assistance, schemes, M.'given- m -the and the various measurement specifications ' t_hey. whu, aevr.ieng*pbeere--fencht-le-y-a*-t-celde-ator'..'--Iatnsd d.-'eregm. Ca"i.ne'd, cear . producers indicates that* this manufacturer was' already 'referred to, were not sufficiently definite .There may oe raw oils that are difficult^to das- not alone in following this practice. to be satisfactory. "JFinally the following proce* Mfy by means of this test,* but.no such! oils have The writer does' not wish to be understood as I dure of treatment of the oil With phosphoric acid * been obtained^ io far ..by' tbe -writer, .and those stating that serviceable (aim tor many purposes was developed, and gave results of practical value aiready examined represent numerous shipments cannot be made from oil containing appreciable for 'comparing the foots present in .various oils of'the leading cnisbera .V .. , amounts of foots, for he knows that such paints and especially for determining whether the oil was : Tne writer regards this *as- a comparative . jre jwdCLdafly^ the jfcQicr particular!v. aged sufficiefltly to*stand inspection' In'.spccifica- method on y -for determining ;wlicther-a raw t- wishes to emphasise is, that the paint manufac tion taints: * lmseed oil.is writ clarified and suitably aged or turer is not permitted to sell such paints to the One hundred cubic' centimeters -of the linseed *"d-or. thc,, abnormal quantities' , leading railroad, public service and other corpor oil, well shaken, art introduced into a short smalt- ; * '? ts f"4. a.tlve- n*merieally ex- ations, who purchase according to specifications. neck 500-cx. flasfo brought to. a temperature of pressing the amount oresent The problem of just The following specification requirements are 30 <tog.C-.100w 103 c* lyropy phosohoric add. *****% ; . typical of an almost innumerable number that the (m gr-1.710 at if deg. C, egualjto 03 per r.., t amount c( toon allowable.; a one that, demand. . paint manufacturer called upon to meet. The acid) previously brought to 30 deg. C are added* ; New York, New .Haven and 'Hartford Railroad and the mixture thoroughly agitated for 1 min- Careful and extended iflVdati ~'i Company rcquires lbit the o3 used in their paints ute, allowed to stand for 1 tnmute and 150 c,c. gation and Yi amiv*r*^ I ; must "have a pale yellow color . .*.. be-well of petroleom naphtha (,p. gr.. 0.753 to 0.TS8) ana -aM " e anasrsredp ; clarified by settling and age*. . . must not con* added and the contents of the flask again agt-lll *G1 pRpcrj^Tnioh aim# to I tain more than 1 per cent, of foots.1* Similarly, tated for t minute. The flask is then connected Heal with fhw isith-f An a i the Southern Pacihc .Railroad Company requires by a short robber lube .(approximately* inches , UDjaCt in ft 1 "oil of a pale yellow-'color, wdl clarified by set- lonjj) to a fiask of no cc cascity, jhe nede of prolittinary way only and to ) (ling and age. - * iVI'v:lt,'mwfc contain less than i per cent, of foots by volume when loo cx. is 1 allowed to settle in a. graduated cylinder for 24 wlahrgicehr uflagsrkad* suuaptepdortteod 1i0n *acn, iInnvteerntethds, paonsditiothn.en?nin?t nuIt +tfhla* *O1 i-Tf fiCUlti 9S f^ph^orr^d^hSsfoihVfewergra^that confront the paint oanu-i { hours at room temperature." vTbe Baltimore and.' Ulted (task, the fort, forming a definite layer, on faoturer ill nai'kstill? hi* \ Ohio Railroad Company^ 'specifications require top o( the acid in die.graduaied neck. The lem- _ a,, + j that the "oil must contain las' than 1 per cent OfMjVU-il'i'H'- Vt-Biuiuierf.-Waa j foots."* "?r.- * ` J^**** , *v I v^. .. 1 ^ /, V \ { The Atchison,' Topeka and Santa Pd are more * ; stringent, in their requirements; "the linseed oil must be pare, raw Unseed 03 free from foots." J No, | The Pennsylvania Lines require 'that the oil musitt I ^ r>. -Ta s il i. CoTi`*4i.V-. or Acto.AND'Uwju:Eiy;'l,iKseK>Oil s .1-;'^ :-xi\ .- ;.lHIh JI of ' vluw *f Fota. -V Velume ot PwN. : ulL > * Pmu bL la j hr. . .JPcraat Pvenlrkb jfm.m.S.lu.r .pram ..................................- v., gp .. -*..* .\.t,.1 . i I | : obtinreiael ld"uarsbseeyqdfuresi"reeseht*taalisnallmgphooeasnsngdidbrlmaeawagfnnreoy."mfrootTmhfoheoerst.sMethtatiilncninghdgsigwattaehnnlalikkttfcds"tahmr-e-- if 4 1 ..........." .q * rs** ** rH r.'!,'",'vkv..... *- ^ * ...... ............... ' .......*...... ........... M * . 0.2 . '0^- l such manner that the foots and other albuminouas ( I matter contained in it shall not exceed 1 per ................-.......... .***' '.................... ns -*x. ,, . * t o..ir r e.1 r* ~ Ilr cent" _ ...................... i 1 * I f The Navy Department requires that the oil j Used shall oe well-settled hosted o3, perfectly dear, and not show any deposit of foots when on No. 1......... 'r::Ta U~Tesra oTOrL^MtrjTSrx^ a s . Kttpm....?^ i'i "** Sind of --lliw.* LIOmiIlLt H on v: V of Foote, *. _PweaL4n tJi.'JJnRiaL OvorslyUt. Heated for one-half hour to a temperature of *Sc'8' 103 to 10$ deg. C.*. Likewise the purchase spec ifications of the quartermaster Corps, U. S. Army, require that tbew^t used must be per fectly dear at 06 deg. .^isd./oot show any de posit of foot* when heated lo til deg. P. n............ ........................24 ** .*.,..** .....i * ----- `6.4 -- ................ . h.A. -- .6,2 *. " ......................... ja t-* W. / *: ,l.*. ] The city of New .York specifications state that ' trie ett used to the paints purchased shall be heated , i to dex. -C. and allowed to stand in a gradu- { 6ted cylinder for M boura at a temperature not lower than go deg. C* and that not over 3 per cone of the material shall separate out -The.dty 4 W TitUbnrfb adheres .to the:Navy Departmest fLaperificatioat as give*'above. f * A large producer of.white lead m o3, in order to meet tfo^woiitmstrri the trade, has* found h advtsaMetotopp^ Ms own pot t* fo sealed packages and AayjpaiticuUr .-emphasis in their it. bright. *rril 0007-SWP-000126361 is *y*cn i^S'.7 .ff 3r&^.- Heiay K. White, who from 1886 to 1913 was vice-presi dent of the Acme White Lead & Color Works, died sud denly in Detroit on September 23 while on a visit to his always retained his interest. years> he has "/.a-jss/.. isi~ NEW PAINT FACTORY IN KANSAS. N. K1RKB WMITf Mi Mt H, ISI9 MatScpKalwrZI. 1914 Mm Wichita has been selected as the home of the-only paint', factory in the southwest The Kansas Paint & Color Com pany, a corporation with a capitalization of $90,000, has been organized and the first meeting of directors was held November *9. The factory will begin operation about Jan. 15, 1917. . Eugene Waugh, brother of M. j. Waugh, and A. L. Salter, for many years salesmen for the Lincoln Paint & Color Com pany of Lincoln, Neb., were responsible in a large degree for the organization of the concern. Mr.'Waugh was made president of the company and Mr. Salter, vice-president C P. Hale, freight agent for the Missouri Pacific, was elected secretary and treasurer. George W. Robinson, president of 1 the Security State bank, and^M. E. Hiltner, a chemist of Minneapolis, are on the board -of directors. A five year lease has been taken on the building at 317 West Douglas Avenue. The factory will be located there. An addition of two stories, eighty feet in length is to be added IN M M O RIAM to the building. Mr. Waugh has annauced that the latest W-AUgV paint manufacturing machinery has been pu/chased -tram gisS: the J. H. Day Company of Cinndnnati. A full Ehe'of paints' Mr. H.KiikrWhite, whwe dnih occurred is * and paint specialities are to' be manufactured! ` Seturdaj*, Sepdembcr 23rd, H<aodtted with The plant will be under the supervision of Mr. Hihner who . our compaaf practically since iu inception. -will move to Wichita about Jan. 1. Af present he is super- ' j .". -Tlie end came quietly but father unexpcd- intending the construction, of a cyanide plant at JDeadwpod, : edb' after a full rounded life, orach of which contributed to the founding of the present S. D., for the Harrimaa'inferests. `He is rated as one of the , foremost chemists of the country. * ..; . .: rlj Detroit*s industrial development. Mr. White mu, until two year* ago, rice president and a director e# the Acme White Lead and Color Works, at which time he jf^r W. rA sUbii, /3 37 '-/% retired from ac&ive burin*** life. Of hu Urge and varied connections none held for him a closer interest than oar company which he . ft referred to as haring foil discovered Prompt action by employes prevented what might have been ' a serious fire in the Lincoln Paint & Color Co-'splant irt Lin coln, Nebraska, last week. . '' 4<in a little Sage room out Grand River Avenue many yesn ago.** HU kindly coun sel-arid wne judgment mAuaeed in no small way the policies of our company which have made for its growth and progress. Our loss u ffistinet and keenly fch. Wc have taken The Central Faint and Glass Co., Detroit; Mich., had a leave of more than a burineu associate. He decidedly catchy varnish window. In front,, on a highly was our advisor, a real friend. varnished board, stood some half worn shoes -- men's , Our officers, who were to him "hi* boys,** women's and children's. A sign above them declared, in the Sales Department and the Employes of large letters: ________ ... the company extend formally their sympathy to the bereaved family. Bid take this oppor tunity of indicating their sentiment on the occasion of the paring of me who has done so much for them n he whom we pause to respectfully remember at th time, Mr. H. Kirkc White.'' H-bijlr: ; . !k Ifev THE FAMILY SHOES Will have a hard job destroying the beauty of vanotile finish The window was draped in black, and in the centre of the background was a huge board, highly varnished, with sign: A Gallon Will Cover Four Hundred Fifty Square Feet, One Coat - On . cither aide of this board were piled up pyramid* 'of the varnish, while on a line stretched across, the window, 0007-SWP-043206 were fastened a number of paint brushe*_oL.di.felSSLsi.ieSi!_ i 0007-SWP-000126362 r'. : 1 '.-.^ * 1 . ,1 1 /<*, ','iiNV ' \ *V. ;: ^ Oi.t j v o liiil c'rrritm of ihe . Southern California Paint, Oil and Varnish As- ` eoclation was' held at Venice on July 29th. / Annual reports were presented by President H. *. G. White, Acme White Lead and Color Works; Secretary A. J. Tweed/; Treasurer M. B. Mc Nulty, Matthews Paint Company. The follow ing officers were elected; President, A. J. Tweedy; vice-president, C. H. Winlcelrnan, Bass-Hueter - Paint Company; secretary, T. F. F. Hartnell, Patten Paint Company; treasurer, M. B. Mc- Nulty, Mathews Paint Company. Execntive ; secretary, Frank Sped, Pacific Wall Paper and ,1*` ^--*" "--L*- National Board of White Lead and tiona! Convention, ly, M. 0. McJVuJty. ' The dub is now starting on its third year, Y* which promises to be one of continued progress. \ \ During its initial two years the clnb has had a very strenuous career and many times it seemed ' as if it was fighting a losing game, but thanks ' to the loyalty of some of the members and their faith in the work of the National Associa tion, the membership has. stood its ground Con structive activities have been carried through and -others begun which promise to make the pres ent the most successful year in its history. ThU year's Kit of officers, like those of last year, are . i representative of leading concern* and with the list of new members and the program outlined by the various committees there is no reason why the:membership cannot be doubled within the next* few months. The report of Frank Waldo, chairman of the Membership Committee, ' read by Mr. Tweedy, presented special analysts of the' Pacific Coajt and Southern California conditions and stated the important conclusion that manufacturers and jobbers to this terri tory must' work under a policy of live and let live that is broader than anything of the sort] worked out byjour trade in eastern territory. i| is l A A. Farrel of the Acme White Lead Co., Detroit, was in Kansas City, calling on the trade. He said prospects for a Mg spring bust, ness were very good. . *n . - ,, V . ' '=* ; "*i i}, . fKuuaa'd&iit * Color Oompany Ohxrtered :for-$80,000 V.- *,<.Loam Bchwirt, Bmlding.a'j^ ' ' ;;Wiohlt* : .(etod^oo th. hcuni.df tbo'buly-palat.factery.^v .th* t ACME EARNS $l;146>3gS , pslreetore Aim to faovoaao j .* VaJao of Comoii Stock.' i Thomas HmJ. -riea -praaldaat^ajyi chairmen af fho Onancr demmitUd 'Of, .1'tlia'Aema*'W,*,Sa e S*;f>t.. '*worfc,tatau lane, a e-a: jry r*~ f 4,tribuUon to the en-aef re,vr' of iba ^.dtpactars for the yaoriwrttag Movap* - ......... ....... * >, f.<S\ractre ;wea - \r;halS'yesterdayjerTbe /ohartar/.waa *re- > ealvad ;Suah|ay-^^^'tactpVy.^WllL'.be- .-gla operetta* aboutJan. :is, itl7.. vSugMte':mntli and X-I*-Salur,*for -) ; any iMN nlwnia /ortW iUeoln ' ' y (Paint St Cater,-tfoompanr 0of .Uneotn. fNib., ware fopmiiU* la's>rfi'd- gree fsr>tb.eWceaUetift of.tha .een- eertLMr.Watfnbwaiioada president ot tha company and Mr, 8allr, vieerprasU dent'C-P. Hale, freight agant for die Missouri' FacStle, f.wu ' elected , eecre- .tarp and treasurer. 0arc*.W. -Robin* son, -preildeat at.-, tba -.-geenrtty.State cKunUt .( HianespoltA.aVeaa. tna: board ot di rectors. 'A.five-year lease' hair .Wen. taken on the T.^.-JMhvarts tafidlns .at 317 fT*at Douglas 'arenas. *-Tha factory, will ba 'laeatad thara An addition of 4wo atorlaa afphty last in Itnfth la to ba added .to tha building. A nsw plats glass front ' also will . be* loatalled. Twenty-five .people will be employed Mr. 'Waafb.-wkl last, night, that'tba latest paint aaaunfactnrfnr machinery bps .basis porchaead fraoa tba J. H. Day campany,-f^Ctac1anatt'`A, fuil Uoa of palnta\aiij|>'paiut>epaeialUae era *t0.ba maattfaetufad .,Tba.'plnat will ba aatcr-tha-yupir*. yUlon'af.Mrirlinhiar.who'wlti .mova ;t^ichtta;sJbout''^aal':2.-At praaeat ba U'eaearihtaadbqr'-tba'eaaatruetfoa of a-cyaoida ;pUnt 'at"Daadwbodr*AiP-* foe.!tba ^Sarrteaa rated ae aaVaC tha' foramoat-ehemUtS of. tha obanls^P'7jVK^''k^^H>^^,J^ Itba yaUrr'tostea^why a paint factory tercet" Htabltabad'in' -7VkhlU,`i said :Mr. -Waugh-.rrhera is* oat 4na- In' IXansaniMatthee^le.ibaro. sueb'a jfac- *-tory tm pklaboUia ar TaxaA Tberefora wa believa Wichita affars. graat -op- portuiUtiasrbB^tlds^llM^^r-tanrftary i v, nL'nO Cm w-- -w ** UietSUrormtbawwhicwh pararaalve!rv"o"o>f *,**74621:.`453S1r.;7S0 13 T;wwaue epppprrooPrnieMtoaod too aedojusti .tha. ipari. ?* '3 ;nr. deal's vopvlsmcntJinrjrtaUjmfint ,;J places tha book vain*,of'lb* Vi p\aTnhrae ecaonmmmaonny*stboecleVn-neda sbaatknowa r iptala -^*MS7Ahp?* Flh;evnrtot 'f lmd enwking aseoSe'of*.^rllK >jAirvW<>>.-aM -accrued UaWUties of 4 {liiTria-dl nnd narrn and surplua 4 aggr*guting lUU.3II.il* l'tl -------------- -- . iACME:WHlTELEADCp> . I: cEARNINGS $1,148.365 ; ' J .'W.t wnilnc. th. Am. Whit. ) ! ImJ Color mrko lor th. irot md- -pl K. wor. to tho tWOtt Jt tuo4.;Tb, j como07 to cumoUUTO pr.fwt.otoctt m common. Of wwmrnt;* Unr to. a 6-Wlfcjto niw^c'W.^r; -:> Mfctttoorbo iw.-tm iwromt h^- :/ffkSMSSit,r.'tb. Dc&-jrjjt - -1 `Steol Cp.. ,~y.a. JA-Cij fV r. ' J dlvttoO ot emt m * W > in Um common <<* * <h r- tin,.. Tti. jumwl iwrfht -- otOcO.~ . . i kaMon-.oC IM to -Whlt. Xto-A CMor to*o QftU -t. lwMVwiit^it . - Uoi. ---------- 'iMe-tV3cAT**i*r'c d a vies. > >'Xn,.CatbairiM Havtaa. 3Zt Tnauuotfl. aamoa, dfad'bCaOOay la Oer heme oh Uia lEad aanivaisejry er ber birth. SMt Uiw wa bn Davtah fall, fractuvtar bar Wy. he Bever'raeorared lu^Sriwu horn an tba bbsl laaim.'Morth Wales, and came irWlf9VfMfb|f bars until by-ooa Ws m Maal and two iTUt if Oahimbua, D. ` pc'_a 1 V*H3aH.*HO*Itr . > KORJf AWD'hllAIIUI .1 *LAC*. . i - 'SjO* . "Haa ;aomaHM^*''aske >. A. from O), Jfirov "Wrlttm `J .'BrtOtoh 'th. Conwy"" "' j-r--' .. i gSt.r 0007-SWP-043207 0007-SWP-000126363 s*J8r -:: ma t i n e e . .***Vg,~\ ` jestKTGr`anberry BogTheater It .- * * * **> rr .'- : .-*- .* * ' ; At BOOMPRICE SUBS *s.<u ' T Walter Russel Presents'^". "AN UNMASQUE" \ * ; .FemirtnfDoeGikoM\fyt-OpBcre ' ^'yl iUeb'i&SicnMr':'..'' & Mustek* W.B. Moo** . . :> '/ ' September i4Ai:U9i6;\'v.''Vf' 3.45 P. M. ! Dramatis Personae . : j$-'s In th Order of tfeor Piuppannee J j.,.' k, George G. Booze . . I E. D. Stair I Sirfc. Bloomfield Barbour . . . Jeremiah Dwyer ISKP Henry B. Packard Henry Ford branch of the 'Acme Whit^Lcad and ______ gether with Ray Farrell ejl Wa A. Stark, taro of hlsKj] assistants, arc motoring around Southern California forM a few dart. They have just returned from viritiog the-* San Diego Exposition, and jre now spending a few days*', at Long Beaeb before commencing the return trip. I What might have resulted in a very disastrous fire occurred In the local factory of the Acme White Load and Color Works. Fire started on the fourth floor of the building, but the sprinkling system soon hsl the blaze under control, and only nominal damage was done'l which was fully covered by insurance.. 9-/6 . . 55^. \3&j Mr. R. H. Stephens, assistant treasurer, and IC. S. Neal. Superintendent of the Acme White , j Lead and Color Works, are taking a few weeks, 1 off from the busy times they are having in De^rV troit, visiting the various plants on the coast,'^ Mr. Neal says that Southern California does not&H receive the proper advertisement as a summer j B resort. 0007-SWP-000126364 m'Ji .-Vi ! ' Vi' lii'* ' f.. V yi. . 7 .' '-'' :j c . . A/fw-7J6 -m - > v^'S<g*k*.*3 I* 1-.^ .1:^. --_________ ____ ...../ '/ - /7 ' - : -Prussian. Blue. ' . By C. D. Ho u j g y and J. P. Sonars. -. In the February issue, 1916k of- Danes, " Oiks a n d Pa in t s ,* J. E. Heekel published ' an improved method of determining the iron content of Prussian blue. Having occasion to examine several Prussian and ) Chinese blues made by different manufac- ; turers, this method was pvea precedence l and was found very satisfactory. In com- f parison with the older method, it was found that chlorate oxidized blues offered no diffi culty by cither, method. Chrome oxidized blues, however, yielded to the treatment pre scribed by Heekel much more satisfactorily . than by the'older method.'" y t'.- - In some instances it was found advisable i to make trial reductions with the stannous i chloride before making the reduction on ; which the analysis was based, as the color I change from pale yellow' to pale green is j very difficult to observe. The' solution ! should therefore be as concentrated as pos- j sible when the stannous chloride is added, j in order to make the end point easier to "observe. j - The following analyses may he of interest, 1 showing the variations which occur' in the ! iron content of Prussian and Chinese blues as produced by different'manufacturers. Table No. t. Prussian Blue. No. ' Per cent Iron. 1 ...;........... :..................... SAT ! S ............................................ IM ; 3................................ JZ.I No. 3 was a soda blue, the other two were - potash blues. Table No. X Chinese Blue. 1 No! Per nt- Iron iI MO ' , * 1 ...............................................3H *. ' 3 .......... .............;..................37.7 I .,.......................... M i- .' The first three were potash and the fourth j-soda blues. . Both soda blues did not reduce to a clear tgreen color,- a trace of yellow remaining, I making it impossible to determine the ! proper amount of stannous chloride to be added. To overcome this difficulty a trial sample was treated as prescribed by Hedcdl up to the point where the stannous chloride j was to be added, and as of the usual j clearing ^solution .' (manganese -sulphate.; ! phosphoric arid sulphuric acids) then added . instead, which served to destroy the yellow color due to iron. .Using this solution as a guide far determining the color end point, another sample was reduced by stannous chloride in the usual manner. AGHe-conw GAINS IN BUSINESS u **>fy.- Jufere ^i$7^j30.jis: Crt; .-,|aWd To TtMiTKi>i:p'k'Pii.r.e<-cVma.r BasixRtufTe' Jrrt*r Ulr ,alw tbs nairn Uea jaae 1> l,u|ur * loum Vtooila. Utt ttVkar .MtaHlah-a jbijaaii.lit SIt I; Wki'fn'Ul Uhia,aim Of.Cha Tbeu>* N*al. 'ale a-Br4iiaatodiip-aii^til''S'-h-a--l-rm---a-a--*-a--r-uia ^.'mklrlbaUea 4Ju annual f- Ua`director* or tho' Aim* %'hlta load A'Oelor VTorkff fm tka Ivor ending Jforaiuliar St',1114. y hri/TM eocipanjrV,vet aaruli.g* (or u ri*, m'iWw:to',nuii. .. .^iwn'whlah'a. raarrtf o?.rMll 70 vproprltt*& ( mflJuatjJho inrr- Mahaadla* inventory ' iv ,4 in * war ';i haala, ,1*n*1nis* baJatiq.* .of'!/.{*41U forJhUrtot/nn bnd. dlvl- - Idend piajeired. ock. rotrvea ! - m4 gnrplua. . , * ; ' 5, *Mmik ( Mmii i: IiafrUd.o**r ti^ntVfoy^vr.btr JO. illl. ur,toiui iafiiemi/v'MM.-: U1.:M"ju Ur'naa..lnt.rMs iaail" l.lls aai.'in.lTi. r.rinii. las c m ot baaSa urchajnl ana rrUlM. umfmna tnarwe. IneruaiaB It. balauc. 10 (UorrMbnoawntHp.f'-l'iMkaOP>to'rraraadrvaaMTrohr amnd* nul*.*A Aq pauaral refer**, laav , w^oa wftjko.111 n Ni*aia - Wa iflppUinanUrT'ato^ainailt tka buck oalua 0/ TOa 111 |, nrimt "'! MilKira !_ 1741.141 . il.rm'tra : .aiillj r.f'.-j ,. ` > >- K?saasaSE55s - lACira^XlfPljOYES=' 1. piini.WortrnBoUef *0ivq*f^mpl23)iiatAzy * M tki Atn* Wkl^ff Ua A Ouigf work* van Mor<ln4 tpu awning *1 & acmpllnanV*rir . . . . eunrr *lvwr. uniS^r tfio.& y ` ika Ac it mi Krnp'.ovea kapinla* llhfl. Tha 4iiwt procioin was cntn 1 plala wllh 11 Btunbtr* pud nrr|l I a|PM and t o p Iknao WPp/lii'no^ ' , ear* ror danrluif *. padra * .b *aI'Awrcroijtlawka#auk'wfMiNP.dlwlattrjlpaualirqinajmmo#n?^. t7o"r>rLr*I,ratPAS?rAF afeoMd jrallqw^aBrlaajmO-i. vi.fei/ *5'^^-/' ^"-'-*^0 r^ ' W+fisr' * ____ * -"*dy ir_ ACUK J; EMPLOYES /DANCE % , * , -- * ,/* / .* ratntJWorka JUilet toaarUllaa ^S*iitTe';..C)^npltm.At"y BynCiJ; ;AA.iCtoololar rwaoarku*s v"s>r **=aatartalnad 8kt$| urdaV .avanlar nt a corapllrnantafer lien 'gtvaa- adv th* uaplef5f tka Aetna Ertiplayea RHe( aaaaelAf tiofla Th dance program ws coni' plat* with 14 nambara wttapi'tnd (nr thoaa who did vat' :-U cape (or danctar procraaatva p^lrq part*! jnu. nrcanlaed. Eta<raa hUM tdf'*tleaka*%Unwaprl*eyaAnlawtrthhouUfldlteadin-o'lrMfg-- ion?f xka Odd Fallows tain- SBatkiine. arapM and Bniah l- y.r. - - ' .` T*'i. Sr; -'-.7 ".i4np r/afTl ---.Tf 0007-SWP-000126365 .Jii,.. !C> ACME COMPANY EARNINGS. Thomas Neal, vice president and chairman of the finance committee of the Acme White Lead and Color Works states in a supplementary contribution to the annual report'of the directors for the year ending November 30,1916: "To in crease the asset value of the common stock and place the company on so sound a footing that it may establish a per manent dividend policy for all time is the aim of the directors." "Hie net earnings of the company for the year are given as $1,148,365.95, from which a reserve of $760,431.7(1 was' appropriated to adjust the merchandise inventory to a pre war basis, leavings balance of $387,934.35. Mr. Neal's supplementary statement places the book value . of the company's common stock at $37.50. ..company's balance sheet shows totals of $6,027,- i r-w^ 843.03, with current and working assets of $2,74.0,409 97- ----- current and accrued liabilities of $241,783.41 and reserves' ; '. and surplus aggregating $L385,359.62. LINCOLN PAINT CO. HOLDS CONVENTION. AiV The Lincoln Paint and Color Company held its annual salesmen's convention in Lincoln Thursday to Saturday, January 4-6. Over thirty of its traveling representatives were present from all parts of the west. Plans were outlined by General Manager A. S. Dongall, for a large extension of the company's business for the coining year. A number of new men have been added to the force, new territories will be invaded and the Lincoln brand established in many new fields. This company has just closed one of the most successful years in its history, showing a large increase in volume over previous years. The program covered discussions of sales methods, rising, practical demonstrations and many subjects terest. The meeting closed with a banquet at the Lincoln hotel. Vi*,. .. 'SSSjtef >*>! ; . .j - 't- /t^<'- * r . .x5L.z2-^i a .. . uafeAmong the (mini men.of prominrnrr who ate visiting South ern California at ihis lime are Mr. MeMimrjr, cl lire McMur try Manufacturing Co.. Uervei; Stone Neal, of the Acme White Jxad X Colo: U'o:k; Mr. Carpenter, of the National Lead Co., St. I antis ; Mr. Kohler, of rlohlrr-Mrl.isler 1`aitil ' *; 2.'' Admgf*. 0007-SWP' y m L ji .. ' . 'r.'ZsiM 3 -v *2r. ! '.Chinese .Wood Oil, . By Dr. CD. Holley and J. P. Roberts.. "\jr . * vC't Table kr`JJ'*?. "'" - ' - v '-At--cii ^Turtuig 1 - Point ss4^ C * 1 ]! Acme 1917 Selling Plan - V5.'-~ The .-writers have had occasion during- ^:-i9i6 to test numerous samples of Chinese T wood oil submitted by various concerns.' ... ji who were either using or contemplated. fusing the shipments from which the sam- -. :>`ples. were, taken. ;.The number of-adul^-terated samples'found was unusually large,-; Vindicating a much larger quantity'of a'dul-' tcrated oil on the market than formerly.. fc, ntThis may be accounted for by the prevails .. Ayeraje .1 - . 83.5 j The Acme White Lead A. Color * 20.3 -| Works, Detroit, Mich., has recently 23.9 22,3 20 sent out `a pamphlet describing the 1917 spring paint selling help* for A . 22.5 dealers in Acme "Quality" paints, onamoli, stains end varnishes. The tret link in the chain of adver- j: tiling eonaisti of an attractive window "S. trim lithographed in striking colors,'! together with a folding dieplay card, i Link No. 2 is a large cloth banner 12 - irwhigh price.-and. scarcity. ' - i ' 4-.- *' 'giSainples.'and shipments that.; were'ac--i .': \iceptable 'were found to be Very uniform in; . r> quality, giving'"tuming points," i. t, show-. "mg an ..abnormal-dispersion, of. 30 to at', which is considerably higher .than for the -if three preceding years.' TThis feature ..has iheen discussed in our earlier articles) but V>Vwhether the superiority of.this oil in'1916. i'was due to"nature; or to 'a more careful `.'selection by the' importers who.were aware I - -- |-9* M , {the theoretical purity.. The various practical.I wests to which these oils were subjected ki- .Jdicated that they'were of. exceedingly u- ;-fpenor character for varnish making1. :. f . A comparison of three of these oils, with 1 . an average 1916 oil and average 1913 to] j . *9*5 oH py * slightly modified Browne heat] 3? \ \ test is given in following table': . -' Table'No. 2. :*^V ii *t*e r -- ;,*'thaf a rapid, accurate test was' now avail- ' able to the ducriminating buyers,' is. a dei hatable .'question. - These high "turning Turning Acid . - . oa. Point Value.. Time,'"'.' 1913-15 15.5 -2.0 20m. 55 sec. point" . oils ' properly handled - have - been 1916 20.5 . 3.5 .30m, osec. found in practice to be far superior to the Special 23.3 ' 7.3- 10m. IS sec, lower "turning point" oils of the'.three :iyears .previous. - Knowing- - the "turning Special 33.9 3.7 ... . 6m. 55 sec. Special .20.5 2.5 V:iom. Osce. it long and S ft wido printed h bright T and attractive colors. It can bo usod 1 across tho doorway or along the ahelv- f ing. The third lid: is a'painter's cap';' which carries the dealer', name' in a prominent position. Link No. 4 ia an attractive mailing card that is sent out over tho merchant*, own name to ' a selected list of prospective point - buyer* furniriied by the merchant A special form U furnished to the mer chant on which there name, can bo written. Then following Unit No. 4 ' H a second mailing card that is sent to the prospective paint buyer about : 10 day* after the first one. Link No. 6 i, a series of attractive)'aewrpaper advertisement,, link No. 7 consists : of a aeries of fear lantern slides, link No. 8 of a metal sign lithographed in "3S. % '' point" and .(he- acid value, the behavior This heat test was practically the same four colors, link No. 9 a gummed -- of the oil in the . varnish kettle can be cal- ; ;as the Browne test, the quantities of oil. sticker giving the merchant's nanu__ ;. ciliated with'considerable, accuracy, which .used, the size of the tubes and the degree and admires in connection with the " is a highly important consideration with the of immersion being the same, but with a Acme "Quality" trademark. - varnish manufacturer. " bath containing eight quarts of oil, main Ona pegs of this pamphlet telle how _, j The "turning point" method as worked -ffout by die writers, for determining the pur17ity ot .Chihese wood oil is therefore much \ ..more satisfactory from ;a practical stand' s-ipoint than the Browne or other, heat tests.' tained at a uniform -out the test. . heat of 282'C ' -t.h..roug h-M, -(,- r The tests again confirm the 'data-present-'I j| ,Jcd *~n Uth.e---w---ri--terI'-s--e--a--r-l-i-e--r--a-r-t-icifl-e,s-,athmatI wSithKJ jt_-on"*ap-,io|glharndenawlpari,ntthh-aaentdshdveeeths1rtea9Ul1eli7nasgssatpaspnrsiadnisggsteaopnDtateisniln.lgst.cshTaeombwlls-- . fompmny has provided a hook of coo- 7-1 Wtheacid value remaining constant, the time Tons showing and describing each one - \Tn fact, the writers.;have shown that ^required for gel formation varies inversely .if the features. Tho coupons are in' -' f<iper cent adulteration can .be added to ,Chi- " is tite turning point, and with the turning I Jl duplicate and on* copy it to ho r*-^; ;nese Wood oils they have examined, .and ^point ranainmg constant, tite `time varies y- ! Vtainsd by the' merchant, as a mamo-%'| ' still be ynthin 'the acceptable limits of .(he ^directiy as'the'aod.value.; It is ftereforej"' *raudum. Tho merchant ia required toSfl ^Heating -*Test Browne's ^method) '*" adopted by.the -American Society for TestIring Matenals under Specification D,-I2-i6, '"for Pupty of-Raw^Tung Oil. -.i ' > .7 -jr^tThe inprovedquality of the oils received ^jipridcht fmm .the-above, and from'a latgel ^.number .of other practical tests that ithej t .- `.behavior of Chinese wood oil in tite Wh I i,nish kettie depends to a considerable extent r* a^on'the acid value and to a greater extent!-1 sign each coupon for each faatnre.thatjj he desires. This ia an exeellsnt plan'l that works to the advaatacs':af botit|! the manafaetunr end the merchant^ .The manufacturer ia relieved of tho>j, expense of sanding esetly advertisiag'Tj | list, year (1916) and the development of '^.on 'the turning point ,. < ''. ... I , matter that will not ho need, and the VI ah adequate method of analysis, *. r, of -From the data presented herewith, to t-j- merehnnt receives only such material ; " - putting a numerical value on the variations 7,gether with the. facts stated in our previous j i that he can nse to advaotage. , ^. m.-quality,; raised the question as to-the ' .articles, and from numerous personal,'coon I ' Another valuable selling help !, the ! _ '-existence of still better grades of Chinese wpiunications, it is evident that diserimiiiaFjiS '/Wood 'oils,'1 that is, oils having '"turning ^iw buyers now receive a mudi better gradei I. appoints'*:'in excess' of at and approaching ^qrChinese wood oil than formerly,;that still I ' - .-; Jthe turning point of the pure elaeomargaric -Tbctter grades 'exist, and that die approved glyceride, which, according to the'writer's -{methods of testing, as per the specificatiohs 'investigations, lies' between 25 and 25.5 at . adopted by the American Society' for Test-1 3S*C. ' tin jrfug Materials above referred to, are inade-l iv-Through the' courtesy' of E. E. Ware'll .-lquate,.'as' they permit the classification Df "Acme Fainting Guide Book." The jf| purpose of thin book Is to give general I instructions b as simp!* and ander- t standable a mnnnsr as poasibls coror-'j . Ing the ores of the varions finishes, ifI This permits the dealer to pare bn to tho intended user tho information that;1 ia necessary to make tho application of f the various products an entire reccoas.^1 several samples; of-were obtained df- ^prnoil aS pure }rhen of very inferior quality, ... It to text beok whlck dealers nre'lf.l . .fleetly fnxtithe primary Chinese'mercharits ,,v-- -enrnt-`extensive adulteratum,.y.ori.-ithe M urged to place ia n convenient priUre'SI > ^flieiurim^in theTqcai districts;where the ' of^bil'now being received: and-oil for ready reference. By referring toil it n grunt many of the innumerable! questions that are asksdr regardingj the proper methods and materialV' be answered promptly. It c pages and Is besotifnlly 0007-SWP- <= Commercial Linseed Oil What Determines Its QualityMethods of Testing By Clifford D. Holley. Ph. D. Before the International Association Master Painters* Convention, New Haven, 1M17 j--S'tt -7-; so high in acid that this company did not dare use it except in their I have been asked to discuss commercial linseed oil, a subject cheapest goods. This did not happen once, hut several times. familiar to all of you* - The gap between what the paint manufacturer and master painter You have been buying linseed oD for a great many years and the are obliged lo accept as raw linseed oil and what the various cor btgquestion is, are you getting the kind of oil you should get? porations will permit to go into the paint used by them is increasing The people who know the most about linseed oil arc naturally each year. the opes who produce it They know vrkat linseed oil should be. The basis of this trouble is the condition of the oil as received This is proven by an advertisement 1 taw recently in one of our by the paint manufacturer and contracting painter, aa regards tack leading trade papers. After naming the brand of oil this advertise of age, the frequent pretence of large quantities of foots, which ment proceeds to stater may or may not be infected, and other impurities which impair the This linseed oil is `Pure**--"Well Settled"--"Free from Foots.*' value of the oil. --"The kind you ought to buy." Some months ago I asked a very good friend of mine who is Gentlemen, I hare never seen a more comprehensive or elearer actively engaged in the manufacture of linseed oil, die following eat statement of what linseed oil should be. than is contained In questions: these brief phrases and remember they -were made hy the manu L What causes dark colored oil? facturer, the man who knows. . Again, permit me to quote from a pamphlet issued by another fe: 9. Why arc there more foots in linseed oil now than there for merly were? an linseed oil manufacturer who makes a specialty of selling his oil m 3. What other causes tended to produce poor oil? 4? sealed packages. free from foots," This "linseed oil is clear. bright, well-settled and , r* His repty to the first question was that dark colored oils and oils that had an abnormal yellow staining power, as may be sorne- jj^ ja:S- l Having ascertained the standard set up by the oil manufacturers themselves, let us see what the careful, discriminating buyers of U' -'j times observed overheating the in white paints freshly applied, are produced by meal before the oil is pressed, causing an excess.of T linseed oil, such as the public service corporations and the various t railroad systems have to say. Hew York. New Haven & Hartford Railroad requires that the oil used is their paints must "have a pale yellow color--be well , . when green or immature, in which ease a distinct greenish color' clarified by settling and age--must not contain more than 1 percent ' | was usually observable. of foots." t fc. His experience led him to believe that any increase in the amount The Atchison, Topeka & Santa Fe are more stringent in their ev'* ' of foots was due to an attempt to squeeze more than the normal r9; . . " requirements; "the linseed oil must be pure raw linseed oil free ** - * amount of oil out of the press cake and shipping the oil before it j > . r ] from foots." The Pennsylvania lines require that the oB must be . ; was properly settled and aged. This latter feature waa confirmed Jr-A j's "as free as possible from foots and well clarified by settling and \ by another large oil producer, who admitted that his usual pro- !?1 age." The Michigan Central requires among many other things i that the oil used shall be drawn from settling tanks in such manner lit. that the foots and other albuminous matter contained in it shall not exceed 1 percent. The Navy Department tequires that the oil used shall "be well- cedure was to ship the oil as soon as it left the filter press, no time jjjj f being allowed for settling or aging, and according to the tests I have made this manufacturer was not alone in following this practice. A My friend hesitated somewhat at the third question, as to tfcb settled linseed oil, perfectly clear, and not show any deposit of foots other causes of poor oil, stating that he did not wish to be misun when healed for one-half hour tio a temperature of 109 to 109 deg. GM Likewise the purchase specifications of the Quartermaster Corps, U. 5. Army, require that the oil used must be perfectly clear at 60 deg* F. and not show any deposit of foots when heated to *19 deg. F*. derstood. as be was not prepared to say how universal the following practice was or give any inlimation as to who might be doing it, but j various oil companies bought screenings and is addition to their : own, pressed them and aeeording to his information, added the Im pure oil thus obtained to their regular run of oil and ground as-:' The Department of Commerce, Light House Service requires: iAA much of the pressed screenings into their linseed meal as they could that the "oil must be absolutely pure. It must be thoroughly set and barely keep within the guarantee under which they add their*-.! tled, light m color, free from suspended matter at 60 deg. F. and I meal. He stated that such a procedure waa usually very profitable have the properties `of a wet] aged joiL`* to.the oil manufacturer as screenings werj| wortJLfTPPl Gentlemen, under what specifications do you buy the oil you use ? ton and the meal *30 to *4400p1 er ton. My own idyesti_gatious and According to my experience, the oil manufacturer says here it is,' analyses I have seen of tbe Uasecd oil meal, indicate that this*is not^ take it or leave it If you tel] him yon want Named oil according an uncommon practice. ; -v to the specifications I nave quoted, he will laugh at you. Furthermore, the presence of pigeon grass aui other simtJar*J The paint manufacturer with well equipped laboratories and ex ^ seeds which contain a considerable percentage of a wax-Ske sub-* perienced chemists, is m a better position to obtain a more uniform ; and satisfactory grade of oil than the master painter and yet the J company with which X an connected was obliged to install 354000 j stance is detrimental, as this so-called wax is soluble in the hot otlj and may not separate until after the final filtering; when the ofl is; I shipped. :^| gallons of additional linseed oil tankage 3 years ago in' order tq- 1 properly settle and sgc their oil and free it from idiots and I'judge 3 other paint companies have done the same. The expense of testing and handling linseed oil, the cost of in- ! j vs stallings large and expensive storage equipment, the interest on the I investment represented by the oil in storage ana the lots resulting I I dearly recall attempting to make a elear toned chrome green'l paint with an oil which subsequent examination showed contained. I this wax and a leopard never had more spots on it than came out*I on this paint after it was applied. The recent investigations of Gardner on house paints are causing . I 9 from the removal of tfac foots, very materially increases the cost ' various state paint and oil officials to regard the question of foots]. I of the oil used by the paint manufacturer antf fo is thyr^fnr. in a serious manna', as indicated by die following excerpt from the'Jl to compare the cost of the .oil used in the high grade mixed paints on the same basis with the .oil ordinarily used by the master painter jTn preparing his paint from white lead in oiL 'ubtless the linseed oil manufacturer will tell you there is no difference between the oil he sells the paint manufacturer in oars and Ihc oil be sells or jobs in barrels which is what the painter uses. r I will cite you an instance which came under my own observation during the past year. Another point company bad. a contract with one of the prominent linseed oil companies to furnish them in tank car lots; Because of delayed shipments, this company was allowed ' ; m Oil report for 1919, Pennsylvania Dept, of Agriculture, Bnlletitt'fl 974, page IP: "According to H. A. Gardner, excessive amounts of I mucilaginous and albuminous matter contained in linseed oQ, comraonly called foots, is nnfit for painting purposes, as these foots I usually contain micro-organisms whkh affect - the me of i paints in which such oils are used* Also the experiences of several of I the prominent master painters with foot oils lent further weight to I the seriousness of the situation and the necessity of seeking a smt| able means that will bring die oil producer, the paint manufacturer! and the master painter together on a basis of common agreement,j Lust September in the Journal of Industrial end Engineering to draw on this same Oil company's local warehouse far oil in bar Chemistry, Gardner states, "sufficient tankage is not always wi able to the oil crusher and therefore the raw oil u often market! immediately after it has been produced, la the writers oplata (that Is Gardner's) such oR is not fit for use in high grade puiuta a .twin's m ^^qC_JJt0llUCL._ `---- -- 0007-SWP' I to I during ... r--. ... ,......., ..... .............. ........... -- .- , merits from which they were taken, should never have been used in {any paint i The Acme White Lead & Color Co. has paid the following | The progressive paint manufacturer realizes the seriousness of ; tribute to the late Herman. G. White, who has been their repthe situation and endeavor* to store hi* oil so that it wilt be properly resentative in California for some years. settled and aged and freed from foots before using it in his paints. ,, In other words he does what the oil manufacturer should have doue v but did not do. -1 Gentlemen, when you want a first class linseed oil, where are you Our sales organisation will be grieved to leant of the death ' of H. G. White, until recently manager of the sales department 1 of the Acme White Lead and Color Works, Los Angeles, CaL fi fping to get it? Can you depend on the claims of those who market 1 linseed oil in sealed packages and in .barrels lor the trade? Some of 3 the poorest oil I ever examined I took from the original packages '3 which I had purchased from fecal deafen to determine how such 4 oils compared with what we were using in our mixed paints. 1 Mr. White parsed away on the morning of October 19th at j his late residence, 1743 Vine Street, Hollywood, Cal. Al ii though in very uncertain health for practically the entire past H year, news of his demise shocked his many friends. Mr.- ? The receipt of several shipments, a little over a year ago, of raw a White was bom at Piqua, Ohio, July 28,1874, After complet- . . i oil containing abnormally Urge quantities of foots, caused the writer to seek a suitable method of comparing the relative amounts ing his collegiate training he chose salesmanship as a field fit- a of foots in different raw oils. Nothing was found m the chemical 3 ting his qualifications. He held several important positions in . i literature that was of material assistance, and the measurement ^ this work before aligning himself with the Acme White Lead "i schemes, as given in the various specifications already referred to, 1 were not sufficiently definite to be satisfactory. Finally, I de- j vcloped a scheme of treating the oil with phosphoric acid which ? gave results of practical value for comparing the foots present in ' -s various oils and especially for determining whether the oil was ij and Color Works as sales representative in an eastern, territory with headquarters at Syracuse, N. Y. His association with us * dates from January 1, 1907. Possessed of a compelling perj sonality, boundless energy and good judgment, Mr. White j ' | aged sufficiently to stand inspection in specification paints, and for use early proved himself equipped with the requisite managerial I in our house paints. . -J This method has been published in various trade papers devoted : `v to the paint industry so I wilt not take the rime to describe.:t except qualities, and after controlling a Michigan territory for a short :.S time, he was chosen as manager of our Toledo branch. Mr. ; to say that the foots are collected and measured according to tht 3 White gradually perfected a selling system at this Ohio point t- k volume occupied. * that enabled it to take its place among our leading branches. VJ Some of the results obtained, however, may be of interest. Avj '{ erage linseed oil, fresh from the filter press gives a volume feeding : I of 4 to S per cent of foots. The same oil after standing for 3 months The personnel of his selling staff at Toledo is practically intact ; today, a tribute to his ability to select productive men. His r. * at usual room temperature shows less than <U5 percent and after 'J last promotion was to the supervision of sales at Los Angeles, j . 5 3 month*; is seldom, over 3.1 percent of foots. Some rime ago I .* .i tested three shipments which gave 44 percent, 4.6 percent and 3.6 p--e--rc--e--nt,af foots, indicating*tth<*akt Athae <oi)i1l nhniAd been shipped 1i1s isnomon u < it wa* pressed. Daring the past summer, of 15 saccessirc ship ments, , showed 0.15 pereent or leu, 3 had over t percent and the J shortly following which appointment his health failed and he was compelled to relinquish active duties, although maintain ing his connection with the organization and until the end showing a keen interest in his former associations. *1 remaining 8 were between OJtS and 1 pereent foots. Last winter the results obtained were considerably higher, over half of the ship ments being between 1 and 3 pereent. Samples which I received . ,, from barrels and sealed packages as handled by- the jobbers and j rebil trade tested 4 to 8 percent bp the same test j I do not wish to he understood as spring that a satisfactory [tl r weiring paint has not been made from oil containing appreciable r *,' amounts of foots, for X know such paints have been made. I do not claim that the esc of a pure, well-settled and aged oil, free from J Beloved by all. Hi Gloss, as he was familiarly and affectionately known, was the leader in any movement that he became - identified with. He was among the best-informed paint men of the United States, and was in considerable demand- as a 1 speaker at various trade gatherings and local meetings. He f was an officer in the Los Angeles Sales -Executives Club, a J member of the Paint and Varnish Association at that point ms fiS foots and therefore not liable to infection, win solve all your paint i and a former member of the Paint, Oil and Varnish Club and 1 aSi troubles, bat I do claim and I am ccrbin that the old maxim, "the better tbe oil the better the job," was never more true than todiy. If you expect to do good work and give satisfaction to your ens- [J i the Builders' Exchange of Toledo. Our company, deploring the loss of one who was devoted * tomers. you must use good oiL To ohblu good oil you will have to its ideals, loyal to its policies, and ever the friend of'those "&s to adopt a suitable and practical standard, safeguard it with apect- ij with whom he worked, attend their sympathy and condolence / CT ficadonx then arrange with one or more linseed oil mannfactarera ;; :? to produce the Hud of oil you require and have in accredited labo- S to his sorrowing family. VS:'!'*!*-' ratocy certify that the 03 meets your standard Such o3 will cost L ^ you more osdner but I do not see how ydb can afford to continue ^ '.h'niiiog linseed off inferior to that used bye paiOHBdUuhcturcr. I T^j.have -shownwhat the oil manufacturer know* how to utlt! good oil Iv* *5 I have presented evidence that you are not consistently getting 0007-SWP-000126369 , Domestic Chinese Wood l> [g^.^P^gtX^ahd J.-R KoBCWt^rI~- .._ 'i'' -j ?: i^ln.Vrecenf lium&er of Drugs, .Oils and paintejithfcu^ters'presented tlie results. ' /l S ' qoff^^tthheeicicy'investigations'* with V Chinese^ .,; ' U'r iSfWwOOoodd''ooils'*oobbttaaiinneedd'direct.fronii' the pro-'T dudngsectidnsof China and"before they*' 'j, --I ' -yf-*.t'S-iSSB In this" Investigation . , . _^ [had :a*.' chance' to pass through the cus- .' pelled oils were thoroughly clarified in.': ! `tomary mercantile channels. These oils ' a centrifuge and put un! in-black'bot-vr .fgrA." __ were superior in quality to any commer-| ties to avoid possibility of.- formation of ' i cial,.shipments previously examined as j "light break." <&, , . w - * T' judged by practical tests and from their Shipments that were considered ac-j r^MO' anamalous dispersions, i. e., by the "Turn- ' ceptible over a three-year period,, priori J . mg Point" method as developed by the to the development of the Turning Point!. < ` ' writers. The "Turning Points" obtained ; method for judging the purity of Chinese'' ' .... " ' " ~ *' are herewith- reproduced for compari wood oil gave a "Turning Point" of 15.6, son with domestic produced oils from nuts.harvested last fall (1916). ; corresponding to an elaeomargaric gly ceride content of about 90per cent. Dur '"rr .. .- Table L . ' \ ing the past year the "Turning Point'! ^e"adtwlooyn* aWWuUtac2rl*b*d4rt*I1JM. Dtrali MTOs - V;' tmwirt bUteJ--------------- z_ .* Chinese Wood Oils Obtained by Special Representative. '. Number. Turning Point. has been between 20 and 21, averaging! 20.7, indicating an elaeomargaric glyee-'' ride content of 95 per., cent, approxi I? J5` C. j t ............. .................. ss.s :'.t .............................................................. 20.S ' mately, As closely as the writers have to cause the'oil to'solidify'at room temjK, been able, to determine 100 per cent, perature and therefore' materially. low^Z1 ; '..................................................tu ,, elaeomargaric glyceride, i. el; -Chinese the'Turning. PointThe "writers have?, S t ..........................................................................: ** ;;*' wpod oil free from natural olein and for .exposed '"standard, sample^ of^-Chinesf^ eign oils, has a Taming Point of 25 to .woodWin-similar bottte. toytlie;actiodSj X 4. Areiuge.' .............................. ...v SJ. 'm *a.o ' The domestic, samples of Chinese' wood 'oii; reported on in this investigation were 'obtained' from nuts grown in four states, vii.r Alabama, Florida, Georgia and Cali fornia. The meats after the removal of 'the-shells, were ground, heated 80* C, "with nearly complete exclusion of air and [the oil immediately expressed with a hy- draulic press, developing 9500 pounds per [square inch. - Approximately 32 per cent by weight of oil was obtained in each jease.:: The oils were uniformly pale and did not solidify at room temperature as did two.samples, of domestic oil,.exam ined about a- year- ago>-' These two sam- ptes were shipped in d 'or. sample bot- [i ties. and . evidently, had received consid- 3 erable'exposure 'to light' (prior to their 5"`receipt and examination by. the writers),, sufficient 'to form enough .."light break"' of light.-until the . contents were co-mrA1' - wearing this data in mind as welt as . pletely-' solidified ' andfound ', that th|<4 the-data contained in-Table 1, the results obtained with the domestic produced oils, - as-given in Table 11 present some very Turning Point had dropped about 5 unites? Therefore the Turrniinngg FPoinl te of the. deyott, mestic oils reported on in our earlier;-'* interesting considerations..... articles were originally' several units ' Table IL - Domestic Chinese Wood Oil Fronr U14 Crop of Nutt. eawn.T.n.iacAdd Xo. Soinx Color Cmr. It 55' C. Vl. higher. .)' in this investigation the freshly ex): pelled oils were thoroughly clarified in: % centrifuge and put. up in black bof-^.f lOtonlu Ei. b u -Vo t f o io sue as ass ties to avoid possibility of formation ofi.' ll!f.rW "light break." ", Union* ....... 4 TaUffikanie. F_U__._.. 5 liBtr. of OHToc<l F.. U.. ........J.U.t.llrTrrrf-- is*, til.~ " - JSSJ 3U> am. SMI 2X0 44* . w -*4f-f as . it . iso Shipments that were considered 'aergi ceptible over a.. threc-yeair period,. prionS to the'development of tht timiiitf Pomft method for judging the purity of Chinese^ Excluding the California oils, the aver V. wood oil gave a "Turning Point" of 15A; age Turning Point of the remaining four corresponding to an elaeomargaric''jjtyf -dlls is 23.S, corresponding closely to the! 'l ecride content of about 90 per cent. -Dun average of 23. obtained in Table 1, which! - ing the past year the "Turning Point" the 'writers believe is the .maximum pqq^l has been between 20 and 21,; averaging sible for'commercial shipments, Pracf)-! 20.7,-. indicating, an' elieoihargaricV-glyi^^ i to.cause. the oil. to, solidity at. room tem- cat teste indicate that these four oils are] /'ride' content'of.'95 per, tenCvitHirduaJ 3 - perature;. add therefore' materially- lower of exactly the same value and character1^ j mately. As closely as the' writerSjd&ve , ^.the. Turning. Point^J The . writers have ** the' genuine;.Chinese wood', oils .- of been; able-to determine .100 percents exposed .standard'.' samples', of .Chinese Table l _nd therefore superior ly ary- ~>laeomar(rrrir' glyceride;' i.S "wood oil[in.similar bottles to the action' commercial shipments so far ra.Minnei! -'w ik n ! <.-1 fire irom nainral dleiit '[of.: lighffnntil -; the-cbntentd [were'.. com- rigi. ip:'1-. Ik s a Turhing-'Poiitt^ofa t *pletelyj; solidified-/aiid'' found : that^ the j,? The. two. California- oils. are. i mainly . ,Turmng:Point had. dropped about 5 units. ahnormal-r':Not only do] they possess -low- w.r- Bearing. thisVdata' m. mind yas: welCrai - -Therefore the.Turning Points' of the hx 'Aecifie gravities and low Turning Points Sthe.data.edntaih'ed in Table,l[-.the ieaMiS Reported, on y in .our earlier. Jdit thejr are- eritirely outside, of- thi acy ^obtained;^withithe dohniestie produced sTW^Sjvere^dngiriallyseveral-: units cepted. limits: of the' Browne heat test,* as*given, in' Table. D present sonie t . . ..--,,.. ^jK^fuTSu^iiiSrij :suifttyua. .uatto] 'take having been, made, a second iot of '?*"** was pressed. The oil obtained cor-- * * responded in all respects to-that obtained .from the first pressing. ...; &These two oils unquestionably would be unsatisfactory- for. commercial usage. Mr . 1 OmmIi Sxn. Stt. Terr F*&e IFmlrfiope, JkU.... M ** 1 AJ..*..B..V.......H.e..r-. ** * 4 TaflikuH, fit... ft Uatrk. -.oC. .ou.u...e...r-:* **. * P. Onr. Pt U* C;TV -Bd ,V ..* .. f- * sam'S-*Ar - and, would be considered; when: 'judged Jby they usual- laboratory, and-, practical - Excluding the California oils; t ^.-tests', as heavUy adulterated. .'. . a age Turning Point of the remaining ^.Correspondenceas - to' the conditioeit ;t:bfls is 23.8,'corresponding closriy'-,^ 'tmder >which : these* nuts- were grown' >Vaverage of 23.'obtained in Table l^v elicited the ioliowingVenation; the writers believe is die 111--------II iii'iT" *' -.................aa--.--` -ti, -fc*. MmMMtal jhiainntflwl-i 0007-SWP te**AAA *i in uuifiy cases4u Vv 5U percent- Aelita^ latter daaa of goods ia pudaud largely I by women wboaavo their miadkmade up I from the reasons eat forth fndha advert*.! i* they havs read, I have been mer-| rjfifK-'lrhsndramg long enough to know that 11 .-^Tjvwiid have nii^tit chance of whanging any I I PUSH NATIONALLY AD woman's view* by offering a brand other I .SUtrftcttef btMBhw ** abo* Uat.tti (Miwt.ettiM tbwuWHit VERTISED GOODS" "I am reminded of the aged bub Blueitrve incident of the darluy peanut yendor at the eireua who, in aa enfeipriemg way, lustily and ineemmUy proclaimed iksn the one *shs ear in the megautW. I Thera are, in addition to the few reasons E il have given, many others that might be I fmanUoned as to why the retailer should f f.'puth the advertised brand. Simmered i u<t the nipenonly of hb frailly ixmited prod uct, neatly and ekaaiy wrapped, with a eoiemn earning aa to the inability of the '7.- vWtorto property enjoy the sight*without [than--while bis leas enterprising com- petitor alongside took advantage of the g.opwn, however, they ean be told in two! . short words that mean aueoem to the 1 :B j deader, i. e., it papj.,'--CartGraham, eflhel 1 Cart Graham Print A WnH Paper Co..L Wichita, Ken., to American Print anat Oil Dealer, ^-S2S&W-- -"a-- V<kmIKm w* ataotnBmamp.v-t-o---'-9-*--r--a-i-m---* (market created by echoing rHeah, too'. H Aside from the fact that most retailers -- .prefer not to be Identified with an 'echo*. fMfc ite M PL I >Mf, the* b'tbiMMIrfpMMitlM!. - m h i mm j o t i. sin; to ua. j . Jlet me ask `Why should the retailer push y ! J. the unadvertiaed kihdP The advertised -{ & kind axe <1) as reasonable in ooet, (2) the ioM tf ri-t u anr jtsi chanoa are very much in favor of their tk irwiii !* Ifet-vradto npwtot Car Gm m IN yMnil ' IK. "* ilf ben* better mod* thin the unadverthed Kind and (3) there is mm money in push* . v; *w - / t:\T- ing iJwn. In staekiqg an advertised Jine fymw<jwHiw vtmornnrnutevgatwohiAPlg**! A* tw ilHpr C -Y-y. .v DOctocepewstityr of selling the mrensumer,. as he Iis )zz:l._v i. |*wd before he coma to roe. I am relieved v * * . earn ter teUrwt . of the personal rwnonaftflity as to the J; sraiTcsssjr quality of the gooos--the manufacturer has vouched for them publicly in standard ^ mediums. The education of the house- `C holder or farmer in the economic advan- ter A# nlwitfi rf toto moA ttojvw hnitulMfc ia at Hanator a.fia. tfbSsT.fmt dmmIWmmwikwaiaf IMII.akB.Mvuteaniij na smspias made haw War mv tortr, paMn< toal M IWIiSa Jmm hem poti m th--a^wniM automSWantoammiteMml.. _________I m Ua Dvtreft i# la ms tow mt ML Otoe " as tor syUN, tsaya or keeping buildings, bares; ete,,/ . .jr*' well painted is something my [ _* ** snd capital would never permit me doing; *s a consequence of the propaganda fort ' psintuig regularly at the proper season, the eonsureen u my teniton J w me for their supply - r--.fioisbcs. The interot that ........... jKdwrtiaeij Uke m tiie feature! Hint link mm& Ja j ; f - f up with ttur nntranal 'adwrtUv m elmfjg i Ian item for the retailer to consider when (the Don-advertiser makes an appeal to f him. Their window trims, thr eon- i-l&V .... ^ i\ ' . J * I Mini f|' 11| l1 ... -a.- - :-~ `.'trfjfii-1 persom were served at the opening restaurant, its popularity has increasal since _______w________ in my then by leaps and bounds. Owing to its sad in t way that I could not think of doing under any other o reputation for food quality and its service, This publiaty carries with it nol callers from other industries ate frequent. value of preserving the -- J. H. Hiftt. le death of J. H. Hatt, manager of the Central Paint'& 1 amish Co., Detroit, occurred in that city oh Thursday, f arch 7. ' . .. . . /I The Company in writing to the Detroit `toueb up' woj Mr. Hatt but a few weeks previous had returned from his j Branch says, "It is needless to say that home, sad isvacation which he annually took during the months of Jnn^j the vigor that had resulted in his attaining .the position + . which he filled so capably to the time of his death. ^ He was stricken shortly after the completion pt hw day s. . duties, and while still in the neighborhood of his place of I, business, passing away after reaching his home: . . VfcSF ; "l.^ Services were held at his late residence,. 256 F.udid ' Avenue, West, Detroit, interment at Wauseon; Ohio, his birthplace. ' . - % 'SM' i Few men in the trade were better known and,none more. beloved than Jake H. Hatt. Originally at the head ofa sue- MSS*- ces&fu] hardware business at Wauseon, Mr. Hatt became f'.' '. so interested in the paint branch of his business, that he j.--' UJS. i vrrr- entered the employ of the Peninsular Paint and yarnish. - James Bocd, Jr^ 3S years old, died on December 19, at his homf' Company, Detroit in 1903. With this Utter company he f ` in Kew Orleans and was buried ia Greenwood cemetery with Masonic * made a brilliant record, and many friends. _ About ten years . services. Mr. Bond was for over ten years salesman for the Acme ago the most important recognition of his ability was ac- j?,.; Whhe Lead it Color Co. m and around Kew Orleans and had a host -' corded .him in his appointment as manager of the citys,.;... LofMe^i fagegOBt. branch of the Acifte White Lead and Color .Worses, knowny.,. .;. s the Central Paint arid Varnish Company. `-Jw.A '. He was a member of the Detroit Paint the Rotary Oub, The Red Run Golf Club, the. Ella|f temity, Detroit Matinee Club, and was an assoqa^r % 0007--SWP--043215 ber of the Master Painters* " " 0007-SWP-000126371 I i Put the Painter On Your Selling Staff! Some Views On REAL Co-Operation With the Painter by G. N. Malm, of Malm Bros. C& Co., Lindsborg\ Kansas. TTHE success of any bti&i- you favor without proper reciprocation l * ness depends greatly on your part. Human natuTe hasn't changed-- j volume; .on the consumption not yet. of goods sold. The large In co-operating with a painter the first * UlUttllMt.'tlwnBM PliviaS^sdtf ] ot..jrJ--T#.I>ai1eat'president of th* Aear'hiat' Varki of Dtil^aad * UiM Doita'-'-ChapiaoB, dittEk; Uitfof..Mr*.?; KUnal* |XO>>afcii, of Boobott^s\*vor<*\B>A2Tid *:ot; hl*h- nceaXqaa&iy. Vjr aor.'-.B. ju .Bboch^ XioitaoBst isoea to'* Battle; Cvorir tralalBff caxap to^pmpajm for; brafat*Vf*nrte*'About.Annto 37.'.: volume alone makes the small margin possible. The small output on a large profit is with us no more. . This means that all the consumers must be reckoned with, and we have found in our re tail paint business that the bulk of the goods wc sell is used by the painter, whtfbcr we sell to him direct or to his customer. We take pleasure in catering to the painter for his trade, as we think it worth to bave-s-and to hold. And to hold it co-operation Is absolotclv necessary. Don't expect anyone to turn requisite is: Get your painter! If there is not a good palmer in your town or locality 1$ that one gets there. How? Ask the trav eling salesman to look out for one. Put an ad in the trade papers, stating exact conditions and facts. Don't promise and don't exagger ate, but get your painter. Haring painter or painters in your town, you should have them in your store. Make it their headquarters; their place of business as well as your own. Be friends. Teal Friends. -r*2: This does not mean that you shouldHeal the J5.4E 'painter in a condescending, patronising way, but make his interests your own. See that he-:jT; 'jT-Jf/f . > . Adrian Xh Joyce, fmenl lain min- : ***r of tho Gherwln-'WiUluns Com pany. of Cleveland, loft hurt week for * Washington to UJco port dm a. confercoco of a committee of point manu facturer* with army and nvy officials, the conference to consider tn atanaardlutloe of palate and color* for equipment. etc. Other member* of tho committee Include Thomas Ked, Acme i White lead -and Colon Works, De- ' txolt; B. W. Heath, Health A MUlls*n. Chicago; W. H. Phillip* Devoe & Kaynoida Co., Inc.; Krneet T, Trigg. of \ John Lucas & Cm, and C. 6. Kennedy ' of Lom Brother* Co., Dayton, O. 1 Jjt*; :W * IV -W,MT:;, isscgK)97f... prospers as well as you. Live and let iVith a little accent on the let What are his interests? He wants work and1 | lots of it Being his friend, yon. should serve ' '-L; "HI GLOSS" PASSES ON him.: Get him jobs, contracts that keep him ' HERMAN G. WHITE, manager of die sales department of the Acme White Lead busy and fill his bread basket Not any triad of jobs at throat-cutting prices, but put him & Color Works, Los Angeles, CaU passed next to the good ones you know of. You away Oct. 19 at his home in Hollywood, CaL Mr. White was born at Fiqua, O., July Z2, ; hear of prospects every day. Keep him posted. v j Talk well of him to your customers. Hclp^^ * 1874. After completing his collegiate training . him along. Skillfully worked, you will in this lie chose salesmanship as a field fitting his qualifications. He held several important po ; way make him as valuable a salesman as any sitions in this work before aligning himself of your elect. J" 1 with the Acme White Lead & Color Works as * But we have found it absolutely necessary \ sales representative in an Eastern territory, ; to give the painter what he wants--the an-fjl/ with headquarters at Syracuse, K. Y., on Jan. * terlal necessary for good work. We have TS. 1, 1907. Possessed of a compelling personality, * found it to our interest as well as to the rater- boundless energy and good judgment, Mr. , est of the painters'buyrng from us to stick to V * White early proved himself equipped with the one firm. When trouble comes, as it win in requisite managerial qualities, and after con- * any paint business, it is always adjusted to trolling a Michigan territory for a short time satisfaction, and the painters have edu he was chosen as manager of the Toledo cated themselves up to these goods and know branch. The personnel of bis selling staff at all about them, until they won't have any Toledo is practically intact today, a tribute to his ability to select productive men. His last i thing else. - promotion was to the supervision of sales at The painter u in a better position to learn Los Angeles, shortly following which appoint all about a certain material, and generally he ^ v? ment his health failed and he was compelled trill tell it without modification. Hell not callV to relinquish active duties, although maintain- the spade an agricultural implement and yaui| ing his connection with the organisation, and \ get the benefit of his findings. Then we are >*.f until* the end showing a keen interest in-his former associations. able to keep posted on every article we handle. * He knows his trade and you know your busi-.J Beloved by all,* Hi Gloss, as he was fa ness. Put the two "knows" under one har miliarly and affectionately known, was the. leadeir.in any movement that he became identi fied with. He was among the best-informed ness and see them pull. Co-opcrate_i$ RIGHT.________ paint men of the United States, and was in considerable demand as a speaker at various trade gatherings and local meetings. He was an officer in the Los Angeles Sales Execu tives* *CUib, a member of the Faint and Var nish Association at that point and a former j T -- "" " r . member of the Paint, Oil and Varnish Club and the Builders' Exchange of`Toledo. ._ 0007-SWP--043216 &$ 0007-SWP-000126372