Document 6D3qzVLDMqGn34ZM4ob0R101

AADDDDEENNDDUUMM TTOO PPEERRFFLLUUOORROOCCAARRBBOONN ((PPFFCC))--CCOONNTTAAIINNIINNGG FFIIRREEFFIIGGHHTTIINNGG FFOOAAMMSS AANNDD TTHHEEIIRR UUSSEE IINN FFIIRREEFFIIGGHHTTIINNGG TTRRAAIINNIINNGG IINN MMIINNNNEESSOOTTAA DDEELLTTAA PPRROOJJEECCTT NNOO.. 1199338822--DDEELLO0 Propared for: Prepared for: MMiinnnneessoot5taa2 0PPooLlalllfuuattyiioeontntCCeooRnnotrtaroodll Agency Agency St. Paul, NN 55185. 520 Lafayette Road St. Paul, MN 55155 PPrreeppaarreedd bbyy:: 5510 RiceDDeCelrlttaeaekCCooPnnasrsukulwlttaaaynn,ttssSuite 100 5910 RiSSchehooCr(re6er5evv1eii)eekww6P,3,a5MMr-kNN3w4554a559y11, 22S66uite 100 (651) 639-9449 OOccttoobbeerr 2222,,22000088 22223333..00000011 Exhibit 2233 STATE02826813 STATE_02826813 TAOFBCONLTENETS TABLE OF CONTENTS 10 INTRODUCTION. 1 1.0 INTRODUCTION .................................................................................................................................... 1 1.1 PU81DB0O 0 OS F BOIE VORS ors sesenesos eos 1 1.1 Purpose and Scope of Services ............................................................................................... 1 12S0 OFWO0 K. 8 ttt] 1.2 Scope of Work ........................................................................................................................... 1 13 Limtatons. 4 1.3 Limitations ................................................................................................................................. 3 20 ADDITIONAL SURVEY OF MUNICIPAL FIRE DEPARTMENTS 3 2.0 ADDITIONAL SURVEY OF MUNICIPAL FIRE DEPARTMENTS ......................................................... 3 2.1 Quesliomaires ReceivedVia Mail Post-30J Ruepnoret 3 2.1 Questionnaires Received Via Mail Post-June 30th Report ........................................................ 3 22 Questomaires LackingTraiingSit Locations 4 2.2 Questionnaires Lacking Training Site Locations ...................................................................... 4 23 Questionnaires Lacking Foam Information 5 2.3 Questionnaires Lacking Foam Information ............................................................................... 5 24 Follow-UpWin MunicipalFire Deparments Locatedin WPAS 2 2.4 Follow-Up With Municipal Fire Departments Located in WPAs ............................................... 8 25Follow-Up Wh Municipal Fire Departments Located in SWARS . 2.5 Follow-Up With Municipal Fire Departments Located in SWAAs ............................................. 8 30 ADDITIONAL SURVEY OF FIREFIGHTING TRAINING SCHOOLS. 3.0 ADDITIONAL SURVEY OF FIREFIGHTING TRAINING SCHOOLS .................................................... 9 40 ADDITIONAL SURVEY OF FIREFIGHTING FOAM MANUFACTURERS. 4.0 ADDITIONAL SURVEY OF FIREFIGHTING FOAM MANUFACTURERS ............................................ 9 4.1 Department Ranking ChangesDue toHCTF-500 Information 0 4.1 Department Ranking Changes Due to HCT F-500 Information .............................................. 10 5.0 GIS MAPPING OF FOAM TRAINING SITES. 10 5.0 GIS MAPPING OF FOAM TRAINING SITES ...................................................................................... 10 5.0 TRAINING SITE RANKING RESULTS. 10 6.0 TRAINING SITE RANKING RESULTS ................................................................................................ 10 6.1 SieProfies " 6.1 Site Profiles ............................................................................................................................. 11 6:2 Ranked MuniFirceDeipaprtmaentls LL IIIII e 6.2 Ranked Municipal Fire Departments ...................................................................................... 13 16:3 RA THAIKSAE HOO. 13 6.3 Ranked Training Schools ........................................................................................................ 13 7.0CONCLUSIONS. 13 7.0 CONCLUSIONS ................................................................................................................................... 13 7.1 SURVEYRESPONSES |. 7.1 SURVEY RESPONSES .......................................................................................................... 13 72 HIGHEST RISK TRAINING SITES FOR PFC RELEASE 14 7.2 HIGHEST RISK TRAINING SITES FOR PFC RELEASE ...................................................... 14 73 FIREFIGHTING FOAM MANUFACTURER RESPONSE 1s 7.3 FIREFIGHTING FOAM MANUFACTURER RESPONSE ....................................................... 15 80 RECOMMENDATIONS. 1s 8.0 RECOMMENDATIONS ......................................................................................................................... 15 90 REVARKS " 9.0 REMARKS ........................................................................................................................................... 17 Table 1 TTaabblee21 TTaabbllee2d TTaabbllee 43 TTaabbllee 54 TTaabbilee 65 TTaabbllee 67 Table 7 LLisisttooffTTaabblleess UUS.S.. MMaannufauctfuraercsootffFuFiirrreeffeiigghhrtiinnsggFFooaammss((NNoocchhaannggee ffroomm JJuunnee 3300t"n RReeppoorrt)) AAlllMMuunniiscpipaall FFiirree DDeeppaarrttmmeenntt QQuueessttiioonnnnaaiirree RReessppoonnsseess. MMuurniciciippaall FFiiree DDeeppaarrttmmeenntt wwiitthh NNoo FFiirreeffiigghhttiinngg FFooaamm UUssee. MMuunniciciippaall FFiitree DDeeppaarrttmmeennttss TThhaatt TTrraaiinn WiWith CCllaassss BB FFooaammss QQuueessttiioonnnaaiirree RReessppoonnsseess rfroomm AAlirppoorrtt aanndd RReeffiinneerryy FFiiree DDeeppaarrttmmeennttss aanndd TTrraaiinniinngg SScchhoooollss TTrraaiinniinnggSStietesswwitithh 33MM FFooaamm UUssee: Municipal Fre Departments Located WithinSourceWaterAssessmentAreas. Municipal Fire Departments Located Within Source Water Assessment Areas AAppppeennddixiAAx AAppppeennddixixB AAppppeennddixiCCx AAppppeennddixiDDx AAppppeennddixiExE List ofAppendices QQuueessttiioonnnnaaiirreess RReecceeiivveedd Post-June 30" Repart List of Appendices Post-June 30th Report GGIISS MMaappooffTTrraaiinniinngg SSiitteess,, FFriree DDeeppaarrttmmeennttss aanndd SSWWAAAASs UUppddaatteedd TTrraaiinniinngg SSiitee SSuummmmarairieess ffroomm JJuunnee 3300t"h RReeppoortd MMuurniciciippaall FFiirree DDeeppaarrttmmeenntt TTrraaiinniinngg SSiitee PPrrooffillees ffoorr SStiteess RRaannkkeeddPPosots-t-JJuunnse3300"th RReeppoorrtt SScchhooooll TTrraaiinniinngg SStitee PPrrooffilei ffoorrSSiitee RRaannkkeedd PPoosstt--JJuunnee 3300th RReeppoorrtt 22223333..00000022 STATE02826814 STATE_02826814 ADDENDUM TO PERFLUOROCARBON (PAFCD)D-ECNODNTUAMINTIONG FIREFIGHTING FOAMS PEARNFLDUTOHREOIRCUASREBOINNF(IPRFECF)I-CGOHTNITNAGINTRINAGINFIIRNGEFIINGMHITNINNGESFOOTAAMS AND THEIR UDSEELINTAFPIRREOFJIGEHCTTINNOG.T1R9A36IN2I-N0GELI0N MINNESOTA DELTA PROJECT NO. 19382-DEL0 11.00 IWNTTRROODDUUCCTTIIOONN 1.4 Purpose and Scope of Services o1.1taPuCorpnsousteanatnsd (SDceolpa)ewoafsSerertvaicineesd and authorized by the Minnesota Poluion Cortrol Agency (PCA) tDoelctaonCduocntsualtdadnitsio(nDaelltas)urwvaesy raecttaiinvietdesanidntoautthheoriuzesed bofy tfhierefMiginhtniengsoftaoaPmoslluctioonntaCinoinntrgolpAergfeonucryoc(MarPbConAs) t(oPFcCosn)duinctthaeddSittaiotneaol fsMuirnvneeysoatac.tiviTtihees aindtdoitithonealusseurvoefyfiarectfiigvhittiensgweforaembsasceodntaoinninthge pceornfldouusrioocnasrboannds r(PeFcComsm)einndathteioSntsatepreosfeMntinendeisnotDae.ltTah'es Paedrduitoiornoaclasrubrovney(PaFcCti)v-itCieosntwaenriengbaFsoefdighotninthgeFcooanmcslusaionndsThaenidr Use in Frefighing recommendations Use In Firefighting Training in presented Training in Minnesota report dated June 30, 2008 ne June 30" Report). in Delta's Perfluorocarbon (PFC)-Containing Firefighting Foams Minnesota report dated June 30, 2008 (the June 30th Report). and Their TThhee ggooaall ooff tthhe ssuurrvveeyy aces activities iiss ttoo deny identify ses sites iinn MMiinnnneessoottaa wwhheerree cceerrttaaiinn ttypyesopoffPePFFCsCss ooff ppaarrttiiccuullaarr eennvviirroonnmmeennttaall ccoonncceerrn aalt tthhiiss tiimmee,, ppeerdflluuoorrooooccttaannee ssuullffoonnaattee ((PPFFOOSS).), ppeerrffluuoorrooooccttaanncoiicc aaccikd ((PPFFOORA)), ppeerrfflloouurroobbuuttaannooiicc aacciidd ((PPFFBA)A.), aanndd ootthheerrss,, mmaayy bbee pprreesseenntt iinn tthhee eennvviirroonnmmeenntt dduuee oto tthhee rreeppeeaatteedd uussee ooff fiireeffigghhitinngg ffooaammss aatt frlreeffiigghhtiinngg ttrraaiinniinngg llooccaattiioonnss.. TThhee JJuunnee 30 RReeppoordt ccoonncclluuddeedd tthhaalt ssuurrffaaccttaannttss uusseedd In Class B firefighting foams are manufactured wih PFCs. F3i0rtehighiing foams formerly manufactured by. 3inMCwlaesrse Bmafldreefigushitinnggafoparompsrieatraerymparnoucfeascstuarnedd awriethkPnoFwCns.toFiCroenfitgahitninogf fboraemaksdfoorwmnelrolyPmFOanSufaancdtuPreFdOAb.y T3MhewseurrefamctaadnetsusiaingClaaspsro8prifertaarfyghptrnogcefsosaamnsd maarenukfnaocwtunretod cboyntacionmpoarnbireesakodtohewrntthoanPF3O1S waenrdePmFaOcAe. TushiengsaurtfaeclotamnertsizaintiConlapsrsocBesfsireafnigdhtcinangnofotbarmeask mdaonwunfacttourPeFdOSb,y bcuolmmpaayniberseaokthdeorwnthatno P3FMOAwearned motahdeer PusFiCngcaomteplooumnedsri.zatCiolnaspsroAcefsosamasndancdanrnaoitnibnrgeafkodaomwsnarteo nPoFtOmSa,dbeutwmitahyPbFrCe-abkadsoewdnstuoraPcFtOanAtsanadndotahreer tPhFeCrefcoorme pnootunadsso.uCrclaesosf APFfoCasmisntahnedentrvaiinrionngmefnotams are not made with PFC-based surfactants and are therefore not a source of PFCs in the environment. 1.2 Scope of Work h1.2e SfoclolpoweinogfsWcooprke of work was conducted under Master Contract Number B15536 and Contract Work. TOhrerfoNllouwmibnegrsScFoDpeE0oSf1w1ork was conducted under Master Contract Number B15536 and Contract Work Order Number SFDE09"I 1. Tasic1 = Obtain Additional Information and Update Report Tables Delta ontined aTdadstkio1na-lOibnftaorinmaAtidodnitfioronmalMIinnfnoersmoalatiomnunaincdipUalpdfraetedRepeaproirmtenTtasb,lefsre training schools, aDnedltamaonbutfaaicnteudreardsdoitfiofnrael-iignhftoirnmgaftiooanmsfroams dMesicnrniebseodtabemlouw.nicipal fire departments, fire training schools, and =manUupfdaacttuerdertsheofffoirlel-ofwiginhgtintagblfeosa;mofsthase dJeusnceri3be0d" Rbeeploowrt. with information fom survey questionnaires rUeptduamteedd tthoeDefoklalowafinegr Jtaubnloes13o,f 2th0e08:June 30th Report with information from survey questionnaires returnedTtaoblDee2l,taAalftMeurnJiucnipeal"1F3i, r2e0D0e8p:artment Questomare Responses o= TTaabbllee 23,, AMullnMicuinpiaclipFailrFeirDeepDaerptamretmntesntwiQtuheNsotioFninreafirieghRtiensgpFoonasemsUse o TTaabbllee 43,, MMuunniciciippaall FFiirree DDeeppaarrttmmeennttss wThitahtNToraFinireWfiigthhtCinlgasFso8amFoUasmes o o TTTSacaabhbblolleeeol554s,,, Questomiske Municipal Fire Questionnaire Responses fom Apartand Refinery Five Departrents Departments That Train With Class B Foams Responses from Airport and Refinery Fire Departments aanndd TTrraaiinniinngg Schools 22223333..00000033 STATE02826815 STATE_02826815 PAAFcdCdd.eaCnnodanuutmnarTTioong FireFfoaimagndhTteiiUnsegin Fesfghting Traiin nMininensogta Delta Projet No. 16302.0610 PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Delta Project No. 19382-DEL0 CH Page 2 TTaabbllees,6,TTraraininiinnggSStietesswwiithh 33MMFFooaammUUssee. + 1FF0oolltlohoewweesdduruuvppeyvvtiiaahattteeltlehepephyhootnnreeanaannoddr opoottlhheeenrrtimmaleelaaynntssrawwniithwhitthhheeClmmauunsniscici8ippaaallqufiirereeouddseeppfaairdmtm-mfeeonnnttissnttghhaafttoarreemsspp(ooAnnFddFeeFdd) tbWbouiutttthhideiadddsdnnuiootrtvit oeppnyrraooltvvhiiidandetfeotrtrhramaeiaiynntiiitnnorgagnintfsriteoeormiinptnfhfooeotrermdmneaatpittaiiaolorlynntmtssreuaunccinthhswttthhhitahtt httChaeeliansrtirsaaniginnBisinnaiggeqsusseiewteoessurseccoofmiuulamllddp-pfbboeeermdlloioanccngaadttefeorddaanoomknned(aa.AmmFaFapFp.). + WuFFsooiitllhlnoogwwafeedodddaitmiuuoppniavvlriiaaainifttnoeierlnlemgepaphbthiouootnnneeifrdaaonnmnddotthtosehthpeederceripfmmayeerwtaamhnnaesstntwwstiiytthhpheettohhtfreeaGimnmauinunmgniciwcsiaiipptseaalsluwffsirreeeedreddieenmppraaaapridptnmiemndeegn.nattnssWdtthhhraaatntakdrreededipp.iooorrttneeaddl information using foam information from the departmentsth sites were more accurately in training but did not specify what type of foam was from the departments the sites were more accurately ranked used in ranked. training. With additional + AlIddseesnnetisiffiseemddenaatllll Affirrreeeasstt(aaSttiiWooAnnXss),aanndda5ffiirdeeefffnooeaadmm bttyraaiinInhiinengg MaairrneeeaasssoltthahaattDaearrpeearllomocecaanttteeddofiinn HeaaalSSioonuurr(ccMeeDHW W).aatteeArr `AglgoesecosoaeggtrrseaadsppmhwhiieictcnahatillnAiinanrfefoSoarrmWmaA(aSttAiiWoonnwAeAssry)ye,ssttpeaermsomvdi((GdeGeIfIidSSn))ebdmymaatbphpyeooMtffhDeSSH.W WMAAiAnADSnseeasaaonnctddaoaamDbilieissntpteaoodrfftmtmmheueunnintScicWioippAfaalAlHffelirraaeeyltehddreeap(pManardrDttmHame)eG.nnIttASss ollloaabcyytaeearitrendpptrrhowiovsitivdhieeinnfddoareemaaaSrtrWiilioeenArr.AbbDyywelteththreeae aMpMdrPPodCveCiddAAetdtthhheaablftyeddteheplepiaicciMttnssDnHaagll.laffriDrreeeaeltsslattoaaccttaiiootominnobnllsoionccweaahdtteiiotorhnneess CSiilnnWattshAhseeAB SSltfataaoylteaeermsiiannnadoorrerdadeueGrsreIttSdoo notbtaaiinnitnhgistionftohremmaatipo.n. Delta added the fire training area locations where Class B foams are used + RSiRneWetq-raraaaiknnnakiknesegddtaocffirirtireheteerttrimraoaniann.piin.ngg locations locations where where Class Class 8 B foams foams are are used used 1o to include include their their proximity proximity to to + FSoWlAowAeads uapcrviiteariotenl.ephone and other means wilh the municipal iro dopariments that did nol rPFrereoossltplpoeoowcnnteddidont1ou0Aprtthevhaeiea (ssteWuulrPrevvApee)hyyonoaarennddaarnettdhhlaaoottcthahhteaaervvdeemienffaiiraneesSsSWwttaAaitttAhiio.ontnhsseThllomeocscuaaentteiecaddidpdaiitnlnioftitnrhheaeelirdrreaccpiooanmmritmnmmugneuisnntltisytey's'stshwaW Wetreedellildhhteehnaaeoddnt mParoptpeectdionandArfeaake(dW,PaA5) woarraanrteedlo.cated in a SWAA. These additional training sites were then = Fmoalpopweeddanudp rwainhketdh,easfrweatrrraainntiendg. schools that dc not respond o the survey before June 13, 2008, which was thecut-off date fo inclusion in th previausty-referenced June 30" Report Followed up with the fire training schools that did not respond to the survey before June 2008, which was the cut-offdate for inclusion in the previously-referenced June 30th Report. 13, + rFFeooglllaoorwwdeienddg uutphpewwuiistthhe otthfheePFmmCaasnnuifuafactcthtuuerireerorssaroosff.fflirDreeeflfigligahhttiainngggaiffooaaalmmlssemttphhtaaettdddtiiodd onnbototatinrreeissnppfooonrnmddat1tio0ontthhreeegssauurrdrvivenegyy wha tyofpPFeCsasre used regarding the use of PFCs in what types of PFCs are used i their am their foams. in their foam producls Delta again products. attempted to obtain information regarding UhUpepddamatuteeniTTcaiabpballelessre11 ttdhherropoauurggihhme66ntoosff,tthhheeeJJuuinneee (33r00atithhninRRgeep5pocorhrtot0wwiisit,hhatthnhede aahddeddiitftiioooannamallmiiannnffouofrrmamcaatttuiioroennrsoo.bbttaaTiihnneeeddtaffbrroloemsm wtwhheeeerreermeuuuqppundedicsaaittpteeaoddfl fire departments, the fire training schools, and the foam manufacturers. t$h0ehMaPlCnAo. merged cels were Included In ihe tables for easier electronic so that no merged cells were included in the tables for easier electronic sorting per The tables sorting per tUPUhoppeuddlaraeyttqeeuddideeeosnxxttiiiossftfiiinetnhdggetttrMraaaiPiinnnCiiinnAnggg. ssiistetieppsrroofbfilaeisssed((AAppoppneenndtdihiexx GGadoodffittihhoeenaJJluunnieonf33o00rt"mhatRRioeoppnoorrot))btooarriccnroeedaatteefrddompprrootffhileeessfffioorerr depariments and newly identified departments and ining training training schooks sites based schools. on the additional information obtained from the fire Task 2- GIS Laver DDeellttaa mmaappppeedd the ranked tring sites Task 2 - GI8 Layer the ranked training sites wwhheerree CCllaassss BB ffiirreeffigighhttiinngg ffooaammss aarree uusseedd rreeppeeaatteeddllyy iinn rtraaiinniinngg eexxeerrcciisseess,, aass dideentnitiffiieedd iinn TTaabbvlee 44,, MMuunniciciippaall FFiirree DDeeppaarrttmmeennttss TThhaatt TTrraaiinn WWiitthh CCllaassss BB FFooaarmss,, iinn oorrddeerr t1o0 oobbttaaiinn tthhee UUTTMM ccoooorrddiinnaatteess ffoorr eeaacchh ttrraaiinniinngg se.site. DDaetlltaa ccrreeaatteedd aa GGIISS llaayyeerr tthhaatt ggeeao--ilooccaatteess eeaacchh ooff thhee ffirree trraaiinniinngg ses sites rraannkkeedd iinn TTaabblei44.. TThhee laayyeerr aatttrribbuutteess iinnccluuddee tthhee fiirree ffooaamm uussee iinnffoorrmmaattiioonn ffoorr eeaacchh ttrraaiinniinngg ssiittee,, iincnludcinug tdthheeittyynppoegss aanndd aammoouunnttss ooff ffooaamm uusseedd iinn ttrraaiinniinngg aanndd tthhee ffrreeqquueennccyy ooff ffooaamm ttrraaiinniinngg. AASs ddeessccrriibbeedd iinn TTaasskk 11,, a2mmaapplalayyeerrddeeppiiccitinngg SSWWAAASs pprroovviiddeedd bbyy hthee MMODHH wwaass Iinnccoorrppoorraatteedd iinntfoo DDeeklitaa''ss GIs layer. GIS layer. 22223333..00000044 STATE02826816 STATE_02826816 DGB2etoa Pmroaacna.F1636r2 0EtLFOoatmanitTniUsgein Fettng Triin onesg Addendum To PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Delta Project No. 19382-DEL0 Foe Page 3 elt compet hTTeasfkao3r3m--asRtReiepopkonorrgttainers n Tass 1 ana 2 io tis repo. The updated Tavis 1 hough and Delta any new compiled tthaeiniinnfogrmstaetiosnumgmaathreireesd airneTianscklsud1edanwdh2 ysinto rthepisorrtepaort.wTehle3upadnaleeldecTraobnliecs v1erthsirooungohf 6neanGdISanyyern.ew training site summaries are included with this report, as well as an electronic version of the GIS layer. 13 Umitatons. eta researc 1.3 Limitations and this report are subject 0 th folowing dations + Delta's rDfDereseeleltfaaagrhcooihbbnttagaaniinndfeedotd,ha,ims rrreeemvvpaiieonewwruteaedadc,r,leuaasrnnurddbsj.eeecvvtaaatlnlouudaathtteoeetddhfoeiilnrlnoffowAorrnimnmogaawttliiloieomncnigtaepptarrioobonivviisedd:eepddervvsooolnlusun.nttaarDrilayyllbbayys ffisrreeonddvecepepasarrttdmmeoenntnstos,l, include he firefighting include the verifcationof ieaccuracy foam manufacturers, and verification of the accuracy or aulhricyof is infomation. other knowledgeable persons. or authenticity of this information. Delta's services do not + IDDneeflottarmcdaitidionnnootrt eppgeaerrfdroirnmmg iaahnnyy lssoittecearrteeoccnoo,nnnnaaariirssassanagnneccmeeenootrrsdeiarcencdttlyphaoybbssiseceanrlvveechaaannryyoaocfferthheseicffisreeofatratiihninggraisSntiteiesns.g. sSpIniuttfbeeolssrcmlaaayvrteeiaovniaininfraefebregrleeaeddrdfiofnbrrgoommmathteiiinnoffolnoorrcmmaaatittoiiononsn, oblained Hom arrangements obtained from theand the We. depaAments And maps. ard oer physical characteristics of the training fire departments and maps and other publicly available information. 220.0AADDDIDTITIIOONNAALLSSUURRVVEEYYOOFFMMUUNINCICIIPPAALLFFIIRREEDDEEPPAARRTTUMEENNTTSS AAalut etthsheieottniimnmaeeieoosff tthfhereoJmJuutnnheee 7853300t"h muricoa fe RReepoprotr,t, DDeellttaa depadments hhaadd rreecceeiivveedd tal were aa ttoottaall ooff surveyed. a response aie of S5%. 443333 ccoommpplleetteedd ffiirreeffigighhttiningg ffooaamm uussee qHueostwionenav8ioreefs hrferos,me qthueest7i8o5namiruenicwipearlefiurensdiegpneadrtmanednttshethreatwawserneoswuarvyefyoedde, taerrmeisnpeohnseederaptaertomfe5n5t%of. origin. Since June 13, 2008. Dela However, 8 of these questionnaires origin. Since June 13, 2008, Delta received additional were unsigned and received additional questionnaires in there was no way questionnaires in the meal contacted responding to determine the department of the mail, contacted responding municipal municipal frefire ddeeppaarrttmmeennttss ffoorr ccllaarrifficcaattiioonn oonn ssuurrvveeyy iinnffoorrmmaatitioonn,, aanndd. ccoonnttaacctteedd nnoonn-rreessppoonnddiinngg apaiments locatie SWAAS and PAS. AS ofOctob1e3r, 2008, an adRonal 34 Questionnaires were d{eecpeairvtemdenvitas mai fom located in mSuWniAcAipsalanrdeWdPeApasr.tAmesnotfs,Ocatnodbearn13a,d2d0o08n,san52adqduietisotniaolnn3a4irqeuseswteiornencaioremspewteerde vreacetiveeledphvoianemwaiilhfromumnimciupnalicifprael dfierepadrtempeanrttsm.enCtso,piaensd oafnthaedsdeitiaodndailio6n2alquceosmtipoentneadireqsuewsetroencnoamiepsletaerde viniacltuedleedphionnAepwpiethndmiuAnx.iciTphaul ,fire dteaplarotfm$e2n2tso.fC7o8p5iemsuroifctihpeasefraedddeitpioarntamlenctosm,ploete8d8%q,uehsatvioencnoamirpelsetaered ainncdludreedtuinmeAdppqeuensdtiixonAn.aiTrheuss, raegtoartadlinogf 5t2h2leofu7s8e5 mofunfirceipfaghl tfiirnegdefpoaam~sm. enDtas,laoir 68r%eg,arhcaivneg cmoumnipcleitoeadl daenpdarrtemtuernntesdurqvueeysstrioencnaiavireedsafreergaJrudnineg13t,h2e0i0r8,usaeeopfresented in firefighting Sfeocatmiso.nsDe2.1t,a2il4s, and 25, regarding municipal department surveys received atter June 13, 2008, are presented in Sections 2.1,2.4, and 2.5. Fortsiy of the questionnaires received via mal rom munca re depaiments contained incomplete iFnofrotym-astixioonf rtheegarqduiensgtiotrnanianiirnegslorceacteioivnes,d fvioaammabirlenfrdosm, anor pes municipal fire odfefpoaartmmuesnetsd i rang contained inecxeormcpisleetse Dineflolramastuiocncersesgualrdyingcontrtaaicntinegd l3o9catoifontsh,efsoeam45 deparmens brands, and/or 0typoebstaoifn fomaimssiunsgedinfinortmraatiinoinn.g eAxdedriciisoensa. iDneflotarmastuiconcersescfeuillvyedcfoontmacttheedse3d3epoafrtthmeenstes 4a6re ddeespcarritmbeedntns Stoecotbitoanins 2m2,is2s3.ing information. Additional information received from these departments are described in Sections 2.2, 2.3. Complete questonaves were eceied fom belowsted uncpa te departments afer June 13, 22..11 QQuueessttiioonnnnaaiirreess RReecceeiivveedd VViiaa MMaaiill PPoosstt--JJuunnee 30" 30th RReeppoorrtt Completed questionnaires were received from the below-listed municipal fire departments after June 13, an, pplcatle 22000088,, wwhheenn tthhee JJuunnee 3300t"h RReeppoorrtt wwaass ffiinnaalliizzeedd.. TThhee ssiitteess wweerree aaddddeedd ttoo TTaabbllee 22 oorr TTaabbllee 33,, aanndd TTaabblleess 44 and 6, if applicable. 22223333..00000055 STATE 02826817 STATE_02826817 APAcFddCda.eCnnoadnuutmnaTrTioong FirefightingFoamand TeiUse inFesfghting Training in Minnesota Delta Projet No. 16302.0610 PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Delta Project No. 19382-DEL0 Page Page 4 ++ bAAmlboaonmrndale + BrAoBBlnolaankccalkkndydduunaccClkkeenter ++ CaCCBnaraolnlloaaokwwnlyaanFyyaCilesnter + DaCCClwaloonsnnlnotaoarnnrtf Falls Dawson +Giuveun Duluth *+ GHGGuarilaabmnnesaarttdaa Harris ++ HHaHederenonnLVLaaaklkeleey LaKfHKiaiildkkydeeeemntnnntyyVealley + LMLLecaewDfwiaaisysvveviitiltntleee ++ MeMMMneecdnDnotdataovastiattHHeiegihgthsts ++ MMMNioielsanmcctaaaasma + NoNNogrooitrrtmvhSeaStntanarar TToouwnnsshhiipp Ogilvie + pRPeeenrmvhiaalmme + SStSRperpepirnihnnvgeigllVenVaalleleyy ++ SuVSSirttceugtprogehreieoaonnnLaLkaeke. ++ WVwWiiilcilmtloooowrwniatRRiivveerr ++ WWW Woiiilnlnmvneeoebrnbtataoggnoo Wolverton 2Q22.2 uQueestiosnnatiresiLLaacockkiinnngqTTrnraaiinniiann,gqSiSititeerLLoocecaattiioosnnss rity municipal fro dopartments intially respondod tthe questionnaire that they rainorpotentially train TwihtihrtyClmaussnicBipaAlFfiFre,dbeuptardtmdennotst ipnritoiavillydorersapioninndgedSttoo thinefoqrumeatsitioonnnsauicreh tthhaatt ththeey tiraniinnogr psoitteesntciaolulyldtrabine wmaitphpeCdl.ass B AFFF, but did not provide training site information such that the training sites could be mapped. OOff tthheessee thy thirty mmuunniicciipaall ffirree ddeeppaarrttmmeennttss., tthhee ffoollloowwiinngg ddeeppaarrttmmeennttss ttrraaiinn wwiitthh ofoaamr aatt vvaarriioouuss llooccaattiioonnss:; thheerree iiss nnoott oonnee rtraaiinniinngg llooccaattiioonn wwhheerree ffooaamm iiss uusseedd rreeppeeaalteeddlyly,, thhuuss thheerree iiss nnoott nonee ttraaiinniinngg ssiittee 0to mmaapp. oorr rraannkk.. * BBBriggoloLataekknee ++ DDDoaawrefrurr ++ MMMaaanzhtetoopmmpeaecd:i ++ BBBBryrrooorwoownntnessnVValallleeyy + FoEDEuddnoinvtneaaarin + NMearzsetrpapnad Oia Nerstrand ++ CCCBeayannrntobbenynynial + HaHFHsootalusiantnintnagdgisns +<= RRORaaalivmnmisdaseaaypyhHampion + CCCCooeohmnhaftaesrsnsesenyetiat l ++ HLLMaoaaklkleadenEiEdlmmoo * Randolph-Hampton RVoebrbgianssdale Robbinsdale Comfrey Madelia Vergas TThhee rreemmaaiinniinngg ssiixx ddeeppaarrttmmeennttss wweerree cconotanctetd tatoodcdeetteterrmeminidneespsepceicfiificcttrraaiinniinngg llooccaattioonn iinnffoorrmmaattiioonn: + ClCorrcooasstssitolaankokeef::tChoCenotInrataicnctitwowiglitihhett,hheeanCidtityythooeff aGCirronosissnsilgaakkseeteeenwnggaiisnnemeeairipnnpggedddeepapanardrttmrmaeennnktetddd.eetteerrmmiinneedd tthhee eexxaacctt location of the training site, and the training site was mapped and ranked. LonuLssoidnnsagdlfaeol:ea:mTTohhreerffaiireenicncghh.iietTf aiinbnddliieccaa2tteweddahsthaac,th,aiinngiheissd 11t34oyreyeeaflarerscstootnnhattthhteehdedeeLppoaanrrsttdmmaeelnnett,,Fihhreee ddDooeepesasnrontotmternreetccadalollles. not ainwihfoam using foam for training. Table 2 was changed to reflect that the Lonsdale Fire Department does = NfNnoooeawtwmtYr,aYoianornrkdkwiMMtthhiiellfssor:aaTmiThn.heienfgifrirseetcechhiweiaefsf ppmrroaovvpiipddeeedddtthahneedllorcanaoktieodcn.oofaftthhetessiietewowhhoenrree tthhee ddeeppaarrttmmeenntt rtraaiinnss wwiitthh foam, and the training site was mapped and ranked. ProrPecrpotorcott.ror.: TThhee PPrrooccitoorr FFriree DDeeppaarrttmmeenntt ddiidd nnoott rreessppoonndd ttooDDeelltaa''siinnqquuiirriieessaatt tthhee ttiimmee ooff thhiiss = Sreaprotret.-LoSauk: Thefrechief indicated that the Geparrainstwitmh Deawnnditsh soap, and that thhShaeaevryyetehhltIa-aaLvkeveeSnnea'tputltrkaaa:ciinenTeeahddewwhfeiiitrhheiffcrirhieigseftihgfatthiniitoidnnni.gcgaTfftoehoadeammtfhiriannt ysyteheaaealrrsods.n.epHHwaeaerstrrmmeelleaaanptteteoddterathdhianatsat nwppdaaitsshrttaDffnokoaaeawmdmnaatrdsiaistnihnhiinnsggotaawwipoon,iuuanlddgndlesikitlheealyyt forSartellLeSauk. have taken place at for SartelI-LeSauk. the fire station. The fire station was mapped and ranked as the training site 22223333..00000066 STATE02826818 STATE_02826818 Agsanaom To Addendum To RC Cotaring FioFotamaindiTsnUsgein Fenigting Triin Minvesgta PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Sota Prom te 163825610 Fos Delta Project No. 19382-DEL0 Page 5 + St Francis: The i. Frans Fire Deparment id no respond to Det' nites a te tieof St. Francis: The St. Francis Fire Department did not respond to Delta's inquiries at the time of ns report this report. 23 Questionnaices Lacking Foam Information 2.3 Questionnaires Lackinq Foam Information In Del's June 30 Repor, ten unig fe departments eportd the use of rsfghtng foam in In Delta's June 30tll Report, ten municipal fire departments reported the use of firefighting foam in raining, but i nt cary ently whch boof foam was used for rang. These fen depariments were training, but did not clearly identify which type of foam was used for training. These ten departments were contacted for this infomation wih the folowing resus: contacted for this information with the following results: + Cloqus: Th fr che icicate (rt te department ain about half of the me wi dish soap Cloquet: The fire chief indicated that the department trains about half of the time with dish soap al will gin foam, bolClass and Angus fen, ost Ces B. The sin and half with firefighting foam, both Class A and B Angus foam, but mostly Class B. The training location was vied wih the re ciel, ard he sie was added o Tal4e, mapped and ranked. location was verified with the fire chief, and the site was added to Table 4, mapped and ranked. + Dian: The ie cis indicated at the department rains at hefre station wi both Class A Dflworth: The fire chief indicated that the department trains at the fire station with both Class A anc Cass Ansul foams. The raring se was added Tab 4, Mapped and rakes. and Class B Ansul foams. The training site was added to Table 4, mapped and ranked. + Jofrs: The fr department scrtary nicaod hatth department io wih ClassA Sik-ex Jeffers: The fire department secretary indicated that the department trains with Class A Silv-ex foam Sinceth departmentdoc nt rain wilh Class Boa the sie vs no raked. foam. Since the department does not train with Class B foam the site was not ranked. + Lanesboro: Th frechi ndcated that he degarent rans wih both ClaAsansd Class 8 Lanesboro: The fire chief indicated that the department trains with both Class A and Class B AQUAEGG fam tks. The Lang sie vs added 0 Table 4. mapped and ranked AquaEco foam sticks. The training site was added to Table 4, mapped and ranked. + Nonfiks. ANoried fe eparinent caplain indicated on thei questtiatoClnasss8 Northfield: A Northfield fire department captain indicated on their questionnaire that Class B foam is used in traning upon dekvery few apparatus veryfeyears, and ha hey have not foam is used in training upon delivery of new apparatus every five years, and that they have not ined wilh foinaehm1 ten years. Since he Cla8fsoasm brand reporcd was 3, 6nd trained with foam in ten to fifteen years. Since the Class B foam brand reported was 3M, and sinc the depariment as rand nh past wih M Glass foam, he aningsievas ade 0 since the department has trained in the past with 3M Class B foam, the training site was added to Tables 4 and, mapped an ranked. Tables 4 and 6, mapped and ranked. + Randal: Th fir chief indicated tat the deparimert rains wilh Pytocor ClaAsasnd B foam Randall: The fire chief indicated that the department trains with Pyrocom Class A and B foam sticks annually. Th aiing 3c wes added o Tobe 4, mapped and ranked sticks annually. The training site was added to Table 4, mapped and ranked. + Rosemount. The re chief deed tht the depart just swiched [0 HT 500 4. oan Rosemount: The fire chief indicated that the department just switched to HCT F-500 A-B foam stick. bul has yet used thom ining. The depariment previously Uained wil Cis BAFFF sticks, but hasn't yet used them in training. The department previously trained with Class B AFFF anc raining foam. The re cif aso relate ha he deparimen ecened oi tocof Glas 5 and training foam. The fire chief also related that the department received old stock of Class B AFFE fom he Fin His i einer and 6d some raining wi hat a he no sro wat AFFF from the Flint Hills oil refinery and did some training with that foam; he is not sure what rand oa hy eceved fom tho finery. In 23 years on he dopartment. he fre chief indicated brand foam they received from the refinery. In 25 years on the department, the fire chief indicated they may have usedSM foam at one me or another The raining Se was added to Table4s that they may have used 3M foam at one time or another. The training site was added to Tables 4 16, mapped and ranked. and 6, mapped and ranked. + Stator: The usofClassA foam for raining was inoroctl noted as 0" in report Table 2 Stillwater: The use of Class A foam for training was incorrectly noted as "no" in report Table 2. he Sate dopariment nated on hei Quesionnar ht heyuso GlaA fsasm nly or The Stillwater department indicated on their questionnaire that they use Class A foam only for Waiing. Since the Geparment does nc in wih las 8 foam, he sie was not arked training. Since the department does not train with Class B foam, the site was not ranked. + Watertown: The fre chet ndcated that the department rain a ve bums in various locations Watertown: The fire chief indicated that the department trains at live burns in various locations wilh ClasAs fan. Since i department does ol in wih Ca8sas he ie was nok with Class A foam. Since the department does not train with Class B foam the site was not Tanked. ranked. + Wlimar The us of assA foam wasno ected i Table 2 of he roprt ue 0 fable Willmar:TheuseofClassAfoamwasnotreflectedinTable2ofthereportduetoatable formating arr. TheWimar deparimen eporied on tht Guestonate hal heyuso Cass A formatting error. The Willmar department reported on their questionnaire that they use Class A {cfor aaimng. Since ihe department dose ot rain wh Cass. oa he si was no arked. foam for training. Since the department does not train with Class B foam the site was not ranked. Several municipal fre departmerts dd not compete, or partially completed, Quesion 8 of the quesionmaie regarding Several municipal fire questionnaire regarding he types, brands departments did the types, brands andnot and quanis of complete, quantities of fam useby the depariments. For te Jue or partially completed, Question 8 of the foam used by the depadments. For the June 30"30th RReeppoortrt,, it wwaass aassssuummeedd thathat tthheessee ddeeppaarrtnmeennttss uusseedd CCllaassss 8B AAFFFFFF mmaannuuffaaccttuurreedd bbyy 33MM.. TThhee folowing deparimens were contacted for lrfcation of the tyes and brands of foam used by the following departments were contacted for clarification of the types and brands of foam used by the 22223333..00000077 STATE 02826819 STATE_0282 6819 PAAFcdCdd.eaCnnodanuutmnarTTioong Firefighting Foam and TeiUse in Fesfghting Traininign Minnesota Delta Projet No. 16302.0610 PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Delta Project No. 19382-DEL0 Pages Page 6 ddeeppaarrttmmeennttss vvaarriioouuss iinnffoorrmmaattiioonn oonn tthheeirr ssuurrvveeyyss,. TTaabblleess 22., 44 aanndd 6 wweerree uuppddaatteedd aaccccoordrdiningglyly,, aass aappppliliccaabbllee.. + BoBcllacaaccskkiddouunccakkl::lyTTfhohreetffairireniccnhhgi.ieeffHiionnddaiiclcasaotteeiddndhthiacatattttehhdeehddaeelppatahrrettmmdeeennptat ruutssmeeessntCCllraassasseAAdffoooanamemataitmvveaarwriiioohuussCplplalaasccseeBss ahoallcecccooadhhseooiplol-arnrereastslimliyssettnfaaotnnrtthtrAAaasFFinFFtinrFFag(i.(AnAeHRRde-AoAanFFllsyFFoFo)i)nncdwweiiicthhawitessttdthaalCftlhflfafratoosmtmhsBetthhdfeoeattpemeacc,rhhttmnnhiieeccanasltlitctcreooalwlillnaeesegg.deenoiionnnteTTrhhatiiinmeeklfeeRRdwiivviteehrr Falls. Class Falls. BSSiinnccee. Brethcekednerpiadrgtme:entThhaesftrraeincheidefoinnldyicoantceedwtihtaht CthlaesdsepBafrotammen, tthuesseisteCwhaesmgnuoat rradnokaerds. . The site was removed from Breckenridge: removed from Table 6 The fire Table 6. chief indicated that the department uses Chemguard foams. The site was = FBBorroroot0khkleyynnpuGCreepnnotsteerero::fTThhhieesddreeepppaaarrr,ttmmteehnnettuddiside nnoofottCrraeessssppooBnnddAFttooFDDFeemkltaaad''seiinnbqqyuu3iirfiMeessfoaarttttthahieeniitinmmgeeosofafsthhisiusmrreeedpp.oortr.t. = BFroorottheen:puTrnpeosfeieofcthhiiesf rienpdoicrta,ttehdethuastethoef CdelapsasrtBmeAnFtFuFsemsaAdnegbuysC3lMasfosr A foam training aisndashsausmneodl. used lSBClarlaoossoswsteaBBns: The fire chief indicated that the department uses Angus Class A foam and has froeammo.vTehdefdreopmaTrtamebnt4ljausentdos6bained Class AB foam sicks but has used them foam. The department just obtained Class A/B foam sticks but hasn't used them yetnot yet. The.used The BrstBorirtaeowiwnwninnassgsfVVroaeaalmmllle.eoyyv::TeThdThehfeesroiftfmierrewTaccahshbiileeerffserrme4eollavaattneeedddd f6tthr.hoaalmt ttThhaeebyyleuusssee4 CCalnaldssBaBAAsFFFsFFfoforrffirre rreessppoonnssee,, bbuut rtraaiinn wwiithh + tBruayicnkin:g Tfohaemf.irTehcehiseiftedwicaastreedmtohvaetdthfreodmepTaarbtlmeesn4thaansd C6. laA s(0asm on hand, bulhasn't used any in Buyck: any in the last four years. Thesiewas The fire chief indicated that the the last four years. The site was removed rom Tabs 4 and 6. department has Class A foam removed from Tables 4 and 6. on hand, but hasn't used = CeCrnrogosissnstelaaekrkeie:n:gAAdssepiiannrddtiicmcaeantteetdd, iiDnneSSleeacctwtiioaonns 22u..2n2,awwshhiilltee trthhoeeactrrhaaiitnnhiiennggCrllooosccsaaittiiaooknnewwfaaressdvveeerpriaiffriieteddmewwniittlhtttohhdeeefCCrororosmssisinlaagkkee. whwheanihtgiccinhhheebberrrdaainonngpddaodrofetfpmAAeaRRnr-tt-mAAuFeFsFnFeFtF,siDi3seuulstsabeerwddabanbysdytuAhthnReea-AbddFleeeFppFtaoar.rtrtmmeeaenctnh.t. For the purposeof his report the Crosslake fire department For the purpose of this report ito it 5 assumed determine is assumed = tFhaaitmtohnet.depTahretmfreentchuiseefspr3oMv-ibdreadnidnfAoRrm-aAtFiFonF.onfourtypesoffoams used by the depariment. Foam information was updated on Tables 2,4 and 6. Fairmont: The fire chief provided information on four Foam information was updated on Tables 2, 4 and 6. types of foams used by the department. + hHHaaarsrdduowinclickyk.u: sTTehdheefiofirraeem ccthhhiireeeffeiinntddiiimcceaastteeiddn ttthhhaeatlttahshetesddeeevppeaanrrttymmeaeernnst.t ccTaarrhrriieefsseAAcRRh--iAAeFFfaFFlFFsoaanneddlaCCtlleaadssssthAAeyffoodaaommnsso,,tbbuutt ttThrraaaabsiinlnoeaasnnnlny4nuuauaalsnlledlyyd6,, but nave rained foam three times but have trained only on timewih new in the last seven years. only one time with new equipment. Tho sk was removed The fire chief also related they do equipment. The site was removed fromnot from Tables 4 and 6. HolrHleoamllonavdned:d: TfTrhhoeemffTirraebcclhehiiee4.ff iinnddiiccaatteedd tthhaat tthhee ddeeppaarrttmmeenntt uusseess CCllaassss AA fooaamr oolnyly.. TThhee ssiittee wwaass. HolHrpeakomspioksnvinseBs:d:ffoTTroahhmmeeifTfirraneebocltcehhuii4ese.fef dnindodiirccaatltreeaiddnittnhhgaa.tt tTthhheeeddfeerppeaacrrhttimmeefennattisuuoitiilcilzzaeerssifiCCeldlaatsshssatB8tAAheFFFFdFFepmmaraatddmeeenbbtyyr33aMMi,n,sbbuwuttitthhhaatt CCCallaallsssshaeAByfsffoooraaasammm aaiasnnnddtohtrteraauiHisnnoeiinpdngkgfioffonroatarfmamrienaalihtnavvglaa.arrTiioohuu1ess0f1liloroec1caa7ctthiiooiAennvfsse:;anlListuowweaacSslsaoruiiinfnlicce.oodrrrFrteehucrcattttllhyytehrnneoorttdeeeesddpeaoaornnrtcmtthhheehenaqqtsuutrefeasositnutiisnoodnnwnntiathahiailrree tHPHhFCCaCtTTsthFFe(-5y5s0e0le0r0aSAiAne-c:Battiffoitrrhneee4ss)H.uupopTppphrkreeeinsssssstiifoeoirnnewaaahsggaeellrnntaettmuuo1ss0vee1eddd1bb7fyytrhttohAhmeevTeHHanoobuppeklki4eiSnnssouFFtihirr.ee FDDueerptphaaerrrttmmreeesnnettaddrcooheesshannsoottfoccuoonnntdtaaii[nhn at LrLPieiFssmmCmoosovrroe(e:sd:eefTTrhhSoeemecffTitraireobniccehh4se)ie.f4fTiiahnnneddiidcsc.aiatetteedwd atthshaatrtettmhheeovddeeedppaafrrrottmmmeenTntat buulsseee4ss.CCllaassss AA ffooaamm oonnyly.. TThhee ssitteo wwaass + Lreimtfoovrekd. frTohme Tdeapbalerstm4enatnddi6. not respond to Dela' inquires atthe time oftis report. For the purpose ofthis report. theuseof ClaB AsFFsF made by SM or raining s assumed. Littlefork: The department did not respond to Delta's inquiries at the time of this report. purpose of this report, the use of Class B AFFF made by 3M for training is assumed. For the + pMMauayrynpnaoarsdred::ofTTthhiees dcreeepppoaarrtr,ttmmteehnentthiddsiddtornnioocttalrreuessspepooonnfddC1tho0eDDmeeglutlaaa'srdiinn"qqouutiihrreiieres"s aaattmtthhiesttimiameesoosff tiuhissmtorreeebppodeortr.tC.lFFaoosrrstthBhee fpouarmp,ose of this report, the historical use of Chemguard "other" foam is assumed to be Class B = fMoeanman.ga: Tne fe chief indicated that the department uses ClaAfsoasm only. The ste was removed from Table 4 Menat~ga: The fire chief removed from Table 4. indicated that the department uses Class A foam only. The site was 22223333..00000088 STATE02826820 STATE_02826820 PAAFcdCdd.eaCnnodanuutmnarTTioong Firefighting Foam and TeiUse in Fesfghting Traininign Minnesota Delta Projet No. 16302.0610 PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Delta Project No. 19382-DEL0 Page Page 7 + pMMutyrrlptloe:s:eTTohhfeethddieesppraaerprottmrmtee,nntttheddiidudsnneoototrfreeCsslppaoosnnsd8ttooAFDDFfeFtlt'am'ssadiinneqquubiiyrriiee3ssMaatorttrhhaeeittnimimnegfoiftsthhasisssrrueepmpoeortdr.t.aFFnoodrr ttthheee ste fomains purpose remains onTables 4 and. of this report, the use on Tables 4 and 6. of Class B AFFF made by 3M for training is assumed and the site = NpNueerwwplfooosdldeeenon:f: thTTihhseereddpeoerpptaa,rrtttmhmeeuensntteddoiidfd nnOooxtfeorerssdppo2o2nn9dd wttoeotDDteienllglta'a'ssgeiinnnq!quufiiorrrieetssaraaitnitthnhgee 'ttiimamees soouffmtthehiidss,rraeepnpodortr.ti. FiFsoorr the the purpose of this report, the aTasbsluem4ed tha his product assumed that this product containsorwas made wih PFC-based surectant. This sit remains use of Oxford 229 wetting agent for training is assumed, and it is contains orwas made with PFC-based surfactant. This site remains oonn + NqTNueaeebwswlteRiRio4itnc.inhaalairrnded::is TTahhCeelafiisrressccAhhiifeeoffaiimn;nddiciihaetcededeptthhaaarlttttmhheent""ocdthhoeeerrs"" nCColhtieeumrsmegguuCaarrdld ffoaBoaamsom ailsis.sttedeThooenn strhieeeiirwas qrueemostvioendnfariroem iTsaablCela4ss A foam; the department does not use Class B foam. The site was + NaNrenoedm,wwovaYYesoodrnrkkofrlMMoemsidll:siT:naSTTbehhleceet4iff.iorrne 2cc.hh2i,ieefvfeiirnniddfiiicceadattetehddehtrhaartatitthnhieenddgeelppoacaarrtttimmonee.nnttThuuseseetssraAAinnnsisunugll sCCtaleasswssaBs8 AaAdEFdFFeFFdfftooorr tTrraaabiinnliienngg and was mapped and ranked. and, as noted in Section 2.2, verified 4 and was mapped and ranked. their training location. The training site was added to Table = rNNoeormrttohhvllaeandnd:f:rToTmhheeTaffibirrelecechsih4eiefafnredel6lat.teedd tthhaatt tthhee ddeeppaarrttmmeerntt uusseess CCllaassss AA ffooaamm oonnllyy.. TThhee ssiittee wwaass + PreamoyvnedefsromThTeabdleepsa4rtamnednt6.dd not respond pPuarypnoesseviollfei: iTshreepdoretp,atrtmseanst sdiudmneottrheasptohendd ettopoaDDretelmltteaa'n'sst nianqqiuuniiriiewesitaahlt CtthhheeemttigmimueeaoroffdtihCsilsa srreesppooBrtr.tA. RFF-oorr the. the AFF and the sie remains onTable4. purpose of this report, it is assumed that AFFF and the site remains on Table 4. the department trains with Chemguard Class B AR- Pine River: The department didnot pPuinrepoRsievoefr: iTsheredpeorpta,rttmsenatsdsidumneodt respond trehastpohned dtfeoopDDareetlltmaae''sntiinnrqqauuiiinrriseesswiaattthtthAheenttiimmueeoofCflthahisisss rrBeeppAoorRtr-.t.AFFFoForFrt-thhee npudrptohseesoifethriesmraeipnosrto, nitTaisbalsesu4med that the department trains with Ansulite Class B AR-AFFF Proancdtothre:TsitheerdeempaairntsmoenntTadbidlen4ot. resptooDelntads inquiriesat the time ofis report. For the `pPpauurdorrdppceootdossreet:oooTTffthateiheissd4err.peepapoHorrtortmtw,,eeitvtnestisrd,aaidsshssneuuommtreeareiddsniptthhnoaagnttdltthohtcoeeadtDdeoeenppltaaawrr'asttmsmienennqnotuttiatririaenicisnlnsaudtwwetihidttehhontJJimetethe-tXeXosAAf tFFuhFiFsrFrsavaeonnpeddotrhttyheh.eeFsosstriiotetehwwewaaasss: not mapped o ranked. added to Table 4. However, not mapped or ranked. the training location was not included on the survey so the site was + RlRoaacmamtsiseoeynys:.: TTThhheee ffsiirreee ccwhhaiiseeffriinenddmiioccavateteeddd ftthihoaatmt ttThheaeblddeeepp4aarrttmmeenntt rtraainnss wwiitthh CCalassss AA ffooaamm aatt vvaarriioouuss + Sloacrattoio-nLso.STahuek:siteThweasfirreecmhoivaedinfdroicmatTeatbhleat4t.he department current rans with Dawn dish sShSooaaaasrppt,ea,lhIaa-aLnnyeddsSthhaauausttke:ttdhheeATyynhhgaehuavfsviereenfnoc'tahrtmiraesaif,inninaeedddnicwwatiithtlehahdtCCatlhlnaaaysstsstthr8Baeiffndoioeanagmpmawssirtlmiinhn eCyyneelataracrsss.u.BrsrHHeoefnotiliyannmddtrsiicaicaiannttesetddhwettihthhpaaaltsDttthahweweonddueeldppdiasahrhrttammveeenntt has always used Angus foams, and that any training with Class B banedenradnoknedo.across the siroet fiom th fre hal. Thesitowas added been done across the street from the fire hall. The site was added fo Table foams in to Table 4, and was mapped the past would have 4, and was mapped SaLndClraain:kedT.he department dd not respond to Delia's inquires at the ime of is report. For the FpSpouut.mrrpapCoiolanssiesero:oofnTf[hhhTieaissbdlrreeeeppspaoor4rrtttm,,anhtehdneet6.udussidee of Class 8 AFF made by SM or not respond to Delta's inquiries at of Class B AFFF made by 3M for ining the time training is assumed and Ue site of this report. For the is assumed and the site Tylreomr:ainsThoen pTUylPeOr:SeThoef cTeapbalretsm4ena:nidt6.not spond to Delta's inquines a ihe tm of this port For the hdesparertpmoretn,ttdiids ansost uremsepdotnhdattothDeedletap'saritnmqeunirtiersaiant sthweittihmAengouf tshiCslarespsoBrt.AFRoAr FthFeF and he's remains on Tabi 4. purpose of this report, it is assumed the site remains on Table 4. that the department trains with Angus Class B AR-AFFF and + dUUeppspsaaalralta:m: eTTnhhteesffi@rreeRccohhyiaieelffCiinhnddeiimcciaactteeaddlttChhoaatmt ttphhaeenGCyllaabssrassnAAd.--BHBeHHd+iE-oExexpspaannnsositioobnneffloioavamem tcchuuarrtrreetnnhtetllyydueuspseaerddtbmbyeynttthhee historically used department is a historically used 30 brand foams. Thosite Royal Chemical Company 3M-brand foams. The site was re-anked and brand. He does not was re-ranked and removed from Table 6. believe that the department removed from Table 6. + pW Wuaarsspeeoccsaae::ofTTihheesddreeepppaoarrrttt,mmetesnnattsddisiddunnmootet drreestspphooanntddhtteoodDDeeepllta'a'ssriitnnqqmuueriirarinieenssts aatwtittthhheeCttilmimaeesBoosff thphrsiosterreiepnpoorftro,ta. mFF.oorr(th3hMee indicate tht hey cd purpose of this report, indicated that they did notit is not manutacture aprotein foam) The sie remains onTabie 4. assumed that the department trains with Class B protein foam. manufacture a protein foam.) The site remains on Table 4. (3M 22223333..00000099 STATE02826821 STATE_02826821 sasonciTmo Addendum To PECGoring Fiopting Foam ond ThiUse in Fafiting Trinign Miescta PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota e Dela rect No. 16582 OEL0 s Delta Proiect No. 19382-DEL0 Page 8 22..44 FFoollllooww--UuppWWitithhMMunuinciciippaallFFriere DDeeppaarrttmmeennttssLLooccaatteeddiinnWWPPAASs hiThirty mmuunniciciippaall ffirree ddeeppaarrttmmeennttss llooccaatteedd iinn W WPAASs ddiidd nlnot rreettuurnm aa qquueessttiioonnnnaaiirree iinn ttimime ffoorr tthhee JJuunnee 30 Report. The below-isted departments were successful contacted and completed questionnaires were30th oRvetpaionret.d.ThTehebseeloswit-elisstweedredeapdadretmd efno tTsabwleere2,sauncdceTsasblfueslly4coanntdac5tefdapapnidcadcioem.pleted questionnaires were obta+ineBdrAA.lolTeeoxhxkaeainsnydednirPsiaaiaterskwere added to Table 2, and Tables LeLaRkoevyite Lakeville 4 and 5 if appliRciacbPPhlelhyf.mmioeoluutdnh ++ CCCBaoralolleeoeddkroloaynnnniieaaPark LLLLiuietccRvhheoffiymeeeldd ++ RRRRoiiiccgchhehfmrmiesooldnndd ++ DFCDeaoelmlteoriordnaitgiLnLlaeaokkneess, + MMLMeuoedvdnteforoinrreedds ++ SSSRhhohaagakkeoorrsppeeeee +JoGGFroaodoromaddvinvniigeetwwon ++ OOOMswsoaaanktktiioicssnenlloa ++ WVSWiit.inontHothhdilrrbaoouirpprey Jordan Owatonna Woodbury AAtttteemmppttss wweerree mmaaddee t{o0 ccoonnttaacctt tthhee ffoolllolwwiinngg ddeeppaarrttmmeennttss llooccaatteedd iinn WWPPSA,s, hhoowweevveerr,, hethe ddeeppaarrtimmeenntss 6did nnoott rreessppoonnddttoo DDeefltiaa'ss iinnqquuiirrieess aatt tthhee ttiimmee oofftthhiiss rreeppoorrtt: + cFCyyaruses FFNeuullsdsaavito + RRieRcededLLaakkeeFFaallls Frazee Nielsville Rice 2.Follow-UpWith MunicipalFre Departments Located in SWAAS The2.5 The MPA provided Follow-Up With MPCA provided a lis of 157 municipal ire departments Municipal Fire Departments Located a list of 157 municipal fire departments located n SWAAS, in SWAAs located in SWAAs, wwhhiicchh wwaass ssoorrtteedd bbyy cciity. aanndd iiss iinncclluuddeedd aass TTaabbllee 77.. AAtt ththe ttimimee ooff tthiiss rreeppoorrtt,, 112244 oofftthhee ddeeppaarrttmmeennttss ccoommpplleetteedd aanndd rreettuurnneedd aa auesiomaire to Det, whi 31 ofthe departments did net respond fo Del's inquiries for information qTuheesCtiiotnnCaliererktoin DReevltear,ew, hMilein3n1esoolf athienddeipcaratmheanttsthdeidRenvoetrreesFpiorendDetpoaDrtemltean'st ihnaqduirbieesenfodrisinsfoolrvmedatiaonnd. Thahte he ci i City Clerk ninoRwecvoevreer, eMd inbnyetshoetaLainmdbiecratteodn tFhraet thDeepaRretvmeernet,FirTeheDecpyarotmf eNnotwhoaoddbeYeonundgissAomlevreidcaanids tshtaetdthaes wocity issenpaorwatecovceireeds (bNyotrhweooLdamabnedrtYoonunFgireAmDeerpiacrat)meonnt.hTehefiecitdyepoafrNimoerwntooidst,YbouutngheAymaerreicaonies tlisyt,edsearsvtewdboystehpearaNtoerwciotioedsY(oNuonrwgoAomdearnidc YforuendgepAamrtemreicnat.) Tonhethedefipreadretpmaertnmttheasntt dilist, nboutt cthoemyplaerteeotnhee Qcuiteys, tsieornvneadirbeyatrheeiNdoernwtooidoYnoTuanbgleA7maenridcaarfeirelidsteepdabretlmoew.nt.TTahbeledsepaanrtdm5enwtesrtehautpddiadteno1t0cdoemnpleytestehse qlueostcioinannaStiWreAeAaSdre. identified on Table 7 and are listed below. Tables 4 and 5 were updated to identify sites ++ located AiABnuauSdddgW ooebbArooAnns. EFErmlmanookrien PPelPmuebmmembreetrrtoonn ++ sBBBiiaiggdcfoglereokpr + FGFFlorraoesnsnttkcloine ++ sSSPtlliauoyrmotdomnennet + Bricelyn BCumtaerxten Butterfield ++ LGGGaokloennenvvceiCocrkekystal ++ VVeVSietrlornronduonelnnGCCreeonnvtteeerr +cuCCCillriinnmtteoaonnx + NLNMaaaakdvveiaasrrCoreenrystal + W VVWiiaaealununbgbueuutlnnGrove + DosCDdueagrlanrieneooCenter ++ MoMMMuaaanpdptiilseaeovviniineeLwwake + Vinger Wendell Winger + eDtoodngcealCoenter + MMuorudnotcakin Lake Ellendale Murdock 2222333..00001100 STATE 02826822 STATE_02826822 sasoncim To Addendum To PECGoring Fiopting Foam ond ThiUse in Fafiting Trinign Miescta PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Dela rect No. 16582 OEL0 Delta Project No. 19382-DEL0 Pod Page 9 330.0 AADDDDIITTIIOONNAALLSSUURRVVEEYYOOFFFFIIRREEFFIIGGHHTTIINNGGTTRRAAIINNIINNGGSSCCHHOOOOLLSS Assooff ithhee JJuunnee 30" RReepporotr,t, DDeefltta hhaadd rreecceeiivveedd ssuurrvveeyy qquueessttiioonnnnaaiirreess bbaacckk ffrioomm 1111 ooff hethe 1166 refghtng firefighting training schoo30o~chated in Minesola. Dela contacted the folowing remaining ive schools, and ther tsruarinvienygisncfhoromoaltsioloncwaatesd ainddMeidnn0esToatbal. e:Delta contacted the following remaining five schools, and their + survey inSftorCmlaotuiodnTwecahsiacdadleCdotloegTea:ble 5: + HeSnt.nCelpoiudnTTeecchhnniiccaall CCoolllleeggee; inEden Prairie + CHeenntrnaelpiLnaTkeeschCnoilclaelgCeonlleBgreaiinneErden Prairie; + MCiennnteraslotLaakSetsatCeoClloemgmeuinniBtryaiCnoerlde; g in Moorhead; and. + NMoirntnhelsaontdaCSotmamteunCiotmymCoulnliteygeConlleEgaestinGrMaonodrhFeorakds;. and, Northland Community College in East Grand Forks. fOtf htheessee ffiivvee sscchhooooklss,, oonnllyy tthhee NNoorrtthhllaanndd CCoommmmunuintityy CCoolllleeggee iinn EEaasstt GGrraanndd FFoorrkkss uusseess CCllaassss 8B ffooaamm ffoorr raining exercises repeatedly at one location. training exercises repeatedly at one location. fhe Of the 1166fifirreeffiigghhttiinnggttrraaiinniinngg sscchhoooollss iinn MMiinnnneessoottaa, tteenn ttrraaiinn oft off-site aatt vvaarriioouuss llooccaattiioonnss wwiithh ssttuuddeennttss aanndd municipal fre departments in the gion. municipal fire departments in the region. 404.0 AADDDDIITTIIOONNAALL SSUURRVVEEYY OOFF FFIIRREEFFIIGGHHTTIINNGG FFOOAAMM MMAANNUUFFAACCTTUURREERRSS eta Delta aattteemmppiteedd ttoo ccoonnttaacctt vviiaa tteelleepphhoonnee aanndd eemmaaiill tthhee ffoolllolowwiinngg mmaajjoorr mmaannuufafaccttuurreerrss ooff frireeffgighhttiinngg foams ormoreinformatan regarding the PEC contentof hei foams: + foams Ffoor maomrReeiandfoyr,mmaatikoenrroefgatrhdeinPgythre oPFcACqocuomantSetntso;f their foams: + TFyocao.m tRheeapdayr,enmtackoemr poaf nthyeoPf yArnoscuotm Aqua Stiks; + Chemguars; Tyco, the parent company of Ansul; + KCihdedmegFuiaerdF;ighting, the paren company of Angus, Kidde and National foam manufacturers: + UKsid.deFoFiarem FTiegchhtninoglo,gtihees:paarendn,t company of Angus, Kidde and National foam manufacturers; + HUa.Sza. rFdoaCmontTreolchTneoclhongoielso;giaensd,(HC). Hazard Control Technologies (HCT). At the ime of ii report, only HCT responded to Delta's inquiries. Ms. Sharon Greiner in the HOT. A`StupthpoerttimSeerviocfetshiDsivresipoonrt,inodniclyatHedCvTiarteeslpeopnhdoende atondDeemlatai'lsoinnqOucitrioebse. rM20s,. 2S0h0a8,ronhaGrtehineeHr Tin tFh-e50H0CAT8Sufprpeorst uSpeprrveiscseisonDivaigseionnt fs not a indicated vfiaoatemleapnhdonies annotd memadaeil ownitOhcntoobrecro2n0t,ai2n0s08P,FtChsa.t thIenfHorCmTatiFo-n50f0oAmeBfifigrehtisnugppfroeasmsiomnanuafgaecntturisesniostsaumfmoaarmizeanddinisTabnloet 1m, aUd.eS.wMithannor ucolntaaionfsFcrPftFiCguhst. riInngofForomraamstiso.n from firefighting foam manufactures is summarized in Table 1, U.S. Manufacturers of Firefighting Foams. 22223333..00001111 STATE 02826823 STATE_02826823 sasoncim To Addendum To PECGoring Fiopting Foam ond ThiUse in Fafiting Trinign Miescta PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Dela rect No. 16582 OEL0 Delta Project No. 19382-DEL0 Pose 0 Page 10 4.4.11DDepepararttmmeenntt RRaannkkiinnqg CChhaanng.qeessDDuueettooHHCCTEF--550000IInnffoorrmmaattiioonn FFoorrDeDfeal'tas's uJunnee 30" RReeppoorrt tit wwaass aassssuummeed tihaatt HHCCTT FF--550000 AA.-BB wwaass aa PPFFCC-c-coonntataiinniinngg ffooaamm.. WWiilhh nneeww Information that HCT30th F500 A-8 does no conain PFCs, he following changes were made {0 Table 4: infor=matiTohnethtaatblHCtlTeFw-a50s0foAo-iBnodloeedsfonortefcloecnttatihnatPHFCCTsF,-th5e00folAlo-w8inigs ecxhcalnudgeeds awseraeCmlaasdse8tofoTaamb.le 4: = TTHThhhCeeeTtHHaFiibb5blbbe0iin0tnigtglAe.FF3iwi.reeasDTDehfeopepoaatrHnrtitommbteeiendnntgttowwFaiarresseflrreDeecemtmptooahvrvaetetdmdHeffnCriotTommwFaTT-s5aa0bbal0lseeAo44-BrsseiinimnsccoeeevxettchhdleuerdooeondymlyatCCshlelaaassrCssalBnaBksesffdooaBasmimfostta.hhmeey.y use use is is + TTfHohhCaeeTmHHFooD-p5pekl0kiti0nnassAc-oFFBimirr.aescTDDtheeeepdpaaHhrrittebmmbeHeinnongtptkwwFiaianresss DppFrireeerpevvaiiDoorteuumspslaelyyrntitinnmwccelalunustddeaeoddlsooconnarerTTmayabboltlveeheid4r fffurooosrremtthhotefehirerrauurissaneeniknooegffdoHHasCCritTTses.FF.-5T50h00e0 ABA-B fHlHooaoapspmkksi.innDBssefFFltoiiartaeemcCCoinihtinafeocfttieinnudddsiietcchdaaettfeeHdrdotrphhaakiaintnihstnhgee.FiddrTeeehppDeaaerrfpttrmmaeerectnmnhtiteeuunflttiailitlzzoseeocsslcaCCrllilfaaayssestshd8BetirAAhuFFasFFehFFeommfdataredadpieeanribbntyygme33fnoMM,ta,mrbbsuui.ttsTithnhaaweltih CtCChllaatlsssstahAABefysffoooraaaasmmmiaaaistnnnddtohtretraauiHisnnoeipindkngigfnoffsor.oatafrmamreinaaihtnavvgllaa. rraTiitoohuu1ess01fliloroe1cc7aactthiiooiAennvfss.;aelwisnt oweaacsSlsaouriiitnfnhicec.odorrTrteehhccaelttlyyHthonnepookttdieeenddpsaooFnnritmrthheeeeDneqqt uputreeaassritntmiisooennwnnntiatahiirree wthaast trheemyotvraeidn fom Table 4 and the ranked sis. at the Hopkins fire hall at 101 17th Avenue South. The Hopkins Fire Department = wThaes EredminoaveFidrefrDoempaTratbmleen4t awnadsthreemroavnekeddfsoitmesT.able 4 since the only foam hey use is HT F- 500The 500 AB. Edina Edina Fire A-B. Edina doesn ize ust one se Department was removed doesn't utilize just one set raining sit. from Table 4 training site, so thedepartmentwas nit ranked since the only foam they use is HCT so the department was not ranked. F- 55..00 GGIISS MMAAPPPPIINNGG OOFF FFOOAAMMTTRRAAIINNIINNGGSSIITTEESS ota Delta ggeenneerraatteedd aa ggeeooggrraasphhiiccaall iinnffoorrmmaattiioonn ssyysstteemm ((GGIISS)) llaayyereoorff tthhee rraannkkeedd rtraaiinniinngg sissites wwhheerree CCllaassss 8B frireeffiigghhttinngg ffooaammss aarree uusseedd rreeppeeaatetdeldy iinn trraaiinniinngg eexxeerrcciisseess,, aass iiddeennttiiffiieedd iinn TTaabbllee 44.. TThhee llaayyeerr wwaass consirucied using coordinates provided for each sation' location during the survey process. The ccooonrsdtiruncatteeds wuesrinegthceonoirndcinoarpteosratperdovnidtedadafotraeaabclhe izing station's inlofcoamtaiotnionducroinmgpiltheed isnuTrvaebyle4praoncedstsh.eTshtee scuomomrdariniaetse.s wTheereutphdeanteindcsotreposruamtemdariniteosaardeatdaistacbulseseudtilfizuinthgerinifonSrmecattiioonn 6.0.compiled in Table 4 and the site summaries. The updated site summaries are discussed fu[ther in Section 6.0. TThhee ddeattaa aatttiribbuuttee ttaabbllee hathat sis iinntteeggrraatteedd wwiithh tthhee GGIISS llaayyeerr nincculuddeess fefire ffooaamm uussee iinnffoorrmmaattiioonn ffoorr eeaacchh training st, including the types and amounts of foam used in training, ihe frequency of foam training and ttrhaeinsinteg isistek,riannckliundginagntdhecrtyepeas and amounts of foam used in training, the frequency of foam training and the site risk ranking and criteria. TThhee GGIISS alayyeerr iis aatttaacchheedd aass AAppppeennddiixxBB aa5s aann eelleeccttroinoinc ffillee oonn aa ccoommppaacctt iscdisc. 60 TRAINING SITE RANKING RESULTS 6.0 TRAINING SITE RANKING RESULTS AAss ddeettaaileedd iinn tthhee JJuunnee 3300t"h RReeppoorrtt, ththe ttraaiinniinngg sessites wwhheerree CCllaassss BB ffiirreeffigighhttiinngg ffooaamm iiss uusseedd iinn ttraaiinniinngg exercises were ranked in order odenyhose wih the highest polenta o create PFC impacts to the sol Groundwater and surace exercises were ranked in groundwater and surface waters. Th ses order to identify waters. The sites were those were ranked according with the highest ranked according to the folowing crea: potential to create PFC to the following criteria: impacts to the soil, + Brand of foam used in vaining Brand of foam used in training AnAnnunauall ffooaamm uussaaggee ffoorr trraaiinniinngg + Prosimiyofnearbysurfacewaters Proximity of nearby surface waters 22223333..00001122 STATE 02826824 STATE_02826824 PADAPFecdFlCddCt.eaa-nCCnPdoaorununotmjtnaaeritTnTioionnNgog. FFi1irr6ee3ffii0gg2hh.ttii0nn6gg1FF0ooaamm and and TeiUse Their Use in in Fesfghting Firefighting Traininign Training in Minnesota Minnesota Delta Project No. 19382-DEL0 Prodmiy of nearbywetlands PPrroowxiimmiityy oof knaerasrtbayrweaestlands + PPrrooxdimmiityy ttoonkeaarrsbtyawreaatser els PPrroouxiimmiityy ttoo WnePaArbSy water wells Proximity to WPAs Paget Page 11 AAnnootthheerr ccoonnssiiddeerraattiioonn wwaass aaddddeedd 1to0 tthhee rraannkkiinngg cre: criteria: hthee proxy proximity ooff tthhee ttraaiinniinngg ssittee tfoo SSWWAAsAs.. TThhee pprrooxsimimitiyttyoo SSWWAAAASs aanndd WWPPAASs wweerree ccoommbbinineedd,, ssootthhaatsstietess llooccaatteedd kh8 with a W WPPAAoorr SSWWAAAAwweerree aassssiiggnneedd aa sSccoorree ooff 55,, essites llooccaatteedd win within 114i 1/4-mile ooff aa WWPPAAoorr SSWWAAAA wweerree aassssiiggnneedd aa ssccoorree ooff 44,, aanndd ssihteess llooccaatteedd bboettwweeeenn l1l44--mmiilee aanndd 11 mmiillee ooff aa WWPPAA oorr SSWWAAAAwweerree aassssiiggnneedd aa sce score ooff22.TTihissaadddtdiitoionnaall rctrieterriioonn cchhaannggeedd tthhee rraannkkiinngg sscoorreeooff tthhee ffoollloowwiinnggfifirreeddeeppaarrttmmeennttss ssiinncceetthhee JJuunnee 0 rreeppoortr:t: 30th + BBuuffifallooLLaakkee:: ttoottaall ssccoorree cchhaannggeedd ffroomm 11331to0 1155,. GaCsasss LLaakkee:: ttooltall ssccoorreeffroom99m1t0o 1133,. + CCllaarreemmoonntt: otoltaalssccoorree ffrroomm11381t0o2233. + DDuunnnneellI-LLaakkee FFrreemmoontn.t: ttoottaall ssccoorree ffrioomm 5510to.69.. HaHmabmubrugrg::tottoatall score score rom1310 from 13 to 15, 15. + Hommony: otalscfroom1r410e16. LiHnawromoodny:Totwontaslrsicpo:retoftraolmsc1o4retofr1o9m. 21 1025. Linwood Township: total score from 21 to 23. + ULtititleeffoorrkk: ttoottaall ssccoorreeffroomm 11991I0o.2233. + MMaannkkaatoto::totottaallssocorree frroomm11991t0o 2211. Maynard: total score rom 71012 MyMtahyn:ardt:otatlostaol rsceorreomfr1om7170to221.2. Myrtle: total score from 17 to 22. + NNeewwiofoilddeenn::ttooltall ssccoorreeffroom 7mto 1710212. + PPiler:z:tottoatallssccoorreeffroomm 11771to0222,. + SSiilvveerrLLaakkee:: ttoottaall ssccoorreeffroomm 11111t0o151,5. + WWaailddoorrft:tototatallssccoorreeffroomm 11111to01166.. + WWaasseeccaa::totottaall ssccoorreeffrroomm 91t0o 113.. + Welcome: totalscfaomr910e14. Welcome: total score from 9 to 14. Deka assigned relative numericalsore oreach crerion ha was meant reflecfh relative importance of ach Delta paasrsiagmneetdera wreilhatirveesnpuemcetroicaisl spcootreentfioarletaochreclreitaesreioPn CthSat w10asthme eeannvtitroonremelinetd athned rtehlaetivseenimsiptolrytanofcethoef eenavcheonpmaeranmtaelterrecweiptthorrse.spect to its potential to release PFCs to the environment and the sensitivity of the environmental receptors. $16..1 SSiitteePProrfoifilleess SSiitee pprrooffileess wweerree pprreeppaarreeddfoforrrraannkkeedd ffirree ddeeppaarrttmmeennttss aanndd sscchhoooollss tthhaatt uussee CCllaassss 8B ffiirreeffigighhttiinngg ffooaamm iinn ttrraaiinniinngg eexxeerrcciisseess., TThhee sstitee pprrooffileess iinncclluuddee tthhee ffoolllloowwiinngg:: stsiete summary summary sheet sheet; 22223333..00001133 STATE02826825 STATE_02826825 AgsanaomTo Addendum To RC Cotaring FiotiingFoamandTsUse in FenigtingTringin Mivesta PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Sota Prom te 163825610 Delta Project No. 19382-DEL0 PT Page 12 + tntooeppaoorggbrryaapwphheiicc lmmcaaatppiossnhhsoobwwiainnggnethheefossiimteethlloeoccMaaltiiOoonnH,, WWneiellnllheeeaaCddouPPnrrtootyteeWccettilioolnnInAAdrreeexaass(C((whWheerprreeogpprrraeemss:eennt)) and and + vel ecardsfo neat wells tained fom the nearby well locations obtained from the MDH's NOH CHI program; on-line County Well Index (CWI) program; + well records for nearby wells obtained from the vnevlelrarodn;maanpd. cblaned fom the US. Fish wetland map obtained from the U.S. Fish & Wile Serves MDH's CWI program; & Wildlife Service's ovine on-line Natnal National Vietands Wetlands + WPCAWhatsin Inventory; and, MyNeighborhmoaopd showing nearby release sites. MPCA What's In My Neighborhood map showing nearby release sites. SteSite pprrooffileessffoorrtthhee fefire ddeeppaarrttmmeennttss aanndd schoo schools sedlisted iinn tethe abetable bbeellooww wweerree iinncclluuddeedd inte in the JJuunnee 36 Report. The sie summaries for these fre departments and schools vere updated to include the GIS30th cRoenproirnt.atTehse asnitdetshuemtmeasripersovfoirmityhe(s0e3 fSireWAdAe.paCrtampeenstsofanihdessochuopodlastewderseieupsduamtmeadritoesinacrloudceitdheedGIiSn AcopoprednindaitxesC.anSdetheprsofitieess pfroorxuimiictyigtoala fSrWe AdaAp. aCrompainetssoaf nthdessechupodoathedaseitespsounmdmedariaefserarteheinJculundeed20i"n RAeppopretnadrixe disincSeuctiosns6s2 aendd6.3. C. Site profiles for municipal fire departments and schools that responded atter the June 30th ++ AAogblerviaelnk Report are discussed Albert Lea in Sections 6.2 ++ and 6.3. HHoopbkion's Hibbing1 ++ PpPioinnreteeRrRviveerr ++ Apple Valley ABpaplbetion Appleton +* Hopkins1 Hhuognolakes Hoyt Lakes ++ pRPProorecershstetetoorsnnter +++ eBBBBBlreaelaaembmcccibkkikiddthhteij1oionooi!fdoe ++ HLsHHLuiiuunmingtwewcootohoioion'nddssoenn ++ Rochester Shertake Silver Lake 551.CCloawrs St. Clair +++ Breckenridge Butanlake Buffalo Lake BBuumes'yie Burnsville +++ Lismore1 Unio Littlefork LMaonektaoto Loretto *+ St. Cloud semi St. Paul TUpseala Tyler ++ cCBClauaayssrcssekb1mLooaknktee + MMMMaaaarynrsnskhahaaratlodll ++ WWWUeopalcscdoaoorlrnaitiaa + CDoCCtuolaimtrtaaeeggmheeoLnGGartkrooevvFeeremont ++ MMMMoiainnnynteneeaaavrpdpdooetloiss ++ WwW Weaaalssldceeooccrmaafe + DunnelI-Lake eEvoannsie EIIsburg Fremont -+ hKMMeyoywrnteRlteeevnidieaong' + Welcome WWiinosnae Winona ++ FFariemyon Evansville Fairmont ++ NNoowhisottenpaul New Richland~ Newfolden2 ++ wOiusApAgipoorrtt Winsted1 Duluth Airport ++ GGFGorleietdndlneveyilneleValey ++ North St. Paul NNootthaonpd' Northland~ + RFMRoioSctcPhheHeAislstirteperPorirAAntieirppooBrrettnd Refinery ++ Golden Valley HHaormdowuirdy' Hamburg + PpNPeaiaocyrytnahenreosRpvaiellpeids ++ MFFMaolairnmrataetHthrhioWlolsninRePRenifnseiehfinaneBlerelryynRdefRineefirnyery + Hamony Hardwick1 Harmony + pen Pelican Rapids Pier~ ++ LSFLaoaokukrlemeSheSCuruoWppnereterinroasrCChCooalollllllgeeRgegeee,f,,inNDDeouruytbluhithn Mankato South Central College, North Mankato e1(1x))ciUUcppidodasat,teeddhefinrofeorormnma,taiti1oonn6iisnnddsiictcaaettseesswetthhreessreeeddmeeoppuaaerrdttmmfeeonnmttssTddooannoob4ttauunlssdee lCalcaas1so8sBoPnPEgsFCoC.rc-crnoatnnatkiaeridniinngg foam foam in ining training i@s)oNeuwpdtaatiedn.ingTshiee exercises, therefore, (2) New training site tllhouoecpcasadettisoosennidteiinsnffOowoWrremImraaettiilroooennpmowwosavarseaspdrhreefircccoeemiivmveaTeddpasbaa,lnendd4wttehaelendaconahtdhreeerrmncacoogolmsmo,pnpgaoenanrneednrnattsnMkooePffdCht.hAee ssiWtiehapptrrosfflileeinwweeMrryee Neighborhood also updated. Neighborhood mapsThe maps ars ncuded in updated CWI are included in Appendix C long withth updated sie topographic maps, wetland maps, Appendix C along with the updated site summary. and MPCA summary. What's In My 22223333..00001144 STATE 02826826 STATE_02826826 sasoncim To Addendum To PECGoring FioFpoamotndiThinUsegin Fafiting Triin Minescgta PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Dela rect No. 16582 OEL0 Delta Project No. 19382-DEL0 Poses Page 13 5M6..22RaRunankkenedd Miuniccipal iFFiirreeDpDeeppaaarrttmmelennttss Training ses associated with 80 municipal ire departments are curently anked cue 0 thei repeated TusraeinoinfgClsaitsessBasfsooacmiatiendrwaiitnhin8g0 emxeurncicsiepsal afiireondeeptaairtnminegntslocaarteonc.urSreonmtley roafnktheed ddeupeartotmtehnetisr rreeppeoartteedd musoereotf hCanlasosneBrfeopaemateindltyr-auinsiendgtreaxneirncgisestse,atanodneeatrcahinoinfgholosceatiiotne.sSwoemree roafntkheed dseeppaarrattmeleyn.tsSrnecpeorttehde umnoere 3th6anReopnoertr,enpienaetemdulnyi-ucispeadldtreapinairntgmesnittes, aBnadbebac,hBoufycthko,sHearsditweisckw.erHeibbrianngk,edHospekpinasra,teLliys.moSrinec,eNethwe. RJiucnhela3n0dt,h RNoerptohrlta,nndi,neanmduWniicnisptaeldd)ewpearrtemreenmtsav(Bedabfbritot,m tBh uycrka,nHkianrgdswbicekc,aHuisbebingw,aHsodpektinesr,miLnisemd otrhea, Nleeyw. 0Richnolatnvda,inNowrithhlaCnlda,ssanBd fWoaimn.steSdi) nwetreherJeumnoeve3d0"frRoemgethre, rhaenkfinoglsowbiengcamuusneiciit pwaalsfdeedteerpmairntemdenthtastwtehreey daonkneodt taranidn awditdhedCltaossTaBdfloa4m. Since the June 30th Report, the following municipal fire departments were ranked ++ aAAAnelbdbxooaarmdnnddeidato Table 4: + KeGGnoooyododvvniieeww ++ PpPyeermthoaamunn ++ ArCBoalreoomxoknakionlyyndnnrFiaCCaleelnsntteerr ++ LLKLaaaeknkneeeysodJtnooahrraoanmnaa + RRPRialaycnnmnddfoaaiullltdh CClleCCoaalqernuabnrreobotnrookoF,kalls + MaLLLpuawlvneeeetmrsnboeeonro ++ RRRRioiicccshhhefmimmeoooldnnuddnt + iCCCvrrloooesqssusrlleaatkkee + NNoMNoeawrwpYileYoitoolrrnakk Mils Mills ++ SWSRoaaobtrsteeeermhlIt-LoLoeuenSnSatauukk + Esian Dilworth Elysian + Norwood-Young Northfield Norwood-Young AAmmeerriiccaa Wolverton Sie profesforthese addtional ranked municipal fire depariments are included in Appendix D. Site profiles for these additional ranked municipal fire departments are included in Appendix D. 63.3RaRnankkeeddTTrraaiinniinnqgSScchhoooollss SSiinnccee tthhee JJuunnee 30" RReeppoorr,t, oonnee aaddddiitoionnaall trraaiinniinngg sscchhoocol,l, tthhee NNoorrtthhllaanndd CCoommmmunuintityy CCoolllleeggee iinn EEaasstt Grand Forks, was30rthanked duefo hei repeateduse of Cass B foams on schoo! grounds. Aotalof ree SGcrhaonodlsForerkpsor,twtarsairnainngkewdihduCelatossth8eirforeapmesataetdthuisre cooflCllgaesscBamfpouasmess,onalsscohoInocllgudroinugndtsh.e ALatoktealSoupf ethrrieoer saclhloeogles in Duldh and report training wthiteh SColuatshs CBenftoraaml sCoaltltehgeeiricnoKlloergteh cMaamnkpautsoe,s,Tahlesosiinecluprdoinfigethoer LthaekeNSourphearniodr `CCoollmemgueniitnyDCuoltuethgeanind Etahset GSroaunthd CFoernktsrails Cncolllaedgeedinin NApoprtehndix E Mankato. The site profile for the Northland Community College in East Grand Forks is included in Appendix E. 21 SURVEY RESPONSES 1c70.o0 nCcOlNuCsLiUSoInOsN.S At7.1 thSeURtiVmEe YofREthSisPOreNpoSrEt,S a foal of 522 of 785 municipal fre epartments have responded to the AFit etfhgehitinmge FoofatmhisUsreepQouret,staiontontaailreo,f e5x2c2kuoifng78t5hemeiugnhitcipuanlsifgirneeddeqpueasrttmioennntasirehsa.veSurrevsepyonofdemdunitocitphael fFiireedfiegphatirntgmeFnotasmacUrosessQthueesSttioatnenafioruen,dehxacltuding the eight unsigned questionnaires. Survey of municipal fire d+epaFritmteetnwtso(aocrro1s0s3%t)hoefStthaeterfeosupnodndtihnagt:munircedeipaprimaenlts do no use refightng foam at al. OCOFfif~ltttyhh-eetAwarrofeeosss(aoppmroossnn1,dd0ii%nwnigg)tohmmfu1utn0hunieciciirppeasaosllpfrofCirnoaeedsiddnseegpp8amfarrouttmnmaieecmnnipsttassl thatfire that uiiize rofghting foam. departments do not use utilize firefighting foam, 243 (or 52%) use only firefighting foam at all. 243 (or 52%) use only + fOCOoflfaasmtthsshe,eAarrfpeoepmamrmaoahxisnii,imnnwaggtiteh22l2y2n577o0urr%seeesdsppoooofnnnCddoilitannsgtgsammBnuunfwoniiacichmiippsCaa.lllasffiisrreBe ddfeeoppaaamrdibmmueetnnuttsssehtChaiatatsusultBifilizzoeeaCmCllaafssorssfrBBe ffrierresefpfioignhhstteiin.ngg + OfmOofufatmtthphseel,emmauopunrpnircdiociiixpfpiaemalrleanfftietrreelylGdo5ece0app%laalrroidtnmmoseefnnnootrttssetrthvaheaianrttywttrriartahiiannCiwwlniaigttshhssGeCBsalsafisosossan.mBB obffrouoataamlums,,iev22eC88%lb%aussoorffsBtthhofeoenaydd.meeppTfaoahrrruttfmsmireeetnnhrtteessrseptrroaiasninnsneoaa.ttt one fepeatedy-used raining locaon 0 multiple or different locations for every one repeatedly-used training location to rank.training rank. session, or at live burns only. Thus there is not 22223333..00001155 STATE 02826827 STATE_02826827 PAAFcdCdd.eaCnnodanuutmnarTTioong FireFfoaimagndhTteiiUnsegin Fesfghting Traiin nMininensogta Delta Projet No. 16302.0610 PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Delta Project No. 19382-DEL0 Page 1 Page 14 + TrTahhneekerrde.emmaTaiwinneiinnntggy-77e99igmmhuutninocifciipptaahlel sffieirreedddeepepaparartrttmmmeenentntstssuttshheaa.tt trpraraieinnsuwwmiiatthbhlCCyllaaussssseB,Boffrooanamamvaaett usseseleleedccttalNlookccbaarttiiaoonnndss wfweoerareem. fortraining, ranked. Twenty-eight for training. of these departments use, presumably use, or have used 3M-brand foam n`OlSnoylyme33scoofhfottohhlees 11g66o ffoiirureleffiiginghfhttoiinhnggettrrcaaoinnmiinmngugrssicclhhyoootoollsseaiinnchtthheefoSSattmaattefsirrterafaiiignnhtooinnng tccoaammloppcuualssdwweipithhartCCmllaeassnssts8Batffoohaaemmi.r. stations, some Some schools stations, some Vain on campus olywith ClAafsoasm, and ane schooldoes go out into the community to teach foam firefighting to local train on campus only with Class A foam, and one school does not train with depadments not train with foam. at their foam. 1.7.22 HHIIGGHHEESSTTRRIISSKKTTRRAAIINNIINNGGSSIITTEESSFFOORRPPFFCCRREELLEEAASSEE. FFoorr tthhee ppuurrppoossee ooff hthiiss rreeppoortr,t, CCllaassss B8fifrlreeffiigghhttiinngg ffooaamm ining training ssikteess llooccaatteedd iinn eennvviirroonnmmeenntatallllyy sseennssiitiivvee aarreeaass ssuucchh aass SSWWAAAAS,s, WWPPAAs aanndd kKaarrsstt aarreeaass aarree pprreessuummeedd t1o0bbee tthhee sissites wwiilthh hthee hhiigghheess:t ppootteenntitiaall oforr PPFFCC iimmppaaccitss 0to ssooillss, ggrroouunnddwwaatteerr aanndd ssuurrffaaccee wwaatteerrs.. IInn aaddddiotino,n, ssiinnccee ffooaammss mmaannuuffaaccttuurreedd bbyy 33MM aarree tthhee oonnllyy CCllaassss BBffooaammss wwiitthhtthhee ppootteennttiiaall 0to bbrreeaakk ddoowwnn oto PPFFOOSS,, tthhee hhiigghheerrrriisskk ssiteesswwhheerree tthhee CCllaassssB ffooaamm uusseedd ffoorr ttraaiinniinngg wwaass mmaannuuffaaccttuurreedd bbyy 33MM aarree hhiigghhliigghhtteedd iinn tthiiss ddiissccuussssiioonn.. TThhee ffoolllolowwiinngg ssiitetss aarree pprreossuummeedd ttoo bbee tthheo ssiitteess wwiitthh tthhee hhiigghheesstt ppaoltoennttiiaall ffoorr PPFFCC iimmppaaccttss ttoo ssoolisls., garroouunnddwwaatteerr aanndd ssuurrffaaccee wwaateterr,, bbaasseedd oonn ttrraaiinniinngg ssiitet llooccaattiioonn aanndd tthhee aammoouunntt aanndd ttyyppee ooff ffooaamm uusseedd iinn trraaiinniinngg:: = M4M0iinmgneaealaplpooonfslsis/o/sSf.t.aPPamauulluIIsnnettedermnaaanttniiouoannlaalllyAAioirpproorrtttr:.ainLLionogcc.aattTeehddeiinnaaairWpWoPrPtAAfraaenndddeaapnnaraatcctmtiievvneektakurasrssettdaarrCeelaaa,,swwsitithBhufuppo(at0om manuiaciured 40 gallons of manufactured by 3M through approximately 2000. foam used annually for training. The by 3M through approximately 2000. airport fire department used Class B foam + aMMpaaprrraaottxhhioomnnaRtReefleiyfinne2er5ryy0,, gSSatLloPPnaasuuollPfPaar0rkka::mLLoouccsaaettdeeddaininnnuaaannllaaycctftiiovvreektkraaarnrsistntgaa.rreeTaahnneeeaMararrthhaeethMMoinissssRiiesssfsiiippnppeiri yRRiivuveserer,,dwwi3iltMhh Class B foams trough approximately 2000. approximately 250 gallons of foam used annually Class B foams through approximately 2000. for training. The Marathon Refinery used 3M F3Fi0nli0nttHgHiiallsslPPilnionefeoBfBnooeansnmddRueRsfeeifdnineaernryny,u, aRRlolosysefeommouoanuitrn.it:ngLL.ooccFaaottaeedmdsiinnmaaanttruraafnnassciittiiuoornnedkkbaaryrsstt3aaMrreewaa,e,rwwieitthhhiasaptpoprprirocoaxxlilimmyaautsteeelldyy in'aining. 300 gallons in training. of foam used annually for training. Foams manufactured by 3M were historically used uDDunuldluuettrhhaInInnttaeecrminavatetiioosnntaaell iAAniivrpeposotrrittg:atiTTohhneefoffroorPrmmFeeCsrsttrruaaniindnieinrnggdillofoecccaatttiiiooonnn oaafltMttshh.ee JDDaunuleluuttMhhosIIennltte,errnMnaaPttCiioAonn.aallWAAhlirppeoorrt3tMii.ss under an active site investigation for PFCs abirpaonrdt fwiotahmfsotalmused In fr response, the brand foam still used in fire response, the Minnesota Air National Guard no fonger trains at the under direction of Ms. Jane Mosel, MPCA. While 3M- Minnesota Air National Guard no longer trains at the Soauirptohrt wCoitnhirfoalamCo.llege, North Mankato: Located in a SWAA and a covered Karst area, wih `approximalcly South Central approximately 50 gallons of varous brands College, North Mankato: 60 gallons of various brands of foam Located of foam usedin a used annualfor SWAA and annually for raining, a covered training. karst area, with + KbKreeannnyydoonnfoFFarimroefoDDreepbpaiarartntmmneuneatnl.t:traLLionoiccnaagt,teedd in in a a SWAAand SWAA and an an active active karst karst area, area, with with current current useof use of 3. 3M- Pbriaonzd FfoiaemDafoprarbti-maonnntualLtoraciantiendg.in aSWAA and less than 1/8 mike west of the Skunk Rive, with current use of 3W-brand Pierz Fire Department: current use of 3M-brand foam for Located foam for b-annual ang. in a SWAA and less bi-annual training. than 1/8 mile west of the Skunk River, with Cl3CaMrlaberremamonondnttfFFoiiarreme DDfereappnaanrrmutmeaneltn:rt:ainLLioonccgaa.tteedd in in a a SWAA SWAA and and a a transion transition karst karst area, area, wih with current current use use of of = sC3CoMoett-ttbaoarfggaeo3ndMGGrfrfooooavvameemFFfiioinrrreetaaDDnionnepiupanaarglrtttmmreaneintn:itn:g.LLooccaatteedd inoradjacent in or adjacent to to a a WPA WPA and and an an active active karst karst area, area, with with Aulseexoafn3dMiafoFaime inDetpraarintimnegn.t: The raining location at the Magellan tank farm is located in a A`aS5SlWeW1xA0AaAAtnhdaaernnibaddraFaanirWWdePoPAfDA.ce, pawwaimilrtshthmppuesrrneeets:dsuumimnTeehtddreaiuuntsisrnaeegi.nooifnf g33MMl-o-bbcxraaatinnoddn foam. The Alexandra Fire Chie was unsure at the Magellan tank farm is located in a foam. The Alexandria Fire Chief was unsure as to the brand of foams used in training. 22223333..00001166 STATE02826828 STATE_02826828 PAAFcdCdd.eaCnnodanuutmnarTTioong FireFfoaimagndhTteiiUnsegin Fesfghting Traiin nMininensogta Delta Projet No. 16302.0610 PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Delta Project No. 19382-DEL0 Pages Page 15 + MfMoyyarlmtfloeorFFtiiarresinDDieepnpagartrtmmeentn.t: Located Located in in a a SWAA and an SWAA and an active karst area, active karst area, with with presumed presumed use use of 3M of 3M HaforammonfoyrFtriarineinDge.partment: Located ina SWAA and an active karst area. = BHeamrmidoinyFiFriereDDepeapratrmtemnetn:t: LTohceatpedoinra tSraWinAiAngalnodcaatnioanctiisveinkaarsWt ParAea.wih surface viaters and wetlands adacent to the aifpot, Bemidji Fire Department. The wetlands adjacent to the airport, wih currant use airport training with current use of foam location is of 3M foam for annual in a WPA for annual taining, with surface training. waters and Fri3FdrMlidefleyoyaFmFiirrueeseDDdeeppianarrrmtameinneitnn.tg: Located Located in in aWPA and a WPA and atransitionocoveredKarstarea, historicuseof a transition or covered karst area, historic use of = cB3BoMrrovoeof0orkkaelyymdnnkauCCrsoseentndttaeeirrnreFFatrisiarr,esinwDDinieetgphp.aaprrtrtmmeesenuntm:te: dBBuoostthhortrfaaiinniin1nggfossiaittemessinaarrteehellorocqcaauttaeerddeiirnnyWVtVPrPaAiAnSsinaag.nndd ether transition either transition of or = BcouvmesrueidlekaFrsitcaDroepaasr,twmoitnht:preLsoucmateedduisneaoWf P3MAfaonadmaipnatrheenirtlqyualrotceartlyedtraininainnga.ctive karst area. + GBouorndsvviilelew FFiirreeDDeeppaarrtimmeenntt:: RGioveordvlioecwateFdireappDreopxairmtamteelnyt: 1L/oLL4cooamccitaaelttdeeedadinwaiianyn.Waa PW WAPPaAAndaannaddppaaannreaanccttltyiivvleeockkaaatrerssdtt area, in an area, wilh active with the Mssissipo: karst area. the Mississippi NoRritvehrSlotcaPteadulaFpiprreoxDiompaarteilmyen1t/4: mLiolecaatweadyi.n a WPA and covered karst area, wilh use of 3M foam used in semkannual raining. North St. Paul Fire Department'. used in semi-annual training. Located in a WPA and covered karst area, with use of 3M foam wPPirrtoehssitntoonn1/4.FFiirree DDeoeppafaartrtWmmPeneAtn,:t:wiTThhheetheffaaSiirogrugrortouhunnBddrssanttrcraahiionnifinntgghssittReeooiisst llRooiccvaaettreeddbeiinnndiaannng aaaccrttoiivvueendkkaatrhrssett naaorrreetaha saainrddde of the within of the fairgrouncs, and with current of use 3M foam. 1/4-mile of a WPA, with the South Branch of the fairgrounds, and with current of use 3M foam. Root River bending around the north side RicwRahitcfehirfe,ielalddndFFiwirrieethDDeheipspatarotrrtmimceaneltnu:t:se LLoofocc3aaMtteefddoaiinnmaain W WbiPP-AaAnnaaunnaldd tccraooivvnieenrrgee.dd Kkaarrsstt aarreeaa wwiithh aaddjjaacceenntt ssuurrffaaccee RowaRcnahontceuehasr,eltstaetrneardriFnwFiiriinrteghe, hDDeiseptpaoarritrctmmaelneutns:te: Located in a of 3M foam in Located in a WPA and active karst hi-annual training. WPA and active karst aarreeaa,, wwiithhuussee ooff 33MM ffooaamm iinn annual training. 7.3 FIREFIGHTING FOAM MANUFACTURER RESPONSE T7.h3e FfiIRreEfiFghIGtiHngTIfNoGamFOmaAnMufaMctAuNrUerFsACarTeUeiRtEheRrRreEluScPtaOntNStEo share information, or do nol have detaed Tdahtea,firreegfiagrhdtiinngg tfoheamPFmCacnounftaecntturoersthaerie feiritehfiegrhtrienglucftoaanmts.toGeshnearrealinefroarmtuartieonp,reosrednotednoitn htaheveJudneeta3ile0d dReaptao,rtreignadridciantgesthtehatPFCClascsonBtefnitreoffigthhteiinrg ffiroeafigmhsticnogntfaoianmPsF. CG-ebnaesreadl lsituerrtaatcutraentsp.reWsheinlteedadindithtoenaJlundeeta3i0lths rReegpaordrtiningdtihcatteyspetsh,atpeCrlcaesnstaBgefisreafigndhtibnrgeafokadmowsncpornotdauinctPsFoCf -PbFasCedcosuulrdfabcetaunstse.dWtoheilevalaudadtietiotnhael rdeeltaatiles preotgeanrtdiianlgftohrevtayrpieosu,s pberracnednstaogfefsoaanmd[b0reraelkedaoswenseplreocdtuPctFsCosf P(0FCthse ceonuvldiobnemeunste,d htoisevdaaltuaatse tnhoet rreelaadtiivley apvoa[ielnabtliael. foFrorvatrhieoupsurbproasnedsoforfafnokaimng tsoleresleaansde rseecleocmtmePnFdCisngtofuthrteheernivnivroesntmigeantit,ont,his idsaatassiusmneodt trheaatdaillyl lavaasilsable.foFaomrsthheapvuerpsoimsieaorfproatnenktiniagl s[it0esrealnedaserecPoFmGSme0ndtinheg efunrvtihoenrmiennvte,stiwgiathionth, eiteixscaesptsiuomneodfthfoaat masll mCaladses Bbyfo3aMm. sAhsavperessiemnitlaerd piontetnhteialJutonere3le0a"seRePpForCts atondthaesesntvairtoendmiennSt,ecwtiitohnth1e.1,exfcreepftgihoininogf ffooaammss. fmoarmdeertbyyma3nMu.faAcstupreredsebynte3dM hinavtheebeJeunnesh3o0wthn Rtoepcoenatlaainndor barsesatkatdeodwnin 1S0 ePcFtioOnS a1n.1d, PFOA. firefighting foams formerly manufactured by 3M have been shown to contain or break down to PFOS and PFOA. 8.0 RECOMMENDATIONS Based on the findiofntghss rescareh p8r.o0jeRcE,CDOetMaMrEoNcDomAmTeIOndNsSthe folowing activites: Based on the findings of this research project, Delta recommends the following activities: 1. 1. ICCnootnnetmtaaacctttioMMnsas.l. JJAaainnpeeorMM.oosOsebelil aooifftnthhieenfMMorPPmCaCtAAiornreeggraeargrddairinndgginttghheetiihrreiirnnvvieenssvtteiigsgtaaittgiioaontniooofnf PPaFnFCdC siimammppalpcitnsagaatcpttrthhotceeedDDuuurleluustt,hh and findings. International and findings. Airport. Obtain information regarding their investigation and sampling procedures, 22223333..00001177 STATE02826829 STATE_02826829 PAAFcdCdd.eanCndoaunutmnarTTioong FireFfoaimagndhTteiiUnsegin Fesfghting Traiin nMininensogta Delta Projet No. 16302.0610 PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Delta Project No. 19382-DEL0 Page 6 Page 16 2. FIFduuenrnttihnieefrrediinnivvneesSstetiicggtaaittoiiononn7.oo2.ff SsFouormmteeheroorrInaavllellstooiffgattthhieeonpporrfeeshsuuemmseeeddsiNhtiieggshh--mrraissykk iffniircrelefufigidgehh,ttiinbngugt ffmooaaamym nttarrataiinbniienngglimssiietteessd 10, he folowing actives: identified in Section 7.2. Further to, the following activities: investigation of these sites may include, but may not be limited SaSmapmlplee publicwater public water systems systems ia in the the associated associated WPA WPA orSWAA. or SWAA. + rSSaccihhneeiddnugulleestaaenn aaapnppdpooiisnnuttmrmoeeunnnttdwwiinithgh ttahhreeeaffirreefoddreepspatarerttmmleeonngtotssgrttoaopcchooynnddauunccdtt ssdirktaeeivnviaissgiietst, tfoosuorofbbcssieearlrvveekattrhhseet tftfreheaaeaitntuueinrrneegvssi,,rsonnitneeemaaerranbbntyydssOuusbrrusffarearccoreevuenwwdataitnhteeegrrsrsaaiaarennnaiddngwwfoeestrtlelaasnniftdodess,,tpooaaptnnoeddgntrooaattplhhheesryroipp,aootngteedrnntotiudiaanrlladiwrrneeaacctgeeeeppr,ttooasrrnssudrloofoifcfriaPPslFuFrCkCfsaarcs1ient twhaeteernsvairmopnlmeelnotc.atOiobnsse.rve the training site for potential soil, groundwater and/or surface + wOsObaabtmttaeapirilnnessappmrfroorpppoleemerrttltoyyhceaaattrcicoaccnieensssi.nssg ffsooerrs.tthhee collection collection of of Sol, soil, groundwater groundwater andor and/or surface surface water water + sOabtmapinlessoiflr,omgrtohuentdrwaaintienrg asnitdelso.r surface water samples for laboratory analyss of PFOS, PFOA, Obtain PFOA, andsoil, and any ofhor PFCs of concern 0 groundwater and/or surface any other PFCs of concern to the MPCA water samples the MPCA. for laboratory analysis of PFOS, 3. AAfnonaaalmlyyzzdeeisaacnnhddarccgooemmdppaaartreetsshaaemmptprllaeeinrrienesguslstssewwsiilthhanrredessppteehccett t1to0ypttheees ttyoyfppeeassn,,abblyrrataennsddssdaaentneddcetesestdtiimmaaanttededdtaahmemooauunnnatlssytooeff concentrations. foam discharged concentrations. at the training sites and the types of analytes detected and the analyte 4. AAnnaallyyzzee aannddccoommppaarree ssaammppllee rreessuullttss wwiitlh hhiissttoorriicc PPFFCC ssaammpplliinngg ccoonndduucctieddbbyytthhee SSttaattee.. 5. `CCgrrreeoaauttneedwaGGtIIeSSr allanadyyleeorrrss soouffrfaaancnaealylwytatiilcceaarll wrrieetshsuurlltesssp1teo0ctggorraapSphWhiiAccaRallSllyy, ddWiiPssppAllasayyanPPdEFCoCtheccroonneccceeonlntotrgraaitctiiaoolnnrsseceiinnpiossroosli.l,, gTTaerhhroeeiualnGGdIcIwSoSvaemmteraarappgaenlladgaya/yopeersrr,sssuclcrocofau.ucllded be used 10 Kenly analyte concentration trends, recepiors at isk, water with respect to SWAAs, WPAs and other ecological receptors. be used to identify analyte concentration trends, receptors at risk, 6. cCaCioeosnrncisashiliaddcreeogrrveediirdeaienngntertiiefcgiscaaaptptiosioon,nnset1coo0.ff.3ffirleeargsseiteefissre. wwChhieearrsees ss8fiiggonniaiffimiccaainntnt tqqeuunaadnneitidttieefssoroouffseCClolaansssschBBemiffocoaaalmmopehhtaavvreeolbbeeeueenmn dfrfiierirsepecsos.rh.taTTrahghniessdaiinninnnffouorraremmlsaaptutoiisonoannsgeemmtaoaoyyfa mbblaeeorrgooeebblttfaaihriienan.needCd2l5abbsyygsaccloBolnnolftonaasaccimtoiinfniggsClitinhahteseesniedgiBgehhdtftofrfoairremeudadsneeenppuoaaanlrrltmycm:heeenntmlthssiecaooBrlruossmrccshhpaooeiootlrlleossleFthuhiamaelt DirDneeepppRoaaorrtsrttemmameneonnutant,,ntnht,hueeatlRRhuieicschaMhmgamerooannotddfhFoFminirroeerPeDDeettephrpaaoarnlrtetmm2ue5menntgRt,,aeflttlhiohenneesWWryioinnficonCnnlaaSatsFFsiirrPeeBauDDflaoepapPamaarrtrktmam,ennenttnuh.tae, lttlyhMh:ieentnFhFeeilaintptBolHiuilmislls-ssSvlRRi.ellefefiiPnnFaeeiurrreyly IFiInnonrttekeRsrmn.oaastetTiihomoinnosaaullinnAAtf,riorpprtohmoraer,tt,iMottnhhaeermaaDtDhuyuollnuuattlhhsPoeIInantrtvtoeealrmeinaauatbmtiliooennRaableyl fAAiiniinrerptproeyorrtrv,tii,neawaSinnntdd.g ttPphheaeeruslNNoonoPrnrtatehhrlklla,aannttddhtehCCeooMlSlllieanegtgneeeeaiF1pniEorEelaisasM-sSattrt.GGsrhrPaaaannluddsl AooFsffoffsiirockcceesi,,.atTtthihhoeeins,MMintifihnnoennrmeeMssaoiotlmitoaaensSSomtttaaaattyeeSatlFFsaiiotrteeeavVCCaohhliiluaieenbfftslseeeAAbrsyssFsoiioncrciteeaifairivtlgiioohentnwe,,rinsttghhAeespseMoMrcisiionnannnteneosesnolo,ttaaatanthSSdteltaaottSreetatthFFeieirreFemiurDneDieecMppiaaaprrartstlmmheaefnlrn'stet `Adldoescepsaptoaaecrrdtit.mamteeionnnttss, where major blk storage facies wth Capaciies of one milion galons of more the Minnesota State Volunteer Firefighters Association, and/or the municipal where major bulk storage facilities with capacities of one million gallons or more arefire are located. 22223333..00001188 STATE02826830 STATE_02826830 Aasoncum To Addendum To PEC GoringFiopting FoamondThiUse in Fafiting Triin Minescgta PFC-Containing Firefighting Foam and Their Use in Firefighting Training in Minnesota Geta Proac a. 16362 0ELO Delta Project No. 19382-DEL0 Page 7 Page 17 2R90.0EMREAMRARKKSS The recommendations contained in tis report represent Dela professional opinions based upon the Tcuhreenrtelcyomavmaeianbdlaetioinnsforcmoanttiaoinnedandin athries arempvoerdt reatprienseanctcoDredlatan'csepwroifhessciuornrael notpinaicocnesptbeadsepdrofuepsosniotnhael sctuarnredanrtdlys,avTahiilasblreepoinrftormabtaiosnedanudpoanreaaSrprievceidficat5cin0paeccoofrdwaonrckerewqituhesctuerdrebnytlythaecccleipentte,d Tphreofecsosntiornacatl between Defta and its standards. This report between Delta and its cient ouines the is based upon a client outlines the scope of work, specific scope scope of work, and oly those tasks specifically of work requested by the client. and only those tasks specifically authorized by. The contract authorized by hat contract or outined in hs report were performed. Tis reports intended only or the use of Delta's tlhoanttcoanntdraacnt yoornooutclilnsedspinecthficsarleypoKret nwteered in wing by Data as performed. This reportaisusinotrenodfetdisonrelyporfot.r tDheetusweilofnDotelatan'ds ccaliennnottanbdealniyaoblneefeorlseunsapuetchiofirciazlelyd rliance identified ibnywarintiyngotbhyerDetlthaiaspaaru.seOrtohfetrhisthraenpoarst. cDoenlttaaiwnielldniont athnids pcaarnangortapbhe, Deka liable mfoarkeusnanuotheoxroizreesds roerliaimnpcleiedbywaarnayntoyth3er othtihrde cpoanrttye.ntOsothfetristharnepoarst contained in this paragraph, Delta makes no express or implied warranty as to the contents of this report. Nancy Rod7ing Project Geologist RReevviieewweedd bbyy:: ~ gE & / JTPorohijnecnEtsMteeasnager Project Manager DDaattee:: OOccttoobbeerr 2222,22000088 DDaattee:: OOctcotobbeerr2222., 22000088. 22223333..00001199 STATE 02826831 STATE_02826831 TTaabbllee 11 TTaabbllee 22 TTaabbllee 33 TTaabbllee 44 TTaabbllee 55 TTaabbllee 66 TTaabbllee 77 TTAABBLLEESS UU..SS.. MMaannuufafaccttuurreerrss ooff FFiirreeffiigghhttiinngg FFooaammss ((NNoo CChhaannggee ffrroomm JJuunnee 3300t"~ RReeppoortrt)) MMuunniciciippaall FFiirree DDeeppaarrttmmeenntt QQuueestsitioonnnnaaiirree RReessppoonnsseess MMuunniciciippaall FFiirree DDeeppaarrttmmeenntt wwiitthh NNoo FFiirreeffiigghhttiinngg FFooaamm UUssee MMuunniciciippaall FFiirree DDeeppaarrttmmeennttss TThhaatt TTrraaiinn WWiitthh CCllaassss BB FFooaammss QQuueessttiioonnnnaaiirree RReessppoonnsseess ffrroomm AAiirrppoorrtt aanndd RReeffiinneerryy FFiirree DDeeppaarrttmmeennttss aanndd TTrraaiinniinngg SScchhoooollss TTrraaiinniinngg SSiitteess wwiitthh 33MM FFooaamm UUssee MMuunniciciippaall FFiirree DDeeppaarrttmmeennttss LLooccaatteedd WWiitthhiinn SSoouurrccee WWaatteerr AAsssseessssmmeenntt AArreeaass 22223333..00002200 STATE02826832 STATE_02826832 4 ; 4 fi s i k m Le g fi 3 iHE TEE 8 IEEE fT] riiit: k :1 i FI E 3 E keestzece i fi: RE p E ffiioled Hanan Hi E 1sy i fiHlall i 22223333..00002211 sare 2826833 STATE_02826833 I Hl i gio c 5| f ay l iE Fiil | oe~oo gle HEahaiHAeld |i i!t HE i i 22223333..00002222 i state 0286834 STATE_02826834 S LTy -- H[1=]14 -- =3 {EE i iin| 1 I] EE h -- wid {dl dai JU LEE NM==Eitiss==== ih = Din, i Ps EE ETE = Il EEx = a LTH Ld EEENInEne 22232333..00002233 STATE_02826835 somes = ==----------" [whidill Loa]aH) IE Hi ERi IT TTTJe CE i J =H Ee a= iPL hLiTeH i ar er | = = = i 1 C TH a EH BE 2233.0024 STATE_0282 ~8~6 un = ] [we] -- H [wdfn | [1] H LE i min {00 H1 o18H eHlS [--u"w HiEeEi L TEE e EEEEE Hil = EIESEIEIE p iPL BAT | la eH Me i = =i Lh le TTT 22232333..00002255 STATE_02826837 ses T Hage in|TT| i| HHl--3 lH i HTH faa A iLisf t| 1 i Ea L aid 3 aad hd il I (|e | JM] Ta (EE 1] = HEE a= i IA Ea N= == = T= SEEEE ines lHHn a 22223333..00002266 STATE_02826838 Ig 1 fd IE i 41 (10 i pH LR i == eee BE 1] Es PEE ! === PL Ld di = == TE EERE REE LA W Ld die Clb dd Lh 22223333..00002277 FR -- STATE_02826839 a [ 1 ese [| | [wid] IE i [4 EE Bi 4d J 1440040 id i mht 1 1 i : i] 1 E gtH CH HE E 2.2110 (B= = i J Esher i RH FHT] = PL ThE ae = x =x i Ch LL LC 2233.0028 STATE_02826840 hi in|| : ill | ii Hl | 0 Hl [TR i iin| i ! {1 1 i Is RIy E fi [1 IC1L 1IRE mH Hf -- LE 1] =EREE EE Hil = 15S HE iSHIEH ! REEL HI HE fo HEL ey = = T= teenies LW HT IR IEE dE 22232333..00002299 STATE_02826841 sess a iin TTHd THTTE : ihliw {b:| h EE HE iid 113 1 CE i | [5% } ile| = Be = FL bili|S = 1 = WH IETEREERE ELIE EE La 2233.0030 STATE_02826842 eT = HITTAR [ CL{ | EiE i {| 1H LH isatn{1g1) P10 ALEL i 0Hd L U E R E RE Que i PEEL iPL H AH EL A = he == = = IFERERE EIREERECMRI ddl I nn 22232333..00003311 STATE_02826843 sess | v gaa n [J]14S 13] [1E| my ll i Fl 2 HEdER 1NIAE ad{if a Had 4d id 1 (Eee iJ EERE = iPL JlHit T= = = re dh CHEE LE 2233.0032 STATE_02826844 == [ ------ TT LTTE I" [ m i T wT ha iT iH dl | n1 H| aE ( mEe L Ii e e PiL d vt e Er TEma|k] = ae = i Lee cn Land Hl 2233.0033 STATE_02826845 [meee = TEE - miahw {1 1), [ Fa o E Bo eiEnl {ETy 14100E Hnali Bm BE=R EieL =01h iE; PL JHE (ede j= = = = a{H TEH IEE IRE 2233.0034 STATE_02826846 iis ] Eig THE | sll i ! ii | LH TR el i IEE it iE hdl =hh i TT PL Eis Windbell = ah -- 0 Lan hd lla ITIVE 22232333..00003355 STATE_02826847 semen | Ca] = : Hpi ||| i op -- Hl IE EE i =| E aged {0 | EH Ei Bidid-d 4 iid Bi di IL TES Ee R e = as i = LEE = Th e N= = z a i a0 22223333..00003366 STATE_02826848 Tn] -- 3 7 Ei pin E 4 ; iii ||| [ | H l fiyay |] Wi getli H H H; H1 : EE 1] Ee EHey a= i Fe HR HE |--" N= == =" a -- nIn TI La dH 22223333..00003377 STATE_02826849 -- Iii : iilil 110 = H1EH |` =i Tiki j ml 11 HHael ei i E EE e =tie il =i i Sa aA ETE fBlb d a ei [S== ESEEEE es =| --_-- WAH LH CL 22223333..000038 STATE_02826850 Se-- = LT 4 B! ii] ill |E i UHHH als Ee EEE El IEUT = 1 = s===sinissmane IEE EEEEE RE! ha IEEE 2233.0039 STATE_02826851 "EEE NE a em p37 [wifi | LL T4T--4 {3 (44 [= Eh{4/44 [= I7% TEIE [41 1 [I -- iH iT [is 1 [11 1 (= a= i J Fr IRE i ERE LL Le = [==SEEsE=t = i EowRHN H E an 22223333..00004400 STATE_02826852 Shs iin ] ii 1 --lh | HH HE | hi | Ll LIE LTT Tl EE Le > LIEes=a a= as i =e | i = = a = Ne Jr g -- Lh 22223333..00004411 oo SSTTAATTEE_0_202882266885533 iin HH HH in [1 {1 y | Wh [10] LA] i a [EM A) maCE wf ig t CHE+ 1E|Ls fT e ie e as i Pet Loi LRdei Ei] hl =r E == E = O nnn n LW HAL 2233.0042 STATE_02826854 = FI [wdil [14 ow TER EERE A ipdin] WEEEE E1 yo |i ]i C EE OEE i J Ee He = Pp J le ~._>~ = = = a a z aH TH a i IEEE 2233.0043 STATE_02826855 ---- -- fas| [1 : [1 iy | | = [1 i iin [fH uit 1 EH OE ti id LE HHEiSl =I=EEES E= ES=E S:p !fSh EE nLiLle ih =1 =r = == WdTa dl odddl fd Co Hd i. rare cases STATE_02826856 2233.0044 = | HHT E | [1 iE i :i || Se E || LHR] WE (Le i J Es EEE i bl TET La e ll n =] BF W HH I H 1 TT 2233.0045 STATE_02826857 TT | Lo fe -- =4 TT EE IE i mi d ]4) 0L]. | H itde ig{| ] fHE i i mie mm L mes e a ih = i Es EA fH de lil = 1 [== iSEsS = BES wd 1 IEEE Cl HEIa 2233.0046 STATE_02826858 Cl, | ld | 1 Fn mi fa HE di[ITT L = Ee e e-- als i ee ENE =1 [EB=tSEsiEEs = Bs ----z -- hh HH CE Co ad 22223333..00004477 STATE_02826859 --li | epr in[| ih [4 i faiirn|]i wit 1H E | L--HHT = 4H A a i]E TH HE A EE 1] == a= i BER ony EE N= oe =o Tr z -- S1 T La 22232333..00004488 STATE_0282 ~860 ses -- TY = SIT fiiiE | ||| EE i ii flag ad WL) 1 Ba ge Li H =e ITAL (EE 1] Eos HH EEE EH P { PE EELE LLL LL A RE = = fn = T= SiEEERSEEEIEEE Lh A lll CE -- STATE_02826861 22223333..00004499 ! WL yg) 0 Elx 1] Hi I = = E I i EEE EE = iC E E == i S = a Lid alti 22232333..00005500 ; STATE_02826862 STATE enna &a 83 HEP> t Bs P355E 558 E EE5: E | f ai3EReaEasiis8fcifiiissgisrt og}g o22gE g8||2z 52 z z: 3i: Eassi |iEf3 32 i5: 5i 5: REEGEO82 | f[|= 5sE3.E s,EpgEiBi igsgsfsisiriiE.ciaizs&:ir5 g:l 2g5 HE `O_ E|:if 85:8835:3842 Bo: is i: F& EE|] i8 iI:t =2 <2 32 2BBole ofi[f8s14oiEnseiti.n..easLsF3 Roa GiiDf 223533538055388 8 B32 22223333..00005511 stare ozs26s63 STATE_02826863 [ [dwaawC f = [TC FEA HTE O TRR EAE T de EE daTT C md{ 7 T EGE H I EIN E EE EE [I [mdPE |EE _ E er g a e o a p |P | = E EIEEE EEE h EEE ni eae ! 1 i p= EHH HH = S====== LETTE [77 ain i TFTESAT In L CL d E HEH 22223333..00005522 -- STATE_02826864 NN [=Ir 11 E CIH J | EE wmJ11 [HH [HEH a {HEY mmm {TH [ mm T m =ra d[[C T {1 d 00040 OHi e Ld JTL ECLl Tn Td LE y|PRIM= = ES EEA Plies ee i VE] | io 1 A a149i oHilli y ee" =a -- I = WHT a AUT [re CITI 22223333..00005533 p-- STATE_02826865 [eH yE H E [fH]H [we {Hs H] [HE| a THE [EH gw HEH EO men | d {HEC iad IT hd [if TH (IT I EE EEay ml Lana Lo ena) | = EEE i2 f e EE e HH FHF HH Hl Ii BEE EE Fg iB HIE i i -- = e -- i l LH EE TTT fe CL HN CHEE JIT stareo2szeses STATE_02826866 22223333..00005544 [rT TTT mH HHH TTR EEEE ER EEE EEE fa HEH mdTHE HH men [IHd {THT iadTH AH LgTW[HY J = L ==00 i | =e bh Ei AWIeR I-- L i ii ! ' Pd uy ee eH = | CEE Tin TT TA fn rr on 2233.0055 Jp-- STATE_02826867 [= TITI FEE HT 3 [d w ge {IHHAETH0 d moe Tn Ho E ha TT HAT EEE LTHE i LgLLY CH Ll LRT LCM EER a ea n |=EiiERE HERE HIE] iJ RE E ES e EFH H H i e h ( Be ne) i TRE le ; i ee To i -- fi-- P e--= r - = 0 -- LRH] I 811TA rr TThrm Arar EIT I 22223333..00005566 raeoases STATE_02826868 [=r Td 1 #7 [dmg [LTJ | il M1 i md CT TYTNTT NE IE EEIE| EE L " led Hi l E il ine ine Th DOH |_E_Eha ge-- ey llE s -- T ---- -- GRlE -- = -- nO f --,t |ld _----f i 0 11 --i I-- -- { = = R T oe H T II EIR 22223333..00005577 STATE_02826869 | [=1 [I HAT Bd 0H i --8 TEE TT Hi i wand| HE 0 ia] [HEE] [id 11 Ei Ea L a t EEm TIE EHEHHH] }$I = E Hl E h ld EE i i i i ER fll Jed | =r WE Eh | [ee | TT 3 = WE TTTTFT i TTT AEH LTT TRiI IH CH 1 Lf 4 TIT gf fakd 1 40:8 22223333..00005588 i STATE_02826870 ~ SE [fa [atin {ulldl |) [J [] -- id (1 111 H C1 ha EL HITE IE [IE fd [mt]of2 ei1 LT HE] ba Ee sd 11 [1 Ee = ILE PH a Vm eT {LURE ml TTA |---- HT I= =r Ere ee =i BE tr tH CHRa Al dl | WE | DOERCERTE OTH 1] 22223333..00005599 STATE_02826871 Mm [li (40 1 7 ltd 7 TT EH [mig {40{1 [wt]11 TT l= Eee = = fT] == | es ===--1 1 rem TI] [| 1] a TT |}i EE E FE IT fOo BHF | eraeriaeaeae == sD 1 ] |i fe = = m=eee ii| Fr i i fh p pi h ti 22223333..00006600 i i stareo2szes72 STATE_02826872 --_-- ann sr ne TABLE 6 TRAINING SITES WITH 3M FOAM USE em October 15, 2008 SITE RANKING CRITERIA T WPA/SWA : site in WPA Annual Class B Surface Water Wetlands Water Wells and/or Foam Usage in Nearby: Nearby: Karst Area: Nearby: SWA=5; Foam Type: Training: within 114 within 1/4 Active=5; within 1/4 within 114 3M current or 5 gal or less=2; mile=3; within mile=3; within Transition=4; mile=3; within mile=4; within Dep~rtment Pee beeTsTeToTTTTTo Marathon Refinery' ES den Flint Hills Pine Bend ~'raining Location Refinery fire training irounds, St. Paul Park Refinery fire training former use in training=8 6 to 10 gal=4; >'10 gal=6 (250 gsls) 1 mile=l; No=0 1 mile=l; No=0 Covered=2; No=0 1 mile=l ; No=0 1 mile=2; No=0 3O Refiqery irounds, Rosemount 6 (300 8ala) 23 6 (No foam used in MN Air National Guard Duluthlnternational training uptc 100 1481h ~irpo~~) 8 gals for response) 3 3 0 3 0 23(b) 1920 Lee Bird, Norlh am ToTo T m TToo [I] Sou:h Central College Mankato 8(~) 6 (up to 60 gals) 1 1 2 1 5 24 Metropolitan Airports Commission at =a [len Minneapolis/St Paul International Airport 8 6 (up to 40 gala) 3 3 5 3 5 33 Former Wrenahall Er eeTe [To Refiqeiy -lighway 1, Wrenshall 6 3 3 0 3 2 25() 205 3rd Avenue SE, =r Hutchinson -lutchinson 8 4 3 1 0 3 5 22 klatch St Paul Public Atorks building, 2303 1st North St. Paul Btreet N. 6 (up to 20 8als) 28 oe mmm] l[ a TL Fairmont be eee oeTemeeTo To TT] Marshall e Le bese e Loe Lo 1] St Clair City shop park lot 417 E. Margaret St, Fairmcnt 8 6 (up to 20 gals) 3 3 0 1 0 21 Marshall Merit Center, 1001 W Erie Rd 8(a) 6 (up to 20 gals) 3 3 0 1 0 21 City of St Clair 8(~) 6 (up to 20 8als) 3 1 2 3 0 23 e lTeeen e TTT Bemidii Bemidii Municipal Ai-port 8 4 (5 to 10 rials) 3 3 0 3 5 26 Tank farm on south edge Clearbrook town. 8(a) 4 (5 to 10 gals) 3 3 0 3 2 23 eA Behind fire station, 22870 Linwood Twp Typo Creek Dr, Stacy 8 4 (5to 10 gals) 3 3 0 3 2 23 1683 Energy Park Dr., St. St Paul Paul 8 4 (5to 10 8sis) 1 1 5 3 0 22 Xlear parMng entrance at meen Perham Mankato 3rairie Winds Middle Bchool 8(~) 4 (5to 10 gals) 1 1 0 3 5 22 --irc Sta. #1,300 Madison ~,ve., Mankato 4 (5to 10 gals) 1 0 6 1 2 21 qorth Metro Fire Training Center, 300 71st Ave. Fridle~/ --ridley 2 (5 gals or less) 28 --illmore County --alrgrounds Fillmore St. Preston ~, Cty. Hwy. 12, Preston 2 (5 8als or less) 28 --ire Station 2 8641 B0th bee pre]Len[TL Cottage Grova SL. S., Cottage Grove 8 2 (5 gals or less) 8 3 5 1 5 27 Ken'on --ire station, 714 2nd St 8 2 (5 8als or less) 3 1 5 3 5 27 EF heen oT Rocqester 2021 41st St NW, Rochester 8 2 (5 gala or less) 1 1 5 3 5 25 City street shop, 1710 fe mTLe TLTTTL Northfield Riverview Drive. 8 2 (5 ~als or less) 3 3 5 3 1 25 -rant of fire hall, Front 11111 Claremont Bt., Claremont 8 2 (5 8als or less) 1 0 4 3 5 23 Various, including VoTech, Magellan tank Alexandria arm, live burns. 8(=) 2 (5 gals or less) 22 My~le Myrtle ball field, Myrile 8(~) 2 (5 gals or less) 22 Page 1 of 2 22223333..00006611 ste aaszears STATE_02826873 _-- ost one TABLE 6 TRAINING SITES WITH 3M FOAM USE enn] October 15, 2008 SITE RANKING CRITERIA WPA/SWA : site in WPA Annual Class B Surface Water Wetlands Water Wells and/or Foam Usage in Nearby: Nearby: Karst Area: Nearby: SWA=5; Foam Type: Training: within 1/4 within 1/4 Active=5; within 1/4 within 1/4 3M current or 5 gal or less=2; mile=3; within mile=3; within Transition=4; mile=3; within mile=4; within Department EE I T Pierz heowee Pfmeme |[vTfeomme o [LT o[0T [LL Crosslake ~'raining Location ntersection of 25 and 27, ~ierz Joint City/Count~ maintenance facility, 13870 Whipple. 25 37th Ave NE former use in training=8 6 to 10 gel=4; >'10 ~lal=6 2 (5 gels or less) 2 [5 gels or less) 1 mile=l; No=0 3 1 mile=l; No=0 3 Covered=2; No=0 1 mile=l ; No=0 0 3 1 mile=2; No=0 22 2 21 Minneapolis ~inneapolis 8 2 (5 gals or less) 3 1 4 1 0 19 [Ro -- se Droor osrao monot eny [oToomonennT01 5 15 0 Rosemount 14700 Shannon Pkwy 8 2 (5 gels or less) 1 1 2 3 2 19 ee 259 Medina St N, reSESEeereee ea Loretto _oretio 8 2 (5 gels or less) 1 1 0 1 5 18 Lake Superior College 11501 Hwy. 23, Duluth 8 2 (5 ~als or less) 3 3 0 1 0 17 ree Littlefork --ire hall, McPhersor & 3rd Av 8(a) 2 (5 gals or less) 3 3 0 3 4 23 --ire station, 103 Canton, a EA EE I, Mcntevideo ~ontevideo 2 (5 ~als or less) 3 3 0 1 0 17 315 N. Main St., at Main ~ Church Sts., Duffalo Buffalo Lake _eke 2 (5 ~lals or less) 15 Wart erty ed me, Cyi oeApres S443Stn al a 0 ES Notes: (a) Foam type or training use not specified, 3M foam use for training assumed (b) 3M foam not currently used in training, but currently used in fire response Site ranked based on use of foam in fire response (c) Ranking assumes maximal use of 3M foam in trainin~c exercises _--DELTA Page 2 of 2 22223333..00006622 p-- STATE_02826874 A CAE Hr Hh tb MR He [shmaa ih k e] |MEER bem abe ih db A Lt lie hin lt J|| sainbs ee cE 0) 00 1000 ORR) DARN 010 OY 000 | bl (|(SMpEa Eias niaai a baieR e E kese | HE op TT SEAT ea gy LIT TC Cee g(a aa RA LL ATLLTLL TC TOL TOTTI ECAC HAT TH Te Tr) edmt de JI | Hem reec E g iTRe al AP 0 ch S| i BO AR AOm ee HL BE BH LEE Palle ski testAe st UE LE ( [Hepp T ER R p TTE REE 22223333..00006633 ERp-- STATE_02826875 FA O CARE ii A i a k CHEE LR EE [er REE e cs : B Sil n ea Ill] | Ln I I |Jbm aat p op= pn mm hh a EE g [|aLAT 0 RTLL OL TLL PEa gyLIT C CACE Cer a ET TE TOC TEE TCT TH oe Te) 3(| fb mediimng amo sedan bai aid 4 vl] ' BE || E000 OA LCAOOY AO0 FE re ET (LT R a EmE R eh ||BAEEsE ean ES lbalan Ca I Eri 22223333..00006644 soe aszewe STATE_02826876 en ICA Hr | Hp E hE a J|| adiana f 1 VLR hE, TT) {| [ tTt aunb IM A (|T dH me b BeE weR i Gia |EA To {gy LITT TT ate LTT TAT TRE iii (IR Te |p [e II TH 10 Saini THEE IC ME E ET CI 22223333..00006655 3 sare casas STATE_02826877 AAPPPPEENNDDIIXX AA QQuueessttiioonnnnaaiirreess RReecceeiivveedd PPoosstt--JJuunnee 3300t"h RReeppoorrtt 22223333..00006666 STATE 02626876 STATE_02826878 rd QUESTIONNAIRE 1" FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 5. What tes) and rants) of foam aarwoer use now an he pst by re Deparment, th for re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tespone ad n rand fea) Pease check a 1a 390. response and in training (if applicable)? Please check all that apply. ZTTyyppeeooffFFooaamm BBrraanndd ooff FFooaamm Usedin Used in Taming? Training? YYeessoorrNNoo. Amount Amount Used Used AnAnnunaulalllyy CuromtUseor Current Use or HHiissttoorriicc UUssee?? CCllaassss BBAAqquueeoouuss FFiilmm-FFoorrmmiinngg FFooaamm ((AAFFFFFF)) Class 5Acanol Class B AlcoholRosson (RyAe Resistant (AR)-AFFF ClssBPoOn Class B Protein Class 8Fuoropetein Class B Fluo,roprotein = (FP) Gass 8Fim Foming Class B Film-Forming Faroproton (FHF) ---------- -------- ---------- Fluoroprotein (FFFP) CosseARFERP Class B AR-FFFP Class AB HI Class A-B Hi Srsonfoom | of 15 ---------- Class A Expansion Foam Class A Trang Foam - Training Foam omer - Other A USL, fe Sih-e~~ y Be Me ys 0 Thai you or your me and cooperation. Ploase contact Nancy Ringa Dea Constant (551-697-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 of ning@dalaany com)o 4m Slocknge ithe Minnesota Poon Convol Aan (651-207-36o60f or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or Jjiimm.sstioocckkiinnggeerr@@staattee..mmnn.uuss)) iiff yyoouu hhaavvee aannyy qquueessttiioonnss rreeggaarrddiinngg tthhiiss qquueesstitioonnnnaiariree.. Please atu this questionnaireto Dott Consplants by: Ms. 2008 in the enclosed stomped, sat Please return tl~;~ questionnaire to Delta Consultants b~" ,~,~,ay 9, 2008 ;- ~'e enclosed aaddddrreesssseeddeennvveellooppee.. Questomnaie compltod by Questionnaire completed by: Famhe ndyTi TRemeAl TRAMUNG OFHCER. Name and Title Fe Department Al KORN Fire Department Re DEPAGT MENT Pcronhe eNumrber 28 USI Phone Number EDaBtOAdRdaNsFs IRE AL-Cown E-M~il Address TRAsvunks OFFDaIteeck. 218-3Y5~6358 Date op Busy B0122 & Sumo. Lora b2-06 XXilnnoogg~eAn''_ ............. hone: 651.639.904 800.1417Fo7k: B91 635.9473 dmeawnliaenu.sam Phone: 5910 Rice Creek Parkway 651.639.9449 / 800.477.7411 Fax: EETE Suite 100 St. 651.639.9473 SSECTE Paul, HN 55126 USA www.tleltaenv.~:ore 22223333..00006677 STATE 02626879 STATE_02826879 . FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Frafiing Firefighting, Foam Use in 5 1. Does your Doparmen cameo has you Deparment rls ls Ar les 8 ooms Does your Department currently or has your Department historically used Class A or Class B foams for protien) firefighting operations? Ee tems? ./~ Yes - Proceed to Question 2 ri Sitnrtearohnobeatrosm __ No - Sign the back of this form and return to Delta Consultants 1. HT SARA) 2. How often is Class B or Class A foam used in response to fire calls? _ ommmes X_ssmette __ rsiovorius __ 0-25% of fires X 25-50% of fires __ 75-100% of fires 5 DrnstoDust SAAS 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? XnosYes 4. HoT 4. How often is foam used in training exercises? pn vont auoy __ Weekly __ Monthly somnaay XX Amway seaman __ Semi-Annually .X" Annually A - __ Other (please specify): __ Quarterly __ Bi-Annually 5. Worms? How much foam is used per training event? Bo stesso son stot0galors ~ Less than 5 gallons __ 5 gallons or van 0 guns mse pec __ More than 10 gallons (please specify): __ 5 to 10 gallons 5. IsaSO In training, where does the spent foam go? tor onstosote _Xcrams __ Storm Sewer __ Sanitary Sewer rReeeee enero __ Other (please describe): __ On-Site Septic /~' Ground EE Where does/did the training take place? Please include address, intersection or other specific location ann information for current and past training areas. and School 7427) Seullle. Po Shlninns MIN SE - ""w e"Toso i Fre 1 Dteamlolsteen2b7i0oH n /T plow Oly sxoe2-- Sinogen ~Ino~en" rE 5910 Rice Creek Parkway Phone: 651.639,9449 / 800.477.7411 Fax: TTT Suite 100 St. 651,639.9473 Paul, HN 55126 USA www.deltaenv.~:em 22223333..00006688 stare 02826880 STATE_02826880 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 8. hat pes) an brancof(fosa)m ar owere used now and nthe pst by i Deparment, both fo fre 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire tesponse and in raping ( aptcaDRY?Fleass chuck of nl 9p response and in training (if applicable)? Please check all that apply. TUosnoidnign? AmUoseudnt Curent Historically TyTyppeeooffFFooaamm [oy -- . , FimForming Foam Class B Aqueous Film-Forming Foam wy 15 lei" (AFFF) B BrarndoaoffFnFooaadmm -- exh bow Cl8ascosh Class B AlcoholRoar OR), Resistant (AR)a AFFF CossBPrown a Class B Protein Clas6s Class B Fuoproen (py ---- ---- Fluoroprotein (FP) Cla8isms Class B FilmForming Forming Fugopoen Fluoroprotein [oa (FFFP) CosseAReER Class B AR-FFFP Glass ABH Class A-B Hi Spansion Foam - oo -- -- ClEaxspasns4ion Foam dnd tows Tanegfoan Training Foam Other re w-- -- i -- Other Used in Training? YYeessoorr NNoo Ves Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Ey Historically UUsseedd?? 0 Slesoet xe Than yufor your time and cooperation. Pease contact Nancy Rodinga Delta Constants 651-6075152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or rodnng@atacrycom) or dm Stocking:atthe Mines Fallulon CarolAgony (G51-507 665 o or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or rmstockinger tse) 50a hve any QoS again io questa. jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PPlleeaasseerreettuurrnntthhiissqquuesetsitoionnnaniariree ttooDDeellttaaCConosnuslutltaannttssbbyyJJuunnee66,,22000088iinntthheeeencnlcolosseeddssttaammppeedd,,ssoeflf.. `aaddddrreesssseeddeennvveellooppee,. QuesTtoemarneciompslete Sby:lack Cire ~Navona( Vdeeebeploacd\ Questionnaire completed by: .... NNaammeeaanndd TTiittllee - --/ 320-763-6IYY Fie Aeplareigneanutdpias FT Fire Department Fano Nmber Phone Number delock @rea-alCpo.m TaeI-Bey Date EE--MMaaililAAddddrreessss Inogen' emer T47 FOR SPOS2 EA 3 S9~O Rice Creek Parkway Suite 1C0 St. Paul, MN 55126 USA 22223333..00006699 STATE 02626881 STATE_02826881 FirefightinQQgUUFEEoSSaTTmIIOOUNNseNNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training te Ca mAw eh 1. Does your Department currently or has your Department historically used Class A or Class B foams for Seppo firefighting operations? ions Yes - Proceed to Question 2 PO or __ No - Sign the back of this form and return to Delta Consultants 2. How often i~or Class A foam used in response to fire calls? Esper a? _~_~ 0-25% of fires 25-50% of fires 75-100% of fires 3. Does the Department have a compressed air foam syslem (CAFS) with a built-in tank on its engine(s)? ~ an YYeess ~3%~ No How often is foam used in training exercises? - -- i) cr __ Never __ Weekly __ Semi-Annually __~ Annually ore 2 ~ Other (please specify): Monthly __ Quarterly __ Bi-Annually owen sd grr? XC Less han' gallos Sgalons __ sw10galons How much foam is used per training event? ~" Less than 5 gallons / , 5 gallons __ 5 to 10 gallons __ MMoorree tthhaann 1100 ggaalllloonnss ((pplleeaassee ssppeecicfiyfy):): ------ ci spittin 6. In training, where does the spent foam go? em onstesone cours ,~ " Storm Sewer __ Sanitary Sewer __ On-Site Septic __ Ground Oter (pease describe): Tospendsmowhege . Col bas loader rudenwdion __ Other (please describe): I~'~_<~,~_~S ~-~ pcoOn[o,~lt_zs...u~ysben. 7. Where boosicid the raining take place? Please clude advess, intrsectn or other speciic location Where-does/did the training take place? Please include address, intersectidn or other specific location ee rs ee eo ed i as, donk Cor ove bre information for current and past training areas. Meee Hrars ago onCom fi Tom Sy oh Give setioel ~ fe " Sejesge ov Hiway RY ow fee. oof bh dvar oF (irz oil "@ G . 147-dankoF Ilan aes Wid Ly Lege beintov FoarnOakVER tot lio, OVER - Xinogen' 5910 Rice Creek Parkway Suite 100 St. Paul, MN 551,25 USA 22223333..00007700 STATE_02826882 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 8. hat ype) and branodf fsoa)m ae or vera used nw an in tho pstby ha Department. bot for fre 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in aii (1 splay? Paase check al at apy response and in training (if applicable)? Please check all that apply. Fmfommfon X=3M ph 25 0c Tupoof Foam BandofFoam TUUrssieenddiginn? VotorNe Training? AAAmmUmUiossoueseuddnlntyt CCuUumsrereensnt?tllyy HWiisUstsooreriiscc:aallllyy ClaTsyspeAoqfuFeooaums Brand Sof Foam Yes or No Annually Used? Used? Class B Aqueous [oe Film-Forming Foam Bekidoc UTM ReCC(AslaFssiFsaF8n)BnAtlAcsl(coOohRhos)ol.l- AFF Resistant (AR)- CAFlFsFsBPown FE CCFCulllaaoassosssp8sBBroPtreonte(infp) ---- ---- ---- ---- CFolmian8gFsime: Fluoroprotein Class B Film- (FP) Forming FFloygproien Fluoroprotein | ---------------- -- C(FFaFsP)samFE CEolmasAesnfsoan Class B AR-FFFP Class A-B Hi = -- =-- Cassa Expansion Foam xe Ne 45 _a _o TTrraaiinninngg FFooaamm eee ee ter rt ---- -- -- Other iToTormhrhawansnnoriokkccdnyykniooiinuunngggff@ o@oerrdrdyyo@eoosllututsarrteettennimiv.nm.ececoooaammnn))dd)ooccryroooJJopuiipmemeraraSStaiavttioocoenckn.ki.ainnnPgPgyleeleeraraaeaasstteset(thccheoooennsMMl[aanicfncetntoseaNgosanaotdnctaacnyygPPRRooolOluddtiniIoinQnngugeCCaasOottinnaDDYtnroeenollotltarAAegCCgeeoonnnnccssyyuul(t(la63na56t11rs--52((96957575-11-68.-066609696767-.o5o51r15522 jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. FotoComteJt sssoct ~ Please return this questionnaire to Delta Consultants by June 6, 2,0#8lff~t-he enclosed stamped, s~Tf-............ Qaduderseisosneadreencveolomppe,e br (ve Lot bom )~ Questionnaire completed by: am"sTanea TH . S ee e Name and Tit)e m FireCeDpeaprate rtmmeenntt ~ ee PhoneNeSmboeTr -7d- 301% Phone Number Ba4t-e4-0 Date Bae E-Mail Address cem Xinogen: --A -- T TeO E-- e I-- TA OO PSa 42-- 6 US om XlnoggA"_............... 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA 22223333..00007711 STATE 02826883 STATE_02826883 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNNeAAiInIRRFiEEre. Training Firefighting qamUseinFire.Training DELTA 7~~ Ne J1 elephona { So 1. DocsyourDeparment curly or has yourDepa Noue Gia A orClas foams for Does your Department currently or has your Department historically used Class A or Class B foams for rehomingopusions? AQ Yes - Proceed to Questio2n firefighting operations? /.,~") Yes - Proceed to Question 2 No. Sign the back of his form and return fo Delta Constants __ No - Sign the back of this form and return to Delta Consultants 2. Howoten'sClass Bo Cass Aoamusedinesprse orcas? 2. How often is Class B or Class A foam used in response to fire calls? so 02sholties a5smaties 5.100% fees ~ 0-25% of fires __ 25-50% of fires 75-100% of fires 3. Docs the parent hve a compress si foumsystem (CAFS) wih a ulin arkonfsengine)? 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? = tYeosYes 4. Howoten isfoam used inningexercises? How often is foam used in training exercises? Never Weakly Vriy Quarterly __ Never __ Weekly __ Monthly Sombamualy sonal SO sammy __ Semi-Annually __ Annually ovwrpoasosooty 7 ~ __ Other (please specify): __ Quarterly d~ Bi-Annually 5. How mucho is usdpor annavert? A LossD ransotars___ guns How much foam is used per training event? f,.~ Less than 5 gallons __ 5 gallons Mor than 10 galas (ease spac __ More than 10 gallons (please specify): = _ 5110ga0 tons __ 5 to 10 gallons 6. ntraing whee dos th spent oam go? In training, where does the spent foam go? Stom Sewer ___ Santry Sower Otnr pleasedescribe_GroscLoeafl __ Storm Sewer __ Sanitary Sewer __ Other (please describe): __ On-Site Septic --//~, Ground 7. Wihoomraetdoonsiodrdctmhon ainngg paoksonaece? rleoaos nude aes, ners rahe specication Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. J wt fon, Prose [FARES OOVVEERR-- D nent eere Inogen' 5g10 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA 22223333..00007722 state 02826884 STATE_02826884 DELTA Pik FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEireTraining Firefighting Foam Use in Fire T 'aining\ 5. What yes) and branodfosm) ar were uss wand th pst by ha Deparment, bot or fre 8, What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response snd nin cate} Poses crock al ht apy. response and in training (if applicable)? Please check all that apply. TUrsuendign? AmUsoeudn.t Curronly Historically TTyyppeeooffFFooaamm Glass Aqueous a Class B Aqueous Boe NN Film-Forming Foam rn (AFFF) y-- Class B AlcoholSomme S\N Res.stant (AR)ae AFFF Cosson --SNA EE Class B Protein cuss Class B born -- NO Fluoroprotein (FP) Class Bim. Forming Class B FilmForm ing Fluoroprotein Fre oT (FFFP) Gree NN CCllaassss 8 AR-FFFP ABHi Class A-B Hi Sroerain Foam - = = -- -- 3-- Class Expansion Foam Tengen NS = Training Foam omer - -- __ = Other `BBrraannddooff FFooaamm _ ~.~~~ DH ~_~ ~.~ N\A Dagas Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? Jae obaudis dg Traiyou for your tine and cooperation. Pleas conoct Nancy Rodina Dla Cansulants (351.667.5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or och @dtaany omoJ)n lockiotnthge Minessie, Potion Corl gency (051597.3000o or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or om sockingerGist mus) i 0 hve any @u0sions rerdng hs oostomnae jim.stockinger@state,mn.us) if you have any questions regarding this questionnaire. Floase rou tis questionnairetoDt Gonculonts bi June 2008 In thenclosad samond. sel `addressedenvelope. Quastonnaecomplied: Questionnaire completed by: Noms and Te Name and Title FreDDopasimarnsesvax Fire Department Phos Noer Te - 59 Phone Number ERY), Da\teWe Date EW Address OES Ne ANN E-Mail Address ack XlnIongog..e.nn.'L Phone: 5910 Rice Creek Parkway 651.639.9449 / 800.477,7411 Fax: Suite 100 St. 651.639,9473 -- Paul, MN 55126 USA www,deltaenv.corn 22223333..00007733 stateozs26885 STATE_02826885 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training x Firefighting Foam Use in Fire Training DELTA Bt 1. DootegsniyonugroDpeepsairotnmesn? curolr hya your Department strat sod Gass Aor Class B foamsfo Does your Department currently or has your Department historically used Class A or Class B foams for firefighting operations? No-Sign the backof his form and str to Datta Consulants ~~ YYeess -- PPrroocceeeedd ttoo QQuueessttiioonn 22 __ No - Sign the back of this form and return to Delta Consultants 2. Howoten a Cass Bor Clss foam used in rsponso roc? 2. How often is Class B or Class A foam used in response to fire calls? _ oavmoimes Ni zesowoites ___ roioonalties 0-25% of fires ~ 25-50% of fires 75-100% of fires 3. Docs the Deparment havae compressed afoam system (CAFS) witha bul tak os engines? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? YesYes ~ ~ NNoo 4. How fen foam ued n ving cress? How often is foam used in training exercises? New Westy Monty Nau __ Never __ Weekly __ Monthly ~ Somat Aooually Smal __ Semi-Annually __ Annually __ Bi-Annually Ovepemessecty __ Other (please specify): Quarterly 5. owmuchfoambsuso por aigsent? ..~w much foam is used per training event? "NL Los than galons Sgalons Less than 5 gallons __ 5 gallons St010 gatos __ 5 to 10 gallons __ MMoorree tthhaann 1100 ggaalllloonnss ((pplleeaassee ssppeecicfiyfy):): . Inteiing, hrs os th spotteam go? In training, where does the spent foam go? Storm Sever SarirySever __ Storm Sewer __ Sanitary Sewer thr pleasedescr __ Other (please describe): onsteseptc __ On-Site Septic Nj Grund ~ Ground 7 Voinmeradnofoir cahreni:nainndgp0as ainceg?aPreiass.s cud aos, nrsotonx oer spciclocaton 7. Where does/did the t~aining tske place? Please include address, intersection or other specific location information for current and past training areas. _-- $ 3 HKwogew OOVVEERR-- Phan: 631.620.9085 180 477.741Fo1r: 51.638.947)mari daliadnr. om 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaerlv,~;em 22223333..00007744 state 02826886 STATE_02826886 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg DELTA 8. What poe and braofnfoaem ar orwor usd now and ne pas yt Departmen, bth for rt 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire espana and msm 1 apa? lose shee a pot pp: response and in training (if applicable)? Please check all that apply. TUasmoidnign? AmUosuednt Currently _ istrically TyTyopeooffFFooaamm Clas 8 Aaueous ee Class B Aqueous Fimromigron _oflocel-- Film-Forming Foam ren (AFFF) Cl8 aconsor Class B AlcoholRemenen oo Resistant (AR)EE AFFF Close Pron I _ Class B Protein Gass Class B Hmoonn ------------ ---- ---- ---- ---- Fluoroprotein (FP) CassDFin- Class B FilmFormos Form ing Tegaitn | ---- ---- ---- -- Fluoroprotein en (FFFP) Cesssamee o_o Class B AR-FFFP Gass a8 4 Class A-B Hi BrBarannddooffFFooaamm Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? Icmag" Expansion Foam Tamegfom o_o Training Foam oer -_ Other Silv-gy New 2w5ed Man N22 Thankyoufor your ime nd cooperation Pleas cotat Nancy Roding a Det Consultants (51-69T-5162 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or rod anaoaacncom) or Sockingr at toe Miahsols Polat Garol Agenc (51-40-66o36r or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or So Socknper@sate mE) 4 ou av ay 4408S rong HS GUESTS, jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PPleleaasseererettuurrnnththiiss questtiioonnnnaaiirree.to Dietltaa Consullttaanntts by JJuunnee 66,, 22000088iinntthhee enc~'e~staSmamppeedd,-~-- ssoetlf.- addressed envelope. Questionnairecompete by: | NULL Questionnaire completed by: Nbar eandeTieCoialGeraceSchwands ~ TT ~ NifatmheeipanrodioTnitbletor Cpe Ot ) Fire Department Phon+o Na3vb2e 0-974-3373 Bo9-22-0% Phone Number Date Be E-Mail Address Kinogen Xlnog,e.,~; .............. rns Phone: ToL 59:10 Rice Creek Parkway 651.639.9449 / 800.477.74:1:1 Fax: Te Suite :Z00 St. 651,639.9473 i} Paul, MN 55126 USA ee a www.deltaenv,cem 22223333..00007755 state 02826887 STATE_02826887 DDEELLTTAA FFiirreeffiigghhttiinnQQggUUFFEEooSaaSmTmTIUOIsNOeNNAiNnIARFFEIiirrRee ETrainin win Llib 1. Does your Department curorrhyas your Department historical soon os 8foams for pe 2 Does your Department currently or has your Department historically used('Class A o)' Class B foams for firefighting operations? ee esto Qnsons Yes - Proceed to Question 2 a nut ont No - Sign the back of this form and return to Delta Consultants vot Cas. fnrrr? How often is Class B or Class A foam used in response to fire calls? orto wate ronan ,,N:b 0-25% of fires __ 25-50% of fires 75-100% of fires 3. DDooeess tthhee DDeeppaarrttmmeenntt hhaavvee aa ccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm ((CCAAFSS)) wwiithtaha bbuuililt--iinn ttaannk on iittss eennggiinee((s)?? Yes = ~ No PO -- How often is foam used in training exercises? ou pn wo cry __ Never __ Weekly __ Monthly __ Quarterly __ Semi-Annually ,..X~ Annually __ Bi-Annually nt __ Other (please specify): + omen ssp on? How much foam is used per training event? Less than 5 gallons __ 5 gallons a More than 10 gallons (please specify): __ 5to 10 gallons + oni ws ses oom7 In training, where does the spent foam go? a ovssesone cons __ Storm Sewer __. Sanitary Sewer ian __ Other (please describe): __ On-Site Septic __ Ground prihota s se Preen, aan psi Where does/did the training take place? Please include address, intersection or other specific location pn tsa oy information for current and past training areas. Clan - Nags maa) ocendh oe f= HKwogenn Xlng.,n.~............... OOVVEERR-- Phone: 651.639.5095 1 8509HT5F7ak: S31639.9475 me.deIatne. tom Phonc: 5g:~0 Rice Creek Parkway 65:!..639.9449 / 800.477.7421 Fax: uite ~.00 St. 651.639.94-73 Paul, MN 55126 USA www.deltaenv.cem 22223333..0000776 STATE_02826888 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5. What ype) andbras) of foamarowere usec nowand inthe pabsytthe Department, bothfor fro 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Sspons ani raring (1 73,6858) Posse Sec al ht 6p response and in training (if applicable)? Please check all that apply. TUasmeidnign? AmUosuednt GuUmseendt?ly HisUtsoreidca?lly TyTyppeeooffFFooaamm `BBrraannddooffFFooaamm Used in Training? YYeessoorrNNoo Amount Used AAnnnnuuaallllyy Currently Used? YYeessoorr NNoo Historically Used? YYeessoorr NNoo Class 8 Aqueous Class B Aqueous Femmton Film-Forming Foam Fr(AFFF) Cl8aAlsconsa: Class B Alcoholem, Resistant (AR)rr AFFF CossBPoOn Class B Protein cusp Class B FFlluuoorroopprrootteeiinn ((FFPP)) EE Class BF Class B FilmForming Forming fumogoen = ---------- ---- ---- ---- ---- Fluoroprotein rs (FFFP) CossBARFERP Class B AR-FFFP ass Aah Class A-B Hi Craton ---- ---- ---- Expansion Foam Clee wel sec lovenel fioed Mie Aer TnngFoom Training Foam 2TNBotsuppiif JER over -- -- ---- om Other~.~ A Shick eid wasel Foust neitiES eri a Er Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 OF rodnna@aetaencom)] you have any questions reahsrueisionnnagre. or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. `self-addressed envelope. PlPeleaasseerreettuurrnntthhiissqquueesstitioonnnnaaiirreettooDDelelttaaCConosnuslutltaanrt#ssb-byySSeepptteemmbbeerr3300,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,, self.addressed envelope. GuestonYaaieectompfllyax, Coe Chiat ( vLeeglerN Questionnaire completed by: NNaammeeaanndd TTiittllee' - iro DopeBrmoentckus Fis Fire Department 21- 947-4486 a Phone Number 10-20% --Date vane E-Mail Address Kwogen Xlnog&". ............... hones 651.035.3005 1 830 037TIFTk: 691.639 5473mdaasliasav.con 5910 Rice Creek Parkway Suite 1_00 St. Paul, ivlN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639,9473 www,deltaenv.cem 22223333..00007777 STATE 02626889 STATE_02826889 DD EF-LLTTAA FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training N C vein Letiphon 1. Dosayour Deparctunmteonrhta yourDgertmont historical us Glos amosr Does your Department currently or has your Department historically us&(~Ciass A'~_Class B fo~ams for retgnng operators? flrefighting operations? es Proceed to Question __ Yes - Proceed to Question 2 No. Sign the backoftis fom and return to Dela Consulants __ No - Sign the back of this form and return to Delta Consultants 2. MowaltenisClassBar Cass Afoam usd n espns oo cals? 2. How often is Class B or Class A foam used in response to fire calls? JO _ommates ___zssonoties _~___ 0-25% of fires 25-50% of fires 751005 of ros 75-'100% of fires 3 Dass th Deparmant havea comprossod a foam sytem (GwAilh Sbul)l tank on fs cies? 3., Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? DO vnoeYes 4. Howoten sfoam used nang exercises? 4. How often is foam used in training exercises? X nvr Westy Monty __ Weekly __ Monthly Semi-Annual sooualy (/,k~ Never __ Semi-Annually __. Annually cuneny __ Quarterly smal Bi-Annual,ly __ OOtthheerr ((pplleeaassee ssppeecicfiyfy):): uclo[,a--~r-~ ~ undwezzte =overStee 5. Howmuchioam fs sed or varing event? How much foam is used per training event? Loss than Sgalons. ___ Salons _ Sto 10gatons __ Less than 5 gallons __ 5 gallons Mors than 10 gallons (ease speci - __ More than 10 gallons (please specify): __ 5 to 10 gallons 5. nang. une does the spent foam go? In training, where does the spent foam go? Storm Sower___ Saiary Sower onstesopte Grom __. Storm Sewer __ Sanitary Sewer Ctr leas doscol: - - Other (please describe): __ On-Site Septic __ Ground 7. Wichremraetdioonsfoidctuhrntianndgpaac Ylaeng? rPeesa.s includ kes, erectoir tohnr speci cation 7. Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. Hwogenr Xlnog,.e.,oL ......... OOVVEERR-- Phone: 631.639.9395 1500.544117" F7er: $51.639.9473 mmm. deliadnu. com 5910 Rice Creek Parkway Suite 100 St. Paul, MIY 55126 USA Phone: 651.639.9449 / 800.477.74:[1 Fax: 651,639.9473 Www,deltaenv.cem 22223333..00007788 state 02826890 STATE_02826890 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 5. Wheto) adbran) foam a orwor sd now annh ae ye Dart. botfhr 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire ams hog eas Pos oaks tah, response and in training (if applicable)? Please check all that apply. Typeot Foam bandotfon VTUeesadmeignt? AAm"vCoouenydt CGuereednit is"teasridasly Type of Foam ClBaAqsueoess Class B Aqueous Firmen ------__ Film-Forming Foam [is (AFFF) GlBoAesons Class B Alcoholew Resistant (AR)noAFFF Class Proton FE -- Class B Protein Chess Class B Roping) ------------ -- -- -- ---- Fluoroprotein (FP) Glass im Class B FilmEos Forming Fan || mm Fluoroprotein fe (FFFP) CosAREI Class B AR-FFFP Cases Class A-B Hi Tne eee Glass A Expansion Foam Class A Toor 7 TT TT Training Foam Over -- Other Brand of Foam A= Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? J hark you or your ne and cooperation. Pls coat Nay Rodrig ot Dols Consular (351.607 5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 nein con) o oS heise Poo, Col Agony (0 S37 568 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or ocing Gite Tou hve ay aoe edn cota jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Please return this questionnaire to Dalta Consultantby Jaris 6, 2008 in the enclosed stamped, 6l% Please return this questionnaire to Delta Consultants br}~J~'~61 2008 in the enclosed stampedi-~se-eTf;...... `aaddddrreesssseeddeennvveellooppee., ~~ " 1 ""-,\. \ avis sm Cum Phont, we) j/-tl ~,~ Dosceel borer J Seem Questionnaire completed by: ~ m,~- [~,._ ~ ~/'t"/~J me rdTie Name and Title _FeoPDepoaremenrt dd Fn . Fire Department Fras5H2om0e-r3 52%-2512- S9a .308 Phone Number Date Ew E-Mail Address XJlnng~ 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA 22223333..00007799 stare os2601 STATE_02826891 DELTA QQUUEESSTTIIOONNNNAAIIRREE Firefighting FFooaamm UUssee iinn FFiirree TTrraaiinniinngg Van Phineas, 1. Doss yourDepartmentcurrentlyor has yourDepariment historicelly Sed CasAsof ClBafoasms fsor Sa ee firefighting operations? (,.,..__ .__...~:=~~ JC Yos -ProtoQcueestsiond2 2~ Yes - Proceed to Question 2 / 7 e-iarn ts fok m and tanto Sata Conan No - Sign the back of this form and return to Delta Consultants 2. How often is Class B or Class A foam used in response to fire calls? 5 DonsthDopwinent have compress fon tm (CAS) ih a st rk og! __ 0-25% of fires __ 25-50% of fires 75-100% of fires Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes j-- No 4. Howtaomuottinoteinn xiress? How often is foam used in training exercises? o_o __. Never __ Weekly __ Monthly acy sents __ Semi-Annually __ Annually Ovremespety __ Other (please specify): ---- __ Quarterly fy Bi-Annually How much foam is used per training event? Less than 5 gallons __ 5 gallons __ MMoorree tthhaann 1100 ggaalllloonnss ((pplleeaassee ssppeecictiyfyy:): __ 5 to 10 gallons In training, where does the spent foam go? __ Storm Sewer __ Sanitary Sewer TT over pss der __ Other (please describe): __ On-Site Septic __ Ground 7. Vitae dosh int pac Pe cat is, rection ivr sl at 7. Where does/did the training take place? Please include address, intersection or other specific location an a information for current and past training areas. pute Clactd fom aX SKinogen XlnoR.e..n_"_ ......... OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA .....~~C--- ~~ ~.,. 22223333..00008800 STATE_02826892 DELTA FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire ig 3\' Firefighting Foam Use in Uk Fire Tr i ng 5. Westt e 3p g RECa CBRE c Sv 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire to response and in training (if applicable)? Please check all that apply. PVT... apo ,ALS.TtEMlty Htforlainty Type of Foam Cones pe Class B Aqueous Gosprens Film-Forming Foam ((AAFFFFFF)) Cgotreda: Quoi.gs 0 =-- ges ue. Class B Alcohols Resistant (AR)- pe ..... AFFF Cogpoen [ Class B Protein cone Class B Cn ny Fluoroprotein (FP) Goi Class B Filmjas] Form ing Fluoroprotein fs (FFFP) ES, Class B AR-FFFP geass Class A-B Hi er pe Glass A Expansion Foam Brand of Foam SILUEEY Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? MO LPP ys yes `TTrraaiinniinngg FFooaamm --_-- ------ -- _-- OtOhtheerr -- ----- -- _-- TThhaannkkyyoouuffoorryyoouurr ttiimmeeaanncdccooopoepreartaitoionn.. PPleleeasseecoconnttaacott NNaannccyyRRooddnniinnggaatt DDeellttaaCConosnuslutltaannttss ((665511--669977--55115522 i A or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or to a sors og mr jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Pose stu tis cussion Dols ConsbyuJus. 208 nh ane stamped. Please return this questionnaire to Delta Consultants by June 6, 2008 in the enclosed stamped, self- aaddddrreesssseeddeennvveellooppee.. a --L--r] Zz Boon? faceno.e Quei~aire c?/~le/~/d b~o~/~ Badee=fo OF Fire Department if- E35- YE0b BL nde SEAN Phone Number ox ux $38~ ASHE Date LL 6Aocsdce,nd LO Jr E-Mail AdSress Sinope TL) XInog~AL............. 5910 Rice Creek Parkway Suite 100 St. Phone: 651.639.9449 / 800.477.7411 Fax: 652.639.9473 OF nT Paul, NN 55126 USA www.deltaenv.com 22223333..00008811 rare casas STATE_02826893 QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training x Firefighting Foam Use Jn Fire Trainin Ey 1. fDDeootessaryyioouugrroDDpeeeppraairrotmmneesnn?tt urtnotrlhaysyour currently or has your Department Department historical historically useused ClAaorslasss Class A or Class B B foams foams for for Yes-Proceed firefigh~operations? to Question 2 NYoesS-iPgrnocteheedbtaockQoutehsitiosnf2orm and return to Data Consultants __ No - Sign the back of this form and return to Delta Consultants 22.. HHoowwg~lteen~ isGlsB o Glass Class B or Class AAffoooamuussoedd iinn rreessppoonnsseeftoo focall? fire calls? 4. 025%offres 0-25% of fires __ 2550%affies. 25-50% of fires 7510of0fr%os __ 75-100% of fires 3. Doss the Dppariment have acompressa i foam system (CAFS) wiha bain tanokn fs enginets)? Does the ves, .~partment have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? No No 4. Howolen i foam used nrining exercises? How often is foam used in training exercises? Never Weekly Hotty Quartry __ Never __ Weekly __ Monthly\. ty ty 2X sna __ Semi-Annually __ Annually ~ __ Quarterly Bi-Annually __ OOtthheerr ((pplleeaassee ssppeecciitfyyy): 5. Howmutfoam is usedpo raining ovont? How Less muc/I.I.h~oam is tuhsaendsgpaelrotnrasi,ning event? 5galons ~ Less than 5 gallons __ 5 gallons __ MMoorree tthhaann 1100 ggaalllloonnss ((pplleeaassee ssppeecicfifyy)):: 51010 gators __ 5 to 10 gallons -- 6. Invoing, hers docsth spontfoam go? In training, wShteorermdoSeeswethre spent foaSamnigtoar?y Sever __ SOttohremr S(peewaesredo_ sc_ rveS)anitary Sewer Other (please describe): -- 0S Septic Ground __ On-Site Septic /'~ Ground 7. IVWihhneerrfeooddooroessom/idciacdd rttthhoeeintrraoaiainnnniindnggptaaakckeeralpilaanccieneg?? aPPrlleeeaaasssee nchida include address, address, intersectionor intersection or cthr other Specic Cpecific location location information for current and past training areas. M0 oonnee Pa ce Xinogen: OOVVEERR-- rane: 651.639.9540 1 850 975 THI Fok: S51698 047) Mania.com 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA Phone: 651,639.9449 / 800,477.7411 Fax: 651.639,9473 www.deltaenv.com 22223333..00008822 STATE 02826894 STATE_02826894 0c" Rely A QUESTIONNAIRE Ie FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 5. What yes) and brano(f fsoa)m a or were used now and i th as: by the Department, bh for fre 8. What type(s) and brandls) of foam are or were used now and in the past by' the Department, both for fire Tosponse an ainng (1 spphcaiey Ploase neck all hat apy. response and in training (if applicable)? Please check all that apply. TUismainign? AmUoseudnt CurentUseor TyTyppeeooffFFooaamm Class Aqueous Fim- Class B Aqueous FilmForming Foam (AFFF) Forming Foam (AFFF) Class 8 Aotol- Class B AlcoholReston (NR AFFF | ~~ -------- Resistant (AR)-AFFF Class 8 protein eee eer rest se Class B Protein Clas 8 Foroproten Class B Fluoroprotein Ic ee ee ee (FP) Clas 8Fim Foming Class B Film-Forming Fuopraton (prep) ------ ------ Fluoroprotein (FFFP) CasBARFER Class B AR-FFFP Cass ABH Class A-B Hi Csr foam ------ Expansion Foam Cass A - Class A Trang Foom - Training Foam omer a Other B Brarnda ooffFnFooaadmm Used in Training? YeYessoorrNNoo Amount Used AnAnnunaulalllyy - Current Use or HiHsisttoorriiccUUssee?? hark you for yor time and cooperation. Please contact Nancy Roding al Deta Consular (51-697-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 o redno@asiaccnomy) or J Stoinger a hg MGSO PION Canto Agency (651-297-3060 1 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or Si Socknger siteToo) 94 hve a eS GATING is Qesionare jim .stockinger@state.mn.us) if you have any questions regarding this questionnaire. Guestonaie complted by PlPeleasaeserreettuurrnntthhiiss qquueessttiioonnnnaaiirreettooDDeletltaaCConosnuslutltaannttssbbyvMMaavy 99.. 22000088iinntthheeeenncclloosseeddssttaammooeedd.osseelflf:- aaddddrreesssseedd-eennvveellooppee.. Questionnaire completed by: Nemwmatie Name and Title Brak Cenker Rp, Fire DepaCtment Foret Phone Number BE Date EEM-Maialil AAddddrreessss Kinogen Xlnog~,~2o .............. oo 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 551.639.9473 www.deltae,v.cam 22223333..00008833 STATE 02826895 STATE_02826895 QQUUEESSTTIIOONNNNAAIIRREE ust wrF FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg DELTA @ 1. DDaooieesrs iyyoonuugrr DoDepepepararartttmmoerensnt?t curently currently o has or has your your Deparment Department torical historically used used Classor Class A or Class Class B B foams foams for for S_ firefighting opveorast-iopnrso?cesdto Question 2 __~NoYes S- iPgroncteheedbtoaQoufcetshtkiiosnf2orm and return t Dota Constants No - Sign the back of this form and return to Delta Consultants 2. HowoflanisCis ox Clas Af uses i respons fe cals? How often is Class B or Class A foam used in response to fire calls? o2s%of res XK assomories __ 0-25% of fires ~ 25-50% of fires T5:100% ores 75-100% of fires 2. Doss the Department have compressed ai foam syst (CAFS) with bli tank an 5 engine(s}? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? XK ves JYes No 4. Howottenis foam used in raining aneroses? Week tony How often is foam used in training exercises? __ Weekly __ Monthly Somiamay sonuaty __ Semi-Annually __ Annually __ OOtthheerr ((pplleeaassee ssppeecciif)y:): avmnualy _X _. cuaQruaertneryly __ Bi-Annually 5. How much foam is usd par vaning event? How much foam is used per training event? EI i __ Less than 5 gallons __ 5 gallons orethan 10 gallons (easespeci): __ More than 10 gallons (please specify): A soon __ -- 5 to 10 gallons ig wns tons? _X_somsewer ___SantaySewer 6+ In training, where does the spent foam go? ~" Storm Sewer Sanitary Sewer Othe lease descr) ___ Other (please describe): ___onsteSepic __ On-Site Septic A /'~ GGrorouunnad 7. WiWinhhkeroreeaiddooonesfeoldsidcutthrhreentirtaiainnindngpataakskeetppellanaccieeg?? aPPrlleeeaaasssee ind include sss, address, nrsectionoother intersection or other specific specific locaton location (AU STAFON [250 infor91ation for current and past training areas w Plud Ge,mr Lu ST on C300 popst per 0 i air ~~ we, <Q, Hwmogent Phone: 5910 Rice Creek Parkway 65:1.639.9449 / 800.472.74:11 Fax: Suite 100 ee St. Paul, MN 55126 USA 651.639.9473 www.deltaenv.em 22223333..00008844 STATE 02626896 STATE_02826896 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training Wrehsepoonsnea)nnndabmriacntsp) fleeasareorlweoarseuchsaocknaowhaanldsnpt.h ps ys Dpetmant both fo re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. TUosnediinng AmUoseudnt CuUrseend?ty HisUtoariec?ally TTyyppeeooffFFooaamm . Class B Aqueous ent, dusted) po 2S le (AFFF) Film-Forming (AFFF) Foam Cl8aAcsobsol Class B AlcoholfosenRy, -- Resistant (AR)AEE AFFF CossbPwan Class B Protein Clos Class B Floren (7) Fluoroprotein (FP) Class Fim Class B FilmFam Form ing Faron Fluoroprotein Fe (FFFP) J Class B AR-FFFP Coss ret Class A-B Hi Eran roam - --_ Expansion Foam Coes (ois) Silu-5 Mo 20250 CTrlaosrsiAngFoam Training Foam OOtthheerr BBrraannddooffFFooaamm Mo isda eae Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently Used? YYeessoorr NNoo Historically YYeeUsssooedrr?NNoo Gack ankle 3 grees ag Nee - Yee hark you or your in and cauperton. Please contact Nancy Rodin a Data Consular (51607-6152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 rod dahae Som) yo hve 5 QueSions rag I Rsseionnae, or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. Questionnaire completed by: <ul C ` L ~ PPlleeaassee rreettuurrnntthhiiss qquueessttiioonnnnaaiirreettooDDeellttaaCCoonsnuslutlatannttssbbyySSeepptteemmbbeerr3300,, 22000038iinntthheeeenncclloosseeddssttaammppeedd,, sseellff-.aaddddrreesssseeddeennvveellooppee.. ------ Questionnaire completed by: Te Tea Baile ble _Name and Cin Title~ mb fhekEBT Fire Department Took TD Phore=Nbe3r- 493-3020 ED925-0% Phone Number Date Kinogen: EE--MMaaiill AAddddrreessss Xlnog,e.~'~ Phone: 59~0 Rice Creek Parkway 65~.639.9449 / 800.477.745~ Fax: Bh Suite 100 St. 655.639,9473 Co Paul, MN 55126 USA www,deltaen~,cem 22223333..00008855 sraTe 02826897 STATE_02826897 QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training Firefighting Foam Use in Fire Tra~i~n~_~:~_ 1 DDb EE LLr TTAAe bref n(A tT otel 1. frfDeirfoeiefigsghhtytioinnuggroDoppeereparaatrtitimoonnessn??t currently or has your Department historically usN e~ eA~ ~ ml Yes - Proceed to Question 2 rt et ents No - Sign the back of this form and return to Delta Consultants VARA -------------- 2. How often is Class B or Class A foam usec~ in response to fire calls? Yo vm ea ers __~ 10% of 0-25% of fires catlx 25-50% of fires 75-100% of fires 33.. DDooeess tthhee DDeeppaarrttmmeenntt hhaavvee aaccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm [(OCAAFSS)) wwiithtah~ bbuuiillt-iinn ttaannkoonnititss eennggiinee((s)?? Yes S~ mNNoo / + on nm eg 4. How often is foam used in training e~ercises? -- -- po. arr ~ Never ~ Weekly ~ Monthly __ Quarterly ty ony fe Semi-Annually ~ Annually ~ Bi-Annually ~ OOtthheerr ((pplleeaasseessppeectcyif)y:): + orm tams spr asss How much foam is used per training event? pion SPY Less than 5 gallons __ 5 gallons I em eee __ More than 10 gallons (please specify): __ 5 to 10 gallons + nn ster tom? In training, where does the spent foam go? ron elcont| tutnss | ies __ Storm Sewer __ Sanitary Sewer rn Be ---- __ Other (please describe): __ OnlSite Septic __ Ground 1 a ni nv str sn et i, co a sco Where does/did the training take place? Please include address, intersection or other specific location Yinestas orgsoc Lacs information for current Locos ov and past training areas. Doon, Trish Sea to Knog OOVVEER R I 5910 Rice Creek Parkway Suite 100 St. Paul, HN 55126 USA Phone: 651.639.9945 1800.477.74F1a1k: 651.635.9433 mom.deliacmatom Phone: 651.639.9449 / 800.477.74].1 Fax: 551.639.9473 www.deltaenv.com 22223333..00008866 STATE_02826898 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training 5. Wht yet) an band)offoam are cr reuse mow nd nth pasho otperaynt, bhfr 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Teipanse So vain apes lea cock aot 2 response and in training (if applicable)? Please check all that apply. Tweot Foam Type of Foam Clase B Aquenis Class B Aqueous copies Film-Forming Foam er(AFFF) Gloss Aon Class B AlcoholRossin Resistant (AR)peAFFF omspPOEn Class B Protein Goss8 Class B Foapoton(pp) Fluoroprotein (FP) ci8sFien Class B FilmFoi Forming Faoign | Fluoroprotein foes (FFFP) CobARFFR Class B AR-FFFP Bomdoifem Brand of Foam Aucus SE -------------- -------- Usdin Used in Tangy Training? Yeorte Yes or No Amount Amount CoedUsed Amy Annually pb 5 Curendy Currently vena" Used? YeeMo Yes or No Histericlly Historically Vee Used? Yeserhs Yes or No ---- -- -- -- -- ---- -- ---- Class A-B Hi Sortafoam ------------ -- -- -- -- Expansion Foam Gon Ags Me vs Class A Tgp 3 Training Foam oer -- j-- rou hoe onal S00 Co 107 Jres retSe ST TC BIS Toorrhannnrrokoddynoninuigfn@ ogrd@yedoltuearletinimav.eecnoamyn.d) cifcfoyoyomooup)uehhraaavtvieoenaa.nnyP y qqlu:u~eessottiinoonntsas crreetggaNarraddniinncggy ttR hhiissoqq~uuegesstitaiootnnDnna~ialrtiraee..Consultants (6581-e60t7-d5~ ' < Freby Please tu is auestonnaire to Det Gonsulans by Saptember 19,208 Tr rcloisd med, Please return this questionnaire to Delta Consultants by September 19, 20~~close~~ 0 `self-addressedenvelope. sare fees aman eTio Poredocia Name and Title FI Feber Fire Department Fre Nie507-725- S000 Phone N~mber ~ --~i ~-- (Fgh Se7-24-08 Date EE E-Mail Address Kwogen Xlno~;~,E'_ hone: 651.639.9198040.4577 1411 Sak: 61.639.9471smni.daltasnr.iam 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.oom 22223333..00008877 sate 02826899 STATE_02826899 DELTA FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNiAAnIIRREEFire Training Firefighting Foam Usei ire-T ai g v ripJoanne 1. 1. DDfoioeessstyiyoonuugrr DoDepepepacarartttmmoenensnt?t carenty currently or or has has your your Department Department historically historically used used CCm llaassss AAe oor CCalassss B B foams foams for for 2 Yes- Proceed firefighting operations? to Question 2 Rot No- ~ Yes -SPigroncteheedatcokQuofetshtiiosnf2orm and retum to Delta Consultants " __ No - Sign the back of this form and return to Delta Consultants 2. Howofen's Coss Bor ClassA foam used in response to fre calls? 2. How often is Class B or Class A foam used in response to fire calls? 20 026%offren 25.50% of tres 75-100% of fres 3. Does ..~O the De pa0r-C 2t5m%entofhfairveer sf ochfmLoreo_ e scefd_ oai 2f5o-a5m0%sy of st fires em (CAFS ) __ 75-100% of fires with a bitin taronsengine(s)? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? vYeess 4. Howofen is fnoeam used in raining exercises? How often is foam used in training exercises? XD News Weeky ___ Monn urn __~ Never __ Weekly __ Monthly __ Quarterly som Amuaty Annoy BiAmnualy __ Semi-Annually __ Annually __ Bi-Annually Otverpessespectyy __ Other (please specify): 5. How much foam sed per Vaiing event? How much Less foam is Less han 5 allen used per training than 5 gallons event? __ 5Sggaatlloonnss Morahan 10 gatos (please speci: More than 10 gallons (please specify): swig __ 5 to 10 gallons 6. Inainng where oes the spent foam 907 In training, where does the spent foam go? Storm Sower __ Santry Sewer __ Storm Sewer __ Sanitary Sewer J -- __ Other (please describe): LO __ On-Site Septic -- __ Ground 7. WW inhhfeoerrrmeeatddioooensef/odrsicd ttrhhentVraaiixnniinnggptatasaktkeeUppllaavccee?? aPPelleesaa.ssee include include acess, address, intersection intersection or or other other speciic specific location location information for c/~rrent and past training areas. XKlinnogo,g,ee.An'. OOVVEERR-- rane: 551.639.F 5005 R00 CTTTRENrE yFak sCha1s61009005x3 M va AeAsR LUoe 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 65:1.639.9449 / 800.4-77.7411 Fax: 651.639,9473 www.deltaenv.com 2222333..00008888 STATE 02826900 STATE_02826900 DELTA QQUUEESSTTIIOONNNNAAIIRREE CEtNt FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrfaaiinnining g 5 What tous) an brands) of amarvere usd now and th astby he Dapasimr,Sih r r 8. What type(s) and brand(s) of foam are or were used now and in the past by the Departmer~t, both for fire aes os rook os. response and in training (if applicable)? Please check all that apply. roy -- tot curonty Witorcaly TyTyppeeooffFFooaamm Gls Aoons Class B Aqueous a ee =-- ---- ---- Film-Forming Foam ry (AFFF) Gl8ocsesl Class B AlcoholLB ee = ---- -- Resistant (AR)- AFFF Gesboan JE Class B Protein Class B Bement) ------------ _-- -- Fluoroprotein (FP) `BBrraannddooff FFooaamm Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? Class B Film- oot) Forming Hagen Fluoroprotein fos (FFFP) CosbmmE Class B AR-FFFP Class A-B Hi Got Expansion Foam -------- _---- -- -- -- ---- Class A mgpen Training Foam over - -- -- = = Other Thar oufo yur tr and copa, Pla conc Naren Dols Corea 818875152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 aman so Singer Mpa Palos ColleA:gony (0 507393 1 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. EE Ge ee Snisasl Please return this questionnaire to Delta Consultants by June 6, 2008 in the enciose~l stamped, self- `aaddddrreesssseeddeennvveellooppee.. [-- Questionnaire completed by: a[retanmie henbdn Chins -- Name and Title R Cellows; ee Nire Dep~Hment PN Phone Number Date E_ mr Xlnog #) ............. Pane: Phone: 651.639.3000 1 5000 ATT Fav: 5910 Rice Creek Parkway 651,639,9449 / 800.477,7411 Fax: $1639.9473 Suite i00 St. 651.639.9473 ] Mem.ARITARRLALE. Paul, MN 55126 USA www.deltaenv,com 22223333..00008899 STATE_02826901 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg DELTA 1. tDosns yogur oDeppaaarttomnesn?t curently has yur Department historical ust CaAcsxCosss 8f om a firefighting opVereatsi-onPsr?oceed to Question \ YNeos--sPigroncteheedbatockQoufestthiiosnfo2rmand return to Dla Consultants __ No - Sign the back of this form and return to Delta Consultants 2. Howaltn'sClass Bo Cass Afoam usd n espns ofr cals? 2. How often is Class B or Class A foam used in response to fire calls? _ oomwoites ___ossoweifes ___Totumeotives 0-25% of fires 25-50% of fires 75-100% of fires 3. DDooeess tthhee DDeeppaarrttmmeenntt hhaavvee aa ccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm ((CCAAFFSS)) wwiitthh aa bbuuililtt--iinn ttaannkk oonn iittss eennggiinnee((ss))?? vesYes NoNo 4. Howoltenis foam uses i raining exercses? How often is foam used in training exercises? New Wey hou Query __ Never __ Weekly __ Monthly __ Quarterly Som ual Aoruaty assert __ Semi-Annually __ Annually Orr (ase speci: - Other (please specify): __ Bi-Annually 5 How much oom i sedper ring ver? How much foam is used per training event? Los han 8 galons Sgatons 51010 gators __ Less than 5 gallons __ 5 gallons Mero tan togotons emesrocti __ More than 10 galrons (please specify): __ 5 to 10 gallons 5 In vaning, harecoos te spt foam g57 In training, where does the spent foam go? Som Sewer ___ Sndary Sawer onto Sept Gouna __ Storm Sewer __ Sanitary Sewer Overiossodoserbey __ Other (please describe): __ On-Site Septic __ Ground 17. aWhrearteidonofoir ctuheknitnagpaoksevloacme? aPreoa.s incl aces, inrsecton or othr speci locaton Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. HKwogen OOVVEERR-- Phone: 651.635.5005 / 300.473 3411 Fak: SL 630 047)wa pMAAR.A 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639,9449 / 800.477,741]. Fax: 651.639,9473 www.deltaenv.cem 22223333..00009900 sate 02826902 STATE_02826902 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training 8. 8. teW Wshhpaaottnttsyyppsee(e(ssn))daannddabbirraannndd(ss())1oaoffpffpoolaamamtaairroe aoPr wlwseearsree uucssheeeddcknnaolwwtaahanntdd aiinpnptlthyh.ee paspast by by the the Deparment, beh Department, both frfor frefire response and in training (if applicable)? Please check all that apply. Typeof Foam BandotFomn YTTUoUraasssnieoenidrdinnitgignlne?e AAAmmmUUmossuoueeauddnlntyt CCUuusrrreeednn?tlty HHiissUttsooreriidcca?allllyy CasTsypBeAoef oFosasm 77 .--? .--~ Brand of Foam Yes or No Annually Used? Used? Class B Aqueous Fi rmnatoam be MP em Film-Forming Foam pres (AFFF) Cl8aAlsots Class B AlcoholResa oy - Resistant (AR)pe AFFF LE -- JE Class B Protein Class 8 Class B Fooropotein (Fp) ---------------- -- Fluoroprotein (FP) Cla8Fsims: Class B FilmForming Forming Fuoraprotein -- Fluoroprotein re (FFFP) CassoARERP Class B AR-FFFP Class ABH . ~ Class A-B Hi Soonfoam --s-- aws -- Expansion Foam Class A Class A Trang Foun Training Foam over rl JA Other XK Torewel XK on es New 10500 Thank you for your mo and cosporgion. Poas cortact Nancy Rodring at Delt Consultant (54,6976152 Thank you for your time and cooperation, Please contact Nancy Rodning at Delta Consultants (651-697-5152 of radhina aaa cam) om Stockings a 1 Minnosta Polton Corr Agancy (651-2975635 or or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or sicker Gate 08) 0s have ay ston regain i auestomal jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. is Dette Consultants by June6,2008 in theenclosed stamped sal: Please return this questionnaire to Delta Consultants by June 6, 2008 in the enclosed stamped~~if- ................... enon pt westonnaie completed by: Questinnaire cm pleted[by: Feros Moemseh on, CoS NYT m2e 00Tie Name and Tille I ~ ..~ Cowoluse Cet FiFiDreepDaerpianretl~tt Prom2s:Nu1m%b-er30-57SC Phone Number Ta 29-50% Date Bs E-Mail Address m Kinogen: e eS Se S SESS 1453He A Xlnog~.n...~............... 5910 Rice Creek Parkway Suite 100 St. Paul, MR 55126 USA 22223333..00009911 STATE 02626503 STATE_02826903 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 1. rDDoaocetss iyynoouugrr oDDpeeepprsaarrtitmomneesnn?tt curenotrhlasy currently or has your your Deparment Department istorcally historically used used ClasAs Class A or or Cass Class B foams foams for for firefighting opeVreastio-Pns?rotcoQueesetiodn2 __ YNoes. -SPigroncteheedbtaockQuofeshtisonf2orm and return to Dla Consultants __ No - Sign the back of this form and return to Delta Consultants 2 tors Gong sores ct ofa fo 2. How often is Class B or Class.A foam used in response to fire calls? J ME enn en 5100tte0s /'~"~-" i~L~fir~e,~~sO " .~t(~)~~f 25-50%of fires __ 75-100% of fires 33.. DDooeess tthhee DDeeppaarrttmmeenntt hhaavvee aaccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm ((CCAAFFSS)) wwiithtaha bbuuiilltt--iinn ttaannkk oonn iittss eennggiinnee((ss))?? vesYes Co ?C' No 4 Howotten foam used in rang exercsos? 4. How often is foam used in training exercises? Newr weak Manny Quarty __ Never __ Weekly __ Monthly JSeminal onal XC Besoraty .,,~Semi-Annually __ Annually Otor(leasespeciyy ~ Other (please specify): /~,~ __ Quarterly Bi-Annually 5. How much foam susedpor ang ent? How much foam is used per training event? Less th3gaoonns Sgatons __ Less than 5 gallons __ 5 gallons ore than 10 gaan (peasespeci: __ More than 10 gallons (please specify): x 5h 6. Intang, whee does 1 spent eamgo? In training, whore does the spent foam go? Sto Sewer _ Santry Sower __ Storm Sewer __ Sanitary Sewer Ober (ease dose): __ Other (please describe): Onto Sapte __ On-Site Septic -- aalgrs = _J0 Grune ~ Ground 7. Whore consid ho sing ako ace? leas incu adress, ersa ottvr spec ocaon Where does/did the training take place? Please include address, intersection or other specific location norman orcute an pat vanng ross. acestlef information for current and past t rainingvaroeass. lusnits Live var Noes aes. wo Lore XKinogen Foote es Homoen beet) OOVVEERR- ser = bok do Lue Ck. ~--"---'"- 5910 Rice Creek Parkway Suite 100 St. Paul, HN 55126 USA 22223333..00009922 STATE 02626504 STATE_02826904 FirefightinQQgUUFEEoSSaTTmIiOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training DELTA peAyd Qt 5. What types) an brandis)of foamar or were used now and inth past by the Department, bh fr fre 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tesponss and In Lain (1 3ppcae? Paase check i ht 3p. response and in training (if applicable)? Please check all that apply. Typeof Foam Brand of Foamy TUUossneeiddniginn? a Training? aAAmmUUmossoueeauddnnntt CGl uurmreenntd tUUsseoorr Foran Foam (iy laBAsquesous Fim- Type of Foam Class B Aqueous Film- LAs------ ABrraind of Foam Yes or No f= fAennsnua#lly0 Historic Use? Forming Foam (AFFF) Cf lBacsoe hosl. Class B Alcohol- i -- Class 8Protein Resistant (AR)-AFFF -------- ------ Class C&lass Class 8B B Foroproten Protein Fluoroprotein _--m-- CF(CFlulPaaass)rssopB8roFFliilommn--FF(ooFrmrmFiipnnygg -------------------- -------- -------- -------- CossBARFFP Fluoroprotein (FFFP) Class B AR-FFFP CBloasmsoAo3nHfi om Class A-B Hi Tp Class A Expansion Foam PE TCrlaaisnsinAg Foam -- over Training Foam A Other o"iTofTrhmhanrsanrinokkoodcyynkdooiinuungngff@ooaarrrd@yye@sooltutuaararetttneiaimvnm.eeccauooaasmcmnn)d)c) ococyforooooJapipemumerarhSSatitttaioooovnccn.kk.aiinrPnPgylgeleesQraautassehteeestMthccioeoionnnMtestaaicsngctntaoeNNrsatdaonintscancyygPPRRoo(oohllldusdlrtnQiaioiunnnneggsaGCaototnonDDtnteroneollaltlaasAA.gCCgeoeonnnnccssyyuult((la60na55t1r1s-.2((2696957571-1.8-.8666696907670-.5oo5f1r15522 jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PlPeleaasseerreettuurrnntthhiiss oquueessttiioonnnnaaiirreettooDDeellttaaCCoonnssuultltaannttssbbyvMMaayy99.. 22000088iinntthheeeenncclloosseeddssttaammpoeedd,,sseellff-aaddddrreesssseeddeennvveellooppee.. Questonnaie completed ty: nude. Ctr Questionnaire completed by: nati nd Title Cte, Fits. Fie Bepariment Fire Department SO7-29/~ 8413 Phone Number Toe Phone Number a Date FLiorAderenss Bails FO 0 tho tusic Core E-Mail Address XXilnnooggeenn'" none: 651.679.51080050 477 TATE Fok: S91E309433 mown delins Rca Phone: 5910 Rice Creek Parkway 65:[.639.9449 / 800.477.74:[1 Fax: Suite 100 St. 651.639.9473 Paul, HN 55126 USA www.deltaenv.~:em 22223333..00009933 STATE 02826905 STATE_02826905 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire TrPaeiri)npg e Firefighting Foam Use in Fire ping 1. Dons you Department carat hs yous Dron holy iad Coss Ace Clos Boas Does your Department currently or has your Department historically used Class A or Class B foams for Rapa firefightiny~erations? 7 ve prossoato uesion \/Yes - Proceed to Question 2 No-Sgn hebaofchkl form an tum 1 Dota Consults No - Sign the back of this form and return to Delta Consultants 2 toot CoCo ns 2. How often/j~ Class B or Class A foam used in response to fire calls? oak oties p-- fa V 0-25% of fires 25-50% of fires 75-100% of fires 3. DDooeess tthhee DDeeppaarrttmmeenntt hhaavvee aaccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm ((CCAAFFSS)) w withiaabut biulitlh t--iinn ttaannkkoonnititss eennggiinnee((ss))?? vveos vi/-'YNes o 4. iwoheni fa andi ang res? How often is foam used in training exercises? vost Very cunny semi-Amually __ Weekly __ Semi-Annually 1 naval Monthly V" Annually eamualy __ Quarterly __ Bi-Annually __ OOtthheerr ((pplleeaassee ssppeecicfifyy)):: 5. How macho sod ur tg over? How much.,].oam is used per training event? 7 Cos un gues s f ours V . Less than 5 gallons __ 5 gallons sto amir __ 5 to 10 gallons __ MMoorree tthhaann 1100 ggaalllloonnss ((pplleeaassee ssppeecictiyfy):): PA -- In training, where does the spent foam go? __ SomSeser ___ SentarySewer ___OnSteSepic 1 Ground __ Storm Sewer __ Sanitary Sewer orm ome dommbr oT Other (please describe): __ On-Site Septic round 1. Whee dois niaken lc? lcs cd tos, ersaction over pac octn Where does/did the training take place? Please include address, intersection or other specific location praCsotrorereiifioimntrsbntmornion Chron Jelly Vere plots information for current and past training areas. XInIongo#ge~n"'. ............. 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.74:~ Fax: 652.639,9473 www.deltaenv.cem 22223333..000094 state ozs2es06 STATE_02826906 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 2. What ypo(s) an ranks)of oom cr wor use ro and nh ay he prime, bot re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Capon on rar f appheane' Floats neck al at 435. response and in training (if applicable)? Please check all that apply. Tipeorem BandofForn TYUaosmteonarigtnl?e AAmmUuosauednlty CUusreesn?t HisUtsoreidc?ally Type of Foam Ly FGloissntAquaeousn 22s 20 AYBN Class B Aqueous Film-Forming Foam ) GF vard (AFFF) Brand of Foam Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? ClCalassss BBAlAclcoohhooll-- Rosny, OS FE -- cassBPoon AFARFeFFsFiFstant (AR)Class B Protein Cassa ---- Class B Fammopotfopn) -------------- ---- Fluoroprotein (FP) Clas Fim Class B Film- a) J Forming < Fropotsin Fluoroprotein ((FFFFFFPP)) CossBARFEP Class B AR-FFFP Css ASH Class A-B Hi Bouton foam = Expansion Foam i NE A =] CW "2 Gtaumnefen x LL Ee ao yo Training Foam over -_ _-- _-- _-- Other Thank you or your time and copperaon. Pleas cotact Nancy Roding at Dea Consultants 651-607-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 o eadhmadlaomcomo sn Soskinge at he Minnsots Poluton Coro Agency (651 297-5600 or or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or eS ger te 1) 50 hve an uestons regain is estore. jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. o naire to lt Consultantbsy June. 20i0n h8e | Please return this questionnaire to Delta Consultants by June 6, 2008 in the enclq~ed sta~ `addressed envelope. Fo Ne The Questionnaire_~ c_o~'m_I_1_p1~leted by:._~% Romeadi The Bagi; Coa; e Crh ve) Name and Title Fi Depa(rmleentar lovopkpLia ee Dap Fire D2ep8ar-tme1nt6-3194 (gnelavork Calision Lolen 13-0 PPhhoonnee NNuummbbeerr DaDtatee - - -------------------- E-Mail Address meXXilnnoogg~eAn'. eh AA SR 5910 Rice CrLpalr ESTT100 Creek Parkway Suite 100 SS pe FA EU St. Paul, MR 55126 USA 22223333..00009955 STATE 02626507 STATE_02826907 DELTA QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee. iinn FFiirree TTr.raaiinn_iinngg Nie ddep bon 1. rDDoeootesgs hyyioonuugrr oDDpeeapparararttommneesnn?tt cuter currently oorr hhaass yyoouurr DDeeppaarritmmeenntt Hsoricaly historically sed CaAosCasss To used Class A or Class fas B foams orfor ~ firefighting opVeorast.ionPsr?oceod to Question __ NYoesS-iPgrnocteheedbto Qaoufestchtiiosnfko2rm and rturn t Delta Consultants No - Sign the back of this form and return to Delta Consultants 22.. HHoowwofofetennisisCClalassss B oorrGCllaassssAAffooaamm uusseedd iinn rreessppoonnsseeftoofecals? fire calls? x~ D sores 0-25% of fires ssootties __ 25-50% of fires __ 1si00sotties __ 75-100% of fires 33.. DDooeess tthhee DDeeppaarrttmmeenntthhaavvee aa ccoommpprreesssseeddaaiirrffooaamm ssyysstteemm ((CCAAFFSS))wwitithh aa bbuuiilltt-iinn ttaannkk onn iittss eennggiinnee((ss))?? NoveYes 4. How often's foam sedin taining exercises? 4. How often is foam used in training exercises? Newer weedy ___ mown Cuan __. Never __ Weekly __ Monthly __ Quarterly -- Semiamuaty 2S Aomnty arammualy __ Semi-Annually ,/~-- Annually __ Bi-Annually Over asaspect __ Other (please specify): 5. How much foamis usec pe varing event? How much fLoaomssisthusaend gators per training event? 5galons MLoesrso nanthan 10 glo 5 gallons (please speci)5 gallons More than 10 gallons (please specify): X_ 51010 gatons .~__5 to 10 gallons Fin =(a Bi Paka Fa rent 5. 6. IInnttrraaiinniinngg,, whheerree cdooeess tthheessppnentt ffooaammggoo?? Storm Sewer __ Sanitary Sewer Onsie Septic round Storm Sewer __ Sanitary Sewer Other (pleasedescribe): mu der of Lhuie __ On-Site Septic l_ o_ kyGroound __ Other (please describe): ~ ~ o-~ ~ iz~ -~,~.~ ~.. ~ 7. iVWnihfnoeemrreaetddiooooenssf/ioddriddchthuee rttrraaainnniindnggptaaaskkteerappillanaciceneg?? ePPalleesaa.ssee Cinocloukdesdoanr,es,fersLacitodnsraler include address, ~tersection or other speci specific cation location information for current and past training areas. | GC eels aul CCaat Seddeecnge Coke -- var fg Fp Lobrage - | oC Twaty of wo delb Lar i mck colge OOVVEERR-- Kinogen Re ee Ty ST TS ee 59:[0 Rice Creek Parkway Suite 100 St:. Paul, MN 55126 USA 22223333..00009966 STATE 02826908 STATE_0282 6908 DELTA wiHO, X QQUUEESSTTIIOONNNNAAIIRREE FFiireffiigghhttiinngg Fooaamm UUssee iinn FFiirreeTrTarianiniinngg is mr) msro ensy Coston 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all TTyyppeeooffFFooaamm cgemmpiemesonntrien Class B Aqueous Film- Forming Foam (AFFF) Jy Class B Alcoholme Resistant (AR)-AFFF -- Class B Protein T&are-- Class B Fluoroprotein BBrraannddooffFFooaamm - vgn that apply. Used in Training? YYeess oorr NNeo Aas Amount --Used Ainnnuaulallyly Current Use or HiHsisttoorriiccUUssee?? (FP) Class B Film-Forming germ Fluoroprotein (FFFP) ---- Class B AR-FFFP Class A-B Hi mi. Expansion Foam rg Class A Training Foam by ShklFoiEr52g0BoemetGos BoB nels Other i str rd cst, Ps cot ary ig Cols Cn63031152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 ot rnSe eb in or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. tale ol Contre 50 208 rd sm Please retur~ this questionnaire to Delta C~,,,s,,,t=n,~ adadddrreesssseeddeennvveellooppee.. gp Questionnaire completed by: | ef TUCA -- --s ee. Name aCl oe frrear fooostont Chred _mniCnitasd sfl Fredea pt my Phone 3250 Number 433(29 (Home ~//~'~YO Z'~-~) eenE-Mail Address Da9te 23-08 XlnJIongoegenn"" 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 U~A Phone: 651.639.9449 ! 800.477.7411 Fax: 65:1.539,9473 www.deltaenv.~'~m 22223333..00009977 STATE_02826909 QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training X Firefighting Foam Use in Fire Training 1 DPEELSTASC----------o-- TQha e! XC Yes- Proceed to Question 2 fiDreofeisghytionugroDpeerpaatrtimonesn?t currently or has your Department historically used Class A or Class B foams for firefighting operations? z~ Yes - Proceed to Question 2 __ No - Sign the back of this form and return to Delta Consultants A How often is Class B or Class A foam used in response to fire calls? x aaron ate sroomatn ,~_.. 0-25% of fires __ 25-50% of fires 75-100% of fires op ca ost CA ts Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? J or Yes S 3 wo PR ram Tak with wbodte 4. How often is foam used in training exercises? fm -- en o.ny iet"y __ Weekly __ Monthly __ Quarterly __ Semi-Annually __ Annually XC ter ase spc Lotion eof Besa Dre Dope __ Other (please specify): SE How much foam is used per training event? __ Bi-Annually > ~' LLeessss tthhaann 55 ggaalllloonnss __ 55 ggaalllloonnss __ 55ttoo 1100 ggaalllloonnss __ More than 10 gallons (please specify): ------ 6o In training, where does the spent foam go? 2Storm Sewer SoniorySower ___OnSteSepic >Ground .z~. Storm Sewer __ Sanitary Sewer SE ____ Other (please describe): __ On-Site Septic >'~ Ground A -- Where does/did the training take place? Please include address, intersection or other specific location God Wnicky information for jy current alt= and past a Yosiuing training Fg areas. Ha lo fa0c/hiloldsy o5n BAonson A foeq Kiss XInog~; 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA Phone: 651,639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv,cem 22223333..00009988 STATE_02826910 QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training Firefighting Foam Use in Fire Training 5 Vina type(s) and brands) of foam ar o weruse now and in the pastby tho Deparment,Lot fr fro 8_ What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire exponen in rang fappicabie Pease cock i at apy response and in training (if applicable)? Please check all that apply. Cimrommgron Masel Gl8oAquseouss TTyyppoeooffFFooaamm Class B Aqueous BBrraannddooffFFooaamm Usedin Used in Toning? Training? YYeessoorrNNoo Amount Amount Used Used AAnnnnuuaallllyy Currently Currently Used? Used? YYeessoorr NNoo Historically Historically Used? Used? YYeessoorrNNoo FFF) Film-Forming (AFFF) Foam ClBaAlscohsol Class B AlcoholSrEoy Resistant (AR)- ACFmFsF dPotn ---- -- ---- ---- -- Class B Protein cFasos onfp) Class B ------------ ---- ---- ---- Fluoroprotein Cla8Fsims. Class B FilmFToomiontg s, Forming (FP) = -------- ---- ---- ---- ---- Free Fluoroprotein (CFoFFsPs) paRFER Class B AR-FFFP ClCaossmAiDnHtom Class A-B Hi ------------ ---- ---- ---- TT Expansion Foam CSaissla om Class A persur STEER Se 55 Meo MNee2o TL ol en -- omer Training Foam _-- =D OTOTFhhthaarennorkkoymyoo@uuffooarryyooauurr tiiamneecanoanmncd)ccoooypooepureaartavitoieonn.a. nPPylelqeauasessetcicooonnnsttaarccettgNaNaradnnicncgyyRhRoiodsdrnQiinnuggeaasttDDeoelrlttaa.CCoonnssuullatarnts((565511--669977--55115522 or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. iE . self-addressedenvelope. PlPeleaasseerreettuurrnntthhiiss qquueessttiioonnnnaaiirreettooDDeellttaa CCoonnssulutltaannttssbbyvSSeepptteemmbbeerr3300,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,, self-addressed envelope. Questomsiscompleted by: rs ~ pte) Questionnaire completed by: NmYeowawTePatho Asst Loe Clint = Name and Title " _e Fre garment ke Fire Department Phone 3mb0a-r 28-2452. D9ri-e 2-0% Phone Number Date Emad E-Mail Address BLXlnogen" ror oe PST, 5910 Rice Creek Parkway Phone: 651.639.9449 / 800.~r77.7411 Fax: TT TRIES -- mts Suite 100 t. Paul, iVlN 55126 USA 652.639,9473 www,deltaenv,com 22223333..00009999 STATE 02826911 STATE_02826911 DELTA FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNiAAnFIIRiRErEe Training Firefighting Foam "4 UseJn--Fire Trai ing, \ ugh) 1 ots oe egret crete yor oper os 8 ams Does your Department currently or has your Department historically us(~d. Class A or_)Class B foams for potion ties = firefighting operations? Ves Proto eQueosidnz by Nanas Yes - Proceed to Question 2 L.~ No he baka of hi form and tun ol Consults __ No - Sign the back of this form and return to Delta Consultants 2 ow fen Cle or Cl Afoam asd eon fo cat? 2. How often is Class B or Class A foam used in response to fire calls? AO_ oases 0-25% of fires _255025%-5a0%forf efiress 7755-:140000%% ooff rosfires 5. Dons~ho Copornan hve compres a fom yo (GAS) il buinark o onl? 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? X ves ,~ Yes No 4 HrsGD 4. How often is foam t.lsed in training exercises? or ewer ony auary __ Never __ Weekly __ Monthly TT ontaomaty | 3C pmaty sAmmaty __ Semi-Annually ~ Annually __ OOtthheerr {(pplleeaasseessppeecctifyyy): __ Bi-Annually Quarterly 5. How mach oom scpar sng oven? How much foam is used per training event? 0 Los vngaens | sootons soon 7~ Less than 5 gallons 5 gallons PAA -- __ More than 10 gallons (please specify): __ 5 to 10 gallons 5. nin, wherdouspsrt eam 7 In training, where does the spent foam go? Taare Onste sete ros __ Storm Sewer __ Sanitary Sewer Oter (aso dre __ Other (please describe): __ On-Site Septic __ Ground 1. Whore dont ing plac? lose cud ros, asain ole spc alan 7. Where does/did the training take place? Please include address, intersection or other specific location emVo eta ouso , = hio ce bounsing - information for current and past training areas. Kinogen Xlnog,e.8: .............. OOVVEERR-- Phone: REL 5910 Rice Creek Parkway 651.639.9449 / 800.477.7411 Fax: LTR Suite 100 St. 651,639.9473 Paul, MN 55126 USA www.deltaenv.ern 22223333..00110000 stareozsze012 STATE_02826912 ww 5 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5. Wat yorands ante fgoasm acre rwuesr scoradckoawh tndoin hepa by h Deana, re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. rUesdainm Amooounnt CCulreearn"t His"toericdally TTyyppeeooff FFooaamm BBrraannddooffFFooaamm Used in Training? YYeessoorr NNoo Amount AAnnUnnusuaealdlllyy Currently YYeeUsssooedrr ?NNoo Historically YYeeUsssoeodrr ?NNoo GSlasos 8tAtquecuos ALge F< red, pts 250le les Class B Aqueous frie : ios Film-Forming Foam (AFFF) Class B AlcoliolCT Resistant (AR)hsAFFF ota deplore ct, Coront Begridls, Revi & crmapeatts mmr ee Class B Protein case Class B anf) -------- ---- -- ---- ---- Fluoroprotein (FP) Gls in Class B FilmFoi Forming en ------ mo ---- ---- Fluoroprotein en (FFFP) Comspuse Class B AR-FFFP G Garo ABy H ---------- -- mE, TT 9 Class A-B Hi Class Expansion "sp Foam Nase 530 Mee Mes TangFoon oT To Training Foam over -__- -- = = = Other akyou or ota copetn. Plas ora Noney Rdg st Dolls Consus (351.697.5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 samy com Foo ov ay esos roe Qoeanra or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. PPllaeaasseerreettuurrnntthhiiss qquueessttiioonnnnaaiirreettooDDeletltaa CCoonnsuslutltaannttssbbyySSeepptteemmbbeerr1199,,22000088ijrnP-tthhee-eenrrcclloosseedd.sst~aammppeedd,, sesleflf--aaddddrreesssseeddeennvveellooppee.. - Questonaiecomplety v oTn olob Questionnaire completed by: RaTdoTpaee Chisl Kao Decoslea _ Name and Title Colevans ED. aee 21% -259- Fire Department 3206 PPhhoonnee NNuummbbeerr ~ q-22-0% DaDtatee TT E-EM-MaialilAAdddrderesss.s XlnIonoggeenn"' Phone: 5910 Rice Creek Parkway 651.639.9449 / 800.477.7411 Fax: -- m Suite 100 St. Paul, MN 55126 US#, 651.639.9473 www.,~eltaenv.com 22223333..00110011 stare02826913 STATE_02826913 DELTA wbs ibs FFiirreeffiigghhttiinn`QggQUFFUEooESaaSmTTmIIOUUONssNeNeNAAiiInIERRFitEEi;er.e_TT_rraaiinniinngg So m nsa ence r etc y oS nt Does your Department currently or has your Department historically used Class A or Class B foams for firefighting operations? Z ~O YYeess-- PPrroocceeeedd ttoo QQuueessttiioonn 22 __ No - Sign the back of this form and return to Delta Consultants [ 2. HowoftsCeosns BorClaAfsoasr usoin osponso ore cals? Drcgarene3f ow 5 a How often is Class B or Class A foam used in response to fire calls? m-~_~.~..~_~_~ ~ % ~ ee = 100-2-255%%oofffifires 2255--5500%%oofffifirres 7755--110000%%ooffffiirres pears + cores spn an mt sr Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? = 2 es on bedi atcgn stotske No 4. How often is foam used in training exercises? on = a Never __ Weekly __ Monthly __ Quarterly free. nih wr Semi-Annually __ Annually __ Bi-Annually >= Over pease soci) _oc.c.axsnrion . Other (please specify): o c~. ~~ ~ + rors aero ) How much foam is used per training event? ZO Lessthan'galons. 5gallons storms f~ Less than 5 gallons __ 5 gallons me __ More than 10 gallons (please specify): __ 5 to 10 gallons 6. IInn ttrraaiinniinngg,, wwhheerree ddooecss tthhee ssppeenntt ffooaamm ggoo?? I ons so ce __ Storm Sewer __ Sanitary Sewer me __ Other (please describe): __ On-Site Septic ~ Ground pee bt es et p os mtre t Where does/did the training take place? Please include address, intersection or other specific location Te"L - Lo hres information for current and past training areas. EcoTok bere etd. Snr OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, P1N 55126 USA Phone: 65:[.639.9449 / 800.477.74:[1. Fax: 651.639.9473 www.deltaenv.oem 22223333..00110022 STATE_02826914 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5 Vina type(s) and branodfifso)m ar ower used now and nthepast by the Dopariman, bot fr re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tesponce and nami SPICES Poss crac a ht ap. response and in training (if applicable)? Please check all that apply. TUasmeidnign? AmUosuendt CuUrseedn?ty HisUtosreidca?lly TyTyppeeooffFFooaamm ClBoAcsuceos Fimrommgrom Class B Aqueous Film-Forming Foam (FF (AFFF) ReGstaoBnsAlcRoysh,ol J -- Class B Alcohol- Resistant (AR)- er AFFF Compote -- Class B Protein casss Class B Faroptan (9) en Fluoroprotein (FP) Class Fam Class B FilmForming Forming Foes -- Fluoroprotein fs (FFFP) CommaEER oo -- Class B AR-FFFP Class ABH: oo ~ Class A-B Hi pansion Foam Expansion Foam ClassA bustSilegx ge 0S yw Yo Class A A Training Foam over -_ Other `BBrraannddofof FFooaamm --Newe-- Used in Training? YYeessoorrNNoo Amount Used AAnnnnuuaallllyy Currently Used? YYeessoorr NNoo Historically Used? YYeessoorrNNoo Thank you for your to and cooperation. Please contact Nancy Roring at Data Consultants (651.6075152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 Co rodnmAaaae a) Hos hve ay Qo raring i stole or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. PPlleeaasseerreettuurrnntthhiissqquuesetsitioonnnnaaiirreettooDDeellttaaCCoonsnuslutltaannttssbbyySSeepptteemmbbeerr3300,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,, self-addressed envelope. Questannarocomplied b: Questionnaire completed by: Name svg TeLota le Name and Title _FCieoDwepgarement TM- . Fire Department 507-265-3435 Foran Phone Number von, -- {e-- les ~-- -25-0f Date EE--MMaailil AAddddrreessss XHKlnwoogg,ee.nn"n oo 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.com 22223333..00110033 STATE 02626915 STATE_02826915 QQUUEESSTTIIOONNNNAAIIRREE FFiireffiigghhttiinngg FFoaamm Ussee iinn FFiirree TTrraaiinniinngg DELTA Cid 1 Do you Opncoreyoe yO rtcfggeAyGss os Does your Department currently or has your Department historically used Class A~'r Class B foams for eetghing oatons? These firefighting,,,...__._..~operations? ES a brani auasion Pees r F/"~J Yes - Proceed to Question 2 ~~ Nox Sign the backof his form and returton Dla Consultants No - Sign the back of this form and return to Delta Consultants 2. Howaten'sClass Bo Cass Afoa us nespns tof cals? 2. How often is Class B or Class A foam used in response to fire calls? Se D2swotires 25.5000 tek ~ 0-25% of fires 25-50% of fire~ 75.10% ot res 75-100% of fires 33.. DDooeess tthhee DDeeppaarrttmmeenntt hhaavvee aa ccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm ((CCAAFFSS))wwitithh aa bbuuiilltt-iinn ttaannkk oonn iittss eennggiinnee((ss))?? OevesYes 4. Howoltnis foam used in aning eves? 4. How often is foam used in training exercises? New wey ___ how cure __ Never __ Weekly __ Monthly __ Quarterly To senidmaty___ Awcaly Sudmually ~ Semi-Annually __ Annually __ OOtthheerr ((pplleeaassee ssppeecicfifyy)):: __ Bi-Annually 5. Howmuch foam Isuedpor vaiing sent? How much foam is used per training event? Loss than gators. __ gallons __ Less than 5 gallons __ 5 gallons Hors han 10 ators (please spc. __ More than 10 gallons (please specify): 6. Intaing, heredoes th spenttam go? In training, where does the spent foam go? 5010 tons 5 to 10 gallons Or lease dose) __ SSttoorrmm SSeewweerr __ `SSaanniittaarryy SSeewweerr __ Other (please describe): __ OOnnS-Sititee -- SSeeppttiicc "X~_ GGrroouunndd 7. Wfhaur dsosct tih raaringdakeeplacee? lnease nde adres, inesectan other sci locaton Where does/did the training take place? Please include address, intersection or other specific location Nagios information for current Foul and past training areBasu. eas Kinogen: OOVVEERR-- rane: 655.639.0005 1 800 47 SHIT Fok: GE1033 947) Ms ARIALLA 5910 Rice Creek Parkway Suite 190 St. Paul, MN 55126 LISA Phone: 651.639.9449 / 800.4-77.7411 Fax: 651.639.9473 www,deltaenv.com 22223333..00110044 sate 02826016 STATE_02826916 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNNeAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5. VTiensaoyrpao(asn)danndamrinagnopfspfol)ameaaeyorPwaesrseeucsheodcknaowhaantdaIpn h.e past by he Deparment, bono re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. wsotfeam Bandaffoan TVUenstendegirnye AAmmUuosuaendlty YCeuUsrsorednr?thyo _ iYseUtssoeerdcr?alley Type of Foam CussBAqeos 3 Cole Class B Aqueous Film-Forming Foam Fen (AFFF) Cl8aAcshast Class B AlcoholSe Resistant (AR)p=AFFF CEE ee me mm ---- ---- Class B Protein cFoaasprsotein (fp) ---------------- _---- -- Class B Fluoroprotein (FP) Class Bin Class B FilmFo Forming Farootan Fluoroprotein fo (FFFP) CBRE om -- -- Class B AR-FFFP Brand of Foam tb Used in Training? Yes or No Amount Used Annually Currently Used? Yes or No Historically Used? Yes or No Le ClCasrsaA8t14on ---------- ---- ---- --_-- Clase A Tongrm Training Foam over = = _ Other whsuee yu mical de Ne Thankyouforyour me anc cooperation. Poss carta Nancy Rodingat Dota Consuants (851-667-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 einscom) fs hove ay auesions raging te quesiomae or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. PPleleaasseerreettuurrnntthhiissqquueessttiioonnnnaaiirreettooDDeellttaaCCoonnsuslutltaannttssbbyySSeepptteemmbbeerr1199,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,, `sseellff--aaddddrreesssseeddeennvveellooppee.. =~ Questonnaiecompetedby. va ny Questionnaire completed by: NCampe aned 17C2 aiteb hee Jolin Name and Title FroCo(sooak Gon Te pt Fire Depa~_~rtme~t Pho L Numbee r o 22M ewae-24-0% Phone Number ~ ~z- "~x-,& f ~,~ Date Kinogen E-EM-Maialil AAddddrreessss Xlnogen' , S-- on 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA mone 651.679.3451 85T0A AFa 0) 030 01%) masaARRSaem Phone: 651.639.9449 / 800.477,7411 Fax: 651.639,9473 www.deltaenv.com 22223333..00110055 state 02826017 STATE_02826917 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg DELTA vZ ee U oN 1. frDDooofoiesgshyyioonuugrroDDpeeerppaaatrritmmoenensnt?t cutenty curr~ntlg oorr h~aass ygoouurtD~eap~aar~mmeenntt isoricaly h~stor~callg uusGseed~alasssA~ ser Cass Class BB ffooaammss ffoorr 20 Y-eProcseod firefi~ht~n~ o~erat~ons? to Questio2n he! ~ NYoe.sS-iPgrnocteheedbatockQoufestthiiosnfo2rmandratur to Delta Consulta~ nts ~ No - Sign the back of this form and return to Delta Consultants 2. Howofen'sClassBor Class Afoam usad i esponso o frocals? 2. How often is Class B or Class A foam used in response to fire calls? %_~t/o 00-22s5%%ofoififeirse,s 0 255of0r%es 7510of0re%s __ 75-100% of fires 3. Dos the Deparment nave @ compressed a foam system (CAFS) wilh abut tankonis ngine(s? ._~ 25-50% of fires 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yor 0,~o NoYes No / ~ 4. How often foam usadin riningexercises? 4. How often is foam used in training exercises? Never Weaidy Monty Quarety Never __ Weekly __ Monthly __ Quarterly SemAnnually Annually BiAmualy __ Semi-Annually __ Annually __ Bi-Annually PO. OOtthheerr ((pplleeaasseessppeeccitfy): ok Awe lokernQ-- -- 5. How much foam iusec pr raining event? 5. How much Less foam istuhsaend5pgearltlroaninsing event? Soallons __ MLoesrsetthhaann 510gaglalollnosns (p_ eas_ e spe5cgia:llons __ More than 10 gallons (please specify): ~J 51010 galons __ 5 to 10 gallons 6. Inraining, whore does tho spont foam go? In training, whSetorermdoSeeswethre __spent foaSmanigtoar?ySewer Other __ Storm (Spelweaesrede_sc_ riv.eSanitary Sewer __ Other (please describe): OonSieSepto 2~c~ GGrroouunndd __ On-Site -- Septic 7. iWinhhforerremeatddioooeonsfso/cdiuiidrthrheeentatranaiinninndggpttaasaktoerappillanacicenog?? aPPrlleeeaaasssea Iinncclluuddee aaddcdrroessss,, iinntetrseerctsioenocortrooittohhenrr speci specific llooccaattiioonn information for current and past training areas. Xinogen: Xlno~,A'_ .......... OOVVEERR-- _- rere 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA Phone: 651.639.91584550 475 TAT Fok: 631.639.0473wnArla.om Phone: 651.639.9449 / 800.477.741! Fax: 651.639.9473 www.deltaenv.com 22223333..00110066 STATE 02826918 STATE_02826918 Firefighting Foam Use in Fire QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire ri Traini ,g What ype nt a fc ar. re aodnt nd pe Depart, fr 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire amt response and in training (if applicable)? Please check all that apply. FU... EI S WTEi covy sltyvy Type of Foam Gos Ans ---- -- oo Class B Aqueous Film-Forming Foam = (AFFF) Gos ct Class B AlcoholGuo Resistant (AR)=AFFF [nar Class B Protein ams Class B ER ney ---------- -- -- ---- -- Fluoroprotein (FP) pmoems J21 y Class B FilmSmeten --_ -- = - Forming Fluoroprotein Fes (FFFP) rn JE Class B AR-FFFP GCemianWW _ Class A-B Hi Expansion Foam po = Class A i -- Training Foam oer -- -- = Other Brand of Foam Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? ork ys sour tdcomet. rss conctNery Friar ek Corsa 051.487.5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 ee Sores en sono or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PPlleeaasseerreettuurrnnththiissqquueesstitioonnnnaairireettooDDeellttaaCCoonnssuuitltaannttssbbyyJJuunnee 66,, 22000088 nintthheeeenncclloosseeddssttaammppeedd.,sseelflf:- `aaddddrreesssseeddeennvevleo/oppee.. Maver Schaschoree QQuueessttiioonnnnaaiirree ccoommpplleetteedd bbyy:: dD ugteo s Shv ee eebsen Name and Title chef _LE220-269-3016 Fire Department f'- ?ot b Phone .Number &-o1ip0 Date E-Mail Address AAA .:...)W)B,6)hL XXilnnooggeenr" eT 5910 Rice Creek Parkway Phone: 65:1.639.9449 / 800.477.7411 Fax: - Suite 200 St. 651.639,9473 RITE TETTEGER Paul, MN 55126 USA www.deltaenv,orn 22223333..00110077 stare coments STATE_02826919 DELTA FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training & Firefighting Foam Use in Fire Training EW 1. Dos you Deparment cent o hasyourDepartment Historica usd ClasAs or Gass8 foams for Does your Department currently Or has your Departmeni historically used Class A or Class B foams for renehing cperaions? firefighting operations? %_ Yos Proceed to Question 2 Yes - Proceed to Question 2 No. Sign the baoftcisfkor and return to alta Consultants __ No - Sign the back of this form and return to Delta Consultants 2. Howften's lass Bo Cass Afoam used in espanse oo cals? 2. How often is Class B or Class A foam used in response to fire calls? 4 ommaes a. .~. 0-25% of fires 25-50% of fires 50st tos 75-100% of fires 3 Dos the Deparment hove acompressafoam sysam (CAFS) ith bain arkon is engine)? 3. Does the Department have a compressed air foam system ~,,~,A, S) with a built-in tank on its engine(s)? veYes Te ~_ No 2. Howotenis foam uso n raing exerees? ANever Weekly How often is foam used in training exercises? ~/i Never __ Weekly _ ___ _ MMoonntthlyy _ __ QQuuaarrtteerrlyy TT semeaty sol semua __ Semi-Annually __ Annually __ Bi-Annually or (lease spect: 0 __ Other (please specify): 55.. HHooww mmuucchh ffoorgnfa,,~ i~ss uusseedd ppeerr ttrraaiinniinngg eevveenntt?. -- vemos oS _ st10 akon Less~ ".fhlal.9ons~ ~..~._.----~5gallons ------z 5 to 10 gallons 6. Ia ni558~rg e~sptooaf5o7 asomoctpr----""___ 6. In training, w~.h~r.e-d___ pent foa -- SomSews __ SantaySewer onSRA rome _--- .-~-~" Storm Sewer Sanitary Sewer -------- -- _-- _ OOtthheerr ((pplleeaassee ddeessccriribbee):): On-Site_~S.S~pt~c ..... .,/ Ground Fromasan tor cute an pod : 7. 7. W Whheerree ddooeess//ddiid4he t~ take ppllaaccee?? PPlleeaasseeiinncgJlue~eaaddddreressss,, iinntteerrsseeccttiioonn oorr ootthheerr ssppeecciiffiicc llooccaattiioonn ir~formation for current and pastT~'atn~.~&~.~ ee ~~ Hwogere Xlnog,e.b)o ............. OOVVEERR-- Prone: 631.635.91484090.433.74F1o1ki 851.630.9473mm EIiARRY. CoM. 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenw.em 22223333..00110088 state 02826920 STATE_02826920 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg TWeishpaortsyepesn)i adabrnacts() faoppawmiaeyorPweeas scoencoawhatnd a5 th pas yiDepron bo or re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire respor~se and in training (if applicable)? Please check all that apply. TUsoendign AmUoseudnt Cuurseendty Hisstoeraic?ally TTyyppeeooff FFooaamm [ry-- Class B Aqueous Ey riot Film-Forming Foam fs (AFFF) Cl8osoteal Class B AlcoholReResistant (AR)peAFFF GosbPoon -- Class B Protein Gases CFFllluauoosrsrooppBrrootteeiinn ((FFPP)) Case im. Class B FilmFai Forming Fraoion _ --_ -- -- -- Fluoroprotein fs (FFFP) Compare o_o Class B AR-FFFP osensi Class A-B Hi nto | -- Expansion Foam Gosh ebsunbod. N40 NN Class A TI, ees | mee met ms en Training Foam over = -- Other BBrraannddooffFFooaamm Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently Used? YYeessoorr NNoo Historically Used? YYeessoorrNNoo oo -- --- Than yoryour ie ndcooperation. Pleasecontact Nancy Roding DiaConstants (65097-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 roe am Fo hove 51 queso orn Gores or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. PPlleeasae se rreettuurrnn tthhisis qquuesetisontniaoirne nairettooDDeettltaa CCoonnssuullttaanntstbsbyF SSeepptetma!~rep~o719F9,, 22000088imntthhee eenncclosleod sesdtsatammppeedd;,~ self-addressedenvelope. petaddussedonions we Ldepleoe QQuueessttiioonnnnaaiirree ccoommpplleetteedd bbyy:: ) Vs 2 FaTmeoonrd Ti Ciel Seolt Gad bs - Name and Title FreDeopasiveert FO Fire Department 520-808-5237 ET a Phone Number a-2oy Date eA E-Mail Address Ninoger: Xlno~.gL ............. 5910 Rice Creek Parkway Suite !00 St, Paul, MN 55126 USA Phone: 651.639.9449 ! 800.4.77.7411 Fax: 651.539.9473 www,deltaenv.cem 22223333..00110099 sate 0226921 STATE_02826921 DELTA vir Lelplos QQUUEESSTTIOINONNANIRAEI_RE_ Firefighting FoamUse inFire Trainin_g Firefighting Foa se ih-Fire CHa SA ST 3R RRSHI Does your Department currently or has your Department historically used C~or Class B foams for eer Co firefighting operations? ~ _2<_Yes - ProtcoQueese tiodn2 -- Luci A sa ~" Yes - Proceed to Question 2 ~ (~~ ~" Con~ul~ts vo ne tis oman rata Come No - Sign the back of this form and return to Delta 2 Hoven Comer Ge Asmar erst ots? How often is Class B or Class A foam used in response to fire calls? Az'L ~ 00-22s5%%ofoffifrireess ___2255:-5500%%ooff ffirreess 775-510-0%o1off0ffiirr%eess CHR SR TBAET RA Does the Department have a compressed air feam system (CAFS) with a built-in tank on its engine(s)? oi Yes -- ~ woNo Howsctvariocsis? How often is foam used in training exercises? on I coms __ Never __ Weekly __ Monthly __ Quarterly semana 3. sw ty __ Semi-Annually .~X:~ Annually __ Bi-Annually ae 0 __ Other (please specify): J ---- How much foam is used per training event? wer S288 eng ~ Less than 5 gallons __ 5 gallons __ 5 to 10 gallons __ L More than 10 gallonE s (please specify): -- 0. inti whore oe the ptm? In training, where does the spent foam go? monn wien ons coms __ Storm Sewer __ Sanitary Sewer er seo sm __ Other (please describe): __ On-Site Septic ~, Ground Tis Sr or A ee AT Ras ier oT Where does/did the training take place? Please include address, intersection or other specific location HR information for current and past training areas,. St Arvoed Cured Kinogen XInog,e.g; .............. OVEERR-- Prone: 651.639.9005 1 800.4713 THE Tob: E31 639.9473mwHoRALASRL.LAR. 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.74!1 Fax: 651.639.9473 www.deltaenv.cem 22223333..00111100 STATE_02826922 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 5 ie na pos) ap d bande)foao ffpoatmasr"eals cersecuhseedcknat ri past ynDeparment,bt or re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire hnt 35. response and in training (if applicable)? Please check all that apply. Typoot Foam Bundotfoam TUVresasdnoirnntye AAmGmoouaondlt CVuireewnst |Hisitosraic?ally Type of Foam ClBaAqsuoes Class B Aqueous CoB Film-Forming Foam (FFF) (AFFF) Ci8Ank e Class B Alcoholee -- -- -- Resistant (AR)p= AFFF CoeBPon ---- -- Class B Protein cases Class B mtnpy mmm ---- ---- ---- Fluoroprotein (FP) Clo8sFiem Class B FilmPog Forming fren | ------------ -- ---- ---- ---- Fluoroprotein fet (FFFP) cabareR Class B AR-FFFP CossraH Class A-B Hi tm = -- ---- -- Expansion Foam Cass fee-- tho toned ZN TTrraaiinniinngg FFooaamm over oo T= Other Brand of Foam zm ~ tq/k~ a ~'~ Used in Training? Amount Used Currently Historically Yes or No Annually Used? Used? 2 FoHaciE el pu| ck 15 paar MN Than youfo your tme and cooperation. Pleas contact Nancy Riant Dgea Conta (151.007.5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 rod aam como ing oo ionosolsPoon Cork Agen (B31 597-0600 o or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or re stn oot You hav ay avetons reg To aos jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Pleas ota tis questitooolne ConsulbtyJaunnet 6,208 he socosedstamp, sot: Please return this questionnaire adaddrderesssseeddeennvveellooppee.. to Delta Consultants by June 6, 2008 in the enclosed s1tamped, self- ~ Rs snd Ti - QuestoFnrnaereecomCplheiteedfby: LS ~Uo Lelepl Questionnaire completed by: Name and Title FewBiTpaerkimveneit ales -- Fire _Fro Da eapmarbtmeerng t qr ziso se9Ss ewoos f s Phone Number Dale Se E-Mail Address oo Kinogen: -- Xlnogen" TR 5910 Rice Creek Parkway T I E Suite I00 St. Paul, MN 55126 USA 22223333..00111111 sate 02826923 STATE_02826923 ELTA aie leghens QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use-ir FirTe ing Firefighting Foam e4r Fl g 1 omen arenty yns Ooprmat sly GigsAYC0 or Does your Department currently or has your Department historically used('Cl,ass A o~C_~ss B los)ms for reins e firefighting operations? 2C Yo-procasdto cussion Yes - Proceed to Question 2 o-ign tbc fh form and rt to ei Conutins No - Sign the back of this form and return to Delta Consultants 2 Foes hse or ClAf ss rose cal? 2. How often is Class B or Class A foam used in response to fire calls? oomattes means rss __ 0-25% of fires __ 25-50% of fires 75-100% of fires 3. DDooeess tthhee DDeeppaarrttmmeenntt hhaavvee aa ccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm ((CCAAFFSS)) wwiitthh aa bbuuililtt--iinn ttaannkk oonn ittss eennggiinree{(ss))?? veYes TeNo 4. oes foam oi rong rcs? 4o How often is foam used in training exercises? ATST esnemtoinwte,s_ souny Monthy seQnuan j.,..-~ Never __ Weekly __ Monthly __ Quarterly Semi-Annually __ Annually __ Bi-Annually ovwpmesesy __ Other (please specify): PR-- How much foam is used per training event? Cn rn lors Sqnors stots More than 10 gallons (please speci): __ Less than 5 gallons __ 5 gallons More than 10 gallons (please specify): __ 5to 10 gallons [TR -- In training, where does the spent foam go? "Simson Saar Sever__Onstosope Gowns __ Storm Sewer __ Sanitary Sewer oven __ Other (please describe): __ On-Site Septic __ Ground 7. Wer costo nario pice? les ct ass, Fitostion ote octi 7. Where does/did the training take place? Please include address, intersection or other specific location Emenolo deevmin swoandy osg. roggy information for current and past training areas. Hwogene XInog~'. ............ OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA 22223333..00111122 state caszeone STATE_02826924 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg Wattonianmce) of pfiocsa eveorssusreadcknaowharn35nh pas yh Dean, Bah re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, beth for fire response and in training (if applicable)? Please check all that apply. Tipe Foam Type of Foam Cl8Asons Class B Aqueous Cobh Film-Forming Foam pss (AFFF) Gres Class B AlcoholGmspae Resistant (AR)- agottm Brand of Foam ob Usain Used in ray Training? veeds Yes or No Amount Amount AUsed Amy Annually Curenty Currently neat, Used? Yoowe Yes or No Mistrial Historically eos Used? Year Yes or No AFFF Cogpen Class B Protein coaesreassnter) --_ Class B Fluoroprotein (FP) Gass Oi. Class B FilmFomine Forming Frggoon -- Fluoroprotein fe (FFFP) A . Class B AR-FFFP Gases Class A-B Hi Smvoton -- -- Expansion Foam cn SoebwProve] _y c5gpe tle Moo Class A 5 Training Foam ober J -- Other harkyou or or tm anc coperton. ise conc Nancy Roding at Dolla Consular (51.087.5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 a amson Hohe ov sy eso ogy os oon, or nrodning@deltaenv.com)if you have any questions regarding this questionnaire. PPlleeaasseererettuurrnntthhiissqquueesstitioonnnnaaiirreettooDDoellttaaCCoonsnuslutltaannttssbbyySSeepptteemmbbeerr3300,, 22000088iinntthheeenclosedstamped, ~~ Daantlesues = >) self-addressed envelope. Gann (ef Questionnaire completed by: FamaCoTae tint 500 Slatfionn Name and Title I gunalig Sapna Fire De3p2a 0-r2t~ 96-3313 Fo Fear Phone Number J w1e0-20% Date Kinogerr EE-MMaaiil AAddddrreessss Xlnog~n" Phone: nT I 5910 Rice Creek Parkway 65:1.639.9449 / 800.477.7411 Fax: NE Suite 100 St. 651.639.9473 a I Paul, MN 55126 USA www.deltaenv,com 22223333..00111133 stare 02826925 STATE_02826925 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg DELTA SN ) (wort) 1. DDooeessyyoouurr DDeeppaarrttmmeennttcucrurrreennttllyyoorr hhaassyyoouurr DDeeppaarrttmmeenntthhisisttoorriiccaallllyyuusseedd Sm Geaavon firefighting operations? nto aosion Yes - Proceed to Question 2 AQ Claassss BBfofoaammssfoforr __ No - Sign the back of this form and return to Delta Consultants Moshi ios Boris Atom sigs 2. How often is Class B or Class A foam used in response to fire calls? osu soot ---- ~ 0-25% of fires __ 25-50% of fires 75-100% of fires Ont Dpatirt ve oprr fo st (CAF) i ano rl) Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? a-Yes How often is foam used in training exercises? oo ey ty curs __ Never __ Weekly __ Monthly __ Quarterly ro, nity sony Semi-Annually Annually OtOhtehrer({pplleeaassee ssppeceifyc).i"~3f~xy2<)[/i,yL~L-.ex..s!~s-~ __ Bi-Annually imo spr mg et? How much foam is used per training event? ot sats serine .}~" Less than 5 gallons __ 5 gallons er en 10 ats Gomer __ More than 10 gallons (please specify): __ 5 to 10 gallons ae 6. In training, where does the spent foam go? men son cnstsoie a_i ~. Storm Sewer __ Sanitary Sewer __ On-Site Septic ~ Ground __ Other (please describe): re ue Nt AOR nOA at? Where does/did the training take place? Please include address, intersection or other specific location nera Frtonetroef eCoaen eo te, At Slect Cross Spud information for current and past training 0reas. wade >pled OF lmao Knog Xlnog~K OVEERR-- rerePhone: ran Re TR RE 5910 Rice Creek Parkway 651.639.9449 / 800.4-77.7411 Fax: CTS 5uiLe 100 St. 651.639.9473 ] Paul, MN 55~.26 USA www.deltaenv.om 22223333..00111144 STATE_02826926 DELTA T5e QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirreeTrTaraiinniinngg, xX Wnt pt) rd rand) fon rw ed ain et hDaparnnt i 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire a te response and in training (if applicable)? Please check all that apply. ---- Used in Amount comers TTyyppeeooffFFooaamm Film-Forming Foam ((AAFFFFFF)) Class B Alcohol- guerre Resistant (AR)- heAFFF Gesrwen Class B Protein JRRs ei) Class B 3M [ght Uden `BBrraannddooffFFooaamm - Training? YYeessoorr NNoo 2M 2/~ py _~0 -- Used AAnnnnuuaallllyy 2 Currently UUsseedd?? Foy ~ -- 45 Historically UUsseedd?? EL Fluoroprotein (FP) Class B Film- fae Forming Fluoroprotein = (FFFP) Co Class B AR-FFFP Cgoemnen, = -- -- Class A-B Hi Expansion Foam or Slex get 20a) Xe gaS Class A ren vm TTP Training Foam over -- Other ~,1/~/(~.~,. _~ TT ryfrour bve edscopto. Pls contt orc Raiar okCoorryalGiha 6r5o1.o44t7.152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 o or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or recom jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. tea ep esstonataeGoersnt ne, 0ointh excess seed cl. Please return this questionnaire to Deila Consultants Dy June 6, 200~ in the enclosed stamped, sell- aaddddrreesssseeddeennvveel/ooppee.. cmc Questionnaire completed bVL_ , TT eter KR Dawe Name and Title TU Chief of Trainin Fire Department ---- Dolh Fit Dp) wTMG-Ac-c Phone Number ToT ne RFUApE-NE93@0-d4o3lo9t6hron.9 < 5 E-Mail Address ET TS InogI...n_'_............. Date Lithmn. gov Phone: 5910 Rice Creek Parkway Suite 100 St. Paul, 1'4N 55126 USA 651.639.9449 / 800~477.7411 Fax: 651.639.9473 www.deltaenv.com 22223333..00111155 STATE_02826927 FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNssNeeNAAiinInIRRFFEiEirree TTrraaiinniinngg VY 1. Doe yourDoparmens ran o as yourDarter trayused Cas Aor Cl BaRm efr Does your Department currently or has your Department historically used Class A or Class B foams for biotite firefighting operations? BE Yor Pocono Gunstont ~ Yes - Proceed to Question 2 EPA -- __ No - Sign the back of this form and return to Delta Consultants 2. Howofln's Gis Boras famud response oro al? 2. How often is Class B or Class A foam used in response to fire calls? DC oosmormes _msowottes ___rsumetties ~" 0-25% offires 25-50% of fires 75-100% of fires 5 Doss tho Daprmnt hve compress foam sya (CARS)wi alin ak nits egrets? Does the Department have a compressed air foam system (C!kFS) with a bJi!t-in tank on its eng he(s)? YoYes XnNo 4 Vortman aS How often is foam used in training exercises? ot Westy won ---- __ Never __ Weekly __ Monthly __ Quarterly Tema puny Leeman __ Semi-Annually ~ Annually __ Bi-Annually Or eas pec -_ __ Other (please specify): 5. Howmycs eam uso os vari oven? How much foam is used per training event? "Be revs gars ___ storogon ~ Less than 5 gallons __ 5 gallons Voro ta0ganons loser, __ More than 10 gallons (please specify): __ 5 to 10 gallons 5. nvr, where dos th sptfoam 357 _<_ stomSowsr __SanitaySewer ~~ _OnSteSeptic In training, where does the spent foam go? ~ Storm Sewer __Sanitary Sewer __ On-Site Septic tert Sogn - __ Other (please describe): ___Ground __ Ground 7. VWifhi~erree ddoocess//cdiidd tthhee ttrraaiinniinngg ttaakkee ppllaaccee?? PPlleeaassee Iinncclluuddee aaddddrreessss,, iinntetrseerctsioenocortrooitthoheenrr ssppeecciiffiicc llooccaattiioonn i ACSE iN doni trib information for current and past training areas. SKinosen: Xlnog~.,.n.~ ................ OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, HN 55126 USA Phone: 65:;..639.9449 / 800.477.7411 Fax: 65:1.639.9473 www,deltaenv,com 22223333..00111166 stareozs2c028 STATE_02826928 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training 8. What types) and brandofifsoa)m ar or were used now and ne pst by the Deparment, both for fro 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tesponssand n aim,(1 appicanle Pease chock al inal apply response and in training (if applicable)? Please check all that apply. Typeof Foam Srandof Foam TVUoosnaionignr? aAmmUeosuesdnlty CuUrssesn?ty HisUtsoreidc?ally Type of Foam Brand of Foam Gins BAqueons Class B Aqueous tor | mm I (AFFF) Film-Forming (AFFF) Foam ClaAlscohsol Class B AlcoholResenon, ---- Resistant (AR)rr AFFF CossBPOn Class B Protein caso Class B Fusroprotan (Fp) -------------- --_-- Fluoroprotein (FP) Cla8Fsism Class B FilmForming -- Forming Fuioramotein -- Fluoroprotein fs (FFFP) CossBARFFP Class B AR-FFFP Gls AH Class A-B Hi anion Foam = CassA Expansion Foam Class A --mane" ramorum 0 Training Foam omar - JEN Other Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? Thor yofor your time and cooperation. Pease contact ney Rocring at Dela Consultants (51,697-6152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 Sonat dataam com) oh Stocking ah Himescta Polton Canto!Agency (851-497-3655 0 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or i Sickingerstote mr) 4704 ave 3) vestons regain 1 cuesiannaie jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire.~.....~ ....~ Please return this quusestionnaire to DDeellttaa ConCosnusulltatannttssbbyy JJuunene6,6, 200~~en-csloeseddststapd~ , pe~ `addddrresseddeennvveellooppee.. Gutorarscomnty Nie Todephoua Har ana Tite Name and Title Lee lokns "ree Conf -- zed Hubbaed or FiFrireeDDepeaprat!~.~nt PowYe Phone Number 21%652-Hu1 /~" / ~ ~ ~ ~ oT we) ow9-3 oF Dale Tote fad Es E-Mail Address XXilnnoogg,ee,nn" OOC1 ............ 5910 Rice CSHL RC REE Creek Parkway Suite 100 St. Paul, MN 255126 USA 22223333..00111177 STATE 02626929 STATE_02826929 DELTA io Pleo FFiirreeffiigghhttiinnQQggoUUFFEEoaoSSaaTmTmIIOOUUNNssNeeNAAiinInIRRFFEiEirree TTrraaiinniinngg 1. Doss your partment cura or ha yur Department socal used lass A or Ga8 fosns or Does your Department currently or has your Department historically used Class A or Class B foams for erating osname? firefighting operations? Vos -Proceed fo Question 2 __ Yes - Proceed to Question 2 No Sign thbackof this orm an retu 0 Dota Consulans __ No - Sign the back of this form and return to Delta Consultants 2. Howften's Glass Bor Cass A foam usd sons oocals? How often is Class B or Class A foam used in response to fire calls? ozs ates 20% tres T5100 ores __ 0-25% of fires __ 25-50% of fires 75-100% of fires 5 Doss ie Driment havea compres i oa sysem (CAFS) with uti ark nf rine? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? -Yes NoNo 4. Howoften's foam usd in ring asco? How often is foam used in training exercises? TT er Week Vary auerery __ Never __ Weekly __ Monthly __ Quarterly fo-- pons oats Semi-Annually __ Annually __ Bi-Annually ivr (eas spect __ Other (please specify): PN ---- How much foam is used per training event? Loss nScolors ___ sgaons __ Less than 5 gallons 5 gallons 51010 goles __ 5 to 10 gallons __ MMoorree tthhaann 1100 ggaalllloonnss ((pplleeaassee ssppeecicfiyfy):): . In aiing, wher docs the spent eam go? In training, where does the spent foam go? Somos Sonar Sever __ Storm Sewer __ Sanitary Sewer CT overGmeteate __ Other (please describe): orswsc __ On-Site Septic __omownd __ Ground 7. Waihmersodones othertain koilagce? wPolans inc actos, seco char speci location 7o Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. XXinInoogge~nK ............. OOVVEER R 5910 Rice Creek Parkway Suite 100 _ St. Paul, MN 55126 LISA 22223333..00111188 sate 02826930 STATE_02826930 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 5 What type(s) and rantofsoo)m ae orwer used ow andin thepastbythe Drimon, boa re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tenaniti tein appa ica he a at sp response and in training (if applicable)? Please check all that apply. rUosaemdiinng AmOoosutnt CuUrseednt Hisstoeriac?ally TyTyppeeooffFFooaamm Ga8Ascvesous Class B Aqueous ARE (A(FAFilFmFFF-FF))orming Foam Caspase BO Class B Alcohola AA -- Resistant (AR)- AFFF FE -- Class B Protein cbassay -------- ---- ---- ---- ---- Class B Fluoroprotein (FP) Cl8aFsie: Class B Filmfan J Forming Pron Fluoroprotein fe (FFFP) I Class B AR-FFFP GCaasrsAoBnHFoam --_-- -- Class A-B Hi Expansion Foam Class A NelSowsfranc N 55e@ Class A BBrarannddooff FFooaamm Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently Used? YYeessoorr NNoo Historically Used? YYeessoorrNNoo Breed) TTrraaiinniinnggFFooaamm -- --_-- -- -- -- OOtthheerr -- _-- _-- Ea orm naam com yo hoe ey sion ren 3 Guess `TThhaannkkyyoouu ffoorr yyoouurr ttimimee aanncd ccooooppeeraratitioonn.. PPlleeaassee ccoonnttaacctt NNaannccyy RRooddnniinngg aatt DDeellttaa CCoonnssuullttaannttss ((665511--669977--55115522 or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. sPsePlelellfefa--asaaseddedrdrrereeettssuussrreennddtethheniinvssvqeqeululeooespptseeit.i.oonnnnaaiirreettooDDeellttaa CCoonnsuslutltaannttssbbyvSSeepptteemmbbeerr3300,, 22000088Iinntthheeenclosed Stamped;.."\ es L(V Lge Questionnaire completed by: Names com Joes pe CuteNe PY Name and Title FDiepaftrhyeon TM> Fire Departtnent Fe 507-327-367 Eo 1o-3-9% Phone Number Date EEM-Maialil AAddddrreessss. KoXlgnogeenr" To orone: 651 639.9045 1 850 0TAIFLok: $51039 947) ws delincas.com 5910 Rice Creek Parkway SuiLe ~00 SL. Paul, ~N 55126 Phone: 651~639.9449 / 800.477.7411 Fax: 551.639,9473 www,eeltaea~.com 22223333..00111199 state 02826931 STATE_02826931 DELTA QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFirreTrTarianiinnigng.., ..". VE2 1. Drotseusr Dkegiatmnencay os we Depend EQtiAorkCH eabne Does your Department currently or has your Department historically used ~or C firefighting operations? - vNeor-SPirno RnT Petals was (4 /,-~:> Yes - Proceed to Question 2 -f'~O-~ L~ ~. tho backof isform an atu to Dots Comte) No - Sign the back of this form and return to Delta Consultants ~ s for 2 HD AA OIE 2. How often is Class B or Class A foam used in response to fire calls? J mionais_rotonatin 0-25% of fires 25-50% of fires __ 75-100% of fires EO-- Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? vsYes ANo + Vowotan som sn vig es? How often is foam used in training exercises? -- ay ory aus Never __ Weekly __ Monthly __. Quarterly omy 50 at "a __ Semi-Annually __(/_ Xo Annually __ Bi-Annually Sven = __ Other (please specify): 5 Houspmer raingvst? How much foam is used per training event? emma an sos ~ Less than 5 gallons f __ 5 gallons __ 5 to 10 gallons __ More than 10 gallons (please specify): SoH . In training, where does the spent foam go? ct at __OnStastots cron __ Storm Sewer __ Sanitary Sewer TT rtp don /~~ __ Other (please describe): __ On-Site Septic ~ Ground Eo -- Where does/did the training take place? Please include address, intersection or other specific location i information for current and past training areas. ~/~ Tie ase a aro f Lol -- 202. ase, 0000000000000 Kinosen OOVVEERR-- ) 5910 Rice Creek Parkway Suite 100 St. Paul, MR 55126 USA Phone: 65~..639,9449 / 800,477.74J. 1 Fax: 651.639.9473 www,deltaenv.com 22223333..00112200 STATE_02826932 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5. a What pot) andibnrgaanodpffspo)eo aarrorlweraesucserdcnaawloatndsnthy past bth Daman, bot for re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. Tipeof Foam bandatfon rUYaseelnodgridnes AAwm"Omoouannlaty YCoCulvreeaerrnd'to HYies"trsoaerrairdcael T~/pe of Foam cise 8 Aqwsous momo Class B Aqueous Film-Forming Foam pss (AFFF) GPBiAA osnet ------ -- -- -- Class B Alcohol- Resistant (AR)- peAFFF Cosson JE Class B Protein cases Class B Flereep -------------- ---- -- Fluoroprotein (FP) Goss im: Class B FilmComa Forming oy || ---------- ---- -- ---- Fluoroprotein fs (FFFP) I -- Class B AR-FFFP Gr es nsn Hl -------- -- ---- ---- Class A-B Hi Expansion Foam Gass - a Class A Tappan TT Training Foam over -_ = = -- = Other Brand of Foam zm Used in Training? Yes or No se Amount Currently Used Used? Annually Yes or No 2500 Historically Used? Yes or No Tray for our me an conperaton. Please contac Ney Rain of Doll Consultants (651-667-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 com Ho have ay aioog vy vs aoanra, or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. sePPlllfee-aaassdeedrrreeettsuusrrenndtethhniisvs eqqluuoeespstetii.oonnnnaaiirreettooDDeellttaa CCoonnsuslutltaannttssbbyySSeepptteemmbbeerr1199,, 2008 2008 ninttehheeeeentcTclloQsseeddssttaamma ppeedd,, self-addressed envelope. tran ogey vi Lely Questionnaire completed by: S ~ ~/~'L&~~'~~ '~ ~~~ RomCaniieTie Caf Pode lacourSicea = Name and Titcleeskine. Fo Prove bmoer FFiirreeuDDoee)ppaarrtt2>mmee1nntt9"--68a77-22772z77 Phone Number S9a- 22-0 Date ---- E-Mail Address HwXolngoeg~nn:' rome: 651.639.9495 1 890.477 411 ToL: S31639.947) Mmradalingny.com 5910 Rice Creek Parkway Suite 100 St. Paul, MR 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 551.639.9473 www,deltaenv.cem 22223333..00112211 stare 02826933 STATE_02826933 DELTA pet FirefightinQQgUUFEEoSSaTTmIIOOUNNsNNiAAenIIRRFEEire Training Firefighting Foam Use in Eir..e__T aining 1. Does yourDepartmencurentyof has your Department strat se-- d lass Aor Ces B foam= sfo Does your Department currently or has your Department historically used Class A or Class B foams for eatghing operations? JX) Yes proces to Questio2n firefighting operations? /z~ Yes - Proceed to Question 2 No Sign the backof his orm andreturn toDatta Consultants __ No - Sign the back of this form and return to Delta Consultants 2. Howton Cass8 or Clase foam usd i csponse fo rs cals? 2. How often is Class B or Class A foam used in response to fire calls? oasattes 25.50% aes 0-25% of fires 25-50% of fires 75.1of0r%es 75-100% of fires 3. Doss he Deparment rave acompress a oan system GAES) itha bl fark ns arin? veo Gudbing weed hack Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? x .?c No ,/ 4. Howe foam used in rsning excises? How often is foam used in training exercises? tor Wook Monty owe Never __ Weekly __ Monthly __ Quarterly SemiAmualy Aovually Shaul Other (leasespecify): accantionditin __ Semi-Annually __ Annually __ Other (please specify): __ Bi-Annually 5. How much foam is se pe rang ven? How much foam is used per training event? Co tesstansakns ____ Sqatons ~'~ Less than 5 gallons __ 5 gallons More than 10 gatos eas speci) __ More than 10 gallons (please specify): stots __ 5 to 10 gallons 6. In vaing, who doos th spat eam 7 6o In training, where does the spent foam go? om Sever __ Santary Sewer __ Storm Sewer __ Sanitary Sewer oveemedeer __ Other (please describe): onste sept __ On-Site Septic Gung __ Ground OT ------------ Where does/did the training take place? Please include address, intersection or other specific location HE prey " Hous information for lvecurrent and wlotar past training areas. otep 2] Brees Rlosto. s ware Lo See Leo ak cay Fib re rus gii n: DoF me sprilic. rae arte OOVVEERR-- XXiInnoogg$e,n~-. ............. rarer 51.675 3T0 TFTTTTobe TTELL) bSLa Im Tam 5910 Rice Creek Parkway Suite 100 St. Paul, PIN 55126 LISA Phone: 65:[.639.9449 / 800.477.74:11 Fax: 651.639.9473 www.deltaenv,em 22223333..00112222 state 02826934 STATE_02826934 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 5. What types) and rans) off ar or versused nowannthepastb heDaparmert, boi fe re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tes50mse and Using f a53catey Passe creck al ht 359. response and in training (if applicable)? Please check all that apply. TUasnendignr AmUoseudnt CuUrseedn?ty HisUtsoreidca?lly ClassBAqueous. TTyyppeeooffFFooaamm Class B Aqueous Fim Forming Foor Arsil3% bo oe Film-Forming Foam rey Cigsly, eis TY G(lAoFsFsF)B Alcohol Class B Alcohol- evan 2 Resistant (AR)AE AFFF CossBProen Class B Protein classe Class B Fooprten(p) -------------- ---- ---- -- Fluoroprotein (FP) Cis8simee Class B Filmfr So Form ing Fauiton | ------ Fluoroprotein Fry (FFFP) CossmAREER Class B AR-FFFP cuss Ash Class A B Hi anton | ------------ ---- ---- Expansion Foam Cassa - J Tnngron Class A Training Foam omer Fk| om em A Other L `BBrraannddooff FFooaamm L.. R y= E Used in Training? a YYeessoorr NNoo Amount 5Used AAnnnnuuaallllyy Currently Used? YYeessoorr NNoo Historically Used? YYeessoorr NNoo Siaars 20:-4400 += -- hark you for your im and cooperation. Please contact Nancy Rodrig at Dota Consuats (6516975162 Tha~qk you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 OF eam com) you ave 3 GUESSregain is Guestomae or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. PPlleeaasseererettuurrnnththiissqquueestsitioonnnnaaiirreettooDDeellttaaCCoonnssulutltaannttssbbyySSeepptteemmbbeerr1919,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,~ _ sesleflf--aaddddrreesssseeddeennvveellooppee.. id = ---- Questionnaire completed by: FarFapn,d Ti Cue {Te Codst Name and Title rotten Fire Departm ent~'O'~'~ U~~'-PhoneLNsumIb1er-4G3- HTT Phone Number -- e7w-23 -0Y Date EE--MMaaiillAAdddrderessss. HwXolnogg~e.,nn" ......... - Phone: 5910 Rice Creek Parkway 651.639.9449 / 800.477.7411 Fax: ree Suite 100 St:. Paul, HN 55126 USA 651.639.9473 www,dettaenv,~om 22223333..00112233 STATE 02626935 STATE_02826935 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training DELTA Coder) 1. Doesyour oparmns cure or ha yourDeparment sora usd GassAcGlass foams for Does your Department currently or has your Department historically used Class A or Class B foams for Fringoperons? firefighting operations? Yes ProtcoQueesteiodn Yes - Proceed to Question 2 No.Sign he backof ns form and return Dla Cansulans __ No - Sign the back of this form and return to Delta Consultants 2 How fen Coss BoClAafosam usd in sponsefo ro cals? 2. How often is Class B or Class A foam used in response to fire calls? oasmatives 25.50% oi es Totot aros 0-25% of fires 25-50% of fires 75-100% of fires 3. Docs the Deparment ave compressed ai fam stem (GAFS) wih a bin akonfs ngs? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? 2 vesYes NoNo 4. Howatifoeamnu'ssd n ving exercises? How often is foam used in training exercises? Cee wes ey awn __ Never __ Weekly __ Monthly __ Quarterly 2 Semionualy 2S ronal sma /~O Semi-Annually .F Annually __ Bi-Annually __ OOtthheerr ((pplleeaasseessppeectctifyyy): [RO ---- How much foam is used per training event? 20. Loss han gators soatons ~ Less than 5 gallons __ 5 gallons S110 gat0ors __ 5 to 10 gallons __ MMoorree tthhaann 1100ggaalllloonnss ((pplleeaassee ssppeeccififyy)):: 5. nano, wher dos thespentfoom 007 In training, where does the spent foam go? 22 SomSever Soniary Sever ,~ Storm Sewer __ Sanitary Sewer [-- __ Other (please describe): - OneSentc __ On-Site Septic Gone __ Ground mao ot Sova ee ay on A ---------------------- Where doesldid the training take place? Please include address, intersection or other specific location information for current and past training areas. a Lip sebinl Bat Tolar E 5 : ; : or Clas / OOVVEERR-- KX wmlnoogge~r,~e Phone: RET 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA 5,51.639.9449 / 800.4-77.7411 Fax: 65:1.639,9473 www.deltaenv.corrl 22223333..00112244 state 0282693 STATE_02826936 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training 8. 8. WTWeahsaptot nytysppeeeo(s)n)daainnddrabbirananinnkdgs(s())f ooaffpffpoohaaemmaabairreeeyoPr lweeexarseee uunsseeecddknnooolwlwhaaanntdd3ii0nnmtt.hhee patpast bythe Department, by the Department, boih both for for rofire response and in training (if applicable)? Please check all that apply. py Salute 4 wes XN Tupoof Foam Type of Foam Cl8onavseoues Class B Aqueous Fimomng foam Film-Forming Foam FFF) (AFFF) Class BAconal- Class B Alcoholety Resistant (AR)Aer AFFF CossBPoen Class B Protein class Class B Fioroprotein (7p) Fluoroprotein (FP) Ci8sFsime- Class B FilmForming Forming Flsoaprotein Fluoroprotein Js (FFFP) ClossBARFFP Class B AR-FFFP Closs AB Hi Class A-B Hi Banson Foam Expansion Foam Brandor Foam --BOMLEELSy -- TTYUrUreaasssimeenodidirnniigSgnn??o Yes or No AAAmmUmUossuoueeulddnnytt Annually YCCueUuUrssrsrroeeeenddrnt??dtlloyy Yes or No HHYiisesUUttssosoreeeriiddrcc??aiallollyy Yes or No NST ae a _-- Tnngfom Training Foam omer -- ----,-- ZV -- -- Other TohFhaaPrnOkkOyyNoouu for for lyyooauuerrttmimeecoaamnn)dd ccyoooopupereaartavitioeonn.A. yPPlleeaaessSeehoccoonnnsttaaGccttRNNaFanncCcyy hRRioosddrQniuinnsggsiaattonDDenelaltteaa,CCoonnssuulltaann'tss (351-697-5152 (651-697-5152 or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. Please return this questionnaire to Delta Consultants by September 30, 2008 in the enclosedstampedr.. selfadaressod envelope. e* m .N\ self-addressed envelope. Questionnaire compltedby: Lorna, Questionnaire completed by: ~ ~ ".,,~ NamTe eanrd TCehair SLun Ses ebre Name and Title ..___.~__,~,,~.~>~z~ ~~ F_i Deparment Frwker . Fire Dep55ar0t0m,e77nt-- 5%-6'~, .t-2Z2Z0o4~ a Date Phone Number q.250% A E-Mail Address Kinogen nana: 631.639.9310 1 505.473 7411 Fok: 651.009.3475 mokweliagnorm._ XInog~A'~.............. 5910 Rice Creek Parkway Suite 1.00 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.74~11 Fax: 651.639,9473 www.deltaenv,~:om 22223333..00112255 STATE 02826937 STATE_02826937 FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTTmmIIUOOUsNNsNNiA[AnnIIRRIFEEireT aTirnaiinningg DD EE LLTTAA V == pours'otd 1. Does Bo~ your ~our Department O~part~nt curentolry ~urr~ntl~ or has h~ your ~our Department Opa~nt historicwal p sslr histodCall~ us~~or Glas8s Ola~s B ffooaammss ffoorr I. See / firefighting operations? ~~'~ ~ Yes - Proceed to Question 2 eva on sa Soka __ No - Sign the back of this form and return to Delta Consultants 2 ETA RST 2. How often is Class B or Class A foam used in response to fire calls? 00--2255%% ooffffiirreess 2X0O 2255.-5500%%ooffffiirreess 7755-10-0%1o0offf0ifirre%ess. Dor Deine acapes om ston CAFS)wih iin ark on ds rg? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? _Yes Tow ...50 1to & HARRI How often is foam used in training exercises? am wo ont on __ Never __ Weekly __ Monthly __ Quarterly EY _h_ h "~d'... Semi-Annually TR aie -- __ Other (please specify): .'~ Annually(~ __ Bi-Annually 5. tor How much foam is used per training event? _22_ Less th5gaallnons 5gallons __ Stot0galons ~,/~ Less than 5 gallons __ 5 gallons __ 5 to 10 gallons __ MMoorree tthhaann 1100 ggaalllloonnss ((pplleeaassee ssppeecicfiyfy)):: --_-- oem som asp? In training, where does the spent foam go? ea _oTata on __ Storm Sewer __ Sanitary Sewer rer pss destor - __ Other (please describe): __ On-Site Septic __ Ground ES. Where does/did the training take place? Please include address, intersection or other specific location oo i information for curre~qt and past training areas. Clans. x Natious Sinoger XInog~A'~ ............. OOVVEERR-- hone: 651.639.91084950.4713411" Fo: 31 635.9475 wes ARIERSRY.CRR. 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800,477.7411 Fax: 651.639,9473 www,deltaenv.com 22223333..00112266 STATE_02826938 DELTA & { QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinng \ 5. Viht pes) and rand of fa aor rsusd now and nh as by ho Dapaiman,Et What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire aw tf apps Poa Crh ao 99 response and in training (if applicable)? Please check all that apply. tUrsadinng A"mGooeusr curenty Historically TTyyppeeooffFFooaamm BBrraannddooff FFooaamm Ca8Asqueoeus Class B Aqueous Fino Foam a Film-Forming Foam he (AFFF) Go8Atsel Class B AlcoholCo Resistant (AR)orAFFF oo Class B Protein Gus : FlCFullouarososrporBporotteeiinn ((FFPP)) - Ga8sFism Class B FilmFomine Forming Eroron ne Fluoroprotein Fe (FFFP) CRITI mee ee ee meen on Class B AR-FFFP Case nB 1 Class A-B Hi Sonton CElxapsasnAsion Foam _Sie TI ee -- Training Foam ots = Other Used in YYTeerassinooirrnNgN?oo Amount AAnnUnnusuaealdlllyy CUuUsrsreeeddn??tly Used? Historically Used? Yb Zeek. WS NES Thar you for ounernd conperton. Pleas contactNancy Rodrig at DlaConstants (51,697-5152 Thank you for yourtime and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 Siamcom) too oki oo ool Olio COTY Anes (814373800o or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or ge Ose oa ay shan ending A Geshe jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PlPeleaasseerreettuurrnntthhiissqquueestsitioonnnnaaiirreettooDDeellttaaCCoonsnuslutttaannttssbbyyJJuunne66,, 22000088Iinntthheeeenncclloosseeddssttaammppeedd,,sseellff:`aaddddrreesssseeddeennvveellooppee.. [-- . - Questionnaire completed by: _R_amKoneesTeTr dmigA-- eFC Name and Title ' - E FreboR seT Gee pupT Fire Department FronNumber E-THG-2218 Phone Number Baieby /, I0 ee E-Mail AddressJ!~ -- XlnoIgn~o.g..enn_''_ ........... 5910 Rice Creek Parkway Suite 200 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651,639,9473 www.rleltaenv.cem 22223333..00112277 sate 02826939 STATE_02826939 QQUUEESSTTIiOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg DSEmLTAcr Di ss o5hX 1. Does your Department currently or has your Department historically used Class A or Class B foams for _X_Yes-Proceedto Question 2 trams firefighting operations? Yes - Proceed to Question 2 No - Sign the back of this form and return to Delta Consultants 2. How often is Class B or Class A foam used in response to fire calls? X oman arent )~' 0-25% of fires __ 25-50% of fires 75-100% of fires + erm en AF 7 Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? x-Yes X" ~o How often is foam used in training exercises? EE wows __ Never __ Weekly __ Monthly SemiAmualy __ Amualy _X_ eiamnualy __ Semi-Annually __ Annually /~/ TA __ Other (please specify): __ Quarterly Bi-Annually + ngs sen How much foam is used per training event? eIn T sats + Cami Hn ~ Less that'5 g.allens 5 gallons , . ~ to 10 gallons __ More than 10 gallons (please specify): + en nase snonn In training, where does the spent foam go? _ SomSewer ___SeniaySever ___OnSteSeptc _X Ground __ Storm Sewer __ Sanitary Sewer ae __ Other (please describe):. __ On-Site Septic ~ Ground Ha Where does/did the training take place? Please include address, intersection or other specific location cor information for current and past training areas. bia fron San ad i Canin ThE, pot Timi. oar &S SCD ju TRAINyg HKnogen Xlnog.,n..'~ .............. .OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA Phone: 65!.639.9449 / 800.477.74:[1 Fax: 651.639.9473 www.deltaenv.com 22223333..00112288 STATE_02826940 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5. What yes) and brandofifsoa)m aeor wereusenodw and in th pabsyUts Departmen, bootr rhe 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire e390 andi ann (1 appicabe Posse check a at apply response and in training (if applicable)? Please check all that apply. Coot Thunder Cee Diet Imectrom Bandotroan TTUvUraaessiireenneddinniiiggNnn?eo AAAmmmsUoseaoueualdnntt YCCeuUUuersrsereeeerddnnt??ttllyye HiissUttsooerridcc?aalllyy YeUtsoerd?he Type of Foam GlaAquseouss Class B Aqueous {Fairmreompgram Film-Forming Foam Brand of Foam Yes or No Annually Yes or No o_o Yes or No ___ (AFFF) Cl8Aacorsor Class B AlcoholRaeewangRy Resistant (AR)- o_o CAFoFsFsspoon Class B Protein CFuaospeclon (fp) Class B ---- ---- ---- ---- Glss Fim Fluoroprotein (FP) Class B Film- FFoorrmmiinngg wForon Fluoroprotein | ---- ---- ---- ---- C(FeFsFsP)maRFERP CBpomsssoannproam | Class B AR-FFFP Class A-B Hi ---- ---- ---- ---- casi Expansion Foam - TgFem Class A over Training Foam - _-- = _-- = Other ToTrhhraaonndkkhyyioonuugffoo@rrayytooauurornttimneecoanmnd)d |ccyoooopupeeraraavttieoonne. yPPliQeaeusseesccooonntTtaaccett gNNaaannccnyy oRRoeoddqnisinneggsviaotmDDneoalrttae.CCoonnssuultlanatrs ((685511--669877--55115522 or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. selfadessed envelope 5 in theencioseq4stamped Qsueelsf-taidodnrneasrseecdomepnlveetloedpbey. : Wed WoreTwoarniee Ctr8 Questionnaire completed by: Tou Froek biel \ Name and Title FoeDeparment Fire Department 50T-27-3730 Pome Phone Number Clu @ i ecst lf ide not T2us3.0% Date EM-MaialilAAddddrreessss. XXilnnogeenn"' Prone e31.420 90051000 TAL Poke S380 ea a 5910 Rice Creek Parkway Suite 1(30 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.com 22223333..00112299 sraTe 02826941 STATE_02826941 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training 1. Does your oparmnt cure has your Dpartmnt istrcaly us Cas or Cas osfo Does your Department currently or has your Department historically used Class A or Class B foams for Foran apasions? firefighting operations? es- ProctoeQueestiodn Yes - Proceed to Question 2 3 No- Sign the baocf thkis form and returnto Dla Consulants _.~No - Sign the back of this form and return to Delta Consultants 2. Howllenis aes Bor Clas Aaa used espns fo ro cals? 2. How often is Class B or Class A foam used in response to fire calls? oashotties 2550 oies Totesatres 0-25% of fires 25-50% of fires 75-100% of fires 3. Does he Desariment have a compresseda foam system (CAFS) wih abull tank ons engines)? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? vesYes NoNo 4. Howotien is foam usd naling esercioes? How often is foam used in training exercises? Never Woy Never _ Weekly Semhmaly _ Aaly __ Semi-Annually __ Annually er (please spect: __ Other (please specify): 5. Howmuch foisauemd por varing vent? How much foam is used per training event? Los than gallos Sgalons __ Less than 5 gallons __ 5 gallons oro hn 10 gallons (pose pect: __ More than 10 gallons (please specify): Morty J ---- Monthly __ Quarterly - J __ Bi-Annually sto 10 gators __ 5 to 10 gallons 8. IInn ttrraaiinniinngg,, wwhheerree ddooeess tthheessppeennttffooaammggoo?? LSLomSewer ___SaSews __ Storm Sewer __ Sanitary Sewer J -- __ Other (please describe): ___ OnSteSeplc Gund __ On-Site Septic __ Ground 7. Wmianetridnocforschee innaitnngpoaskVpalancge? rlee.s cud ares, merstorooinr spctclaaton Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. Himogen: OOVVEERR-- rene ver 7 SCTRTY SUTTSE TR TE UE 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.com 22223333..00113300 sate 02826942 STATE_02826942 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training 5. What 006) ard bran) offoam acwer used nov and nh pat by th Dearie, bot fe What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tetonssnd aan opine'Peas hock al by o4l response and in training (if applicable)? Please check all that apply. /./_ ~ffo~0 soto Bundotfomn TUYasemesidonirgnb?e AAmmUosweuadnty CuUrsoensty HisUtosreicdally Type of Foam ClBaAquseosus Class B Aqueous Com Aes eo fe Ne Film-Forming Foam ren (AFFF) Gla8 ksonso: Class B AlcoholSeem Resistant (AR)f=AFFF CassBPown o_o Class B Protein cases Class B Fiaroprtan (9) een -- - -- -- FIuoroprotein (FP) Coes Fim Class B Film Forming Forming tn -- | | ee Fluoroprotein fet (FFFP) CesBARFEP Class B AR-FFFP Coss rgti Class A-B Hi Cro mm -- -- ---- Gass A Expansion Foam Brand of Foam Siw=tr Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? Mee 0 gf Mee TrTarianiniinngg FFooaamm eee Le omer -500 No 2090 Nee RASC Other ' ~ ~ ~ OC._) /..a.~ 12, ,~o~ ~ Fee Thankyou for your to and cooperation, Pleas contact NancyRoig af Dal Consults (E51.607-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or veoma aaa comy roo Seeing tog Mipeteta alu, Cor Agony (351-597-3608 of or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or anna at toa hava a aso ego Bb ootorrate _ -- jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. . p 2008 PPlleaesease rreettuurrnn ththis is qquueestsiotinonaninreairettoo DDeellttaa CoConnssuultlatnatns ts bby y JunJunee 66,, 20200088iinntthhee encelnoclsoesedd stastmamppeedd., seslelff:- - `addressedenvelope. = QuBesteionxnaire cComprleiteed fby Wick Bawhsnek { Vee T-- elde_ c Questionnaire completed by: Crooduied FP NNaammeeaannddTiTliltlee So a FreBusaiment PFiareneDeneNpiarmtmbeeSrnt07-312-00% Phone Number 4-23-0% toe Date ERE E-Mail Address ~XIinnoo~geenn" 5910 Rice Creek Parkway EE SFTTTIER Suite 100 St. Paul, MN 55125 USA 22223333..00113311 sraTe 02826943 STATE_02826943 DELTA QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg _ JVeEleplhosoes 1 ons your Deparmentcron has your Deparment hora sad Coss Aor Coss Booms firefighting operations? asfdo ts Elna & Clock To Does your Department currently or has your Department historically used Class A or Class B foams for firefighting operations? 5 Yes -ProtcoQueesteiodn2 2 Yes- Proceed to Question 2 werd maith FoSeo- Af moet. 2008 V~,.,~,~.-q ~r,,-~ F-<~o - ,,'(-//~-! ,-~ ~_r.)o_r/d_~ No Sign theback af tis orm nd eur o Dots Constants __ No - Sign the back of this form and return to Delta Consultants 2 Howolleni Cas or GossAloo sed i esonseo fr cols? 2. How often is Class B or Class A foam used in resoonse to fire calls? ozswatties asso ottes X80ves , __ 0-25% of fires __ 25-50% of fires ~" 75-100%.of fires , 3 os heDeptt have compres a foam sam (CAFS) wi a bn sakponifns aangea? r0e%s. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? 2~TS B"~ Yeeses, TE 4. How tenioosm used ning exes? 4. How often is foam used in training exercises? Neer Wey ent aunty __ Never __ Weekly __ Monthly __ Quarterly _ -- _ SSeemmii--AAmnunaulalllyy _ x 7_ ~ AAnncnuuaallllyy _ -- _ BBii-AAmnnnuuaalllyy Or last spt __ Other (please specify): 5. Howmueh oom i used por vaiang vent? How much foam is used per training event? Lvaon gsuns 5 goons Less than 5 gallons //~2) 5 gallons Wore hn 1 ats(Hoses soci __ More than 10 gallons (please specify): sto 10 gatos __ 5 to 10 gallons 8. IInn ttrraaiinniinngg,, wwhheerree ddooeesstthhee ssppeenntt ffooaamm ggoo?? OC Sm Sewer Story Samer 7~ Storm Sewer Sanitary Sewer Over css dose __ Other (please describe): OntoS_ ep __ On-Site Septic Grow __ Ground 7. Wrorgse ne vnoek nce Pgeas ses, rsectonsr rer soc on Where does/did the training take place? Please include address, intersection or other specific location es information for do current and past eros training areas. He silat oF 44 SH - cody ies --- -- ew eouq Inogen' OOVVEERR-- 5910 Rice Creek Parkway Suite 1(30 St. Paul, MN 55526 USA 22223333..00113322 stare 02826944 STATE_02826944 FrofihtinQQgUUFEEoSSaTTmIIOOUNNsNoNAAiInIRRFEEie Training Firefighting Foam Use in Fire Trainin DELTA kx0o]t 5 Wht yo) ad branodffso)r aro we usd nw and has yh Departmen, bah ef 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire sh tears Pens ek ho response and in training (if applicable)? Please check all that apply. ryeana,m Sg"Goooudg"t Gurenty Historically TTyyppeeooff FFooaamm Cl8aAeosn Class B Aqueous rene Film-Forming Foam pes (AFFF) Gore con Class B Alcoholrt tt -- Resistant (AR)SoAFFF TAI mm-- re -- -- -- Class B Protein Css Class B Bvearon (hy -- _ -- -- Fluoroprotein (FP) Posey Class B FilmBeis ee Forming Pgs -- Fluoroprotein os (FFFP) SPANNER ores tee smn sn Class B AR-FFFP gaan Class AIB Hi Cato -------- -- ---- Expansion Foam Gen oo J, Class A A ---- -- TTT Training Foam Over J -- Other `BBrraannddooffFFooaamm Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? Thankyou for your ine a cooperation. Pease ona Nancy odin a Del Conuas (651607.6152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 ead emcon] ooo oc sha esse uhos Carve eres (687431o8 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or eo ou ay vasooping socio jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. spa Chel PlPeleaasseererettuurrnntthhiissquqeusetsitioonnnnaaiirreettooDDeellttaaCCoonsnuslutliaannttssbbyyJJuunnee66,, 270.00088iinnt[hheeeenncci~oosseedus~t=aammpie~ed~,,sseei;ff:- aaddddrreesssseeddenenvveellooppee.. Questionnaire completed by: IL Cpcatscacic JI IName and Title isCopan Fire Department Foose 22ers ~ Phone Number --2729 ub Chef R/b d ---- E-Mail Address Kinogen Xlnog~L 5910 Rice Creek Parkway Phone: 651.639.9449 / 800.477.7411 Fax: Suite 100 St. 551.639.9473 Paul, MN 55126 USA www.deltaenv.com 22223333..00113333 [Ep-- STATE_02826945 DELTA Tue FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training x Firefighting Foam Use in Fire Training ops ry roost ty dh ho Does your Department currently or has your Department historically used Class A or Class B foams for firefighting operations? Yes - Proceed to Question 2 TR mara ssn No Sign the back of this form and return to Delta Consultants bo orGosfr m a 2. How often is Class B or Class A foam used in response to fire calls? Orn ptr pASe 0-25% offires 25-50% of fires 75-100% of fires Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes xNo roc sss st How often is foam used in training exercises? i ums ou __ Never __ Weekly ___ Monthly __ Semi-Annually __ Annually __ Bi-Annually tn i Sm __ Other (please specify): Quarterly + ome mt nt How much foam is used per training event? __ Less than 5 gallons __ 5 gallons p---------- __ More than 10 gallons (please specify): __ 5 to 10 gallons ba toms In training, where does the spent foam go? psy ve ovsi: iass a i __ Storm Sewer __ Sanitary Sewer __ On-Site Septic __ Ground I Mdioorasariou er -- __ Other (please describe): 7. "iA~he~'e does/did the training take place? Pleaseinclude adaress, intersection br other specific location information for current and past training areas. XKilnnooggen~:; OOVVEERR-- _ none: 651.630.9040 1 500.037 011 Yow: 391.639.9473WarLALICASREALL. 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 65:1.639.9449 / 800.477.74:11 Fax: 651.639.9473 www,deltaenv.cem 22223333..00113344 STATE_02826946 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5. Vina types) and branof dfoa)m av wero usednow and intepast by to Deparment bootr fhra 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tsponde ond rami appucabloy Please check a rat 3p. response and in training (if applicable)? Please check all that apply. Typeof Foam ndotfoam TrUYaeoionsdioinrgn?f AAmmUmoseaudnlty CUusreesn?t HisUtsoreidc?ally Type of Foam ClaAquseosus Class B Aqueous frond Film-Forming Foam frees (AFFF) Gl8aAcsahsor Class B AlcoholSse, Resistant (AR)AE AFFF SS Class B Protein cases Class B fon oo ---- Fluoroprotein (FP) Gl&oFism Class B Film= Forming Forming Foote = ---- ---- Fluoroprotein fet (FFFP) Cesbanere Class B AR-FFFP Coss ABH Class A-B Hi fr _-- Expansion Foam Css - Class A Tengen Training Foam oer - Other Brand of Foam Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? Thyao fnor k youre and coopraton. leas conat Nancy Ring at Dil Consultants (351.007.5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 of ecm aac com or 3 Slekingr at og Minescts Poon Camvot Agen (651-27.060o8f or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or rete sy 5 have ay Queso roprdng Th GuESIGTRRHS jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. nals toDelt Consuls by Juno , 200 sai i Please return this questionnaire to Delta Consultants by June 6, 2008 in th~wfdTS-~d sta~ he `aaddddrreesssseedd eennvveellooppee:. `QQuueessttiioonnnnaaiirree ccoommpplleetteedd bbyy:: ~ A L~'---~'~ Hare "anTdoiny Pr Wolff ?yciprant oCCaF Name and Title re HDeoptarsmefntod Foe Dt Fire Department Fen25 4s ~22% hw9.3.08 Phone Number Date Ea E-Mail Address XXilnnoogge~n'~ TT TT 5910 Rice Creek Parkway Suite 100 TT St, Paul, NN 55125 USA 22223333..00113355 sTaTe 02826947 STATE_02826947 DELTA QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirreeTTrraainiinyit , N= Gone spSa osa aaht asoe SaStn 1. Does your Department currently or has your Department historically used Class A or Class B foams for Sao firefighting operations? Ne tag? Yes - Proceed to Question 2 the back of 7~No - Sign this form and return to Delta Consultants 2. How often is Class B or Class A foam used in response to fire calls? 0-25% of fires 25-50% of fires 75-100% of fires 3. DDooeess tthhee DDeeppaarrttmmeenntthhaavvee aa ccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm ((CCAAFFSS)) wwiitthh aa bbuuiilltt--iinn ttaannk onn ittss ennggiinee((s)? LE ~Yes =No -- ey How often is foam used in training exercises? __ Never __ Weekly _-- __ Monthly J __ Quarterly __. Semi Annually __ Annually __ Bi-Annually I __ Other (please specify): How much foam is used per training event? __ Less than 5 gallons __ 5 gallons AA More than 10 gallons (please specify): 2 Ba------ In training, where does the spent foam go? __ 5 to 10 gallons __ Storm Sewer __ Sanitary Sewer pm __ Other (please describe): __ On Site Septic __ Ground EE -------- 7. Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. ogee = haus sel B cows nf HA Knog Xlnog~". OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA 22223333..00113366 STATE_02826948 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training & Vihatye(s and rand) foam are ar vere usd no a ihpas yh epartrent.h rre 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire a ing apes leas heck a a py. response and in training (if applicable)? Please check all that apply. r Usdin Amoe unt -- TyTyppeeooffFFooaamm BBrarannddooff FFooaamm Glee 8 ecus me we Class B Aqueous i Film-Forming Foam fos (AFFF) GE a8Asbso m -- -- -- Class B Alcohol- Resistant (AR)- poAFFF HEH os me mm om me Class B Protein Goes Class B teeny -------- -- -- ---- -- Fluoroprotein (FP) Cass Fim: Class B FilmFama Forming Fragen --_---- -- -- Fluoroprotein fe (FFFP) CARE Class B AR-FFFP Cassia Contam Class A-B Hi Expansion Foam |~. F---------- ~. cameogronm ni1 e X06 pCriuacl leveso Sfganpael rs peTraining Foam over = Other Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? HisUUtssoeeriddc??ally -- Hm rivet vmakuntaal = +i ea Fire hankyufor your timo and coepraion Plas contac Nancy Ring De Constants (051.097.5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 eam com: So Srosingr or Htests Pots Cont Agony (61557300o8 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or rrrGama an) ou ho ay acess og 103 ues jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Plsseretum is questionn0aDitrse june ,20081 i samped so. Please return this questionnaire to Delta Consultants by June 6, 2008 in re addressedenvelope. QQuueesstitioonnnnaaiirree ccoommpplleetteedd bbyy:: T nl TmT t Coe Chin Name and Title FeaDepaarnitmeesnt Falls Yb Fire Department ~ 507-78-3570 Fro Naber Se Phone Number pbs _ 9-3 0K Date mE E-Mail Address XlJnIongo,eg_e~n"'. .............. 5910 Rice Creek Parkway Suite :tOO TE St. Paul, HN 55126 USA 22223333..00113377 sate 02826949 STATE_02826949 DELTA FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training vie (eto 1. frDDeoosgegsshyyioonuugrrDDoapeeppraaartrtmimoenensnt?tccuurrreennttlyy oorr hshas yyoouurr Depart Department historical historically uusseedd CaAosr lsos Bfos Class A or Class B foams for -- Yes-Procosdto firefighting operations? Question? NYoe.s S-iPgrnoctehedbatockQoufetshtiosnf2orm an return Data Consultants 2. How __ oftenis No Cla - Sign ss 6% tGhe lnbaAcaakfoorsaf mthuisasfiorrnmdraensCdpolrnesateunrtnosftoreBDceoeltta?CGonosulhtants lon ou How often is Class B or Class A foam used in response to fire calls? [O2retees __'}0-25% of fires __ assonaiives ___ 25-50% of fires 7540of0ro8s. 75-100% of fires 3. 3o DDooeess tthhee add qh DDeeppaarrttmmeenntthhaavvee aa ccoommpprreesssseeddaaiirrffooaamm sgysetem ((CCAAFFSS))wwitithh aa bbuuiitlt--iinnttaannkkoonn iittss eennggiinnee((ss))?? SANT Tlekrical wipe 4. How oftenis oars used in aning axes? How often is foam used in training exercises? Kew wees omy Quneny _~ Never __ Weekly __ Monthly ~ Quarterly Semiamuaty Horuaty Sramualy __ Semi-Annually Annually __ Bi-Annually Othe lass spect) __ Other (please specify): 5 How much foam is used po airing vent? How much foam is used per training event? Lossthan galans S gators __ Less than 5 gallons __ 5 gallons Marothan 10 galas (lease speci): _ More than 10 gallons (please specify): 5010 galons __ 5 to 10 gallons 6 Intrinig, unre coos tho spent foam 07 In training, where does the spent foam go? SomSewsr ___SamtrySewsr __ Storm Sewer __ Sanitary Sewer J -- __ Other (please describe): __OnSie Sepic Grown On-Site Septic o_ o_ Ground 7. Vivre dosid he raining take place? Pease includ ads, terse or othr specif ocaon Where does/did the training take place? Please include address, intersection or other specific location rorsion for cto and pat dane ros information for current and past training areas. elanet placd vil Lo cue bare Joie. OOVVEERR-- rE r Xinogen ST R CT r T PyTSp Se T Ue e 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA 22223333..00113388 STATE 02626950 STATE_02826950 DELTA ud FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training \ \/ Firefighting Foam Use in Fire Training 5 Vat pes) and bras) foamar wer uc now and ne past By heparin infor fre 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire espera snd am 1 pica Posescheck a ht 3p. response and in training (if applicable)? Please check all that apply. TUrasvdiinng? AmUosuednt Curent stoially TTyyppeeooff FFooaamm `BBrraannddooff FFooaamm Close8 uu Class B Aqueous Perommatom ---- BS Film-Forming Foam wren (AFFF) Gl&aAostosl Class B Alcoholme Wo Resistant (AR)aCAlFaFsFs BProtein ~~ ------ Class B Protein cise CFFllluauoosrsroopBprrootteeiinn ((FFPP)) ~~ Class Bim: Class B Film- Fam NS Forming Fomogoitn | -------------- -- -- -- Fluoroprotein wre Class BARFFFP (FFFP) Class ABHi Class B AR-FFFP Class A-B Hi Caan \ Se he Expansion Foam Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? eo nS TT Ns wo Gass A Pogue OS Og) heaws Aeoes TTrraaiinriinngg FFooaamm OOtthheerr ---- Ns BS = cm ---- hAayrno kfoar youmr mecaonmd ocooperatSiokn. ilnasstcronitamcaNtanecyPRoloadtionngCfoDnvllaACgoennacuyl(a68n1t27(6.58168087 $152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or rig me ) Tou hav ary Qos eGR hh Guestannre. Pleasereturnthis questionnairetoDeltaConsultantsbyJune 6, 2008Inthe enclosedstamped self: jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Please return this questionnaire to Delta Consultants by June 6, 2008 in the enclosed stampedT self- `aaddddrreesssseeddeennvveellooppee.. P---- LC . Questionnaire completed by: amTees eTie Coogess DSS Shae Tisaneg Sees Vows Name and Title ND Swe Oreh Fre Deparment Fire Department EH -IN-ORS Pe Phone Number Date AENCCOORT FATS \ edens Eta Aseess ~-Ma~l Ad6ress XKiInnooggeeng' rene eer ers SR TS Toke ENe133 ata am Phone: 5910 E~ce Creek Parkway 651.639.9449 [ 800.477.74~$ Fax: Suite 100 St. 651.639.9473 ST OS TE: Paul, MN 55126 USA www.deltaenv.corn 22223333..00113399 sraTe 02826951 STATE_02826951 QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training Firefighting Foam Use in Fire Training 1 DCeEoLDeTpnAtcrary t Cso ceCassnhe Does your Department currently or has your Department historically used Class A or Class B foams for friend firefight.ing operations? msm Yes - Proceed to Question 2 rR ST __ No - Sign the back of this form and return to Delta Consultants 2 Foote Cse or lsAo a ss cs? 2. How often is Class B or Class A foam used in response to fire calls? ee vont ~ 0-25% of fires ~ 25-50% of fires 75-100% of fires Br HE SS S A? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes Fa"],, +. Hogs mp" How often is foam used in training exercises? Ker i I -- "~ Never __ Weekly __ Monthly __ Quarterly Binoy " pny hs __ Semi-Annually __ Annually __ Bi Annually __ OOtthheerr ((pplleeaassee ssppeecciiffyy:): 5 MgHow much foam is used per training event? EE evs pons sng ~,~-"~" Less than 5 gallons __ 5 gallons eon oo ns ry __ More than 10 gallons (please specify): __ 5 to 10 gallons ts Ue SS 6. In training, where does the spent foam go? aan ayo, ___ongntone pons Storm Sewer __ Sanitary Sewer 5 orton82 2 Ge Sava lng __ Other (please describe): ~'~ "~"x~::~" __ On-Site Sept, ic ~o~_~.%e~.~ & __ Ground 1 Wor dos ik cen ps rc is scer eccan 7. Where does/did the training take place? Please include address, intersection or other specific location I WL dndot wie Soa TCotnmas inf..~ormatio,n fo[.current YoXes and past trainin~ areas. ace Romer BE Te 58 Tne Nimes SScoacuse, ey " wt AS ose ox AYTD W_ ed Foo veaond,, or Cow Niels Se Doouy BOM I SO See ond Scope. Anis Can RMuelualke OOVVEERR-- Hwogew Xlnog~K ............. 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.741! Fax: 651.539.9473 www.deltaenv.em 22223333..00114400 JRSTATE_02826952 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg DELTA . Whattyoo(s) ane cran(s) of fosm ror were usd now ad nh past by he Department bth for ro 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tecponce nd ram pica' Please crack al na 30 response and in training (if applicable)? Please check all that apply. TUasnednign? AUmsaeudnt Curenty Wtoically TyTyppeeooffFFooaamm Cl8aAqsvoosus FimFormng Foam Class B Aqueous Fihri-Forming Foam rrp, (AFFF) Gml8an csohso -- Class B Alcohol- Resistant (AR)- re AFFF BT eee me em Class B Protein Cases Class B Sane -------- ---- ---- ---- -- Fluoroprotein (FP) Cus rin Class B FilmForming Forming in _ -- -- -- Fluoroprotein re (FFFP) ClsbARFEP - Class B AR-FFFP cG ass Apy H ------------ ---- -- TT ---- Class A-B Hi Expansion Foam Case Gagisa- 0 casNop Class A TOG. et mmm mt am Training Foam over = _ Other BrBarannddooffFFooaamm l loowe Used in YYTeorassinooirrngNN?oo Amount AAnnUnnusuaealdlllyy Used? Currently Used? Used? Historically Used? _ Thankeyouaoroyovratsmmsaamn)d ocroosopraStoni. gPeatsoconptaoctsaontcayPRooldiionCaotrDoottaACguonncsyu(l0a5r1s2(98750.00080T1512 ___ Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 retre mu 0 ha ay Gators agar i custome jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. his ausstonn taConsullants by Jun6,e2000 stamped set. Please return this questionnaire to Delta Consultants bV June 6, 2008 in the enclosed stam~e~ addressed envelope. Questionnaire completed by; Fane araTione Clial Curt Name .:~d Title(,~, fA Fee Dip 507-951-2109 FiFrireeDDepeaprt~rrhteennt~t~_~/oJ~ 5o7- 9 5"l-ZIo~/ PPhhoonnee NNuummbbeerr Mmivar TT oAk TT 9-22-09 DDaaltee ewe E-Mail Address Ninogenr Xlnog~,ff~ ............. Phone: ra A Te TL 5910 Rice Creek Parkway 651.639.9449 / 800.477.7411 Fax: T_e Suite ~00 St. 651.639.9473 Wanai Paul, HN 55126 USA www,deltaenv.~:om 22223333..00114411 state 02826953 STATE_02826953 DELTA QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 1. Doss Does yyoouurr DDeeppaarrtmmeenntt ccuurrreennttllyy oorr hhaass yyoouurr DDpeepratrtmmeenntt hhiissttoorriciaclalyl uugsG~lsassAAsk~r CCllaasss B fooaarmss ffoorr efghngcparasons? = firefighting operations? ~ 32 es - ProceedtoQuestion 2 A) ~z~ Yes - Proceed to Question 2 "No Sign thebackoftis form and return o Dt Consultants __ No - Sign the back of this form and return to Delta Consultants 2. How olen Cass Bor ClAafsoasm used in rsponsteo fr cals? How often is Class B or Class A foam used in response to fire calls? 2 ~..~<:> ornotes 0-25% of fires _assow25e-5t0%forf efiress ___1siookolties 75-100% of fires 5. Doos the Doparment have compressed afoam system (CAFS)vil bull tankon is nines? 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? vesYes So~-~ No 4. Howoten foam usdin rain execs? How often is foam used in training exercises? 2O_ Newer Weay Monty Cure ~ Never __ Weekly __ Monthly __ Quarterly Jp T--" Annual SiAnnualy __ Semi-Annually __ Annually __. Bi-Annually Other (plate specty: __ Other (please specify): 5. Howmuch foam is usd pr rang event? How much foam is used per training event? LosstanSoalons Salons __ Less than 5 gallons __ 5 gallons More than 10 gars lease spit __ More than 10 gallons (please specify): stig I __ 5 to 10 gallons 6. ntaning, une dosth spat oa 07 In training, where does the spent foam go? SomSewer __SantarySever __. Storm Sewer __ Sanitary Sewer Over oasodoscoor Other (please describe): ___OnStaSeptc __ On-Site Septic Grow __ Ground 7. Vfiobrermeadtooofordcthur3an7inptatsakeapliacne?alrceo.a nclud ade, inesecton other speci ocaton Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. Xinogerr XInog~,L_,,,,,..... OOVVEERR-- Phones 31.020 2S00Is TBE00 GreekSAFTErTyOL: ESTSe190 SG m Fa Wa i 126aVOR 5910 Rice Creek Parkway Suite 100 St, Paul, MN 55126 USA Phone: 65~t.639.9449 / 800.477,7411 Fax: 651.639.9473 www,deltaenv.em 2223333..00114422 state 02826954 STATE_02826954 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 5. Vit pee) nd bans of foam ae wer usednw a pst yh Departmen, bof 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Jimbaran fd response and in training (if applicable)? Please check all that apply. rUosaemdigne Am"Boooutn"t Curent Witoricatly TTyyppeeooff FFooaamm G8oAaussaus Class B Aqueous a a -- Film-Forming Foam ps (AFFF) Goss Aeon Class B Alcohola ee et ---- a -- Resistant (AR)feAFFF TUT, meres er een en en Class B Protein cases Class B Seen ---------- ---- ---- mo Fluoroprotein (FP) CleFie Class B FilmFam Forming Ren ---- -- ---- -- Fluoroprotein Ts (FFFP) CosbARFR Class B AR-FFFP Gls 814 oY Class A-B Hi CToneanta,CxTagdme NT ee T 530 me Expansion Foam BrBarannddooffFFooaamm Used in Training? YYeessoorrNNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? ~"-~,-~ ~1 Tat ----t----ptty TX Training Foam ober -- -- = = Other Thyaoufnor ykour mead cnperaton. Plas conte any orn st Dot Contant 651.007.5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 aa com So Singer tr nests Pati Con Agony (1557008 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or ane ot ou ave ay asin rope 1s oso jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. itm os tons ts Costin A 20. se sn J `aPdlderaessesreedtuenrnvethliospqe.uestionnaire to Delta Censultants bF June 6, 2008 in the enclosed a stam If- ed) QouemstainmaiTriskeceomplySpwerk x = ee Chie( =Ww C Name and dro Title SFiee. Ox FesDeparment Fire Department peck: 205 Yd- Prana arte' oe Phone Number (5222. 9-3-0% Date -~-~------ - EE--MMaialil AAddddrreessss. re XInJInooggen en" area 5910 Rice Creek Parkway Set Suite 100 SRA St. Paul, MN 55126 USA 22223333..00114433 stare 02826955 STATE_02826955 DELTA QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg Vie dedeplons 1. DrDoaofoegsshyyioonuugrrDDpeeperasrtompnesn?atccturrerennmttlyyoeorrhhnassyytoouurrDDeeppaarrmtmeenntthhisisttoorriiccaallllyy sedCass used Class Ao Cas A or Class 8Bffooaammss orfor 22Yes - roses to firefighting operations? !x:~ Yes - Proceed to QQuueessttioino2n2 No Sign the back ofthis form and return to Datta Consultants No - Sign the back of this form and return to Delta Consultants 2. Howofenis How often is Cass Class Bor B or ClAafosam Class A foam uusseedd iinn rreessppoonnssee(t0o refire cals? calls? AKL oaswotoftfrireess _~ 0-25% __252-5-5500%%ooffffrireess _ 75175-01000%%oofffiirrteess Tm Podabts fomn gatinidon=e Clos A 3. Dos tho Ceporiment have compressed a foam system (CAFS) witha bitinfarkon fs ongine()? 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? we Yes 4. Howoffotamnusiedsin ining nerces? How often is foam used in training exercises? New wey mony cue __ Never __ Weekly __ Monthly __ Quarterly 52 Sembamuaty saat Bramaty ~ Semi-Annually __ Annually __ Bi-Annually ZZ ter ease speci; __ Other (please specify): 5. How much oar is usedpor vaning vent? A Less ans ators Sgalons How much foam is used per training event? /....~--~. MLoerses tthhaann 510ggaallloonnss __ 5 gallons (pleasespecify): __ More than 10 gallons (please specify): ____ Stot0galons __ 5 to 10 gallons 86.. IInn ttrraaiinniinngg,, wwhheerree ddooeess tthhee ssppeenntt ffooaamm ggoo?? Somer Swan Serer __onSlpioe ..k~ Storm Sewer -- Sanitary Sewer -- On-Site Septic 2 ter (ease dose: : // v Other (please describe): ",~dL~..~-- "--,.---~ 0 Gaurd ~ Ground 7. Where dosnsa rdandg ako place? laso induc address, I spec ocson Where does/did the training take place? Please include address, inte~ection or other specific location foCtlo ior crFt anad askrann ares Naiovs sales information for current and past training areas. rowie Woe Xinogen: ram Yoon OOVVEERR-- TeSOre 5910 Rice Creek re e ~ e A See Parkway Suite :[00 St. Paul, MN 55126 USA ne 22223333..00114444 STATE 02626956 STATE_02826956 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire ere)& Firefighting Foam Use in Fire Trainin 5. VToisnsaontyspee(nsi)ianndvbarma1onafdfopiampaaroPwaearseucsheodcknaw arnd n9p i pastby the Deparimen,both for re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. TUosendgin? AmUoseudnt Curent Useor TyTpyepeooff FFooaamm Clase Aqueous Fim- Class B Aqueous FilmFi Foi iRy -------------- ------ Glass 8Alcohol Forming Foam (AFFF) ReCRsleaisssissttaaBnntAt l((cAAoRRh})o--lA-AFFFFFF CosOPown - Class B Protein Cl8Fauopsetesin Class B Fluoroprotein I) ---- re sr (FP) Cl8iasFormsing Class B Film-Forming Foro oton (FEFP) en ee Fluoroprotein (FFFP) CmsmAREEE Class B AR-FFFP Class ABH: Class A-B Hi Gson foam Class A Expansion Foam Class A Training Foam - - - Cr Training Foam other TT Me ------ Other `BBrraannddooffFFooaamm Buss Ho Used in YTerasinoirnNg?o Yes or No Jo Amount AnUnusaeldly Annually CHHuiissrtrteoornriitccUUUssseeeo??r or hweus___oapsolis Yeo Sols aebees Thankyo for your me an coopraten. Pass cata Nancy Roding a Dla Consular (651-097-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 saaom of Son Steiner ong Minnasct Pollan Cont Agency (651-297-3668 of or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or cingte nu) ou hve any Questions raring is Qesomae jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Questonnakecomplied by: PlPeleaasseerreettuurrnntthhiissqquueesstitioonnnnaaiirreettooDDeellttaaCCoonnssulutltaannttssbbyyMMeayv99,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,,sseelflf:- adaddrderesssseeddenenvev~loloppee.. Questionnaire completed by: Name and THe Name and Title -- FFiirree DDeeppaarrttmmeenntt Prom2s7Ni-mb7er93- 238) a Phone Number TT Tae= 72-28 Date a E-Mail Address XwInooggeenn"t 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55~_26 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaer~v,com 22223333..00114455 STATE 02626957 STATE_02826957 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn F" ire L TraE in X o 1. fDDrooeeefssigyyhooiunurgroDDpeeeprpaaartrtitmmoenensnt?t ccuurrreentnlytooyr hhaassyyoouurrDDepeapratrtmmeenntt hhiissttoorriciacallly uusseeddCClalassss AA oorr CCllaassss B8 ams foams ffoorr X_ firefighting opYeerasti-onPsr?oceetdo Questio2n ,X~ NYoesS-iPgrnocteheodbtaockQoufesthtiiosnf2orm and return to Delta Consultants __ No - Sign the back of this form and return to Delta Consultants 2. HHoowwoofftteenn iisCCllaassss BBoorr CCllaassss Affooaammuusseeddiinnrreessppoonnsseettooffrireccaalllss?? X__ ozstoffres '~ 0-25% of fires 25.50%of res 25-50% of fires 75-1o0f0re%s 75-100% of fires 3. DDoooess tthhee DDeeppaarrttmmeenntt hhaavvee aa ccoommpprreesssseedd aaifr ffooaamm ssyysstteemm ((CCAAFFSS)) wwiithh aa bbuuiilltt-iinn ftaanrkk oonn titss eennggiinnoef(ss))?? X~" Yveess 4. How often foam used in airing exercises? How often is fWoeaemklyused in training exercises?Monthly __ Weekly __ Monthly -- SSeemmi-i-AAnnnnuuaallllyy __ --X)~_ AAnnnnuuaallllyy Other (please spect): __ Other (please specify): Quarry __ Quarterly --_ BBii-AAnnnnuualalllyy 5. HHooww mmuucchh ffooaamm iiss uusseedd ppeerr rtraaiinniinngg eevveenntt?? X__ tess thgaationns 5gallons MLeosrse tthhaann 510ggaallolnosns (please spe5cig)a:llons __ More than 10 gallons (please specify): 51t0 ga0 tons __ 5to 10 gallons _ SomSeser ___SontaySewer 6. IInnttrraaiinniinngg,, wwhhoerree ddooeess tthhee ssppeenntt ffooaamm ggoo?? Other (please doscrbey __ Storm Sewer __ Sanitary Sewer __ Other (please describe): ___OnStoSepic _X_Ground __ On-Site Septic ~/' Ground 7. W WInhfheoerrrmeeatddioooeenssf//oddiiddcuhthrereenttrtraaaiinnniindnggpattasaktkeevappillanaiccneeg?? aPPrlleeeaaasssee iinnccluldued aaddddrreessss,, iinntteerrsseeccttiioonn oorr ootthheerr ssppeecciiffiicc llooccaattiioonn information for current and past training areas. bound bnhe=l1l1 248 due ose wong libs Loom asa lie Gon clog ay ab o=i% XXKIinnoogg$e~n; ............. Phone: 651.639.9745 /500.344117F3ax: $91-639947] MAaarlsASRR.CRR. 5910 Rice Creek Parkway Suite 100 SL, Paul, MDI 55126 USA Phone: 65/~.639.9449 / 800.477.74~.~[ Fax: 651.639,9473 www.deltaenv.~:em 22223333..00114466 STATE02826958 STATE_02826958 DELTA Tw FFiirreeffiigghhttiinnQQggUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Foam Use in Fire Trainit g rWeesptm or r ge te torodmt e What type(s) and brand(s) of foam are or were used now and in the past by the response and in training (if applicable)? Please check all that apply. tron muranSEoE a REI Type of Foam Pereon Class B Aqueous memes Film-Forming Foam es(AFFF) Class B Alcohol- fGoow Resistant (AR)- AFFF Brand of Foam Used in Training? Yes or No Amount Used Annually Co Class B Protein Ey -- -- Class B Fluoroprotein (FP) Class B Film- onForming mA Fluoroprotein e 2 r ee (FFFP) D Sre Department, both for fire CCyp Currently Used? ny Historically Used? -- Class B AR-FFFP Class A-B Hi eoExpansion Foam Belen -------- TTT Class A wer TT Training Foam ww -- = = Other TS anti tonT ,re a S. te 0,2 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 ee le or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. mn amares At arial253581 Please return this questionnaire to Delta Consultants bv June 6. 2008 in the enclosed st~.~ped, se~f- addressed envelope. ny Questionnaire completed by: Zo To slL eet acwasioe Name and T~le thin utley FnaeH! Cytsopsr Fire Department caee PPhhoonnde~NNuummbe6err E-Mail Address Xlnog~n" , ~ = "', ( /ne: ,~ a He ire 100 St Paul, MN 55126 USA 3 9.'~15494~90/R~eO-~r.kT~[ Fayx; 65.639.947~ www.deltaenv.com. 2223333..00114477 STATE_02826959 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg DELTA VN Ol 1. frDDeootseosshyyioonuugrroDDpeeeprpaaarrttmomerensnt?t current currently or has has your your Dpaiment Department istoicaty historically used used ClaorsGasss Class A or Class B B foams foams for for firefighting opVeorastion-sP?rocecdto Question NoYe-s -SiPgrnocteheedbatockQcoufeshtiisonf2orm and return to Datta Consultants No - Sign the back of this form and return to Delta Consultants 2. Howoften' lass Bor ClaAfsoasm usedin esponsoto re cals? How often is Class B or Class A foam used in response to fire calls? emotes osswotbes __7siooelfies 0-25% of fires 25-50% of fires 75-100% of fires 3. Doss tha Department have a compressed ai foam system (CAFS) with abultin tank os engine(s? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? ves NoYes No 4. Howotenis foam used in ring verses? How often is foam used in training exercises? Nar Wook Monty Quarry __ Never __ Weekly __ Monthly __ Quarterly SemtAmualy Ep" __ einmay __ Semi-Annually __ Annually __ Bi Annually __ OOtthheerr ((pplleeaassee ssppeecciiffyy}): 5. How much foam is used per ving sven? How much foam is used per training event? Loss rans galons 5 gallons __ Less than 5 gallons __ 5 gallons Varo than 10glons(easespi} More than 10 gallons (please specify): stom -- __ 5 to 10 gallons 6. I ring, wher does to spent foam g57 In training, where does the spent foam go? SomSowor ___SantorySever__OnStoSopte __ Storm Sewer __ Sanitary Sewer Over lease deserve) __ Other (please describe): __ On Site Septic Ground __ Ground 7. fVoihramraldion oursceurreainndgpatsatkeUlaacee? rleeeas include aces, inerscton othr Spec acaton Where does/did the training take plaoe? Please include address, intersection or other specific location information for current and past training areas. Xinogen: OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, NN 553.26 USA Phone: 651,639.9449 / 800.4,77.7411 Fax: 652,639.9473 www.deltaenv.cem 22223333..00114488 STATE 02626960 STATE_0282 6960 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 5 Vib type(s nd branodf fioasm a o wre usc now and nthe past bythe Deparment, bot fs fre 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tesporas and Ua ( 9Picae Pleas chock a hat 35. response and in training (if applicable)? Please check all that apply. _ellaBvSc . ee TUosneidnign? AmUoseudnt CuUrsreednt?ly HisUtsoreidca?lly IupeofFoam Type of Foam BBrraannddooff FFooaamm Class 8 Aqueous FimfFomngFoam Class B Aqueous Film-Forming Foam ----20% (188s WF (AFFF) Ca lass cohol o_o ---- Class B Alcohol- Resistant (AR)- arr AFFF omston ---- -- ---- -- Class B Protein cusss Class B Faopotan (Fp) ---- Fluoroprotein (FP) Glo8susm Class B FilmFoming JE Forming Fusoopotsin Fluoroprotein FF (FFFP) Cosspamsrr FE -- Class B AR-FFFP Class ABH Class A-B Hi Expansion Foam Class A Expansion Foam Silvey FP . Training Foam oer Ey Other Used in YesorNo Training? Yes or No 6g yo Amount AAnnUnnusuaealdlllyy ozs Currently YesorNe Used? Yes or No Historically YesorNe Used? Yes or No AM hrcyou for your tne and cooperation. Please contact Nancy Rodina Delta Consulnts (851-607-6152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 oan Gasaa om yo ave ay ason eGaNGNG 14s Qussioae or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. PSleeasegraau heisneqtuoegsetionnaitre Delta ConsultantsbySeptember 30, 20i0n t8he eanclosed stamped,_~ Please return this questionnaire to Delta Consultants by September 30, 2008 in the enclosed stamged, self-addressed envelope. " ........... Questomaie complete by: . pn pb \ ce Cre Slee Sepr al Fora snails Name an.d ~itle FeaDeparment Fire 07-56 Department 3-220 Prone Number Phone Number Bae q-25-0%" Date ET -- E-Mail Address S Xlnog~,L ........... rene eer ore 05 TL Tak: SL 7 maiiasnteom 5S931700 RRiiccee CCrreeeekk PPaarrkkw waayy Suite 100SEPaul, WN 55115 USA Suite !00 St, Paul, NN 55126 USA Phone: 65:1 639.9449 j 800.4-77.7411 Fax: 65:1.639,9473 www.deli:aenv,com 22223333..00114499 STATE 02826961 STATE_02826961 QQUUEESSTTIIOONNNNAAIIRREE DELTA "Lughmty FFiirreeffiigghhttiinngg Fooaamm UUssee.iinn EFiirree TTrraiinniinngg "veer ON ~ pa: 30,es 1. DfDoroceefssgyhyoiounurgr DDopeeeppraaarrttimmoenensnt?t curenotrlhays currently or has your your Deparment Department hhiisstorrcicaalllyy uusos= e la~ ssA- 3o)~_CCllaassss foams B foams for for firefighting operations? 2~DS YYeess-- PPrroocceeeedd ttoo QQuueessttiioonn 22 No- Sign the back of this form and rettouDerltna Consultants __ No - Sign the back of this form and return to Delta Consultants 2. Howoften s GasBsor GlaAfsears usedn response fo fro calls? 2. How often is Class B or Class A foam used in response to fire calls? 028% offros 0-25% of fires 29 assures 25-50% of fires 75.1o0f0ro%s 75-100% of fires 3. DDooeess tthhee DDeeppaarrttmmeenntt hhaavvee aaccoommpprreesssseedd aiair ffooaamm ssyysstteemm ((CCAAFFSS)) ithwith aabbuuililtt-iinn ttaannkk 0o1niistseenncgiinnee((ss})?? = Yvreeoss ~ No 4. How tens foam used in raining exercises? How often is foam used in training exercises? Never Wacky Monitly Quarry __ Never __ Weekly __ Monthly __ Quarterly 59 Sori Annual pr Sannualy ~ Semi-Annually __ Annually __ Bi-Annually Other (easespecity __ Other (please specify): 5. HHooww mmuucchh ffooaamm iisuusseedd prper trraaiinniinngg veevenntt?? JOik:p LLeessss tthhaann 55gaglallloonnss __ 55ggaallloonnss Hore than 10 gatons (lease spect): __ More than 10 gallons (please specify): 51010 galons __ 5 to 10 gallons 6. Intraining,whoredoos to spont foam go? In training, Stom Sewer where does the _spe_n_t foaSmanigtoar?y Sewer __ tor Storm S(peewaesre d_ esc_ ribeS)anitary Sewer __ Other (please describe): Onsite Septic __ On-Site Septic Ground __ Ground 7. 7. W Wihnheferoreemaddooteeissfoi/oddnriicddetthhnee ttrraaiainnniindnpggatstaatkkaee ppllaanccee??aPPgrlleeeaaasss.ee iinncclluuddee adres, address, nlesecton intersection oor the other speci specific llooccaattioonn information for current and past training areas. XKinogen: Xlnog~,~[o ............... OOVVEER R Prone: 651.635.9945 1 800.477 3411 Fok: 391.639.9475 MANAMEIARRE.LAT 5910 Rice Creek Parkway Suite 100 SL. Paul, MR 55126 USA Phone: 65!.639.9449 / 800.477.7411 Fax: 651.639,9473 www.deltaenv.cem 22223333..00115500 STATE 02826962 STATE_02826962 QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training Firefighting Foam Use in Fire Training 5. 8. WWThehsaapttontyysppeee(a(ssn))daannnddrbbaramnrad(sa1) ooafnfpffpooi)aacmmabaalrceeo?orrPwwleaersroee uucssheeddcknnoaolwwtaahanntddaipinnplttyhh e past past by by hethe Deparme, Department, boih both for for refire response and in training (if applicable)? Please check all that apply. TUrsaendign? AmUoseudnt CuUrsreendt?ly HisUtsoreidca?lly TyTyppeeooffFFooaamm Cimon Anus eer gmpewd how Clas8e Acuoous ry Class B Aqueous (AFF) Film-Forming Foam (AFFF) a et ERE Glass BAcono- Lok Class B AlcoholResistant (AR)er AFFF ComsBPutn ------ ---- ---- Class B Protein cSaososnvotifpn) ---------- ---- ---- ---- ---- Class B Fluoroprotein (FP) ass Fim. Class B FilmFTomimng o || -------- ---- ---- ---- ---- Forming Fluoroprotein FF (FFFP) CasseARER Class B AR-FFFP CCosmsmAoSnHfom ------------ ---- ---- ---- ---- Class A-B Hi Expansion Foam Class A ------ Se Class A Tog om ee ---- Training Foam over --_-- --_=-- -- ---- -- Other BrBarannddooffFFooaamm Used in Training? YYeessoorrNNoo lotuesoTl 36% Amount Used AAnnnnuuaallllyy Currently Used? YYeessoorrNNoo Historically Used? YYeessoorr NNoo ekwey an "hark you for your in an cooperation. Pleas contact Nancy Rodringa Delta Consular (661-697-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 oF ahaaom) yo ave ay eon eA 1 Gueetonnate. or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. return. Detta ber19, 2008inthe stamped, ~~ Please return this questionnaire to Delta Consultants by September 19, 2008 in th~enclo&ed stamped, self-addressedenvelope. Vier kplone self-addressed envelope. Questionnairecompletedby: J Questionnaire completed by: Toa. Fed Firelialoa = mackie Name and Tile FiNraemDeeapnsedrmTeietlnee~t d~ry~F - B Fire De--pa0rtm3e-nt44Y-%019 Phone Number Phone Number Tae9-220% Date EE-MMaalil AAddddrreessss. HwXolnoggeenn" To oo EE 5910 Rice Creek Parkway uite 100 St. JESSIE tC RR Phone: 65:1.639.9449 / 800,477,7411 Fax: 651.639,9473 ar Paul, MN 55126 USA www.deltaenv.com 22223333..00115511 STATE 02826963 STATE_02826963 DELTA FirefightinQQgUUFEEoSSaTTmIIOOUNNsNNeiAAnIIFRRiEEre Training. Firefighting Foam Use in FJre- Traini_P,g vee | kp Leone 1. Dus your Departmen curenyhas your Doparmnt tray ued Cass A orGs B Garo Does your Department currently or has your Department historically used Class A or Class B foams for Resin opeconst firefighting operations? Ves ProtocQueastieon Yes- Proceed to Question 2 No ign theba o tis form and return to Dll Constants No - Sign the back of this form and return to Delta Consultants 2 How ofan Cass BorClAafosam us neon oo col? 2. How often is Class B or Class A foam used in response to fire calls? saat assmotiies 0-25% of fires 25-50% of fires Tears 75-100% of fires 5. us he Departmen have8 compress ai foam syste CARS) ih abein fark ns cin? 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? vesYes --No & Howofienis foam usd in ring ness? 4. How often is foam used in training exercises? Never wooky Wortiy Querery __ Never __ Weekly __ Monthly __ Quarterly Somimualy Aomaaty Shmcly xc Oe leasesoot) conse crop JoarS __ Semi-Annually __ Annually __ Bi-Annually Other (please specify): _.~_~~ @Lo-~ t---/~2~c-~- ~ 5. Howmuch foam is sed or rang ven? How much foam is used per training event? J Loss vansoaons ___ sgalons Sto 10galons ~ Less than 5 gallons __ 5 gallons More han Ogators peasospectyy __ More than 10 gallons (please specify): __ 5 to 10 gallons 6. in taing, wher dooth spent foam go? In training, where does the spent foam go? Storm Sewer __ Santary Sower Onsite Sept Gnd __ Storm Sewer __ Sanitary Sewer Other leasdere __ Other (please describe): __ On-Site Septic __ Ground 7. Wcinao dooeotschoeeaai7npoaksnacye? rloa.s cud ess, inrsection ahrspeci action 7o Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. Zslteus erry door eam Ho cisctacca of Foon Cairo oni Xinoger: OOVVEERR-- EN 5910 Rice Creek Parkway Suite 100 St. Paul, Mlt 55126 USA Phone: 651.639.9405 / 800.475 3411" Fok: 831.639.3475 men.MeliRR. Cm Phone: 651.639.9449 / 800.477.7411 Fax: 651.639,9473 www.deltaenv,cem 22223333.00115522 sate 02826954 STATE_02826964 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training DELTA a What ypes) and brand) af foam arwere used now ar in hepast by ho Daparmrt, both or fee 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire essence nn vam PICS" logs choc hat 31. response and in training (if applicable)? Please check all that apply. TeUasmeidnign? AmUosuednt Curontly Historically TTyyppeeooff FFooaamm C Pinf5ioAmqaugs eoFuosam -------- -- ee -- Class B Aqueous Film-Forming Foam pss (AFFF) C8As coho- ------ ---- -- -- -- Class B Alcohol- Resistant (AR)- wr AFFF Op Class B Protein cases -- Class B Firoproron (7) Fluoroprotein (FP) Cla3 Fsis: Class B FilmForm Forming Fuoropoion -- Fluoroprotein FF (FFFP) CossBARsEP J Class B AR-FFFP Pe Class A-B Hi EExxppaannssiioonn FFooaamm cuss deus da perezNes ed Class A Tbe Training Foam otr =e Other BBrraannddooff FFooaamm Used in Training? YYeessoorrNNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? Tr J. Thank you for your mo and coapraton. Pass cota rc Rodin a Dla Consular (651607 5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697 5152 rsdncom) rm Socket ahs Miaesots Pout ConrlAgency (51207-4660 0 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or gaGta rt) 1 7ou hav ag aeons raring is cuesomle jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PPleasleeasererettuurrnntthhisis. questionniariree QuesiannatePceampedby: `addressedenvelope. to Delta Consultants by by Jur June 6, in 2008 in nor iclosed th~-en~l~d ed,s * L= g stamped, self- BY ........ -...,.\ Questionnaire completed by: .~C~ NNaammeeaannddTiTtiltlee FiedDeepadritoentn FO Fire De9pa5rtm2en-t 492-2-- 535 Phone Number oo D9ue-10-08 Date EE--MMaaiillAAdddrderesss.s HXilmnooggeenn"' rome Phone: To oor ore So ag TT TOR, LOR) 5910 Rice Creek Parkway Suite 100 St. 65i.639.9449 j 800.477,7411 Fax: 651.639.94-73 Marneta am Paul, NN 55126 USA www.deltaenv cem 22223333..00115533 STATE 02626965 STATE_02826965 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 1. Dossyour Deparmentcurenty or has yourDepartment striatedClaAss ios B foamfsor Does your Department currently or has your Department historically p'~ed Class A or~lass B foams for ne Eos firefighting operations? 20. Yes - ProtcoQueesteiond2 ~ Yes - Proceed to Question 2 No- Sign th back of thi oramnd return fo Dota Consultants __ No - Sign the back of this form and return to Delta Consultants 2. Howoten i CassBor Glas A foasuse in esponse fof cals? 2. How often is Class B or Class A foam used in response to fire calls? XC oases assotives 7510v0es ,,~" 0-25% of fires __ 25-50% of fires __ 75-100% of fires 2. DocttheDepartmenthave compressed a foam system (CAFS) wilh bul tankon engines? / 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? vesYes >= No 4. Howat foam used n aningeverons? 4. How often is foam used in training exercises? Never Weekly Noni Quarry __ Never __ Weekly __ Monthly __ Quarterly Sombsoouaty Aomiay [ir __ Semi-Annually ~ Annually Ip -- Other (please specify): / __ Bi-Annually 5 Howmuchfoam is spr ning ven? How much foam is used per training event? 50 Los tans tons 5 gaons St 0gaions Less than 5 gallons 5 gallons __~ MMoorree tthhaann 1100 ggaallloonnss ((pplleeaassee ssppeecicfifyy)):: _____ __ 5 to 10 gallons . neki, wher docs the sper fa 07 In training, where does the spent foam go? StormSawer __ saiary Sever __ Storm Sewer __ Sanitary Sewer Over (ease cose) __ Other (please describe): onstoseste JO cron IOn-Site Septic EL 7. WFhieormeadtoiunsperdcth urianngyaetkseWanlnatcse?Prlona.s lodeads, recon othersoci oan Where does/did the training take place? Please include address, intersection or other specific location information fpr current and past. traini~.~ areas. Lb leyivs lade R'. wa el Kinogen: Xlnog~,% .............. OOVVEERR-- oo 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA rane: c51.ca0.90es 055 oT Fans COLO 935 misao, Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 wwvv.deltaenv.~;om 22223333..00115544 state 02826956 STATE_02826966 QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training Firefighting Foam Use in Fire Training 5. 8. WW Thehasathitoyntypepese(a(ssn))daainnnddabbriarngad(ns()fdooafifpffpoosiaac)mmatiaaerrey?aoPr lwweeaersee uuhsseeecddknnaoolwwhaaannddaiilnnytt.hhee past past by by ths the Depart, Department, bootr fhre both for fire response and in training (if applicable)? Please check all that apply. TyTyppeeooffFFooaamm GaBAsquesous Class B Aqueous Comet, Film-Forming Foam (Fre) (AFFF) ClBaAosnso Class B Alcohol- Resistant (AR)- rE AFFF CBU Class B Protein Gass Class B Ppei(nfp) Fluoroprotein (FP) Cl8aFsims- Class B FilmForming Forming Foaptotsin Fluoroprotein Ey (FFFP) CosBARFEFP Class B AR-FFFP Cass ABH Class A-B Hi rato Expansion Foam `BBrraanndd ooffFFooaamm Moet TUosaemdnign? Used in Training? YYeessoorr NNoo AmUoseudnt Amount Used AAnnnnuuaallllyy CuUrsreendt?ly Currently Used? .YYeessoorrNNoo te -- a eee mr me ------------ ---- ---- ---- _-- -- ------ -- -- ---- me mm ---- m21m TT Historically Historically Used? Used? YYeessoorr NNoo -- ---- ---- -- TN T Glass A Siteer Le Ze Ne Me IAAI Class A mdr mr LEP em Other Training Foam Gem -- ---- -- TOohfhatharreenirkdyynoonuugofcorr yyaoouurlr tiimmtcoeoaaamnn)ddoccyoomooopupeerahrataitviooenn.a.n yPPllqeeuaaessseetcciooonnnttaarcctteNNgaaannccnyy IRRosocdkqniuinnsggsaiaot nDDnaeeiltaea.GCoonnssuulatannttss (6516975162 (651-697-5152 or nrodning@deltaenv.com) if you have any SaPllfeaasieiaotsusedteinsveqluoepset.ionnaire to Delta Please return this questionnaire to Delta Consultants by September 30,2008 questions regarding this questionnaire. Consultants bv September 30, 2008 nthe in the enclosed enclosed stomped, stamped, sQueelfs-taidodnnreaisrseecdoemnplveetloepdeb.y: Questionnaire completed by: Nara and TileCaco No>llhahe2 fee Clade Name and Title keeCe Fre Deparment Fire ~epartment PhoneeNeumbe2r48 - 36-9700 Phone Number Tat0e -158 Date EEM-Maialil AAddcdrreessss Huwogenr Xlnog~,~. .............. rarer Phore: aot ea Se 0G STL Toh, 5910 Rice Creek Parkway 651_.639.9449 / 800.477.7411 Fax: oo ree Suite 100 St. Paul, HN 55126 USA EE030267) Msdeliacav.com 651.539,9473 www.deltaenv.eem 22223333..00115555 STATE 02826967 STATE_02826967 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training fre bet rosy 1. DoosyourDepartmentcurry or hayourDepariment historically gd lasAsJ CaB fsoamssfor Does your Department currently or has your Department historically u~"6d Class A ~t Class B foams for firefighting operations? "~ -...~_.~-~" Yes -ProtcoQueestaiodn 2 __ Yes - Proceed to Question 2 No- Sign the baocfthkis form and return to Delta Consultants __ No- Sign the back of this form and return to Delta Consultants 2. How often is Clas8osr GaAsfosam used n response fo re cals? 2. How often is Class B or Class A foam used in response to fire calls? 025% oftes 2550 oft X7510o0fte%s 5. Doss_ th _ Dopa0r-2im5e%ntofhfairveesacomp_ re_ ssisf2ao5a-d5m0%sysotfefimre(sCAFS)wi7tha2~>'~uJ io7tf5-t1a0r0i%onoftfsireensgine(s)? 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? veYes AD No 4. Howes foam used in rang exercises? 4. How often is foam used in training exercises? Newer Wesky __. Never __ Weekly A. Semanmualy Aoaly 7,,~ Semi-Annually __ Annually Other(pease speci): __ Other (please specify): Monthy Monthly Banal __ Bi-Annually uarety Quarterly 5. Howmuchfoam = usporeinding vent? How 30 much ~:~ Less foam is Less than galons used per training than 5 gallons event? __ 55ggaalllloonnss ( __ More More than than 1100 ggaalllloonnss ((pplleeaassee speci: specify): 51010gators __ 5 to 10 gallons ~ 6. 1 uaining, wher doss the spot foem co? In A Siom Sawer training, where does the _spent foaSmankgaor?y Seer OStthoermr (Speewaesrecoscrbe)Sanitary Sewer __ Other (please describe): On-Site Septic __ On-Site Septic Ground 7_~ Ground Cr eins - 7. WiWhnhfooermroeadtodicoosenlsfd/doiiddcutthrhreetntartaiianniinnnggpotaaekkteepnlpialacnceeg?? aPPrlloeesaaesseeinincclluuddee address, address, intearasorespcatceiloocatnin intersection or other specific location information for current and past training areas. Loo Looms Levon foc le VO Fre lowe, rey ort, lnk lean Kinogen XlngsA"- .............. OOVVEERR--> are orn TE TS 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.cem 22223333..00115566 STATE 02826968 STATE_0282 6968 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 6 We hat yer t) g raAnaooemombearysorPovearse uheadckmoanwoansinte he Deparment Sih forre 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. TUasndigny Amooautnt Cnuearr"t His"tloreiacal TTyyppeeooffFFooaamm ofefesasmeiAoavnooesr ons vostlyMIosNe s 30 et c~e/~lass B Aqueous Film-Forming Foam en (AFFF) GA uoMoto om. = -- = Class B AlcoholResistant (AR)feAFFF FS -- Class B Protein GGastes ney -------- -- ---- -- ---- Class B Fluoroprotein (FP) Gases Fim. Class B FilmFa | ------ -- -- -- -- Forming Fluoroprotein fet (FFFP) IRTP meme wee rm -- Class B AR-FFFP GG usoABy H: ------ 4 -- 5 TT Class A-B Hi 7% Class A Expansion Foam Class A fH mre a -- en Training Foam ober = = -- Other `BBrraannddooffFFooaamm wry Used in YesorNo Training? Yes or No Amount AAnnUnnusuaealdlllyy Currently YesorMo Used? Yes or No Historically YesorNo Used? Yes or No ks YN rangfr yout nd operation. Plas ona Nar Rocha eta Corsa (651.0975152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 nm oyFr Hove ry eon eo RETO or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. esc stu isaston t Dts GonsbuySaplonmbiors15, 200th enclose stamped sePllfe-aasdedrreetsusrendtehnivseqluoepset.ionnaire to Delta Consultants bv September 19, 2008 in the enclosed s>~tamped~.........~'-~ ces tgp 4fo? Toe Questionnaire (lied completed by: Dov Noad. Raman Th Name and Title FiDKeengpodarEt >: _ creme Fire Departf-nent a 507-838-35t 7 e q-2208 Phone Number Date EE--MMaaiill AAddddrreessss TT H Xlnow gen"ogen' 5910 Rice Creek Parkway Phon~': 651.639,94.49 / 800.477.7411 Fax: ETI Suite 100 St. Paul, HN 55126 USA 651.639.9473 www,deltaenv.com 22223333..00115577 stareo2azeses STATE_02826969 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaini inngjr - DELTA AS pn etry sn ty nC Gs Ld0 Does your Department currently or has your Department historically used Class A or Class B foams for firefighting operations? /~ Yes - Proceed to Question 2 __ No - Sign the back of this form and return to Delta Consultants How often is Class B or Class A foam used in response to fire calls? ~ 0-25% of fires __ 25-50% of fires 75-100% of fires --- Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes No How often is foam used in training exercises? __ Never __ Weekly __ Monthly __ Quarterly __. Semi-Annually __ Annually X~ Bi-Annually rors saan __ Other (please specify): How much foam is used per training event? Less than 5 gallons __ 5 gallons __ 5 to 10 gallons MoMroree tthhaann 1100 ggaalllloonnss ((pplleeaassee ssppeecicfiyfy):): res scm sn In training, where does the spent foam go? ve __ Storm Sewer __ Sanitary Sewer onsets __ On-Site Septic aoe __ Ground __ Other (please describe): Where does/did the training take place? Please include address, intersection or other specific location salainformation na for current and L past training areas. oud & XKilnnogge~nK' ............. 561206-91 wqo2 HF O OVVEERR-- _-- Phone: 651.619.91480405.477 7411 Fak: 651.835.6475 maw. deliacn.com "5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.~39.9449 / 800.47-7174:!1 Fax: 651.639.9473 www.deltaenv.~:em 22223333..00115588 STATE_02826970 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg X A 5. Wattoes) an brads) offama ersusd nw and aay ho Depa, ho ew What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire ng th aleaSey Poschuck ho 299. response and in training (if applicable)? Please check all that apply. ruoraadinn Amooou'nt urenty tray TTyyppeeooff FFooaamm Gass Auman ee me -- -- Class B Aqueous Film-Forming Foam pe (AFFF) Gl8Ahso Class B AlcoholGomme Resistant (AR)aet-~Fi- its arc NS Class B Protein GFueassun 6p) --_-- - Class B Fluoroprotein (FP) Gls Fin Class B Filmfmt | ------ -- -- ---- -- Forming Fluoroprotein fe (FFFP) I Class B AR-FFFP GG us ADA -------- -- = oo TO Class A-B Hi `BBrraannddooff FFooaamm Used in Training? YYeessoorrNNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? cman _Si-ex hs Spl Yo Ab Class A Arter? | mm-- 0 LL Training Foam Over -- = Other Tharcyoutot your tmanmd cooooprnaStoni.nlnasachniMacttKar PRualkainog aDnelaACgorrs(85a12(007513600670 o$152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 nas 0 Yo ov ry RSTO orn Gor. or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PlPeleaasseerreettuurrnntthhiissqquueesstitioonnnnaaiirreettoo DDeellttaaCCoonnssuultltaannttssbbyyJJuunnee66.,22000088iinntthheeeenncclloosseeddssttaammppeedd,,sseellff:`a~ddddrreesssseedd envelope. [-- Questionnaire completed by: Toe Oe Swede NNaammeeaanndd TTiittlee. oo BE A FFiirree DDeeppaarrtmmeennttl oo (oy mses Phone N~mber loule EE--MMaaiill AAddcdreressss. HXwIonogge~w: TT 5910 Rice Creek Parkw'ay Suite 100 St. Paul, MN 55126 USA Phone: 65;[.639.9449 / 800.477.7411 Fax: 651,639.9473 www.deltaenv.em 22223333..00115599 stare o2s26071 STATE_02826971 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNNeAAIInIRRFEEire Training Firefighting Foam Use in Fire Training o / 1. DDoeEs youLr DepTartmAent csrnorthays your Department htorcaly uso ClaAsosr Cless B fo@Gamso Does your Department currently or has your Department historically used Class A or Class B foams for gh operaions? firefighting operations? Jos proces to Question /,/-Yes - Proceed to Question 2 No- Sign th baof tchisfkorm and return to Data Consultants __ No - Sign the back of this form and return to Delta Consultants 2. How fons Class B or ClAafeoasm ued sponse oo cals? 2. How often is Class B or Class A foam used in response to fire calls? eames asso attuos 0-25% of fires /25-50% of fires T5100 offre 75-100% of fires 5. os he Deparment hve a compressed a foam sytem (CAFS) wih in ark ons engines? Does the Department have a compressed air foam system (CAFS) with a buiLt-in tank on its engine(s)? vesweYes 4. Howofion is foam used in raining anarcsos? How often is foam used in training exercises? New Weal tomy utery __ Never __ Weekly __ Monthly __ Quarterly semiaoty pe Amuaty ot Avaly __ Semi-Annually ~,~ Annually __ Bi Annually Overtoasespesty __ Other (please specify): 5. Howmuch foam is uedportarivenntg? How much foam is used per training event? D~ L Leessss tthhaann 55 ggaatliloonnss. ___ 55ggaalloionnss. Wore han 10 gatos lease speci - __ More than 10 gallons (please specify): 51010 gallons __ 5 to 10 gallons 6. ntwhaa dois0nspentgoam go? In training, where does the spent foam go? I mae samysowr_onssosons Soran __ Storm Sewer __ Sanitary Sewer Over eas dose) __ Other (please describe): __ On-Site Septic ~Ground 7. VTirneoevdaosttothoingvaokneopagce? oPleaase nc ada, inrsecon other spc locaton Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. Hwogent OOVVEERR-- rere ETTB EE FREES 100 TE TOIeT UsE 59:1.0 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477,7411 Fax: 651.639.9473 www,deltaenv.com 22223333..00116600 sate 02826972 STATE_02826972 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 8. 8. VTWiehhsaaptot nttysyppeee(a(ss)n) aainnsddabbrrnaanngddi(ss())1oo3ffpfflooacamamtaairreeeyoorPrlwwoeearrseeeuuhsseeecddknnooawwhnantdd 3nin9tDthh.ee paspast by by hethe Deparment, Department, bohboth arfor frefire response and in training (if applicable)? Please check all that apply. Typeof Foam Brandof Foam TYTiUUroaasssiiaenomdaiirniniNgnng?o? AAAmmUmUuossoueeauddnlntyt CGuUursrereendnt?tllyy HHiissUttsooreriidcc?aallllyy CCFilanTsleysEpo8BaeArAqmoqufsueFeoooeFauuomsso Brand of Foam Yes or No Annually a Used? Used? [res Film-Forming Foam (AFFF) ClBaAcsonso- Class B AlcoholeReroe, Resistant (AR)- CAFaFsFsBPoen Class B Protein cFiaosoeton (pp) Class B ------------ ---- ---- ---- ---- CFFFCFiouolluasrorossmmrrseioionnpBBgggrFooFtitielemminn-- (FP) em -- -- (Fe Fluoroprotein C(FaFsFPs)BARFER CECCgallaaasssnssssAABi-oABBnRHHF-FioFaFmP = == = - ass Clas A Expansion Foam Tongro Class A --X woe mzNe Ed reg " ea 77 ETyTT omer Training Foam --_-- .-- TToOrhhthamaenonrkdyynooIuugffoEorrayylootuurar dttiimimeecaaonnmdd)cc:ooooippemerarStaiitioconkn.i. ngPPellereaaasisehcceoonnHttaaiccmtteNNsaoantncacyyPRRolouodinoidnngaCiatotDnnDerelglltaaAgCCooonnnscsuyull(taa6nn5it1ss.2((6065751-18--660909707--c56f115522 or ecknper sat. ns) nrodning@deltaenv.com) you or Jim have any cestions regain I GostoRTIHe. Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire .......................... PPleleaasseererettuurrnnththiiss qquueessttiioonnnnaaiirreettoo DDeellttaa CCoonnssuullttaannttssbbyv JJuunnee 66..220d008~ iinn tthheeeenncclloosseeddssttaammppeedd,, sseellff- "NN `addressedenvelope. | Questonnate completebyd: ub Lele phone Questionnaire completed by: dob n Ware and Tis ---- Name and Title " } _FisKDeeparbimaertlt Fb nn Fire Department Focgns N-umbe3r20-249-2221 Daqte-4-0% Phone Number Da(e EK--MMaailil AAddddrreessss. - " XXilnnoogg~ean" ....... oT TT TE raLr RT eI _ 5910 Rice Creek P~rkway Suite 100 St. Paul, MN 55126 USA 22223333..00116611 STATE 02826973 STATE_02826973 DELTA QQUUEESSTTIIOONNNNAAIIRREE Firefighting FoamUsein Fire Training or blephoae ppt tTTT Does your Department currently or has your Department historically used Class A or Class B foams for firefighting operations? A, ~._~_. Yes - Proceed to Question 2 oS tm kt fom 3d tr to ei Contents No - Sign the back of this form and return to Delta Consultants 2 ovotanis Cie Sor Clo Aton est esprit? 2. How often is Class B or Class A foam used in response to fire calls? Coasts ~ 0-25% of fires Sle dores - 12 25.50%of es 25-50% of fires porjad T5100%ct fres 75-100% of fires 5. ner STAT Ba china aon (CAFS ith bia otangio? oes the epartment ha~e a compressed ai~ foam system (CARS) with a built-in tank on its engine(s)? yaYes >No Hovtomosattin aaignsss? How often is foam used in training exercises? ovo ty wont omy /)k/~" Never Weekly __ Monthly __ Quarterly __ Semi-Annually __ Annually or pes ct : __ Other (please specify): " 5 bom cam esr vg? How much foam is used per training event? Bi-Annually __ Less than 5 gallons __ 5 gallons irn s my, More than 10 gallons (please specify): __ 5 to 10 gallons onan, ars cose va am In training, where does the spent foam go? et SySot ___OnSteet To __ Storm Sewer __ Sanitary Sewer __ On-Site Septic __ Ground B ii m ---- __ Other (please describe): Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. TT rg ale KXwlnoogg~e..nn_'e_ Ea aa OOVVEERR aE 5910 Rice ua Creek Parkway a Suite 1(30 I ir St. Paul, MN a] 55126 USA 22223333..00116622 STATE_02826974 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraainininin X W DrEpsLnTsaAto ffoomvsroyednt rrnte yDt ogenn th T {s R 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. a Used in Amount pTa m. TTyyppeeooffFFooaamm Class B Aqueous Film-Forming Foam BrBarannddooff FFooaamm I Training? YYeessoorrNNoo Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? (AFFF) Class B Alcohol- gmomeo Resistant (AR)=AFFF A Class B Protein Class B 1 a ptFluoroprotein (FP) Class B FilmForming Fluoroprotein (FFFP) a-- Class B AR-FFFP gm = Class A-B Hi Expansion Foam oh - Class A oo Training Foam ps -- = Other S sre rT ent copter, Pas odCo Conta 187 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-69T5152 rma lo re bie Cro or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. spon PPleleaasseerreettuurrnntthhiissqquuesetsitioonnnnaairireettoo DDeellttaaCCoonsnuslutltaannttssbbyvJJuunnee66,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,,sseellff-: aaddddrreesssseeddeennvveellooppee.. Questionnaire completed by: ofople. Dre fept. NaammeeaannddTTilitlee. = A0A)R2s Fire Departmen[ Phone Number Zz7-21-08 Date E-M~FAddress KXmlnooggeenn" Phone: 5910 Rice Creek Parkway 651.639,9449 / 800.4-77.7411 Fax: E Suite t00 t. Paul, MN 55126 USA 651.639.9473 www,deltaenv,om 2223333..00116633 STATE_02826975 DELTA QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training Firefighting Foam Use in Fire Training hd 1. Doss your Department cstntoyr hsyourDepartment historical used lass A or Glass foamfos Does your Department currently or has your Department historically used Class A or Class B foams for etching opwatons? firefighting operations? Ro proconttoGussion ~ Yes - Proceed to Question 2 No Sign thobackofthis form and return t DotaConsultants __ No - Sign the back of this form and return to Delta Consultants 2. Howoftn's Cass BorClass Afoam used inresponseto recals? How often is Class B or Class A foam used in response to fire calls? XXX,_ o0-z2s5w%otoif frireess _2s50%atfies __ 25-50% of fires 7755-10:0%1o0offf0fior%ess 5. Doss the Department have compressedai fam ystom (CAFS) witha btn tankons angino(e? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engirie(s)? X_ ves oYes No 4. Howoftn is foam usadin rnin ararcises? How often is foam used in training exercises? 2KX~ NNeevveerr __ WWeeeekkllyy __ MMoonntthhllyy __ QQuuaratrteerrllyy `SemiAmualy somly BiAmnualy __ Semi-Annually __ Annually __ Bi-Annually overteasospecty __ Other (please specify): 5. Howmuch foam is used por rang overt? How much foam is used per training event? X_ Loss tasgatnors 5 galons ~X~ Less than 5 gallons __ 5 gallons oroth10agalnas (lease spc __ More than 10 gallons (please specify): - 51010 gators __ 5 to 10 gallons 6. In ring, wheredos the spent foam oc? In training, where does the spent foam go? XK stom Sewer __ SataySewer Onsie Seti [-- ~ Storm Sewer __ Sanitary Sewer Other lasso descr) --------ee __ Other (please describe): __ On-Site Septic __ Ground 7. Wfohremraetdioon efosr cuttheraainnidnpgaackksvpanaece? Prlceaa.se includ acess, tersectonor he speci locaton Where does/did the training take place? Please include address, intersection or other specific location Je buve. information for NA trained current and past training areas. Mh Foan Ta A Jeny Fiml. XKilnnoogg~eenn": OOVVEERR-- rene: 651 639.91084000 837 7411 Fok: 241.630.9473 was dnliaene.com. Phone: 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA 653..639.9449 / 800.477.743.1 Fax: 651.639.9473 www.deltaenv.com 22223333..00116644 STATE 02826976 STATE_02826976 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5 inate and rants) fom rear vere usc now nd ho as yo Deptt. both re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire oe sani aca Pan hooker 3. response and in training (if applicable)? Please check all that apply. Tipeot Foam pontoon TGUeesaeadrmihn?e AAm"loooudny.t Cuereenst istDoirsisc?aly Type of Foam iFimrs0aomerosanrson Aug Bay be Zon NN. Class B Aqueous Film-Forming Foam egyps & Laee dywed da. ds C(lAaFsFsFB) Alcohor Class B Alcohol- = I Resistant (AR)- Brand of Foam .~ ~ '~'~-('~ & Used in Training? Yes or No Amount " -Used AnnUally Currently Used? Historically Used? 1rly \, x AFFF Cobo Class B Protein cuss Class B nny Fluoroprotein (FP) Cassin: Class B FilmFarry Forming Hduon Fluoroprotein ---------- - ---- ---- ---- ---- --_ = -- -- (FFFP) i Class B AR-FFFP Goss AB1 = Class A-B Hi Sraneon Foam -- Expansion Foam Clss A Seuzge hs acon Class A rn e---- LL i Training Foam oer = Other Ina yuo ne sd competion Pleas ona Nandini Dea Constants 651.007.5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 daa como so Sings Monet Par Cont Agony (0557 3008 a or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or mee Yo ov ay esr op he aio, jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. ios. 2 T ~ PPlleeaasseerorettuurrnnththiissqquueestsitioonnnnaairiree ttooDDeletltaa CCoonsnuslutltaannttssbbyyJJuunnee 66,,22000088iinnthe enciosedstampedsell: Questomnare caplet by: addressed envelope. Questionnaire completed by: C wom debphon Tim vTis Beehlbe _ ~-- Name and Title Frabpaimart LbolLancs= L.Slovevin poi =4%1- 7024 Fire Department Fri Soe L~i- W~J--7ozfff Phone Number 9-9-0% _ Date EEM-Maiaill AAddddrreessss. ee HXKInwoogg,ee.nn" , ......... ree or 5910 Rice hbAA Creek Parkway Suite 100 St, Paulr MN 55126 USA 22223333..00116655 state 02826977 STATE_02826977 DELTA CvLLeepln" FirefightinQQgUUFEEoSSaTTmIIOOUNNseNNAiAnIIRRFEEire Traini Firefighting~F_~oam-Use-i#I Fire-Training ER ---- Does your Department currently or has your Department historically used Class A or Class B foams for Ro operations? swim oR. mm LA firefighting ,,~ ~ r ~ bl~ No Sign thback this form and turn o ota Consults | - "g " Delta Consultants HootsClas 5 is Aor etn ser rca? 2. How often is Class B or Class A foam used in response to fire calls? corn sso es satin 0-25% of fires o/ 25-50% of fires > os Cieat 75-100% of fires + sro ts SS ar Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes =No . Henst---- 4. How often is foam used in training exercises? os vr iy cums __ Never __ Weekly __ Monthly somo pe rosy in Semi-Annually ~ Annually JEP B oiikii i __ Other (please specify): __ Quarterly Bi-Annually 5 Howmucn foam suse por waning event? 4 Jockos, 5. How muchfoam is used per training event? rms gon smn signs __ Less than 5 gallons __ 5 gallons __ 5 to 10 gallons ~Xx MMoorreetthhaann1100 ggaalllloonnss(p(plleeaasseespsepceicfiyfy):): ,~~ Hdoog s al . oii sere ss penton? In training, where does the spent foam go? ms ayo __onswsese x ccna ..~ Storm Sewer __ Sanitary Sewer ron con __ Other (please describe): __On-Site Septic 2~" Ground 1 Whe os ik paces cad rs, sconce ls sechclocsin Where doesldid the training take place? Please include address, intersection or other specific location Srinformation for current and past training areas. ot 0 35SJey ---- XXinlnoogge~no: OOVVEERR-- 59~.0 Rice Creek Parkway Suite 100 St, Paul, MN 55126 USA 22223333..00116666 sareoases STATE_02826978 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5. What tyets) and brane) of foam ar or were used now and I thopastbye Deparment.bn for re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Teapots avd tami p15 Pleas ehach a ht ap. response and in training (if applicable)? Please check all that apply. TupeotFoan fandotfon YTUresaeadnighn? AAmGwoouoadnyt YCeuUsrsooenarrtlyo HYiseUtssooreirdcla?llley Type of Foam CSl8I oAgsuaem s a em Class B Aquoous Film-Forming Foam Fre (AFFF) GplpBaAosttosl es -- -- Class B Alcohol- Resistant (AR)- AEAFFF RBH mmm me ms ee Class B Protein case _ Class B Farolan (9) -- Fluoroprotein (FP) Case im Class B FilmFoming Forming on ---- -- Fluoroprotein re (FFFP) CORA os em mm Class B AR-FFFP Cr lass A e TT= -- = oT To Class A-B Hi Class A Expansion Foam Class A tee | mr | met reer ee Training Foam omer Ee CE Other Brand of Foam Used in Training? Yes or No Amount Used Annually Currently Used? Yes or No Historically Used? Yes or No lscBrad pte <5pl Jo du Thar youtor our me and cooperation. Pease conact Kary Roding st Dita onauas (51607-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 eames hv ay Gueslons regarding Dis Qssstonnae: or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. Pleaseroturn thisquestionnairetoDeltaConsultantsbySeptember19, 2008intheenclosedstamped, Please return this questionnaire to Delta Consultants by September 19, sesleflf--aaddddrreesssseeddeennvveellooppee.. 2008 in the e-- nclosed stamped, Sn, Fame and THe oo Questionnaire comer { CC Llephon ore Clate Questionnaire.__~,~,.~.._. completed~__~,~ ~bY: Name and Title Coss Dlibtmenn > lFPrieoonapNadortrmenesnt laptio-- n --et---- 1) 320-6eq= Fire Department ize Phone Number 9-24-08 Date mew E-Mail Address HoXlngog~en" rene em ame F55e0i eGe FTRELS100 WdTau aRStISaaUmS Phone: 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA 65~..639.9449 / 800.477.7411 Fax: 651.539,9473 www.deltaenv.cem 22223333..00116677 state 02826979 STATE_02826979 DELTA QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirreeTTrraaiinniinngg Yup 1. rDoastsiyonugrDoepraretmmen?tcurrenty oh you Deparment orluse GSiesl25e)elys, foaaomsick Does your Department currently or has your Department historically firefighting opYeerastio- nPs?rotocQueesteiodn2 (ache poco No Sigtnhe baocfthkis formandretuntoDeltaConsultants ~ Yes - Proceed to Question 2 No - Sign the back of this form and return to Delta Consultants Lecall". dHwer __ yrsed f- 200% 2. Howoftn's Cass o CaAsfosam used in sponse to re col? 2. How often is Class B or Class A foam used in response to fire calls? JO ozs otis 25.30%of res 7510of0fr%es 0-25% of fires 25-50% of fires __ 75-100% of fires 3. Doos Does the the Depariment Department have have compressed a compressed iair oafoam ssyysstteamm ((CCAARFSS)) wwiiththaa bbuuiilltt-iinn tartank oonn sangre)? its engine(s)? ve ~ 20 NoYes No 4 Howotin s foam used n vaning exercises? How often is foam used in training exercises? 22 Never Wea Worthy -- f~o Never __ Weekly __ Monthly __ Quarterly `Som muaty Aorualy OrAmnuaty __ Semi-Annually __. Annually __ Bi-Annually _ Oberllessespesty __ Other (please specify): 5. How much foamis use por vaiing sent? How much foam is used per training event? Less than gars, 5 galans __ Less than 5 gallons __ 5 gallons Moran Ogos plemespeety __ More than 10 gallons (please specify): 51010 galons __ 5 to 10 gallons 6 Intining, heredoes th spat foamgs? In training, where does the spent foam go? _ SomSewsr ___sontySowr __ Storm Sewer __ Sanitary Sewer J ---- __ Other (please describe): __onSieSepie __Ground __ On-Site Septic ___ ~ Ground Tok un n5k pase wader 7. WfhoorrmealdionesflodrdChoe rtaintingpttaoi lace?rPelesa,se include adres, ersecton olor speci ocatr Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. : ode ie XKilnnooggee.#r;o OOVVEERR-- Phone: 5910 Rice Creek Parkway 651.639.9449 / 800.477,7411 Fax: Suite 100 St. 651.639.9473 i . Paul, MN 55126 USA www.deltaenv.cor~ 22223333..00116688 STATE 02626980 STATE_02826980 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNNeAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5. What ys) and rans)of foam ae orwere used now and in th pastby the Deparment, bth for re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire ocaonse ni rain 1 aspcaey? Passe check a 1 290 response and in training (if applicable)? Please check all that apply. TUasendginy AmUosuednt CoUrseend?ty HisUtsoreidca?lly TyTyppeeooffFFooaamm Ga las 8Aq, ueous re ---- -- -- -- Class B Aqueous Film-Forming Foam rer (AFFF) Cel8ao csons -- -- Class B Alcohol- Resistant (AR)- er AFFF CREO rem re mn ee Class B Protein cCaosstofnp) ---------- ---- ---- ---- ---- Class B Fluoroprotein (FP) Class BF Class B FilmFoming Forming Froromoten = Fluoroprotein ren (FFFP) ComoMeER -- -- ---- -- Class B AR-FFFP aYmienoy ----m mm mp mm el Class A-B Hi Expansion Foam Class A nokSusebro] plo. TOT _gnbowd, bebo Class A TamgFoom om ---- ---- Training Foam ower -- Tt -- ---- -- Other `BBrraannddooff FFooaamm Used in YTYeroassinooirrngNN?oo Amount AAnnUnnusuaealdlllyy Currently YYeeUsssooedrr ?NNoo Historically YYeeUsssooerdr ?NNoo Thank you for your me anc cooperation. Pioso contact Nancy Rodrig a Dla Consular (051-697-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 osteoom) you he sy on GAN 113 Sonate or nrodning@deltaenv.com) if you have any questions regarding this qnestionnaire. PPlleeaasseerreettuurrnnththiiss qquueessttiioonnnnaaiirreettooDDeellttaaCCoonsnuslutltaannttssbbyySSeepptteemmbbeerr3300,,22000088iinntthheeeenncclloosseeddssttaammppeedd,, sesleflf--aaddddrreesssseedd eennvveellooppee.. wh BN Questonnsiecompetedby: . vee let)\ Questionnaire completed by: Cree Coed Brodt Rico tele 4) NNaammee aanndd TTiittllee Lobe fork Fo. FFiirreeDDeeppaarritmmeenntt ) 215-235-5109 Phone Kimber ae Phone mber ter S----mmp oo _ O-1-0f Date Kinoger: EE--MMaaiill AAddddrreessss Xlnog~n" , oo emma: Phone: e517 2 050 ST LTE Tak 5910 Rice Creek Parkway 65~_.639.~)449 j 800.477.7411 Fax: 91600) Suite 100 St. 651.639.9473 To eos Paul, MN 55126 USA wm sltasne.cam www.deltaenv.com 22223333..00116699 STATE 02626981 STATE_02826981 DELTA FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training Cd" 1. Doo sour Deparment corny rh oe Dern irl selGeeAbr Clo ars Does your Department currently or has your Department historically use~Class A")gr Class B foams for frostvitto = Yes - Protco Qeuesetidon 2 firefighting operations? ~:~ Yes - Proceed to Question 2 ~" No Sign thebaocf hkis frm and rtm to Gla Constants __ No - Sign the back of this form and return to Delta Consultants 2 How tensCis Bor Glass Afoam use in sponse or cals? 2. How often is Class B or Class A foam used in response to fire calls? oases pr. f-- 0-25% of fires 25-50% of fires 75-100% of fires 5. Do{ts nTs Deeprtmeort hoeve ncowmpTr3estoaars plgoly(CoAFwS)wich gullin an ns engine? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? vesYes No Not Sues 4. How olen seam sd ain eres? How often is foam used in training exercises? \ over Wes Vorty Gunny )<'[ Never __ Weekly __ Monthly __ Quarterly SemArnualy poly seaman __ Semi-Annually __ Annually __ Bi-Annually ove emo spect _ __ Other (please specify): 5. How foumi so or oring oven? How much foam is used per training event? oss han gallons salons S10 10 gatos Less than 5 gallons __ 5 gallons __ 5 to 10 gallons __ MMoorree tthhaann1100gaglallloonnss ((pplieeaassee ssppeecicfiyfy):): 6. In tain, wher does h sentfom 05? In training, where does the spent foam go? Seem Sever SanitarySever __ Storm Sewer __ Sanitary Sewer a __ Other (please describe): onsi seic __ On-Site Septic Groat __ Ground 7. Wm hore doo th ining akeapcye? oPlnsse ino ies, erosion thr spc cain 7. Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. OOVVEER R Prone: 531.639.5305 1500 973 7411 Yok: 651030947) mmntoaatiasonms. 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.com 22223333..00117700 stare 02826982 STATE_02826982 FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNssNeNeAAiinInIRRFFEEiirree TTrraaiinniinngg DELTA 5. What ype) and branadfioasm ar orvere used row and Fa pabsy the Depaorth ftr,re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tosponte i raning apical Pease chock al hal 9p. response and in training (if applicable)? Please check all that apply. TeUasmaidnign? AmUoseudnt Currenty Historically TTyyppeeooff FFooaamm tGlassiB Aqeueouss be. es Nae de. te) Class [3 Aqueous Film-Forming Foam py (AFFF) Gl8aAlsots ee ns ------ -- Class B Alcohol- Resistant (AR)- rE AFFF CAOBIM mmmnees mm mrs an en Class B Protein n caseey ------------ --- ---- ---- ---- Class B Fluoroprotein (FP) Class Bim Class B FilmFForramoionpgrotan _-- = -- -- Forming Fluoroprotein ery (FFFP) COMBHIIP eee mm mm mm om Class B AR-FFFP SClpaasnssiAosn Ftoam -- ee Class A-B Hi Class A Expansion Foam Class A TomgFon Training Foam omer --_-- Om ---- Other BBrraannddooff FFooaamm dstben) Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? Nae fnbked O Thanknyoufoarcyamuarartmmcoamn) ocooopenraStitoonc.ingPlee:aase{cnooMnintneNsaontcayPRoloutiogn CforDtorlllaACgoonnsyu(a6n5s1-(263917.-68067o6-58f152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@cteltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or kr te rs) You hv a lon erin i queso. jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Please rou this questionaire o 0 ots 8 the enclosed stam addressed envelope. Please return this questionnaire addressed envelope. to Delta Consultants by June 6, 2008 in Ck Leper the.en~16~ ~stamped, self~ J---- Lber) Questionnaire completed by: -- CNamraaend Tdie Seert Nakon - Lakewitle Name and Title FE Fire s Depar-tme9z nt4S 4710! Gi0-0% _ PhPohonneeNNuummbbeerr oo oo DaDtaete: oo Xinogen: EEMMaallil AAddddrreessss Xlnogen" remeron are S TerS e reTyoL SSN0T2IdE Fd a aSSI UncRa 5910 Rice Creek Parkway Suit:e 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.om 22223333..00117711 STATE 02626983 STATE_02826983 DDEELLTTAA vi ebb) FFiirreeffiigghhttiinnQQggUUFFEEooSaSaTmTmI.IU.OOosNNUeNNsiAeAn-IIiRRPFEiEirr-ee TTr-ariinniingg.... bitttenie etfs oe Gann 1. Doesyour Does your Deparmentcurrent Department currently or hasyour or has your Deparment Department historical historically used(Gass usedfClass Apr A/~r a~lasss 8sB ff~g;aammssffoorr firefighting operations? ~,~' Yes - Proceed to Question 2 __ No - Sign the back of this form and return to Delta Consultants How often is Class B or Class A foam used in response to fire calls? /z~.) 0-25% of fires 25-50% of fires 75-100% of fires bet et po CS i 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes o=tetto 4. How often is foam used in training exercises? oO __ Never __. Weekly __ Monthly __ Quarterly __ Semi-Annually __ Annually __ Bi-Annually iXX.--. OOththeerr ((pplleeaassee ssppeecciif)y:): a, #s.~.~s4_~y,,~, o~ llie pon Eoe n + erracetare 5. How much foam is used per training event? i EI BR .,~ Less than 5 gallons 5 gallons __ 5 to 10 gallons __ More than 10 gallons (please specify): nr et ttn In training, where does the spent foam go? sal ..~ Storm Sewer __Sanitary Sewer ote __ On-Site Septic mum I:,,X~ Ground 1 __ Other (please describe): p ey o eer eeee rn ts tpt Where does/did the training take place? Please include address, intersection or other specific location As information for current and past training areas. Scr Xlno~,,n,)~ ............... Phone: Phone: 651.630.0045 / 800.477 7411 Fak: 5910 Rice Creek Parkway 651.639.9449 / 800.477.7411 Fax: } OOVVEEiRR--> S'Jite 100 St. Paul, ~IN 55126 USA 631 839m. em.0dal4 tas7 nu.c3om 651.639.9473 www.deltaenv.com 22223333..00117722 STATE_02826984 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training Vib eds) and braofsfo)am ar ofwereus mow and inept by he Dapaiment both ar fro 8. What type(s) and brand(s) of foam are or were used new and in the past by the Department, both for fire Tospomua nan 1 appicabiey? Pease check a ht apy. response and in training (if applicable)? Please check all that apply. pectFoam bundofFoam TUYosonesidonirgnN?o AAmmUmosueadnlty CuUrsmeedn?ty HisUtsoreidc?ally Type of Foam Clase 8 Aquos od 5 2059 FimsomugFoam Class B Aqueous Film-Forming Foam Fn, = JAP (AFFF) Ga8sAcotho Class B AlcoholSn Resistant (AR)pa AFFF CuseBPOWn Class B Protein cases Class B Fuaropain (77) Fluoroprotein (FP) Ca8sFasm Class B FilmForming -- Forming Fomogen | ---------- ---- a Fluoroprotein wre (FFFP) ComBARFFP Class B AR-FFFP Close AH Class A-B Hi Coiontoan -- -- ---- ---- Expansion Foam Class A exdtleny do cul JE TCralaisnsinAg Foam Training Foam oer - oT Other Brand of Foam ----XSoo { = Used in Training? Yes or No Ko Amount Used Annually Currently Used? a Historically Used? = Aes -- -- "aThranokayou faor yougr ioCanodocfomoopteraStliookn.ingPolraashceonMtaicntnNeasnocayPRooldurtionngaCtoDielltaAgCeoncnysu(8l5s12(95714.0669075152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 o or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or SmSicknerGe ru) f 04 ave any stor Garin is quesiannai jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PPlleeaasseerroettuurrnntthhiissqquuesetsitioonnnnaaiirreettooDDeellttaaCCoonnsuslutltaannttssbbyyJJuunnee 66,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,,sseellff-: scossedsovelope. p . addressed envelope. Guestonnaecompletedty: NER Tee Cran beck Questionnaire completed by: Dolewmet~-- FemoTtwe = J LaPoy Name and Title To. Fabien 4) 501-324- Fire Department 3 S22 PPhhoonnee NNuummbbeerr - To fellas -- 9-10-08 Date E-EM-Maialil AAddddrreessss eeKinoger XInog~"_ - orone tines rAv5910 SEOERice CrAFRFECSET0E300SA T 513A 6 TS Creek Parkway Suite 100 St. Paul, MN 55126 USA 22223333..00117733 STATE 02826985 STATE_02826985 FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNssNeeNAAiinInIRRFFEiEirree TTrraaiinniinngg DELTA ' AR rs 1. Does yourDepatment cuanto is your Deparment hisorcaly used l--ags Aor Gis fpals o:r Does your Department currently or has your Department historically used Class A or Class B foams for rehahing operators? firefighting operations? Yes Procondo Question 2 __ Yes - Proceed to Question 2 No.Sign he baofctiks fom and return ala Consultants __ No - Sign the back of this form and return to Delta Consultants \ J 2. Mowofeni Class B os GlAafsoasm usd in espanse fo fre ces? JSX oases ___z5somkites 2. How often is Class B or Class A foam used in response to fire calls? 0-25% of fires 25-50% of fires rstocsolties 75-100% of fires 5. Does the Depart av + compres ai foam system (CAFS) Wiha ulin tankon fs engines)? 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? veYes AA No. /- 4. Howalen foam usadin aking exercises? 4. How often is foam used in training exercises? X__MNever Weakly Vorty Quarry ~_ Never __ Weekly __ Monthly __ Quarterly Semi Aonaty Aanuaty Shovuaty __ Semi-Annually __ Annually __ Bi-Annually Othe (lasospect - __ Other [please specify): 5. How much foamis ued por ring even? How much foam is used per training event? Lestansgalons ___ sgalons __ Less than 5 gallons __ 5 gallons More tan 0 gatos (oasospontyy More than 10 gallons (please specify): sot __ 5 to 10 gallons 6. Intainng. wher dos th spent foam gs? In training, where does the spent foam go? Storm Sows __ Santry Sever __ Storm Sewer __ Sanitary Sewer J ---- __ Other (please describe): onsio epic __ On-Site Septic oGoowns __ Ground 7. Where does th Using ak lace? Please ud aes, erect aver spec cao 7. Where does/did the training take place? Please include address, intersection or other specific location tomiotSavoon mang vo tami information for current and past training areas. JInogen' OOVVEERR--> 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA 22223333..00117744 state 02826986 STATE_02826986 QUESTIONNAIRE FFiirreeffiigghhttiinnQggUFFEooSaamTmIOUUNsseNe AiinnIRFFEiirree TTrraaiinniinngg 5 DWhEatL) Tnd rAant) foamar or wer snow ad pat be Deparinn, bt forLQW a$dx What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire eam oes sro obo oo response and in training (if applicable)? Please check all that apply. rUoosadirn AmMoau'nt curenty Wtoricaly TTyyppeeooff FFooaamm GGlas 8pAuss ee -- Class B Aqueous Film-Forming Foam pes (AFFF) CUl8aE Aostosl or. mm =e Class B Alcohol- Resistant (AR)- feAFFF TBI mmm mn oe ee Class B Protein GGoSss ney ---------- ---- -- ---- ---- Class B Fluoroprotein (FP) Gl8aFisn Class B FilmFri | -------- -- -- -- ---- Forming Fluoroprotein -- (FFFP) SIRI mms mt on me met Class B AR-FFFP consH DprtonFoam Class A-B Hi Expansion Foam Gloss kX Lull Zp Class A Tot) | rime -- Te --_-- Training Foam omer = = Other BBrraannddooffFFooaamm ~ Used in Training? YYeessoorrNNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UsUseedd?? Tp 1 74 /~ hkyoufr your ma and capticoni. nFgloss onMaemNoanrPFaotagCstoonteanCeonysta(6n5ts 2(9571605078.5o152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or nso) Tod bn ay sr eranhs Qo jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire: Please return this questionnaire to Delta Consultants by June 6, 200~ in ........... stamped, ~1_ aaddddrreesssseeddeennvveellooppee.. Guess complied Quest~nnair/p completed by: hat A Ye 4 _ Name and Ti/tle "Fhb ale _ Fire Department FEraw SOsN-Y3E Yip7eS" pple oe Phone Number Date Ho~Ingo~een" an TE Phone: 5910 Rice Creek Par~way 655.639.9449 / 800.477.74~$ Fax: Suite 100 St. 65~.639.9473 TE Paul, HN 55~26 USA Www.deltae,~.cem 22223333..00117755 stare 02826987 STATE_02826987 DELTA Totlo FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training _ Firefighting Foam Use in Fire Training Se | gptaiotoen sous Cd Does your Department currently or has your Department historically used Class A or Class B foams for firef~ng operations? Yes - Proceed to Question 2 TT ween __ No - Sign the back of this form and return to Delta Consultants og rc tr 7 How often is Class B or Class A foam used in response to fire calls? _X oom 250% ares 100% otros ~ 0-25% of fires __ 25-50% of fires 75-100% of fires ee i e7 Does the Department have a compressed air foarn system (CAFS) with a built-in tank on its engine(s)? Jya Yes How often is foam used in training exercises? OEE owen __ Never __ Weekly __ Monthly __ Quarterly Semi-Annually __ Semi-Annually A AAnnnunaally _ ___ __ BBii-AAnnnnuualalllyy ~ pe ee __ Other (please specify): + srgtom asso eset How mt~c.~h foam is used per training event? A han sns [-- sro __/'~' Less than 5 gallons __ 5 gallons __ 5 to 10 gallons rTgRi IE sano? __ More than 10 gallons (please specify): In training, where does the spent foam go? .,,~' Storm Sewer __ Sanitary Sewer nie __ On-Site Septic oe __ Ground __ Other (please describe): ES A -- Where does/did the training take place? Please include address, intersection or other specific location DF S 2 Gi e Gl hea, Ha I information foj:.,cur~nt an@ past/jtraining areas. .,~ /) I,/ .,~ ~/ Xinogen- OOVVEERR--> } Shane: 631.630.189050403037411 For: 51.630.9473 Mri dalianny.am. 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.com 22223333..00117766 STATE_0282 6988 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5 Wht iype(e) and brandis) of foamarwero usd now and nthepastby th Deparment, bofor re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. response and in training (if applicable)? Please check all that apply. Typoof Foam Brand of Foam VTUoosrneoidrnitgnl?e AAmsmmogeluydnt YCuesrseroeqnrtrlloy HYiseUtsosroiercdaNloly Type of Foam Brand of Foam Used in Training? Yes or No Amount Used Ann__q_qp~ Currently Used? Yes or No Historically Used? Yes or No Sot, osuly So wo 0 Te Class B Aqueous (RFF) Film-Forming (AFFF) Foam een) ail, LethWend GRs s ct eee Ww ee -- -- Class B Alcohol- Resistant (AR)- re CAiFaFsFs 8 ProteinCs Class B Protein ied bonne 10yLs i a caussn e y ---------- ---- ---- ---- ---- Class B Fluoroprotein (FP) CsaFsim Class B FilmFFoarmmionggosn | ---- -- Forming Fluoroprotein Fe (FFFP) TBI eee om me ree em Class B AR-FFFP Cla ass ABn H ---------- TT = -- Tg Class A-B Hi Glos hosel 4 25 yg ClassExpaAnsion Foam Toerr en X TT o --/- al Other Thankyoufor your to and cooperation. Pease contact Nancy Roding i Dolla Consuans 651-697-5162 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 rac@oiaam am yo ave ay Questor eGarOg 4s Gusstonake. or nrodning@deltaenv.com) if you have any questiorqs regarding this questionnaire. BE ~-- Please return this questionnaire to Delta Consultants by September agg self-addressed envelope. Questionnaire completed by: re Clie Con Collie dm -- Nameand Te Name and Title LeE nCod FreDeparment Fire Drepa3r=tm2e0n-t 22-le Ho Phone Number p:r de WOH Ena w9e-280% Date EE--MMaailil AAddddrreessss HoXlngogeen" or 5910 Rice Creek Parkway Suite 100 St:. Paul, MN 55126 USA Phone: 551.639.9449 / 800,477.74.21 Fax; 651,639.9473 www.deltaenv.cem. 22223333..00117777 STATE 02626989 STATE_02826989 DELTA FirefightinQQgUUFEEoSSaTTmIUIOOsNNe-NNiAAnIIRRFiEEre Training Firefighting Foam Training V4 phot, > 1. Does your Department curentloyr hs your Dearment hircaty Goad GaASsrCso fms for Does your Department currently or has your Department historically used Class A or Class B foams for rngopeaions? firefighting operations? Ves - ProtcoQueesteiodn2 __ Yes - Proceed to Question Z 7~ No Sin the backof his form and tum 10 Dota Gonsulants No - Sign the back of this form and return to Delta Consultants 2. HowlinsClasBsor Class A foam used in esponeo fo fro cals? 2. How often is Class B or Class A foam used in response to fire calls? 028 otties 20 25505ates 0-25% of fires renformant ~ 25-50% of fires, . 75-100% of fires 33.. DDooeess tthhee DDeeppaarrttmmeenntt hhaavveeascooomm prpersessesdea~ir/mfo~aym~sty~s-tmem'(~(ACAFFSS))wwiitthh aabubiulitlt--iinn ttaannkkoonn iittss eennggiinnee((ss))?? veYes ne ~ No 4 How fens foam used nang exerci? How often is foam used in training exercises? ro ey oy oun __ --__ Never __ SomiAnnually Weekly __ Annually Monthly __. Quarterly aB-Annually __ Semi-Annually ,~Annually __ Bi-Annually __ OOtthheerr ((pplleeaassee ssppeecicfiyfy):): __________ 5. woh foam fs used por ring var? How much foam is used per training event? Se Loss ran' gatos Sanions f~.~ Less than 5 gallons __ 5 gallons 7 bore han 10 gos lens spc): __ More than 10 gallons (please specify): St 10gakons __ 5 to 10 gallons . Intiing, hire doos te sper foam 57 In training, where does the spent foam go? Sommer ___SontaySewer __ Storm Sewer __ Sanitary Sewer __OnSieSepte_X0 Gromd __ On-Site Septic ~_. Ground __ OOtthheerr ((pplleeaassee ddeessccriribbee):): ns Gress Where does/did the training take place? Toi mmaion tot cone a es one information for current and past training eUere Please include sron cls,address, ealaial par intersection or other specific location KogIneogern' OOVVEERR-- rane con 5 oAeTCES ToL SEISsoM ri Aw i e 5910 Rice Creek Parkway Suite 100 St, Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.cem 22223333..00117788 sate 0282699 STATE_02826990 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg oA Se A Tvasneagny aUmsoedun Gummy Historical 5 What type) and branodf fsoa)m a orwero used now rd in ast by he Depart, both or fre What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Teshones and nang 1 apphcabi? Please check a at apps. response and in training (if applicable)? Please check all that apply. Used in Amount Tupootfoam Type of Foam Gi8nAqsueosus Class B Aqueous Cimrommoton Film-Forming Foam WF (AFFF) Glass 8 Aon " oe Class B Alcohol- en Resistant (AR)AREAFFF CBI ee. mm em ee Class B Protein asst Class B Faoroeoten (7) ~-- Fluoroprotein (FP) ClaBsism Class B Film Foming Forming Fluoraposin ~ -- Fluoroprotein (Frey (FFFP) ComBAREER oo ---- Class B AR-FFFP Class A Hi oo -- Class A-B Hi Bxparsan Foam --_-- Class A Expansion Foam Class A oT ee ---- -- - Training Foam over --_-- TT" QQ -- oe ~~ Other (*V~'~\'L~'~ BBrraanndd ofFoom __ ~0(~'. of Foam -- Coe , ~ Yosortio Training? Yes or No Annually Used Annually Used? Currently Used? Used? Historically Used? Aue Sadoiveal am Mu esos ohfamrekocyonumofo@raysoturaamnocoamn)d ocouJpiemraSttoonc.kiPnlgeaishceonMtianchNeasnacayPRootuxtionngGaotnlDieollloACgeonncsyu(l6t3s1-(265017.-60967o6561f52 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv corn) or Jim Stockinger at the Minnesota Pc ution Control Agency (651-297-8666 or Feiner etoY)ou have ay uestons regarding is uestonnais. jim.stockinger@slate.mn.us) if you have any questions regarding this q uestionnaire~.~........... PPlleeaasseerreettuurrnn tthhi:is questtioionnnnaairireettoo DDeletlata adadddrreesssseeddeennvveellooppee.. Questonnecompleted oy "Don Daut-sebs Questionnaire completed by: Fite FrebLoautvmeenrne. FB Fire De5partme5nt07-253-Giefl FonsNumer Phone Number CCoonnssuullttaanntstbsbyy JJuune 6, 22000088iinn.tt_~/enc.losef statammppeedd,, ,. self- ~N\ vo- cot tbe CEiork l-- ed --L-- ulepl. on" e r-', fb (. ~ ~ v -- (werk a5-05 ew Date E-EM-Maialil AAddddrreessss. or oo e Kinogen h 8 43 SAFO OOo TPWARPERS ET Xlnogen" 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA 22223333..00117799 STATE 02826991 STATE_02826991 / DDEELTA FirefightinQQgUUFEEoSSaTTmIIOOUseNNNNiAAFrIiIiRRrEEeTr_a_i_n_i_ng~~. Firefighting Foam Us. eil Fire Training wuo ntelepbrs 1. Does your Deparment curently of has your Deparment hstoricaty used GlasA Class8 foams for Does your Department currently or has your Department historically used Class A or Class B foams for frehohing oouatons? firefighting operations? _X~0__ YYeess-- PPrroocceeeedd ttoo QQuueessttiioonn 22. No Sign thobackof this form anreturnto Data Consultants __ No - Sign the back of this form and return to Delta Consultants 2. Howoftenis Cics a Cass Afoamused inresponse fo re cals? 2. How often is Class B or Class A foam used in response to fire calls? Casthossndtes __ovsoseetiues 5.10ot0r%es + Pearly lace B -- Homo (~.(.&4,X A 0-25% of fires 25-50% of fires 75-100% of fires 3. Dossth DeptRetveSoomprssedai am sysiom (CAPS) wih a uit tak an 5 gins? 3. Does the Department have,a)compressed air foam system (CAFS) with a built-in tank on its engine(s)? kveesYes 4.How olen foam uscd in raring exercises? How often is foam used in training exercises? ewes wenn ~ 3our __. Never __. Weekly __ TT Somaru Aovaly rr __ Semi-Annually __ Annually P-- -- eee Other (please specify): Monthly __ Bi-Annually J_ Quarterly 5. How much foam isused er raining vent? How much Lesstans gatons__)C_ foam is used per training event? 5 ators Toren Less than 5toggaallolnosns p~ ose spectyy 5 gallons __ More than 10 gallons (please specify): S010gatons __ 5 to 10 gallons 6. Intaing. where coas the spent foam 0? In training, where does the spent foam go? SomSour Sankary Sewer __ Storm Sewer __ Sanitary Sewer Other (ploase ese: __ Other (please describe): onstoSepte __ On-Site Septic Ground __ _ Ground 7. nWWhoheerrremaddonoesef/odrsicduthteetiraaiinnidnngpattsaktkeevlpaalaccgee?? lPreleecassa.e iInncclluuddee akses,n| irsetion address, intersection oor terother speci specific ocaten location _ Pure information fanc for current daae aon and past training areas. =F wile Luvese, tho TS Lo clip pith dup of pllonceecs roan Zoal gic ne XXilnnooggenn" , . OOVVEERR-- Een AT 5910 BORice Creek Parkway PRSuite 100 St. Paul, MN eee 55126 USA 22223333..00118800 sTaTe 02826992 STATE_02826992 . QQUUEESSTTIIOONNNNAAIIRREE FFiireeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg D F.. L 85.. WWThehsaapttotnpysepelesn()si)aannnddrbbirranannnddg(((ss)1)oosffpffopoaaimmcaaaeereyoorPrwlweeerarsoee sucseheeddcnknoaolww haaaannddpIInin tt.hheappsasttbbyy heDepartmen,bah the Department, both or fro for fire response and in training (if applicable)? Please check nil that apply. Coss some pes 2hul ye x5 TUrsiednign? TypeofFoam Celm8aAqeuseosurs ---- Class B Aqueous Film-Forming Foam (RFF) (AFFF) Cl8asohso. Class B Alcoholae Resistant (AR)Fe AFFF CassBPrown oo Class B Protein calasns y) ---------- ---- Class B Fluoroprotein (FP) ClaBFsims- Class B FilmForming Forming Flioraprossin (FFP) Fluoroprotein (FFFP) Coss BARRED oo Class B AR-FFFP CBoosmsmAoBntHoan | ------ == Class A-B Hi Expansion Foam BrBarannddooffFoam Used In Training? YY,e~=soorr NNoq Amount Amount Used Used AAnnn.uuaallllvy -- -- -- ---- Ll ---- = Curent Currently Usede. Used? YY,e.~soorr NNoo -- Historical Historically Used? Ulld? Yy~essoorr Nboo ---- ---- -- ---- TT -- ---- Class A Toboemr gFem Training Foam oo OL -- -- -- -- -- OTTOhtharenarkayyoonuunffoaorarykcyootuuarrsttiimmceeaaamnn)d Iccooooopupeerahrataitviooenn.n. yPPllqeeuaeassseticcooonnnsttaafccettgNNaaranannccgyy rRRioosddruniiennggstaatoDDnlenlltaa:CCoonnssuulaltantnsts (8510075152 (651-697-5152 or nrodfling@deltaenv.com) if you have any questions regar~lin9 this questionnaire, _p~!=_~_~_e,~tum lhi~ q~estlqnnaire to Delta Con:~ltant~ by $#Dfember 30, 2008 in the enclo~e~ stamDedJ " serf.addressed ~nvelo~e~ Questomare competed: et) Questionnaire completed by: Namse hsnoa Teo Lamon] Fed Chief % Name and Title FiADeapadrtimeontn Cafe five Fire Department oy 38/-/22 Phone Nurbor Toe Phone Number F-2Y-0g Date J Evade E-Mall Address oe Phone: aera a se CATTEak: 5910 Rice Creek Parkway 651.639.9449 I flO0.477.7411 Fax: $51038.3473 Sulte 100 St. 651,.639,9473 mwdaliaRRL.SOR Paul, MN 55126 USA Www,deltaenv.cont 22223333..00118811 STATE 02826993 STATE_02826993 FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTTmmIIOOUNNs Ain -W[Veancy 1.DDocEsouLr opTmeAnt coma hsyour epamensrcly ei Cis Ao&Tr hGiospdBahgirsengsor Does your Department currently or has your Department historically used Class A or Class B foams for frcatcbeci) firefighting operations? XC ves -pocaeato uemton ~ Yes - Proceed to Que~llon 2 No-Sign heBakof hi fom and tum oOnaGonautar -- No - Sign the back of this form and return to Delta Consultants 2 How tani Clos orClaes Alo uecin espns cls? 2. How often is Class B or Class A foam used in response to fire calls? castor _f soueties Ts0mtottes ~ 0-25% of fires ~ 25-50% of fires 75-100% of fires 3 con teDeprirnt ave corprsed foam ys (CAF)wthaul arkanrgo? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? KoveYes 4. Howoteni amused nang cron? No o How often is foam used in training exercises? TT comeamaly ____ Armualy ~NNeveveerr ~ WWeeeekkllyy ... __ Semi-Annually ~ Annually _X_ iamuaty , MMoonntthhllyy -- Quarterly /.~ . Bi-Anrlually _ OtOhtheerr ((pplleeaassee ssppeecictifyy)):: 5. How muchfa sodprinovgen? . How much foam is used per training event? C tesavan Somos gaara stron ~ . Less than 5 gallons ~ 5 gallons Voth togolors Glee ~ More than 10 gallons (please ~ 5 to 10 gallons 5. ntiwhedon cunt oom? In training, where does the spent foam go? _~ ___ StSotorrmmSSeewweerr _~ ___SSanaintitaarryy Sewer Sewer ____....OOn-nS-SititeeSSeepptiticc XJ~_. GGrroouunndd 1 ihre cos pt ing kecea ePaseo es, retin hr sion ~OtOhtheerr((pplleeaassee ddeessccrriibbee)):: -_ Where doesKIlcl the training take place? Please include address, intersection or other specifte Ioc~tion inTfoormmataionffaordcurrenLtaanndepast =training aHreuasn. g0 wes? 2 Tomided lone Tame zeox - InIongoegnen"' OOVVEERR--.- Phone: 5910 ~lce Creek Parkway 551.639.9449 / 1~00.477.?,tll Fax; Suite 100 St. 651.639.9473 ep ET Paul, HN 55126 USA Www.deliaenv-eom 22223333..00118822 srare_oasases STATE_02826994 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire TTrraaiinniinngg Firefighting Foam Use in Fire DELTA a. Whattype(s nd rants) of oom areorwer use nwand nepas by th Deparment ohfor re What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire espera snd tain PIGS Pleas chock a al abl. response and in training (if applicable)? Please check all that apply. TUrsaevdinign? AmUosuednt Curent Historically TTyyppeeooff FFooaamm CassBAeoss Cimommoroan Class B Aqueous Film-Forming Foam Fen, (AFFF) GC las 8e Achat -- -- -- -- Class B Alcohol- Resistant (AR)- REAFFF RBI ms mm em em om Class B Protein BGasoesone) _---- -- -- Class B Fluoroprotein (FP) Cl8aFism Class B Film" Formin| g -------- ---- ---- ---- ---- Forming Fluoroprotein FE (FFFP) ConBAIP eo em mm mm ---- Class B AR-FFFP ClGassrrothn ---------- = Tree a Io Class A-B Hi Expansion Foam Cassa rebsussbeet No e5vel Mw de Class A Ttoun HoweTonon borerhaunf asdoneog ruse Training Foam oer 0 Other BBraranndd ooffFFooaamm NoCla B wast Used in Training? YYeessoorrNNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? TT hank s you forcyaovuraemmecoamndocogopoeraStiooni. nPlseaatsoceonMtaicnNnanacyFRooodinnCgorDvollAgCeonncsyu(l6a51r2(6675-196805075o152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 ctr se mrs) you hve a lions regarding I questo, or nrodning@deltaenv.com) or Jim Stoc~Jnger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. oi turnthis quostionnai nsutta ne 6.2008 inthe en Please return this questionnaire to Delta Consultants by June 6, 2008 in the addressed envelope. addressed envelope. ole TT N Question compile by: wan felipe Questionnaire completed by: NamWeoaenedTHE(Wiel Pcbart Wichmoor _ -- NameW and Titleco hanBern FB. -- Fire Department ,f~oo1~~~ $~26_-3~10o!l PhPohonneeNNuummbbeerr oo oo q-22-0%" Date oo Kinogen E-EM-Maialil AAddddrreessss Xlnogen" TT 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 55"[.639.9449 / 800.,~77.7qll Fax: 65!.639.9473 www.deitaenv.ern 22223333..00118833 STATE 02826995 STATE_02826995 DDEELLTTA A QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinnFire Traini N\feelt 2 1 Docs your Oeparmant cure rhs your Deparment socal seGas2s) iss 3 foams for Does your Department currently or has your Department historically used(C_lass A..~ Class B foams for roti cpoaons? = firefighting operations? X_ Y-eProcseedto Questio2n Yes - Proceed to Question 2 No- Sign tho back of this form and rettouDrotna Consultants __ No - Sign the back of this form and return to Delta Consultants 2. Howoflenis Glass B or GlaAfsoasm used responstofr cals? How often is Class B or Class A foam used in response to fire calls? _ oasvortues 550% of res 0-25% of fires 25-50% of fires T510of0re%s 75-100% of fires 5 Docs the Deparment have acompress a foam system CAFS) wih un tank ons angie(s? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? ves fwYes $ No 4 Howotenis foam used in ang exercises? How often is foam used in training exercises? XNewr __ Weeky ___Monhy J------ ,,~ Never __ Weekly __ Monthly __ Quarterly Semiaumualy Aoray Sraly __. Serni-Annually __ Annually __ Bi-Annually _ overessesseaty __ Other (please specify): 5 How much oan is used par vaining event? How much foam is used per training event? Less tran 3 gators 5gatons __ Less than 5 gallons __ 5 gallons toro han 10 gars (lease spo: __ More than 10 gallons (please specify): 51010 galons __ 5 to 10 EEgallons 6. In raining,wheedos the spent foamgo? In training, SomSewer where does the _sp_en_t foSaamnagro?ySower ___OnSteSeple Ground _ __ otergemsecwemer__________ Storm Sewer __ Sanitary Sewer __ On-Site Septic __ Ground __ Other (please describe): 7. ners does tn rain take piace? Pease includeadress, ntrsecoritohnr speci cation Where does/did the training take place? Please include address, intersection or other specific location foreaiton fo cea nt and eac r,agaross ; sani A various information for current and past training areas. Xinogen Xlnog~'. ............... OOVVEERR-- orev 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA hone: 651.639.3305 1 500.077 411 Fak: $91.539.3475Wr.ARIGARRELAM. Phone: 65:1.639.9449 / 800.477.7431 Fax: 651.639.9473 www.deltaenv.em 22223333..00118844 STATE 02626996 STATE_02826996 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNNeAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 8. 8. VW oisnhpaaotttntyyeppseea(ssn))daainnnddrbbraarngad(ns1)dofp(fpffolsoaca)mmabaairreee?oorrPwlweeerarseeeuuscsheeecdcknnooa wwhaatnnddaipinpnltt.hheeppaatstbbyy heDeparinar. both the Department, both for for rofire response and in training (if applicable)? Please check all that apply. nko Es ESE 055ionNoss conta arcy RoarsDi Codints (051675152 TTyyppeeooffFFooaamm Cl8aAquseoeus Class B Aqueous mtn Film-Forming Foam rey (AFFF) Cla8 sohs Class B Alcoholee-- Resistant (AR)NE AFFF Cort BOE Class B Protein Clas8s Class B foten fp) Fluoroprotein (FP) Class Fim- Class B FilmForming Forming Fiuoroproten Fluoroprotein Fm (FFFP) CBA Class B AR-FFFP Close 8H Class A-B Hi on Expansion Foam Class A Class A Training Foam Training Foam ove, Other BBrraannddooff FFooaamm -- meen ------------ oo oe ---------- et | Toe Debs Usedin Used in Toamng? Training? YYeessoorr NNoo em Amount Amount Used Used AAnnnnuuaallllyy Currently Currently Used? YYeeUsssoeodrr ?NNoo mm Historically Historically Used? YYeeUsssooedrr?NNoo -- -- ---- -- -- mm me mem ---- ---- ---- ---- oo me em ---- ---- ---- nt ---- ot ---- sme Ys --f_--ed =Fry Ts oF radio else com) you naveany questord eGaring is Gueslonnare: Thank you for your time and ~pera~lease contact Nancy Rodning at D~lta Consultants (651-697-5152 or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. ey Questionnaire completedby: - NJelepbo) B Please return this questionnaire to Delta Consuo ltants sesleflf--aaddddrreesssseeddeennvveellooppee.. - Questionnaire completed by: Fame"aEnaiiTrhgee uibee?n ChiE s LaR wcporth = Name and Title Prone Number FiFrireDe eDeppaarrtmtemnet nt \) 507-529-3341 Phone Number Ta9e23.0% Date EE--MMaialil AAddddrreessss Knogen Xlnog~en" ............. oo oo C res arn 67E mTeSe SR ST TE FRR: T$T0) e1930557MS Fwe ReEeR SnaUmE Pho~qe: 5910 Rice Creek Parkway Suite 100 St.. Paul, t4N 553.26 USA 651.639,9449 / 800.477,7411 Fax: 65:1.639.9473 www.deltaenv.conn 22223333..00118855 STATE 02826997 STATE_02826997 DELTA FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNssNeeNAAiinInIFRRFiEErierTr_a.iTnirnag i Clap Lo oe Dog ty ys epGe s crCe o fifDrireoefefiisgghhyttoiinnuggroDoppeeerpraaatrttiimoonnessn??t currently or has your Department historically claws used Class ~C~.4~ AB aliks A or Class B foams for ~f- ~_ ~ ,4h~" ~- ~-~ OR vrtiniumint /k~) Yes - Proceed to Question 2 ee mauaCn oan __ No - Sign the back of this form and return to Delta Consultants 2. How often is Class B or Class A foam used in response to fire calls? X_ oat fa I ~(' 0-25% of fires __ 25-50% of fires 75-100% of fires ------------------ Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes vowsoo esis? How often is foam used in training exercises? i ens i soonn ave __ Never __ Weekly __ Monthly __ Quarterly __ SOtenmeri(-Apnlenausaellyspac): _ ____ frAanvncuaellycon(ed_4_ % yomg Bi-Annually __ Other (please specify): -~!-~_,~,~'C,L How much foam is used per training event? ta urs __ Less than 5 gallons __ 5 gallons Tr vrai eli __ More than 10 gallons (please specify): sEwe eoe __ 5 to 10 gallons 6. IInn ttrraaiinniinngg,, wwhheerree ddooeess tthhee ssppeenntt ffooaamm ggoo?? ve a Storm Sewer Sanitary Sewer D~e eos __ Other (please describe): onsusas __ On-Site Septic --m_es __ Ground eo Where does/did the training take place? information for current and past training Please areas. include 0% mide address, intersection or other wespecific location -- er 43643 TT OOVVEERR-- XlnJIonogg~enL' ............... Phone: 5910 Rice Creek Parkway 651.639,9449 / 800.477.7411 Fax: Suite 100 St. 651.639,9473 _ Paul, MN 55126 USA www.deltaenv.com 22223333..00118866 STATE_02826998 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5 Viet sand brane foam aver sa i an hips by he Depa shoo 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire oe sam th apps Pos hack ah 301 response and in training (if applicable)? Please check all that apply. TeoFoun Bndotfoan YUvaesnsanoirgndye AAmm"uUosuaendlty CVuirsean?t |HisUtsoerditcal Type of Foam Ga0Ascussousi meme rm mam em Class B Aqueous Film-Forming Foam en (AFFF) Fy Class B Alcoholee Resistant (AR)pesAFFF Cadpn oe -- ---- ---- Class B Protein cass Class B Fcootan 9) -- Fluoroprotein (FP) cass: Class B FilmEtomn ---------- ---- ---- -- ---- Forming Fluoroprotein Frm (FFFP) cme em -- -- Class B AR-FFFP Gass oH Class A-B Hi Hvmtan ------------ = -- Expansion Foam Brand of Foam Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? pfyom Ems et m1el as es Training Foam over = = Other hoak oa u for n ose tncoan comspmetSioen,nePlreatsocoMnecsNtantcayFoodliRnG CooDrtaetaACreoyr(s3a5126317.8660670 $o162 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or nae sea ou ho ayQar iGoei stona jim.stockinger@state.mn.us) if you have any questions regarding this quest onnaire ....... `addrossod envelope. \ se. is questiontnoaDierleta Consultants 22008 inthe self Please return this questionnaire to Delta Consultants by June~.62~8 in the enclosed stamped, self-- " --... addressed envelope. Quostomaiecompleted by: u wie [el hors, ) Questionnaire completed by: lo fukie Fee Cla ~~ << 7 NNaammee aanndd TTiittllee Woepliwoosh FrLso(m-249-2e %00 e9-e 5 0% Fire ~e~artment = PPhhoornee NNuummbbeerr DDaatee maw E-Mail Address Hinoger: Xlnog~n" , ener So 5910 Rice Creek Fl Parkway Suite 100 ASt. paul, ~ 55126 22223333..00118877 sate 2826999 STATE_02826999 DELTA Co Letepbmn QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm .UUssee-. iinn FFiirree ' TTrraaiinniinngl_ --_-- -- SS Does your Department currently or has your Department historically used Class A or Class B foams for Ri firefighting operations? 1 respecte avston2 .,,~ Yes - Proceed to Question 2 a nin kth form and rm Dots Constr __ No - Sign the back of this form and return to Delta Consultants 2. How often is Class B or Class A foam used in response to fire calls? PO oan aries _~ 0-25% of fires 2255--5500%% ooff frireess 75-100% of fees. 75-100% of fires 5. Dosh Date oem a yt HFS) 34 rk on npr 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? veYes A~'eNo +. owotens hamuess nigaces? 4. How often is foam used in training exercises? fe oor ty au __ Never __ Weekly Semi-Annually _~ Annually Ce nt oT __ Other (please specify): 5. How mon ser igor How much foam is used per training event? Monthly __ Quarterly __ Bi-Annually ~ er hn 10 tr Gs sot Less than 5 gallons 5 gallons __ More than 10 gallons (please specify): __ 5 to 10 gallons In training, where does the spent foam go? Storm Sawer __ Sanary Sewer onstesepte x0 Grom '~.~ Storm Sewer Sanitary Sewer 7 coe toma dir BS -- __ Other (please describe): __ On-Site Septic ~ Ground 7. Wor drs tori tlc Pesci ids, isco rh scl ein Where does/did the training take place? Please include address, intersection or other specific location rnne information for current and past training areas. is gi = C allo 4 XlnIongo,eg.eAn''_ OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126. USA 22223333..00118888 STATE_02827000 QUESTIONNAIRE QUESTIONNAIRE Firefighting Foam Use in Fire Training x Firefighting Foam Use in Fire Training DELTA To2w0 \ 5 iho ype) nvd ebrsantt) fapepbmaanracyrlweear ucsehdknoawl baadt iephe pty ho Depart, ih a fr 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. sUesdodlinn, AmAouont Gurenty Wisoricaly TTyyppoeooffFFooaamm BrBarannddooffFFooaamm Used in YosorNo Training? Yes or No Amount Amually Used Annually Used? Currently Used? Used? Historically Used? [amrsoyme--ns a -- Class B Aqueous Film-Forming Foam ey (AFFF) CaB Asoneo -- Class B AlcoholCampden Resistant (AR)prAFFF Epo em me mn Class B Protein Geoees nippy _-- Class B Fluoroprotein (FP)' Ges Bim . Class B FilmFoaireS | ---------- ~~ --_ Forming Fluoroprotein fTeNR ees ee it en en (FFFP) Class B AR-FFFP ECrasasnarFoam - Class A-B Hi Css A Expansion Foam Class A TrTaraiinniinngg FFooaamm XX --Samt -- dege Mb -- ---- oer tT Other honk you for your ine and coaprtson.oPleans caontasct NaarcyPRoolsoisnCaorDtloaACgoornsyal(a6t5s12(067541666987051152 Thank you for yourtime and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 so wav ry doo orn hs cues. or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. aa ddrreestseedenvelope. e eele 003 sw ivi5v0se0dSsTtAaMmPpEsD,,Ss6ei1t: .......... addressed envelope. . ........ .~y .urn..., zOUt~ ,~, ,,,~ =,,~;dsetl stampecl, self Questomaro comply Questionnaire completed by: Ror sain EE Name and Title MeDaiitttis. FiresRescue FFiirree DDeeppaarrttmmeenntt tet Rescu --_-- (215) 744-Se7 057 27-08 Pc PhhoonneaefiNNiuu1mml5ba sb|e1err@rio@rrortl th hLs bee.z lGrocthD>atb e econ E-I~ail Address XHoogew Xlnog~:_ ............ rons can em Sees TTL Tor TELS A on 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv,com 22223333..00118899 state 02827001 STATE_02827001 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg Foaamm UUsse iinn FFiirree Traiinn,iinngg 1. DDonEs ouLDeTptAt crn ur opr rica sd Go A or a L smQseoor e h Does your Department currently or has your Department historically used Class A or Class B foams for st firefighting operations? Le esate cuoin ~, Yes - Proceed to Question 2 Ho inh ack a ifarnd tr Bek Constr __ No - Sign the back of this form and return to Delta Consultants 2. How often is Class B or Class A foam used in response to fire calls? 3. Dontb cpatrart ea rsd fay (CAFS wih lin nk rn XXe, 00-2255%%ooffffiirreess 2255--5500%%ooffffiirreess 7755--110000%% ooff ffiirreess Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes -No Hovatooomni vg xe? How often is foam used in training exercises? __NNeevveerr __ W Weeeekkllyy __ MMoonntthhllyy : __ QQuuaartrteerrllyy __ SSeemmi-i-AAnnnnuualalllyy __AnAnnunaulalllyy X~_._. BBii-AAnnnnuualalllyy __--. OOtthheerr ((pplleeaassee ssppeecctifyyy):: omc sms sda? How much foam is used per training event? 3 Castors oo suns Less than 5 gallons __ 5 gallons " ean 0sse More than 10 gallons (please specify): SE ---- St __ 5 to sBtnE 10 gallons In training, where does the spent foam go? Overton senron --_ __ StoStrormm SSeewweerr __ __SaSnaintitaarryySSeewweerr __ Other (please describe): ____OOnnS-tSeiteSeSpepttcic G'r~ oGuronundd 7. Cries ng awvoahe WWhheerreeddooeessi/ddi~ad thhgd aiglake trainingtake ppi]aa~c;ee-.?~ PPIlEeRgSsei. ~m.~auuc~. Utofseus!Li: e-- vss ........ ore ooo nn Sp -......................~"...... ! HXilnnooggeennr" OOVVEERR-- es Fa, FEU 5910 Rice Creek Parkway Suile 100 St. Paul, MN 55126 USA moner 591.635.9045 [000 477 74TH Fak: 91.639.9473washdeltagnv.com. Phone: 651,639,9449 / 800.477,74ll Fax: 651.639.9473 www,deltaenv.cem 22223333..00119900 STATE_0282 7002 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg DELTA Caso hogs hs 5 a Se 5. 8. W WTehhsatptotyynpeeesa(s)n)daainnddtrrbarnaainndng(s(d)1oao(fpfpffsoloaca)ammtiaaorre)o?oPr lwweeearrseee uucssheeeddcknnooawwlaaanntdd 2iinp thepas by the past by the the Department Department, both both frfor frefire response and in training (if applicable)? Please check all that apply. Usedin Amount Used in TypoofFoam BrandofFoam TYaasmoirnNgi?o AnUnsuaeldly Training? Amount Used CCUuurrsrneetn?ltlyy HHiissUttsooreriidcca?allllyy CClase o BAqueous Tvpe of Foam Class B Aqueous Brand of Foam Awcus orhh Yes or No L55 Annually Used? Used? auteodb Film-Forming Foam aren (AFFF) GClo8aMsoetso Class B Alcohol- -- -- =-- Resistant (AR)- ACFeRsEsBPOOn AFFF mm ---- Class B Protein ieses8 n) Class B ---------------- ---- TT TT Fluoroprotein GForrmiaBngFsims- Class B Film- (FP) FFhoaromroinpgrotein --_-- (FFP) Fluoroprotein (CFoFsFPs)BARFFEP -- ---- ---- ---- ---- GCCCallpaagsstessiABAo-BABnRfHH-ioFi FaFmP -------------- Sr Expansion Foam TTraaminoinggfFooaamn Oter --A _ das 2S SMe Mer =-- TOForhhrthaan nsennrtrokkodytynoxoiuina uggfef@ ootrrdyySeooe tluutaarrtetteniimvmn.eeccouoaammnn))d) coocroroYooJdp0ipiemumrearhSStaivttioootencn.k.aoinPPnglcleeacraaaukassteteosttithchciooeoonnMnntMitsaanigcrncntteneegNeNsaasaoronrntitccaanyygPPRRohoiolllosudltniaocoinunngreaCGsaiooitDnroDnteinreollalgtlealAAsCCggoeeonnnncscsyyuallt((a6a6n5n5t1ss1-2-((6962575911-78-.-66698607567-o.65o56r1r15622 jimstockinger@state.mn.us) if you have any questions regarding this questionnaire. Gear ---- Cie beet) addressedenvelope. - Pplleeaasseererettuurrnntthhiissqquuesetsitioonnnnaiarireettoo DDeellttaaCConosnuslutlatannttssbbyyJJuunnoe66,,22000088 nin tthheee.necnlocsloed~st~tammPps~,,sSeleflf-.. .ddressedenvelol~e. Questionnaire completed hy: NameCanua nTot Rick Magee FNamRYeoEansdEtTitRlCe ocermFinTe emer Fire DepaSrtm0e1nt -455=2%0C Pane Number Phone Number ~ "V L,,~ ~" ~ ~"~'-~ ) --- mr eme er T Bat9e -1-0% Date GRR E-Mail Address Kinogen Xlnog~7_ ......... -- omer 31.639 9r010oS806 eTApTeE rrPRyL. E61e-33199094S7E)NFe wanudnse WlEtaE3s1n3.6cUvaSemK Phone: 5910 Rice Creek Parkway 651.639.9449 / 800.477.7411 Fax: Suite 100 St. Paul, NIN 55126 USA 651.539,9473 .www.deltaenv.om_ 2222333..00119911 STATE 02827003 STATE_0282 7003 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 1. HDDrooosenssghyyioounurgr cDDoeeoppraaarrtttmemneesnn?tt curently currently or or has has your your Department Department istricallyused historically used Giss Class Aor A or CGl=laa=ssssf8Bofoaammss for for 0 firefighting oYpeersatioPnrs?oceetdo Questio2n NYoes-S-iPgrnocteheedbtaockQoufestthiiosnf2orm and return to Delta Consultants No - Sign the back of this form and return to Delta Consultants 2. Howollenis Cass Bor ClAafosam used in response to fre calls? 2. How often is Class B or Class A foam used in response to fire calls? So ozs ottres 25505 fres 75-100%of fres . Cle B-wob want ce 15 204008 Cl A-1e Hea con ./k=~ 0-25% of fires __ 25-50% of fires __ 75-100% of fires 3. DDoeoesstthhee DDeeppaarrttmmeenntt hhaavvee aa ccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm ((CCAAFFSS)) wwiitthh aabbuuililtt-iinn ttaannkk oonn iittss eennggiinnee((ss))??. SS vNeosYes 4. Howoflen's foam used in raining exercises? How often is foam used in training exercises? Neve Westy mony uanery __ Never __ Weekly __ Monthly __ Quarterly Semeomuaty Analy Samual Other(please speci): zge. __ Semi-Annually __ Annually __ Other (please specify): Clad (oe __ Bi-Annually 5. How much foam s used per raining vent? How JOmuch foLaemssisthusaend' galons per training event? Sgations /k3 MLeosrss tthhaann 510gagllaoonnss (p_ leas_ e sp5ecgaillons __ More than 10 gallons (please specify): 51 10gallons __ 5 to 10 gallons 6. intraining, here ces he sentfoam go? In training, wShteorermdoSeeswethre s_pen_t foaSmanigtoar?y Sewer __ ter Storm Spleewaesre scr: __ Sanitary Sewer Other (please describe): _Onto Septic __ On-Site Septic X_ Ground /~ -- Ground 7. Vitro dosi hig ke pac? rss co sis, scion ool spc acon 7. Where does/did the training take place? Please include address, intersection or other specific location nkrgmoleon "Graetn antd past aCnagaarnco.te Cone we Yvon, Sete, information for current and past training areas.. foek tof Sl0o%b dea Av St 7 Xinogern: XIng-e-2 ............. OOVVEERR-- rane 631.039.915B400 033 TAT FOL IL 00019453 Wisma 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA Phone: 651.639.9449 / 800.477,7411 Fax: 651.539.9473 www.deltaenv.~:em 22223333..00119922 STATE 02827004 STATE_02827004 DELTA 3 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree Training Training 7 Uay 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, response and in training (if applicable)? Please check all that apply. T vest Amy o `TTyyppeeooffFFoooamm cnn Class B Aqueous gmomens Film-Forming Foam BrBarannddooffFFooaamm Used in YYTeerassinooirrngNN?oo Amount AAnnUnnusuaealdlllyy CUuUsrsreeeddn??tly both for fire ry Used? Historically Used? (AFFF) Class B Alcohol- eon Resistant (AR)- AFFF en Class B Protein oEe Eory Class B 3M -------- M0 gh _ -- _ Fluoroprotein (FP) Class B Film- oEyn -- _ Forming Fluoroprotein (FFFP) er Class B AR-FFFP wt.. -- -- Class A-B Hi Expansion Foam F wrp Men EEJ, Class A oga yoo. Training Foam -- en pe TA Other rk is rd snp,Pe cot Rn Ou Cnn(1 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. `addressedenvelope. PlPeleaasseerreettuurrnntthhiissqqueusetsitioonnnnaaiirreettooDDeellttaa CCoonnssulutltaannttssbbyyJJuunnee66,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,sseellff:- addressed envelope. Questionnaire completed by: `NNaammee aannddTiTtitllee. rT Phone G51 Number a E-Mail Address Kinogen Xlnog~n" , SU6-57" "~7'~ 7 =Gh Date ones Phone: 551.039. 9nn 30 GS STL ak: 5910 Rice Creek Parkway 651.639.9449 / 800.477.7413. Fax: oo S01639.9475 wed ltasRY. cam Suite 100 St. Paul, MN 55126 USA 65"l.639.94-73 .w_ww,deltaenv.om 2223333..00119933 STATE_0282 7005 D DEELLTTA A QQUUEESSTTIIOONNNNAAIIRREE Te FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg ET frotoCsateeh CRT os Shes Ae re Somer Does your Department currently or has your Department historically used Class A or Class B foams for firefighting operations? ~X_ YYeess-- PPrroocceeeedd ttoo QQuueessttiioonn 22 TR esaot tc ao nso Soka Com __ No - Sign the back of this form and return to Delta Consultants 1 TA RISE SANTA) How often is Class B or Class A foam used in response to fire calls? X_ ozsiottes sorts Totton tn ~. 0-25% of fires __ 25-50% of fires 75-100% of fires 1 Cote Copter comers compo CAFS} sin nkon gels? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes . ven Woo 4. How often is foam used in training exercises? nny tn __ Never __ Weekly __ Monthly __ Quarterly ty seat J -- Semi-Annually Annually / __ Bi-Annually 2X omer essa spcyDLny stofas on dem ~ Other (please specify): _/./2~ 5. Horm -------- 5. How much foam is used per training event? Less tansgolons JK, Sontons sot Less than 5 gallons __~.~_ 5 gallons s------------------ __ More than 10 gallons (please specify): __ 5 to 10 gallons a Sap) In trainin,g2,where does the spent foam go? _X SomSower __Santary Sewer __OnSieSepbe Ground k'~ Storm Sewer Sanitary Sewer __ On-Site Septic __ Ground E S R Ss STPAR SS ARE Sian __OtOhtheerr((pplleeaassee ddeessccriribbee):): Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. Kinogen Xlnog~". OOVVEERR-- re on TT 5910 Rice Creek Parkway Phone: 651.639.9449 / 800.477.7411 Fax: TO Suite 100 St. 651.639.9473 CR_ Paul, MN 55126 USA www.deltaenv.em 22223333..00119944 rare casero STATE_02827006 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee .iinn FFiirree TTrraaiinniinngg DWA hEtL) TmaA) ou rcmrsSser haanti ty hi Dopamat, iLe[A43R 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. mestron bmatrem SSoaarthtao?y tansy' "dt Type of Foam aman Class B Aqueous Em, Film-Forming Foam ((AAFFFFFF)) Gupte (leagnd fs Sul go ws Class B A!coho!- Resistant (AR)AFFF men Class B Protein a LR py -------- -- -- -- -- Class B Brand of Foam Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? Fluoroprotein (FP) Class B Film- fo Forming whesy Fluoroprotein -- -- -- ---- (FFFP) Class B AR-FFFP mWainlee ------ -- To Class A-B Hi Expansion Foam Cassa Cheaged ps 358 ze ee Class A ]-raining Foam over --- = -- Other nkuorid cprion, Pes cota ig ek CoonrysaGgoe 5o16r97o5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 co Se cad or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PlPeleaasseerreettuurrnntthhiissqquueessttiioonnnnaaiirreettooDDeellttaaCConosnuslutltaannttssbbyvJJuunnee66,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,, sseelflf:- fom o et addressed envelope. Nam and Title oo Fire Hen 7 BEEebe( oc-domSCgou~bel.2con - CDatle ul/E Hinogene Trerer ov 60 oan SGT EL Tak: 3)635.9475 www daltatne.com. Phor~e: 5910 Rice Creek Parkway Suite 100 St. 651.639.9449 / 800.477.7411 Fax: 65J.639.9473 Paul, MN 55i26 USA www,deltaenv.em 22223333..00119955 STATE_02827007 DELTA QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training Firefighting Foam Use in Fire Tra ng 1. Docs your Deparment urenty has your Deparment Hisrcaly sed Cass Aor Class Bfoam or Does your Department currently or has your Department historically used Class A or Class B foams for earnopiesnvangs? firefighting operations? X_ Yes-ProtcoQueesteiodn ~ Yes - Proceed to Question 2 NoSign th backoftisform andreturntoDlaConsutants \ No - Sign the back of this form and return to Delta Consultants 2. Howofeni Cass Bo lass A fam us inreson 0 10 clk? How often is Class B or Class A foam used in response to fire calls? 0oaemoines _ossewetws Y'} 0-25% of fires 25-50% of fires __rstoeries 75-100% of fires 5. ons he Deparment Fave compres a osm ssf (CAFS)wi aulfark n fs angio? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? vesYes we ~Z~; No Fowotin s foam usd n rong verses? How often is foam used in training exercises? Neer Westy Nowy cure __ Never __ Weekly __ Monthly __ Quarterly Fp -- Aomaty Smt ~ Semi-Annually __ Annually __ Bi-Annually __ OOtthheerr ((pplleeaassee ssppeecicfifyy)):: 5 Howmuch foamis sed per ring even? How much foam is used per training event? YC Less han 3 gars Sgalons Less than 5 gallons 5 gallons Wore han 0gatos (losesect) More than 10 gallons (please specify): S010gatons __ 5 to 10 gallons 5 Invi, wherdosthe spent foam 07 In training, where does the spent foam go? Som Sever ___ Saiary Sever __ Storm Sewer __ Sanitary Sewer tr (pease desl: __ Other (please describe): - onswsepie __ On-Site Septic KX aroma X- Ground 7. Where dot h iin ak loce? lsc aes, nrstionor othr spcielotion Where does/did the training take place? Please include address, intersection or other specific location FoVrgaasniofoescurentAgescogrtoanneed rSch.iuchares information for current a.nd past training areas. Kinogen XlnogsE'. ............ OOVVEERR-- _ 5920 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA none: 631.639.9400 1800 473 AT] Fok: SS10m1n0dal4iasn7s.L3om Phone: 651,639.9449 / 800.4-77.7411 Fax: (551.639.9473 www.deltaenv,com 22223333..00119966 sate 02827008 STATE_02827008 DELTA Tox FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNssNeNeAAiinInIRRFFEEiirree TTrraaiinniinn8g 9i 5. int pas) and brmandss) oaftfeoasm ar oPr voeroe ucsadthnwhantd 5n,h as yhDapainan bh re 8. What type(s) and brand(s) of foam are or were used new and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. Team -- "ooed CurentUsoor TTyyppeeooffFFooaamm GFaamB scFuemsesBFein ----- Class B Aqueous Film- Forming Foam (AFFF) Gon oatte ANGITERYS I ClCalassss BBAAlclcoohhoollResistant (AR)-AFFF SE Class B Protein ClBFarersopretin Class B Fluoroprotein ww _ (FP) Ges 8 Fi Forming _ Class B Film-Forming peat ---- Fluoroprotein (FFFP) Coonrtn Class B AR-FFFP. cm uss 8y 1H ------ ------------ ------ Class A-B Hi `BBrraannddooffFFooaamm IN5, TE Used in YesorNo Training? Yes or No Amount AAnnUnnusuaealdlllyy HistoricUse? Current Use or Historic Use? O10 bn _Y14TOR O Expansion Foam CCllaassss AA mere TTTT Training Foam over - Other _Slv-gX YES 3) Clueeesd. maforn your my esndcoEopergSor. iPleasne coMagwtaNiae ncyPRorionlgCooDnottaACongs(u6l0to1s2(067n.531080y061o8152 Thank you for your time and Cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or as oo Yo i ay dots agri Gsm jim .stockinger@state.mn.us) if you have any questions regarding this questionnaire. Pleas tur his auestionniet Dt Gonsuans by Mey, 2008 th enclosed amped, sal: Please return this questionnaire to Delta Consultants by May 9, 2008 in the enclosed stamped, self- addressedenvelope. - Questonnars completes Crue Questionnaire completed byB: ineiwse Fing CHiFcE -- te fotyr1i % Fing CHE Mipew Name and Title Fig PEPT- Femme Bou Y5mBes Fire Department PPhhoonnee NNuummbbeerr DDaatte Er E-Mail Address BDXInogen" Phone: 5910 Rice Creek Parkway 651.639.9449 / 800.477.741:1 Fax: Suite 100 St. 651.639.9473 -- Paul, NN 55126 USA www.deltaenv.cem 22223333..00119977 stare 02827009 STATE_02827009 DELTA PRE FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training y Firefighting Foam Use in Fire Training fo mEmp ne nese go i i Does your De/#artment currently or has your Department historically used Class A or Class B foams for oe tocmin firefightin~/l~erations? ~/ Yes - Proceed to Question 2 nor __ No - Sign the back of this form and return to Delta Consultants tpn 2. How often is Class B or Class A foam used ig/#esponse to fire calls? Ltn rene 0-25% of fires / ,-/ 25-50% of fires 75-100% of fires A Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? + 7t%om sas How ofLen is foam used in training exercises? ptWeeklyAAty -- Qa uanery __ ::::l,~nnually SI : __ Other (please specify): 7z~nthly v Anually __ Quarterly __ Bi-Annually 5 How myn1s used pr training avert? How much.~,,~am is used per training event? CEE Less than 5 gallons __ 5 gallons ol __ More than 10 gallons (please specify): --_-- __ 5 to 10 gallons 6. IInn ttrraaiinniinngg,, wwhheerree ddooeess tthhee ssppeenntt ffooaamm ggoo?? ono Lon __ Storm Sewer __ Sanitary Sewer ed __ Other (please describe): __ On-Site Septic pe G~round rm A ------ 7. Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. Live sTavetong Bords- VAMOS Loca TiowS Sins Xlnog~A; ............. 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639,9449 / 800,477.7411 Fax: 651.639.9473 www,deltaenv.~:or~ 22223333..00119988 STATE_02827010 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training inate) a brandis) foam ar or vere usc nw a nh as yn ep. bo or re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire eon ein appa Peas heck a ot spy. response and in training (if applicable)? Please check all that apply. Tmeot foam pundotfom TrYUaesmrodioinrngS?e AAm"wGoouaondyt CUusreendt HiUstsoersica Type of Foam Ggasmsp8 Armsos PT. shby sk <0 7~ Class B Aqueous Film-Forming Foam ((AAFFFFFF)) Co aBAsone e ---- -- Class B Alcohol- Resistant (AR)- pesAFFF FS -- Class B Protein CSaesepang ------------ _-- Class B Fluoroprotein (FP) Cass Fin: Class B FilmEom | ---------- ---- -- ---- -- Forming Fluoroprotein fe (FFFP) CAAT?| meres met em ae ee Class B AR-FFFP HGlaessrAoBHboan --_ = -- Class A-B Hi Expansion Foam Brand of Foam Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? [oreor Augeth=(oubd YuCroemr0 22[0 aYY Training Foam Over JE em Other Tran afoyonuar tmmcaonmc)ooopoeraStioonm.iPglrasgcrMtisNeantcyFRoodibngCotoDnevlaACgoarrsu(6a51s 269571.65057355152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or renn. yo ho ay awh eg 48 Gost jim.stockinger@state.mn.us) if you have any questions regarding this questionn~i.~e. .......... Floss tun tis aussttio aoltns Gonnsuiltacnt June [6.2008 heencosed stamps sa Questomarocompetes. Nes blphon J Please return this questionnaire to Delta Consultants by June 6, 2~O~in the enclosed stamped, self- aaddddrreesssseeddeennvveellooppee.. Questionnaire completed by: b S. eonse , n FrewCChtaiitf= Tee Name and Title \ onebre e200 FB oo FiFrireeDDeeppaarrttmmeenntt oo FroNamber 163-23%- 5359 Phone Number Ea~9--10tO: - 0O~%/ Date Ninoggr: E-EM-Maialil AAddddrreessss ~Inogen" , rere Tr 5910 Rice Creek elSeb Parkway Suite 100 St. Paul, NN 55126 USA 22223333..00119999 sate 02827011 STATE_02827011 DELTA Guo belo) QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg Ste 1. DDooeess yyoouurr DDeeppaarrttmmeenntt ccuurrrreenntltyoloyrr hhaass yyoouurr DDeeppaarrttmmeenntt hhiissttoorriiccaallllyy uussde~dJCClalassss AA eb'C~ClalassssBB. foah]nss ffoorr mE om rgfnsap firefighting operations? tours Yes - Proceed to Question 2 a tras pmcomtons No - Sign the back of this form and return to Delta Consultants sog ashortibsto(Lashasmasives 2. How often is Class B or Class A foam used in response to fire calls? 7510of0fe%es 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes = jb<'2 No + wr mtg 4. How often is foam used in training exercises? mown __ Never __ Weekly __ Monthly Sn aw wi Semi-Annually Annually ~ I - _ __ Other (please specify): __ Quarterly Bi-Annually + ovmammis stiot How much foam is used per training event? OE a ~ Less than 5 gallons 5 gallons Tn ren _ __ More than 10 gallons (please specify): __ 5 to 10 gallons rash esto In training, where does the spent foam go? oe _ontmome scons Other (please oscribo): opal ~ Storm Sewer __ Sanitary Sewer __ On-Site Septic __ Other (please describe): k'~b ,,~-~._~-J~, A _.~ Ground 1 feoinra sore i hedee ec be otro tn 7o Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. fark Lots - lNeeoie cusT Sogn Xlnog.e.~n"_ ........... OVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA 22223333..00220000 STATE_02827012 FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNssNeNeAAiinInIRRFFEiEirree TTrraaiinniinngg Whatman foam rrvores ed gt yh Dap, th 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire dr response and in training (if applicable)? Please check all that apply. nett, ern SeLe a-- TDy pVoyor viy Type of Foam Class B Aqueous ety fastedvised aseerbronssl Film-Forming Foam~ em, (AFFF) .~ A ee me -- CCllaassss BB AAllccoohhooll-- Resistant (AR)AFFF Gases Poa SE Class B Protein Gusss Class B rt S-- Fluoroprotein (FP) maim. Class B FilmJoes Forming on ---------- -- Fluoroprotein ss (FFFP) STON smc mm wn nn Class B AR-FFFP opr Class A-B Hi Stn -- = -- Expansion Foam Gaon oki. A" d09el New 0 Class A Tamgrem msalufx 40 ___ No Mes Training F~ ho oe LT TT Other Brand of Foam Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? Arnulade TTrean ouao dammy esandcorou smo pSrog. rlosssoe MrorNaaasrs FcotiisnaCoDrolsAgConoyr(3l 0675310000875o152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 Samer or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. ed geet i Please return thfs questionnaire to Delta Consultants by June 6, 2008 in the Ss No addressed envelope. Sus PB Questionnaire compPleetned by: (rene A i Er = --_-- Name and Title stamped, self- Lebo J _0 Fre0sge0 aT 0W 0000000000 Fire Department 320-w23-/%:/1 em Phone Number 5-9-0% Date EE--MMaaiill AAddddrreessss rere XInIongo~gAen''_............ 5910 Rice Creek Parkway Suite 100 ET Ce wid p e St. Paul, NN 55126 USA sense 22223333..00220011 stareo2s27013 STATE_02827013 DELTA (SNatLeegon FirefightinQQgUUFEEoSSaTTmIIUOOsNNeNN-AiAnIIRRFEiEre Traini Firefighting Foam Usein Fir Trainin g [ "#72.|1 DH os e5r2Oo nVpetSrepnoirnnoo chcoreesbsnaoAcyklcruoot sfusobisosndforCmre eaosnpdporantsnmr rtocDeylka CeodnGsoussAo hi 8 om "2 Does your Department currently or has your Department historically used Class A or Class B foams for firefighting operations? ~D Yes- Proceed to Question 2 __ No - Sign the back of this form and return to Delta Consultants How often is Class B or Class Afoam used in response to fire calls? Jp 2550 tes -- .?o 0-25% of fires __ 25-50% of fires __ 75-100% of fires 5 Dos a Deprtratpv comes foam ssa OAS) ith ain ark ne snr? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s}? veYes <nNo 4 Howouomsets aeinng icsin? How often is foam used in training exercises? Nar Westy sory aur X Never Weekly TT tomo pony "en __ Semi-Annually __ Annually Oaspc) - __ Other (please specify): Monthly __ Quarterly __ Bi-Annually 5 Howmcihdtparovo amvesnt? How much foam is used per training event? Los rans gos gor stor __ Less than 5 gallons __ 5 gallons __ 5 to 10 gallons __ MMoorree tthhaann1100ggaalllloonnss ((pplleeaassee ssppeeccififyy)):: 6 Inti, wher oss hes mz? In training, where does the spent foam go? SormSonr Satarysows__onstosepic ors __ Storm Sewer __ Sanitary Sewer pA-- __ Other (please describe): __ On-Site Septic __ Ground 1. Wher dont vn vin a ce lea nde aces, scion ter soi ocstn Where does/did the training take place? Please include address, intersection or other specific location ee iy ase eso information for current and past training areas. # fe wk onl a 4 Loviofe + So C . todse Kinoger: .XInog~". ............ OOVVEERR-- 5910 Rice Creek Parkway Suite 190 St:. Paul, MR 55126 USA 22223333..00220022 stare o2s27014 STATE_02827014 QQUUEESSTTIIOONNNNAAIIRREE FFiireffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 5 Wht yo(e sn beainnc()afpopaemaaseoaPvlaesre ucshaddmoa1w a1n2d 0nth . pasty Fo oparman. bh arf 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. TupeotFoam PontofFoun TUViseosndegirnd?e AAmGmoouwnyt YCeuUrrsoeerndhte HYiesUstseoerrdit?ciaol Type of Foam cas nan 0 Class B Aqueous msBhwens gl ((FAAilFFmFF-FFF))ormninog Foam Gpi8oS ccahsok ee emt -- a -- Class B Alcohol- Resistant (AR)- feAFFF -- Class B Protein Gosss CFFllluauoosrrsooppBrrootteeiinn ((FFPP)) Gus Fin Class B FilmoFuarmapotan _ -- -- Forming Fluoroprotein fs (FFFP) re AFP meme Class B AR-FFFP GGasseABHy ---------- ---- ---- T-- TT Class A-B Hi Expansion Foam Brand of Foam Used in Training? Yes or No Amount Used Annually Currently Used? Yes or No Historically Used? Yes or No oT -- CTlosae Aro Totbuco. Ne uudge Mio er Training Foam over sR Other Try for your ime ard cospraton. loco coria Nancy Rin = Del Cans (551-667-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 gna som ov ay oer rn sesso, or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. pussers sirtoDela Consultants Se 2008 in th nctosearstampocs Please return this questionnaire to Delta Consultants by September 19, 2008 in `sseellff-a-addddrreesssseeddeentvlveellooppee,. uestonnaecompetedby Nh Questionnaire completed by: FamPsindpTee Ciel Shaw Vo Lith Name and Title EE \\ 952-353-257 Fire Department - ' " ~ rare Ser Phone Number a BGae-24-08 _ Date EEM-Maialil AAddddrreessss HXwlonogge~nn' Phone: 5910 Rice Creek Parkway 651.639.9449 / 800.477.7411 Fax: Suite i00 St. 65!.639,9473 Paul, HN 55126 USA _Www.deltaenv.com 22223333..00220033 sate 02827015 STATE_02827015 QQUUEESSTTIIOONNNNAIARIER_ .E...................... FFiirreeffiigghhttiinngg FFooaammUs-s iinrFie re TTrraaiinniinngg--'" ~~. DELTA Ee) tw -- ~ [e Paws! 1 oS nes s ep ry eu Otc Se en 2Yes -Protco Qeueestidon 2 " fDiroeefisghytoinugr Dopeepraarttimonesn?t currently or has your Department historically u ~O s -~~ ,~ LCcla] ss &ms~for'~f !><:Cb Yes - Proceed to Question 2 masta Constr __ No - Sign the back of this form and return to Delta Consultants 2 oot os or hs A on erenstca? How often is Class B or Class A foam used in response to fire calls? ~JU arene SR 0-25% of fires 25-50% of fires 75-100% of fires 33.. DDooeesstthheeDDeeppaarrttmmeenntt hhaavvee aa ccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm ((CCAAFFSS)) wwithi aabut biulitlh t--iinn ttaannkkoonn iittss eennggiinnee(ss))?? Ra Yes ~ No / 4. How often is foam used in training exercises? -- po on cy __ Never __ Weekly __ Monthly __ Quarterly Semi-Annually ~ Annually __ Bi-Annually ny TT mm __ Other (please specify): Lowman restr ang ont How much foam is used per training event? 2S Les than ators sgalons Sto 10 gators. ~ Less than 5 gallons __ 5 gallons rr en oo __ More than 10 gallons (please specify): __ 5 to 10 gallons ti sv ser 7 In training, where does the spent foam go? ar bows ioan | _Jn __Storm Sewer __ Sanitary Sewer oe psy __ Other (please describe): __ On-Site Septic tR:3 Ground ST Where does/did the training take place? Please include address, intersection or other specific location Ee rr L i, Shas sk ; Le inform ati~_~(~re~nto,~nd pas~ning ~.~[s. Kinogen Phone: 5910 Rice Creek Parkway 65:~.639.9449 / 800.477.743.1 Fax: OVEERR-- a Suite 100 St. Paul, MN 55126 USA 651.639,9473 www,deltaenv.~:om 22223333..00220044 STATE_02827016 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire ms Xx Firefighting Foam Use in Fire Trainino i 5. inate) and rani foam aor war sed nw and nh gtby ho Depermon, bt fr 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire rms van 1 pphcaay lease cack a hl a3. response and in training (if applicable)? Please check all that apply. TupeotFoam SandofFoam TrUosnerdgtin?e aAm"mooeuaendst CHuamotneturssoo?r Type of Foam Gflase8 uoausrFin --_---- Class B Aqueous Film- Forming Foam (AFFF) Gass 8 Aono _ Class B AlcoholReston (WR) AFF Resistant (AR)-AFFF Cerro| Sms tr emer Class B Protein Glass B Foro Class B Fluoroprotein ES - (FP) Gloss im Forming Class B Film-Forming eo ---------------- ------ Fluoroprotein (FFFP) Sr commen eee st emer Class B AR-FFFP GSlisoABnH Foam -- a -- Class A-B Hi Class A Expansion Foam Class A TrringFom EN AES Training Foam over EE NZ Other Brand of Foam Used in Training? Yes or No Amount Used Annually Current Use or Historic Use? _SlevoE0 w Y&Es Seal CuaninT hayourfeosrcoousraatmiceaamndocsoooperaStitoni.nlgesaseoognMticsthNsoatarPRoohcikoinngConkDoelkaACgoennscuylt(a6n5t1s 2(05713,86697o5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or asa) You Nov ay 4061 gin is Qos jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Pros ou tis questions to Dts Concufnts by Ma, 2008 i the ccosed amass, lt. P!~se r~turn thi~ que,stiennaire to De!ta Ccn~u!tat~t~ by May 9, 2008 in the ~nclo~d ~tam~ed, se!f.Frei addressed envelope. Quesiomato complied: Questionnaire completed by: oo NNaammee aanndd TTiittllee = Fre Dept20 5 25-184k Fire DeparLrnent negems PPhhaonnee NNuummbebre'r Ee E-Mail Address MFO 5/22/08 DDaattee HwXmlnoogge~nn" rere eon ere SrTe ETTSpeTRL SEUe5160600SC)ePda aESdTam Phone: 5910 Rice Creek Parkway 651.639.9449 / 800.477.7415 Fax: Suite lu0 St, 651,539.9473 Paul, IVlN 55~26 USA www,deltaenv.~em, 22223333..00220055 sate 02827017 STATE_02827017 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 1 DeEyeLDTopAe city ry Dirrty Cl Ace Ct 0 Wyot Does your Department currently or has your Department historically used Class A or Class B foams for Ly firefighting operations? va Y-~ Yes - Proceed to Question 2 Howstoni os 0 or is Afigvs o? __ No - Sign the back of this form and return to Delta Consultants 2. How often is Class B or Class A foam used in response to fire calls? A -- 2.'XX . 00--2255%%ooffffiirreess _ ___ 25255-050%%oofffifirreess 7755-1-00%1oof0fffiirr%eess Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes ne ~,.~_ No I How often is foam used in training exercises? Ty ty __ Weekly Somer XC pony __ Semi-Annually __ Monthly :;~_ Annually __ OOtthheerr ((pplleeaassee ssppeecicfiyfy):): A How much foam is used per training event? ttt ose .;~/~ Less than 5 gallons __ 5 gallons __ MMoorree tthhaann 1100 ggaalllloonnss ((pplleeaassee ssppeecicfiyfy):): oe __ Quarterly fy __ Bi-Annually -- __ 5 to 10 gallons 6. IInn ttrraaiinniinngg,, wwhheerreeddooeess tthhee ssppeenntt ffooaamm ggoo?? Stom Sewer Santry Sewer OnsieSepte XsGround __ Storm Sewer __ Sanitary Sewer oreiS omens one ___ Other (please describe): __ On-Site Septic ~X,,~Ground AOE HOHHARE eo Where does/did the training take place? Please include address, intersection or other specific location mires he information for current and past training areas. : FEE [Po Crven 5 --_-- Darn G$0y 00000000 Sino Xlnog~#~. .............. 5910 Rice Creek Parkway Suite log St, Paul, Mr4 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax; 651.639.9473 www.deltaenv.cem 22223333..00220066 STATE_02827018 DELTA QUESTIONNAIRE QUESTIONNAIRE Te FFiireffiigghhttiinngg Fooaamm UUssee iinn FFiirree TTrraaiinniinngg X 5 Wheto) and ranoffoteamnsesrPc oesrosho roh woantd 95 ep by i Dopari,bol for 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. S [E -- mises TTyyppeeooffFFooaamm Goon AqueousFin: Class B Aqueous Film- `BBrraanndd ooff FFooaamm Used in Training? YYeess oorr NNoo Amount Used AAnnnnuuaallllyy Current Use or HiHsitsotorriiccUUssee?? mGosobdalem Class B AlcoholGunde Resistant (AR)-AFFF -- Class B Protein Ta rsh Class B Fluoroprotein pos - (FP) Cons Fan Forming Class B Film-Forming Gemma Fluoroprotein (FFFP) El --ommmton etm i cotntor Class B AR-FFFP poy Class A-B Hi gman Expansion Foam yy oad yes coal pew- Class A A Training Foam over TT Other nay for ur tmaacorn. PlsNcnoaocoyaFloaog, sGoDotl nCoyut(t9-s59(76501000070152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 sven omen riots or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PPlleeaasse~c,,e~-tuu.-~.r."n..tthhiissqquueest~itioonnniaiaiirreettooD~a,,,t~"t-~a'~C.o.n..s.u..l.t,a..n..t..s..b,.y.M..ae. y 3,2008in the enciosed stamped,soil: adadddrreesssseeddeennvveellooppee.. Cuestomars compiled, [oe Questionnaire completed by: EEGuat 1147e--p chee Name and Title FreCoomtonan rh STAR Fie Fire Department roveg aia g codByg oe Phone Number Date ee x Cp e oil le SOM E-Mail Address " 140; ep Za. 7. ole, Sinogen 5910 Rice Creek Parkway Suite 100 St, Paul, MN 55126 USA Phone: 651.63.9.9449 / 800.477.74111- Fax: 651.639.9473 _www.deltaenv.corrl 22223333..00220077 stare 02827019 STATE_02827019 QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in FireTraining X Firefighting Foam Use in Fire Trainin | DB ELTA chseec th Cs crsfsTo; ur Does your Department currently or has your Department historically used Class A or Class B foams for Em firefighting operations? ~ I YYeess --PProrceeodttc oo QQueueesse ttiiood nn22 os i econo __ No - Sign the back of this form and return to Delta Consultants How often is Class B or Class A foam used in response to fire calls? comet FO. 0-25% of fires 25-50% of fires 75-100% of fires ee AHA oven Ada irk tere? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? i.Yes .p No Wea omy How often is foam used in training exercises? __ Weekly __ Monthly ke curry zf(/ Quarterly __ Semi-Annually __ Annually __ OOtthheerr((pplleeaasseessppeeccififyy)): erm How much foam is used per training event? rns __ Less than 5 gallons z~ 5 gallons protien More than 10 gallons (please specify): ------ in training, where does the spent foam go? ine aso __ Storm Sewer __ Sanitary Sewer __ Bi-Annually __ -- oe 5 to 10 gallons __onswsone __ On-Site Septic Eeons ~ Ground -- Other (p!ease d~~s t.,.r.l.k.~. ). A ar Where does/did the training take place? Please include address, intersection or other specific location Meia ra tve ant Lk 1 information for current and past training areas. pute tl | pan s5En . Kinga 5910 Rice Creek Parkway uite 100 St:, Paul, iVlN 55126 USA Phone: 651.639.94-49 / 800.477.74:11 Fax: 65]..539.9473 www,deltaenv.cem 22223333..00220088 STATE_02827020 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5. TWemhpteyros(e) antd aainnc)(faopampare ar veearo uhsedckmoawoatndsnthh pasty he Deparmont. boi fr 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. TUrsaemidnigny Amoovuant Guursoendty HisDtoowrdi?cal TTyyppeeooffFFooaamm cgusos maeonss: i0c meina s te I"Spdes Neo Class B Aqueous Film-Forming Foam we (AFFF) GlAsloet Class B Alcoholasa Resistant (AR)peAFFF aries He Class B Protein Coalss ony -------- -- ---- ---- ---- Class B Fluoroprotein (FP) Guse Fim Class B FilmFFuogien _---- -- - Forming Fluoroprotein jos {FFFP) IITA? eee eee er erm ee Class B AR-FFFP CC asay s ---- -- -- -- -- Class A-B Hi Expansion Foam Glee EE Class A Tanngrom = Training Foam over = Other BrBarannddooffFFooaamm Used in YesorNo Training? Yes or No Amount AAnnUnnusuaealdlllyy Currently YesorNo Used? Yes or No Historically YesorNo Used? Yes or No hryfo your mar caapsoton. Pisco Nenoy Ring a Dot Cans (651-657-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 dSnom yo hove sy shor ren hs Gussie, or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. Floss atuen this questionnaire 0 Dla Consultants b September 15, 2008 nthenclosedstamps, Please return this questionnaire sseellff--aaddddrreesssseeddeennvveellooppee.. to Delta Consultants by September 19, 2008 in the encloseda stamped, noo Questonnale completed by vLup Questionnaire completed byz Fore (et Brad rake Cpt) NNaammeeaanndd TTiittllee oo oo FFrireeBDoeWprarmtmaeq4nnt5sz2--4q677--27799-77 Fo Phone Number ba 9-23-08 Date ------ E-Mail Address HXwlnooggene" nt oe Phone: err T re eT e 5910 Rice Creek Parkway 651.639.9449 / 800.477.7411 Fax: ES s ets2Gs Suite 100 St. Paul, MN 551z6 USA 651.639.9473 www.dettaenv.~:om 22223333..00220099 sate 02827021 STATE_0282 7021 DELTA QQUUEESSTTIIOONNNNAAIIRREE ;W< p)\ FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg..... 1. Doesyour DepartmentcurentyorhasyourDeparment historical used: Css Ao GosBom for Does your Department currently or has your Department historically used Class A o~Class B fo~ms for fretting operons? firefighting operations? TE Yen procondto Queston2 ,~ Yes- Proceed to Question 2 No-Sign the baocf iks form and return to Dla Consultants __ No - Sign the back of this form and return to Delta Consultants 2. HHoowwololfteenn'iss CCllaassss 8B oorr CCllaassss AA ffooaamm uusseedd iinn rreessppoonnssee toe to fire ccaalllsk?? 7"~. 2"~, 2. 028%kof ees 25500 ares 781008otras __ 0-25% of fires __ 25-50% of fires __ 75-100% of fires 3. Does the DeparmentJhoavee a 1co0m/p9r<eTss Za foeam.s syst (CAFS) with abulin ak ons agin)? 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? 2mvesYes 4. HHoowwofotfteenn iiss ffooaamm uusseedd iinn ttrraaiinniinngg eexxeerrcciisseess?? New Weeky ___ Nowy urns __ Never __ Weekly __ Monthly __ Quarterly TT omsmaly pO Aemaly sama Semi-Annually ~ Annually __ Bi-Annually ter lease spec: ------------ __ Other (please specify): 5. How much foam is usd por baring event? How much foam is used per training event? po tes rnscolors __ salons _~2_ Less than 5 gallons __ 5 gallons ie tha 10 gals (rlease spect __ More than 10 gallons (please specify): _ swtogns __ 5 to 10 gallons . nang, wheredoes the spat oam go? In training, where does the spent foam go? Sim Sower __ Santary Saver onstesopte 0_arona __ Storm Sewer __ Sanitary Sewer [-- __ Other (please describe): __On-Site Septic ~ Ground 7. Vibro does he aining take lace? Passe include sess, erseckaothne pec ocaton Where does/did the training take place? Please include address, intersection or other specific location Fiemme fo cura pes rg on Sh poy ely pragsc wd LPPu infr~__~a~,f~~<0u-~tre.n~t a_ndb'p_a(~_t_t'rainin~ g areas~ q~ ~4~ ~ ~f~_.,~. Lh oo TT 95se7s4i4a0o.x52 OOVVEERR--> XInog~i ............... meres er 57SA CTETTT SCTe e i Em e 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651,639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv,cem 22223333..00221100 sate02827022 STATE_02 82 7022 DELTA Aw QUESTIONNAIRE xX FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree Training Ls 5 Vib type(s)andbrandis of foam ar ower uscnow and nh astby the Department,bh for re What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tassos and in Uainns (1 opiate? Passe check all hl 9p. response and in training (if applicable)? Please check all that apply. Typeof Foam Brand ofFoam YTUeasoanrdtgiln?e AAmmUmosuueandlty CuUmsoenrty HistoUrsiecda?lly Type of Foam Cl8Aqoueosus Class B Aqueous FimForming Foam -- Film Forming Foam Fey (AFFF) I ClBaAosls eee mm me ---- -- Class B Alcohol- Resistant (AR)- rE AFFF HII eee mn ee mn Class B Protein cn ass y ---------- ---- ---- ---- ---- Class B Fluoroprotein (FP) Cla8 sims: Class B FilmFFouramionogten -- -- _-- Forming Fluoroprotein ft (FFFP) CoBARFEP eo -- -- ---- ---- Class B AR-FFFP Class ABH Class A-B Hi Cy ---- mm Class A Expansion Foam th Training Foam oar re Other Brand of Foam Silver Used in Training'?. Yes or No Amount Used Annually Currently Used? Historically Used? A [oosals _blge/ 0 Trhankmyoufocreyonuar imemanod coooperraStiloonc.inPgl:eaosenconMtianceNsancyPRooln"gGofrDtrlolaAgCoonnsyul(t55a1n-(289571-.8669678:o5f152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or Skin iate 09) 1 00 have ay elon fogaring this questi. jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PPlleeaasseerreettuurrnntthhiissqquueessttiioonnnnaaiirreettooDDeellttaaCCoonsnuslutltaannttssbbyyJJuunnee66., 22000088 nintthheeeenncclloosseeddssttaammppeedd,,sseleflf:`aaddddrreesssseeddeennvveellooppee.. Question completed by: Questionnaire completed by: FaDroowa,ndielie" OFD Treagsacer Name an~Lritle Frae lDepearmeent Fire Department Phone3Nu2m0be-r 972-9157 E Wo vem Phone Number E-Mail Address 7oe-708 XXKlinnooggeenn'" Phone: 5910 Rice Creek Parkway 651.639.9449 / 800,477.7411 Fax: - Suite 100 St. 651.639.9473 mr Paul, MN 55126 USA www.deltaenv.om 22223333..00221111 stare 02627023 STATE_0282 7023 QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Exex Firefighting Foam Use in Fire Trainiqg Ww 1. DfDrooeesfgsyhyionougurr DDoepepepararartttmmoenensnt?t cureonrhtays currently or has your your Deperiment Department historically historically used used ClAaorsClasss Class A or Class Bfoams B foams for for XC firefight~/~ ovpeorsatioPns?rotco Qeuesetiond2 -- YNeos-SiPgroncteheedbto Qaoufetschtiiosfnok2rm and rettuoDrelnta Consultants __ No - Sign the back of this form and return to Delta Consultants 2. Howoften is Class or ClAfoaamussed in respolno sre calls? 2. How often is Class B or Class A foam used in response to fire calls? 025%offres Rossonottes 0-25% of fires 25-50% of fires 7510004 ofres 75-100% of fires 5. Dosthe Department have acompressed ai foas sytem (CAFS) wih itn frk ants ongne(s Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Aves CwYes No 4. How fons foam used in raining exercises? How often is foam used in training exercises? Never Woskly 2 ony uy __ Never __ Weekly _ Sommwaly __ Awusly _ seamualy, __ Semi-Annually __ Annually Ober leasespeciy __ Other (please specify): ~,, Monthly __ Quarterly __ Bi-Annually 5. How much oem is used er aing event? How R_ much ~'X Losstr5gaallonns foam is used per training Less than 5 gallons event? __ 55ggaalllloonnss More tan 10 galons (lease spec): __ More than 10 gallons (please specify): - 510 10 galons __ 5 to 10 gallons 6. Invaring,whero oss he spent foam 07 In training, Somsowss where does the spent foa_m_sagnot?rySower __ SOtvoermrGSleewsesrede_ se_ ibeSyanitary Sewer __ Other (please describe): ___onstasopic __ On-Site Septic _Y_Grouns ~/ Ground 7. Wher dossidd he taining ake lace? Please include advess, nrsecton or ober specific locaton Where does/did the training take place? Please include address, intersection or other specific location fonaon or cre ad pas Unig aces OFD Cr hay information for current and past training areas. XKinoger OOVVEERR-- onPhone: TT 59:1.0 Rice Creek Parkway 651.639,9449 / 800.477.74:L1 Fax: EoDoA Suite 100 St. Paul, NN 55126 USA 651.639,9473 www.deltaenv.com 22223333..00221122 state 02827024 STATE_02827024 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5. What pec) andbrant) foam aorrweer used nw ardi the pastb he Deparment, both forfr 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Toso 3rd ran (1 399A" Pease neck a hat 301. response and in training (if applicable)? Please check all that apply. Twpeof oan Bundotforn TYUaesvendogirnN?s AAmUaosueldnyt CuUrseesn?ty HisUtsoreidc?ally Type of Foam Casot 8pAaqueouns gethuawd No 0 ayslebe Nig Class B Aqueous Glass 8Aloha: (AFFF) Film-FormingFoam Class B AlcoholReem Resistant (AR)pe AFFF CRI ee. mm em em Class B Protein cassn Class B Fasopotenp) -------------- ---- ---- ---- ---- Fluoroprotein (FP) Ca8sFisn Class B FilmForoang Forming Foogpoen | ---- ---- ---- ---- Fluoroprotein Fe (FFFP) CossBARFP Class B AR-FFFP Cast ABH Class A-B Hi Satin oC ee Expansion Foam Class A a Geanoe Loly ide = epseocv tCons Class A e. Trraaiinniinngg FFooaamm or = gee Other Brand of Foam Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? R~E)~E-So}~ "oul pspv/'klFo rock, owed Gaset ax 0 dUJ~J--~z~3~ 4,,t-~---. | WheeS CTE 2 -- Seed Than youfor your me an coeperaion. Please contact Nancy Roceinagt Delt Constants (51.6975152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 a ohana am) 6 i Sccingor a no insets Fallon Contol Agony (651-497-3685 or or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or i certo 1500 a any GLB regarding is coesiannae. jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PPlleeaasseerroettuurrnnththiissqquuesetsitioonnnnaaiirreettooDDeellttaaCConosnuslutltaannttssbyJune6,22000088 nintthheeenclosedstamped,self aaddddrreesssseeddeennvevleoloppee., -. I many vin belpbnad Questionnaire completed by: Faoemr elo Chin) Wark Porsrdean ---- Dsabic Name and Title FT. Fre Deparment Fire Department Ww) 320-$59-2290 Frond arber ewe Phone~Number 4-10-0%" Date Es E-Mail Address e NKinogent : h e350 S3a C3re Tar SEun O 100 FS C FaAsA e Ie e Tr S e Xlnog~A"_ 5910 Rice Creek Parkway Suite 100 St:. Paul, IVllt 55126 USA 22223333..00221133 stare 02827025 STATE_0282 7025 FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNsseNeNAiAnIIRFRiiEErre_Ter_aiTningg DELTA Cin Logon ~~ 1 pp Snesgc n Jets Does your Department currently or has your Department historicallYlQSed Class/~ or) Class B foams for firefighting operations? sto avsin Yes - Proceed to Question 2 em nant el costars __ No - Sign the back of this form and return to Delta Consultants How often is Class B or Class A foam used in response to fire calls? et te ep vs se 5 CAF 1 /~ 0-25% of fires 25-50% of fires 75-100% of fires 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes = ,~P No A How often is foam used in training exercises? ns ty e __ Never __ Weekly na __ otMonthly ie__ cv Quarterly Semi-Annually __ Annually __ Bi-Annually So OOtthheerr ((pplleeaassee ssppeecciify)): {ew Fun oars ll ET d How much foam is used per training event? ,/~ Less than 5 gallons __ 5 gallons / Gm - __ More than 10 gallons (please specify): __ 5 to 10 gallons + nesi peso? In training, where does the spent foam go? oon Se ns se etn s on __ Storm Sewer __ Sanitary Sewer __ On-Site Septic __ Ground Wnt ht etts,mtc n eft __ Other (please describe): Where does/did the training take place? Please include address, intersection or other specific location pure inforr~ation for Li current, and = past trainin~ areas. No won Miue fe Del Puceact Trail Cas Aone AREF, denat bund XltJlOIngoegleln" OOVVEERR-- 5910 Rice Creek Parkway Suite :tO0 St, Paul, NN 55125 USA 22223333..00221144 STATE_02827026 FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNssNeeNAAiinInIRRFFEEiirree TTrraaiinniinngg 5 Ws ht te nd rante s) ffs rrPoeory srdomtoowhatndvnih. pst bhCarman, fo 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. Testeom Stan ttVaientnil,n aAmApoeuyrntt YCuSorreednyet HYtMoeeceaaelhy Type of Foam Ge oss Muy seus ee -- -- Class B Aqueous Film-Forming Foam or (AFFF) GI aroto oe et ---- -- = Class B ALcohol- Resistant (AR)- j=AFFF A | mm------ -- ---- Class B Protein mos y ------ -- ---- -- -- Class B Fluoroprotein (FP) gm Class B FilmFi | -------- ---- -- Forming Fluoroprotein EE (FFFP) i -- Class B AR-FFFP pGroyn ---------- _-- Class A-B Hi Expansion Foam Goh _ Class A | -------- TT Training Foam omer = Other Brand of Foam Used in Training? Yes or No Amount Used Annually Currently Used? Yes or No Historically Used? Yes or No vr your your mead couposes. nyleesos conntaec Ndanea RosinsgoatDrot.Corsa (51657-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. Paso eum puta enter 3, 000 inthe cn " ssePellflef--aaasddeddrrreeetssussreenddetheninvsveeqlluooeppseeot.ionnaire to Delta Consultants by September 30, 2008 in the enclosed,~sta~ll .....A"'--.. \ Questonnot completedby: (pug) Questionnaire completed by: RaTnoa e Ciel Wo Lov5e WanSS Name and Title. Odde eg Fo ren ee FroDmatmen Fire Department LE5E07-657-2505 o9e.250%" Phone Number Date EE--MMaaiill AAddddreressss. HXwlnooggeenw" Tr Te TT Phone: 5910 Rice Creek Parkway 651.639.9449 / 800,477,741:!. Fax: AT Suite 100 St. 651,639,9473 ne Paul, MN 55126 USA www.deltaenv.om 22223333..00221155 JEp-- STATE_0282 7027 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg D DEELLTTA A vVve-e Lphr 1. 1. frDDeootesstiyyoonuugrr DDpeeappraatrrotmmneesnn?tt cantor currently or has has your your Dparimenthstorcaty used Department historically used CaAosrCasse Class A or Class BB~ ~ firefighting ea Proceed operations? to Questio2n SCz'~" No-Yes No- Signthebckofthis form - Proceed to Question 2 Sign the back of this form aanndd rreettuurrnnttooDDeeltta CCoonnssuutlatannttss Vo~0"~ (~ i 5~ ..2( 2. Howoften sClass Bor lass Afoam usecinresponsefofr calls? (Fo oamyise rio How often is Class B or Class A foam used in response to fire calls? o2swarires asso ottres Tot0o0f r%es 3. Dos the 0-25% of fires Department have acompressed ai 25-50% of fires oa sysom (CAFS) wl__ uli7n5-1a0r0k%onofffs oionrgie ~ noass ?y~ ,f[ore 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? ves oYes 4. Howofstfeoanm used in ang rcroses? 4-, How often is foam used in training exercises? Never Weakly Mani -- __ Never __ Weekly __ Monthly __ Quarterly SemtAnmualy Aomaly arsaniaty __ Semi-Annually __ Annually __ Bi-Annually Other ease soci) __ Other (please specify): 5. Howmuch foam sed por aning event? How much foam is used per training event? Lost than 5gators Sgallons __ Less than 5 gallons __ 5 gallons Horothan 0gators lasospoct __ More than 10 gallons (please specify): 51010 galons __ 5 to 10 gallons 6. in raiing,wher dos thespent foam go? In training, where does the spent foam go? Stom Sewer __ Santary Sever __ Storm Sewer __ Sanitary Sewer Ona lease sere) __ Other (please describe): onesep __ On-Site Septic rou __ Ground 7. Whore dons th raining taka pice? Please includ adress, ntrseoceiaoben speci location 7. Where does/did the training take place? Please include address, intersection or other specific location fcr forcenatnd ac sng roar information for current and past training areas. HAwogenr Xlnog~,L .............. OOVVEERR-- Prone: 651.639.9188050.47 7411 ToL: CEL 635.9433memnidaliasns.tom 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.cem 22223333..00221166 stare 02827028 STATE_02827028 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5 het yi pe) ann d rans)afopapmaer oarlwas schoedcknao1w an1dsonth pat yh parm. fo rs 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. TyTyppeeooff FFooaamm ClCalassss BB AquAqeueoouuss. gern Film-For~!ng Foam oF) (AFFF) "-~" Gos 8 con Class B Alcohol- Resistant (AR)- p=AFFF RT Class B Protein cussCFFllluauoosrsroopBprrootteeiinn ((FFPP)) Class Bin Class B FilmTomiForming Fraeapoton Fluoroprotein fs (FFFP) TRI? Class B AR-FFFP Casas Class A-B Hi Bann Foam Expansion Foam Gann Class A tamngfom Training Foam oerOther `BBrraannddooff FFooaamm walla 27"me ees mmmmm-- ------ ailely Sin --I--_N__a0ke aUnsidinngzOAomsoudnt Used in Training? YYeessoorrNNoo Amount Used AAnnnnuuaallllyy CuClrseeanrt"y Currently Used? YYeessoorrNNoo His"toonrai?cal Historically Used? YYeessoorr NNoo slo Veeaddyd,A enatelaLo em me rn i oo = TT -- _ ---- gh sol Mp = = 4 = Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 es inna Fv ov 5 coe agin es qorstonnare or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. pase narto Dota Consutants by in . Please return this questionnaire to Delta Consultants by September 19, 2008 in the e_n.closed~ampedi---~. self-addressed envelope. QuestoEnnasecompTlyed Questionnaire completed by: she. _sedompn FTO NNaammeeaanndd TTiittllee oo Fre parinet Fire Depa5rtme0nt -44-2454 FrameRube: Phone Number b t ls [SWA| TEN ~f~~~ TGa-220%" Date EE-MMaalil AAddddrreessss To P Xlnogen' E 5910 Rice Creek Parkway Suite -- 100 St. Paul, NN 55126 USA Phone: 65~_.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.com 22223333..00221177 sate 02827029 STATE_02827029 DELTA QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUsseeininFier_eoTTrraaiinniinrgL_ Lio on ) Dons oprcarey or os Dept rly ess ySomes an Does your Department fifrireeffiigghhttiinnggooppeerarattiioonnss?? currently a or has pysoxur DepGapas rtment historicall4y used C-l--a~_s---s-A'--o"r Clas~ s B foams for Sr" ~ Yes - Proceed to Question 2 rent a nt soe evn ./ __ No - Sign the back of this form and return to Delta Consultants 2 Wt Serine ct? 2. How often is Class B or Class A foam used in response to fire calls? BE 0-25% of fires 25-50% of fires 75-100% of fires 5 n Clakah-~fy ace senod iiek EBno--ycr onefSyhRoateot to 3. uoes the Department have a compressed air foam system (OAFS) with a-built-in tank on its ehgine(s)? Yes po ,.~::" No SAI 4. How often is foam used in training exercises? ee ey wow I __ Never __ Weekly __ Monthly __ Quarterly Sony ots seri __ Semi-Annually __ Annually over emer Zope __ Other (please specify): __ Bi-Annually YmFlow much foam is used per training event? __ Less than 5 gallons __ 5 gallons TT wens gemey or __ More than 10 gallons (please specify): __ 5 to 10 gallons oi, eon vi sests on 7 In training, where does the spent foam go? ee Soman Saysons oonrsene e__nouoeme __ Storm Sewer __ Sanitary Sewer __ On-Site Septic __ Ground __ Other (please describe): Where does/did the training take place? Please include address, intersection or other specific location F i i o2 n oa Npn n tue or wwrit yClawaBsR information for current and past training areas. Knog Xlnog~2 ............. OOVVEERR-- Prone: 651.639.9345 1 800.473.74F1a1k: 51.639.9477 nadaltaans.com 5910 Rice Creek Parkway Suite 100 St. Paul, MR 55126 USA Phone: 651.639.9~-49 / 800.477.74~.1 Fax: 651.639.9473 www,deltaenv,cem 22223333..00221188 STATE_02827030 DELTA wo QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirreeTTrra ningg, _ Wht te nd tam rvs td ow rdoo psy Deer br 8. What type(s) and brand(s) of foam are or were used now and in the past by the Depsrtment. both for fire response and in training (if applicable)? Please check all that apply. Ja S EE comy nay TTyyppeeooffFFooaamm Class B Aqueous oebawens 0X X Film-Forming Foam rs(AFFF) Ah Class B AlcoholSprew Resistant (AR)RaAFFF ben Class B Protein pSrEet enemy -- -- Class B Fluoroprotein (FP) Class B Film- giat ---- Forming Fluoroprotein = (FFFP) Co Class B AR-FFFP agmaesnes -- -- Class A-B Hi Expansion Foam Gon - Class A i. ------ -- TT" Training Foam or -_ -- = = Other BrBarannddooffFFooaamm Used in Training? YYeessoorrNNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? T ark ut ur cmon. Press core oc rey Boia DAu oCorrhsoa 5or1.h07o15 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 oncn) i Sek or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PPlleeaasseerreettuurrnntthhiissqquueessttiioonnnnaaiirreettooDDeellttaaCCoonnssulutltaannttssbbyyJJuunnee66,~ 22000088iinntthheeeenncclloosseeddssttaammppeedd,,seit: Foaddressed envelope. QuebimoecnoympSe crtgun, - -- 4 cf Nard Title,,,,.-" ~ ,"-, Rono Fons Dg } FiFrireeDDeeppaarrtmmeenntt A=E 34e=4401 (i0" % Phoffe ~u~ber ECin re ciby Kpetham com E-Mdil Address - Date HwXolngoge~rne" rome Phone: oo 5910 Rice Creek Parkway Suite 100 St. vaul, NN 55126 USA 631.699.9000 1 on TL Tak: 91 535947 asdslAR.SOm. 651.639.9449 / 800,477.7411 Fax: 65:1.639.9473 www,deltaenv.com 22223333..00221199 STATE_02827031 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree Tb raining g Pk 1. Dons your Deparmons curony has your Dogerimant strc usod iss Aor Cia 8 foams or Does your Department currently or has your Department historically used Class A or Class B foams for [rented] firefighting operations? XM Ves protco Qeuesetiodn z J Yes - Proceed to Question 2 No- Sign th back of his form and stu to Dla Consultants __ No - Sign the back of this form and return to Delta Consultants 2. How olen Glass B or Clas A foam used i response ore cals? How often is Class B or Class A foam used in response to fire calls? C saeans XY moon rsioveoties __ 0-25% of fires ,~/ 25-50% of fires 75-100% of fires 2. Docs the Copriment have a compressafoam stom (CAFS) vith a bitin tank ons ange? 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? veoYes Hw __~___ No 4. How often foam used in valing exercises? 4. How often is foam used in training exercises? J Te JE __ Never __ Weekly __ Monthly __ Quarterly ~X_ somaomuaty Aavuaty Samay Semi-Annually __ Annually __ Bi-Annually Othe plasospect: ER __ Other (please specify): 5. How much foams used pr raring overt? How much foam is used per training event? X_ Les tan gatos Sgalons Less than 5 gallons __~, 5 gallons More than 10 gaons lease spect More than 10 gallons (please specify): 51010 gators _ __ 5 to 10 gallons 6. ntaing. where doeth spent foamgo? Som Sewer ___santarySewer In trai~ing, where does the spent foam go? Storm Sewer Sanitary Sewer [-- __ Other (please describe): __onstesepre __ On-Site Septic i _X{_ Grow ~' Ground 7. TVivarro odootsortnhe rSariong ank loaeceme? olaaono cide ross, inrsaion ihr speci locaton Where does/did the training take place? Please include address, intersection or other specific location Pion Minds conFZney 457) information for curre~'-'a~d past training areas. 02s ict GY0cfor soi KTH on Ninogen: Xlnog~8"_ .............. OOVVEERR-- . 5910 Rice Creek Parkway Suite 100 St_ Paul, NN 55126 USA Phone: 651 638.9085 1 800.977.7415. Fok: 91.609.9471 dmaarrliannARm. Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.cem 22223333..00222200 sate 02827032 STATE_02827032 QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training Firefighting Foam Use in Fire Training DELTA 5 What ype(s) and rantofsoo)m re or wer usednaw ard nepast by he Deparment bo for re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire etponee ed rpm 1 9PICSIoT Please chock a ot a1. response and in training (if applicable)? Please check all that apply. TUosendgin? AmUosuednt Curry Historcaly TTyyppeeooff FFooaamm fotinen fend 2000 _ Pong Glass 8Aqueous To (eee Film-Forming Foam BrBarannddooff FFooaamm & Used in Training? YYeessoorr NNoo [24s Amount - Used AAnnnnuuaallllyy Currently UUsseedd?? credo Historically UUsseedd?? pe Gflaosso0 tceonror fs Resistant (AR)prAFFF FAI ee em me moe Class B Protein ctassoe ny ---------- ---- ---- ---- ---- Class B Fluoroprotein (FP) Cass rum- Class B FilmFiFaornaggoten _ --_ Forming Fluoroprotein FR (FFFP) RBI oe mm ---- Class B AR-FFFP ClGosreenBa1te | --_-- Class A-B Hi Expansion Foam cassA hawt pe. esOfe Class A TGF? emer met mr we Training Foam ove = __-- Other Z~ %L~ ,/~{f~ /- 50 ~1~ __ Thank you for your to and cooperation. Pes contac Nancy Rodingo Dota Consular (651-607-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 vadasacmcosn) ot Son Sloings at hs Mionaste Poluion Coll Agency (651-297 386 o or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or chro sora rs) You hae a Guess Garin i esiomors jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Please return tis cusstonnaieto Dott Consultants by June 6, 200 nthe enclosed stamped. sal: Please return this questionnaire aaddddrreesssseeddeennvveellooppee.. to Delta Consultants by June 6, 2008~~in the enclosed starnpedi self- [-- Cv bbls) ive cet Questionnaire completed by: Raean Tile -- Name and Title Peed kliva rem" FP ieDeepimeent t FD U3- 50%- Sil Fire Department '7c~ b. PPhhoonnee NNuummbbeerr 5oq - ~. ill rG)--1,o0--00~% DDatatee a oo EEM-Maialil AAddddrreessss XKiInnooggenn" TT Phone: [/910 Rice Creek Parkway 651.639.9449 / S00.477.74~.1 Fax: Suite tOO SI:. 651.639,9473 a Paul, NtN 55126 USA www.,4eltaenv.com 22223333..00222211 sate 02827033 STATE_02827033 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training 1. Dons ur estan cet reining coeratons? firefighting operations? ur opm rst cosS AgS s or No. Signthobackof tis form andreturn toDita Consultants ~ 2.YYeess --PProrceeodttc oo QQueueesstetiioond n2 __ No - Sign the back of this form and return to Delta Consultants 2. Howoten's Coss BrClass Afoamusd n espns of calls? 2. How often is Class B or Class A foam used in response to fire calls? J ozs artres 25500ots ic750% oes 0-25% of fires 25-50% of fires ~ 759100% of fires awe 33.. DDooeess tthhee DDeeppaarrttmmeenntt hhaavvee aaccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm ((CCAAFSS)) wwiitthh aa bljibilt-tin-itnatannkk oonnititss eennggiinnee((ss))?? veYes AeNo 4. How~ otn s foam used n ning exces? How often is foam used in training exercises? New weky wenn Quarry __ Never __ Weekly __ Monthly __ Quarterly Somamualy paruaty Svseualy __ Semi-Annually __ Annually __ Bi-Annually On leasospocty 2-3 [emBr Other (please specify): . How much foam i ved pr raining vent? How much foam is used per training event? X_ Loss han'gallons sgalons Less than 5 gallons 5 gallons aro than 10gas (lease speci): __ More than 10 gallons (please specify): 51010 galons i__ 5 to I 10 gallons 6. Inti, hers docs the sent am go? In training, where does the spent foam go? Som Sever __ Santry Sever ~ Storm Sewer Sanitary Sewer Ona lease dosera) Other (please describe): __ One Sept __ On-Site Septic Grown __ Ground 2000 udVou wedP 7. Wf here e dofiortm cuttheir nandgpaokteapiacge? rleoaose cde aos, morsatono ter speci locaton Where does/did the training take place? Please include address, intersection or other specific location information 0 ene for current and =past 13250 Chel training areas. ,, BooDurkin bLee 4 Lo Coon der sg oy wale tons Me Lass & 4 = * " = a Pee u . Kinogerx Xlnogen" , OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 300.477.7411 Fax: 651.639.9473 www.deltaenv.cen~ 22223333..00222222 state 02827034 STATE_02827034 DELTA Wo. QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg Fooaamm UUssee iinn FFiirreeTrTaraiinniinngg oA Qs Vi pts ndbrs) fom rt wt ain etby heparan, 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire rreessppoonnssee aannddiinn ttrraaiinniinngg ((iiff aapppplliiccaabbllee))?? PPlleeaassee cchheecckk aallll tthhaalt aapppplyly.. vote Aman Used in Amount en TyTyppeeooffFFooaamm Class B Aqueous `BBrraannddooffFFooaamm -- YesorNo Training? .Yes or No AAnnUnnusuaealdlllyy Used? Currently Used? Used? Historically Used? Film-Forming Foam (AFFF) oy Class B Alcoholer Resistant (AR)heAFFF on Class B Protein aCm2e nr -- Class B -- --_---- Fluoroprotein (FP) Pfaresm Class B Film- Form ing Fluoroprotein (FFFP) =-- Class B AR-FFFP agneonns = -- Class A-B Hi Expansion Foam . , t~ / CSlass An Sifya-EX X T jpgal T XX Training Foam - Ee -- Other m anr ge anspor. PescrotonRi aseConsearso(r51o.o71r52 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 eo) a oi or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state-mn-us) if you have any questions regarding this questionnaire. PPlleeaasseerreettuurrnntthhiissqquuesetsitioonnnnaaiirreettooDDeellttaaCCoonnssuultltaannttssbbyyJJuunnee 66,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,,sseellff:`aaddddrreesssseeddeennvveellooppee.. fE otrasan J. Y Questionnaire completed by: Name and Pole I epartment 357 mag ADe "~hone Number Bdrtppes@bibhles;e.g.com E-Ma~ ~dd~'es~ - ST, Date PT XInogen" one Phone; rT 5910 Rice Creek Parkway 651.639,9449 / 800.477.7411 Fax: Tee) Suite 100 St. 651.639.9473 -- Pa,JI, P1N 55126 USA nasties an. www.deltaenv.(:om 2223333..00222233 STATE_02827035 DELTA FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNssNeeNAAiinInIRRFFEiEirree TTrraaiinniiqngg .~ Tw : Bur rertosperipstmitiamitohnsmpaenri Does your Department currently or has your Department historically used Class A or Class B foams for SE firefighting operations? er eto aston .~ Yes - Proceed to Question 2 mrs bt ons __ No - Sign the back of this form and return to Delta Consultants 2 Hovertimp--t----------" How often is Class B or Class A foam used in response to fire calls? __ __ __ 002-255%%offoifrfieres.s _K_ 25.50% of fires X 25-50% of fires 751705-1000%% ooff ftirreess. 3. DDooeess tthhee DDeeppaarritmmeenntt hhaavvee aa ccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm ((CCAAFFSS)) wwiithtaha bbuuililtt--iinn ttaannkk oonn iittss eennggiinnee((ss))?? XmYes .No + orton om so va? How often is foam used in training exercises? __ Never __ Weekly __ Monthly __ Quarterly XC mtn ony wri zi~ Semi-Annually __ Annually __ Bi-Annually ty _ __ Other (please specify): onc ns ots aig vn? How much foam is used per training event? Am 7~ Less than 5 gallons k.~ 5 gallons __ More than 10 gallons (please specify): __ 5 to 10 gallons + nig sms gon 7 In train[7, where does the sp.~oam go? WT is 7Z~:~,__ Storm Sewer ~ Sanitary Sewer 7 oe pn = __ Other (please describe): __ On-Site Septic __ Ground hers i Pen ees, stone hs etn 7. "Where does/did the training take place? Please include address, intersection or other specific location S Moi Step s Kiyand-- Hoe information for current and past training areas. enol my) 57a8T XwXlonogge$,Er OVVEERR-- Phone: 651.639.0480 1 800.477.7411.Fox: 851.639.3475 mwratianira.m 5910 Rice Creek Parkway Suite 100 St:. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.74~.1 Fax: 651.639.9473 www.deltaenv.cem 22223333..00222244 STATE_02827036 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 5. Vina type(s) an branof fdoa)m a orvere used nos ann he stby hoDepartbot fo fre 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tosponce snd rain) appcabley Pease check a ot S01. response and in training (if applicable)? Please check all that apply. TueotFoam Bandotfoam TVUreassieondirindngl?o AAmUwosaeudnyt CuUrseendt |HisUtsoreidc?ally Type of Foam Cglasae8 tAque,ous asd N/ ef Mes Class B Aqueous (AFFF) Film-Forming (AFFF) Foam Gass 8 Aono wie Class B Alcoholin Resistant (AR)A AFFF J Class B Protein case Class B Fiaropoten (7) Fluoroprotein (FP) Gl8aFisn Class B FilmFFoursmoirnogmoten JEN - Forming Fluoroprotein Fe (FFFP) CosbmrsEP Class B AR-FFFP Cass ABH Class A-B Hi EarnFoam a rr Expansion Foam Case Sitemgy of peel de TainngFoan Class A Training Foam over J J Other Brand of Foam Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? Zr hisfericer > 7 ae Mad NN Na Thankyoufor your time and cooperaion_ Pleas contact Nancy Ring a Dla Coolant (051.097.5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 oF ra asiaan com) dm Soskinge a he Hinnsots Poluton Contr Agency (651-287-8686 or or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or reer a sare ma ou ve ay Questor raged hs cuestomare. jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. pp -- Jt Consutan 8 in heGrclosed stampa sot. `addressedenvelope. Please return this questionnaire addressed envelope. to Delta Consultants by June 6, 2008 in tl~ e~nclosed stamped, self- como vee delipleons Ree QuestionnaireWore completed Cbyl: ueC Rvael Wamewarie Pili Name and Title reDepatnent Fire Department Fe Suen -- ~~/~_ _ Prone Niumnboer 2d3ods -- G.9.0%" Phone Number Date EMEa-Mialil AAddddrreessss XInJongo~gAen"'_ So 5910 Rice Creek Parkway Suite 100 _ TT St. Paul, MN 55126 USA 22223333..00222255 STATE 02627037 STATE_02827037 DELTA Cl bone, ) FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firegighting Foam Use in Fire Training pvim Does your Department currently or has your Department historically used Class A or Class B foams for firefighting operations? Yes - Proceed to Question 2 __ No - Sign the back of this form and return to Delta Consultants 2. How often is Class B or Class A foam used in response to fire calls? Clots ores 25.50%of tes rs otres ~--" (-~'~~0~ of fires 25-50% of fires __ 75-I]00% of fires cansA- 56% Lm 33.. DDooeess tthhee DDeeppaarrttmmeenntt hhaavvee aaccoommprpesrseedasaiirsrffooeaadmm ssyysstteemm ((CCAAFFSS))wwiitthh aabbuiuliltt-iinn ttaannkkoonn iittss eennggiinnee((ss))?? Yes + who-- ts -- 4. How often is foam used in training exercises? eeent a tnt i cum __. Never __ Weekly Monthly __ Quarterly Other (pleasespec) too - __ Semi-Annually __ Annually __ Other (please specify): .,~ Bi-Annually 5. wma ami por aor? ! Toe 5. How much foam is used per training ev..,ent? ee hans tons Samos ss Less than 5 gallons 5 gallons _~Z__ 5 t~ens MMoorree tthhaann 1100 ggaalltleonn-- ss ((pplleeaassee ssppeecicfifyy)):: Srasee Crit _a X_ stormSower ____Saritary Sewer 6. IInn ttrraaiinniinngg,, wwhheerree cdooeess tthhee ssppeenntt ffooaamm ggoo?? / Storm Sewer ,Sai~ary Sewer __ Other (please describe): onstesetc __ On-Site Septic Xara y" Ground Where does/did the training take place? Please include address, intersection or other specific location tear information foar cwurerenntcaned oo iets past training areas. Loo lol. Gace. etst - Xlnog,..e..,n_.'. ............ OOVVEERR--> 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA 22223333..00222266 STATE_02827038 QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training Firefighting Foam Use in Fire Training DELTA 5 What pols) and ranofsoo)m ae or wor usenow and inepas bye Deparment. What type(s) and brand(s) of foam are or were used now and in the past by th,e Department, mans rang soesoay Ps chock ht 0B 2 ERAS. response and in training (if applicable)? Please check all that apply. TUasmeidnign? AmUoseudnt Cumenty TyTyppeeooffFFooaamm CCilr8oaAcussosruossm zebesta h eaoet Class B Aqueous Film-Forming Foam FF) (AFFF) Cl8acsohoel. Class B AlcoholRomy Resistant (AR)err AFFF mE, -- em ---- Class B Protein cFaosmoor (fp) ---------- ---- ---- ---- Class B Fluoroprotein (FP) la8sFisn Class B FilmFoming Forming ody =~ -------- ---- -- ---- Fluoroprotein FFF (FFFP) cmeamere Class B AR-FFFP `BBrraannddooffFFooaamm Used in YYTeerassinooirrnNgN?oo Amount AAnnUnnusuaealdlllyy Used? Currently Used? bo for re both for fire Historically Used? Historically Used.'? -- ---- ---- Soman fom -- Ar CClalassss AA--B8HHii Expansion Foam QF. a -- 0% omen Teese iG wert 2 rmesgfom Training Foam Somer FEO jad ht niger EE Other ~C'(~-i~,~ <,"[c,.-rdF" V~-~Lv~" "ofThwaeroycoiuifnorcyaotuar ainmecoamn)d ocrooJpenraStioocnk.inPgelreaotshceonMtaicntnNeasnoctyPRloanngaCorDtaotaAgCeonncsyu(l8a5r1-2(9E75-18-665967-o5r157 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or im ackimerBae of 9 hve a avestons regarding is questions acd jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. `addressedenvelope. on Please ee return this questionnaire to Delta Consultants by June 6, 2008 in ttfe enclosed stamped, self- - .... addressedenve,ope. ~.. ~ -- ~ Guestarete come vis bly Questionnaire completed by: . .. . Timeaand TM ie l Chak Woden Name and Title FireRDeipcarhmemnotnd EB Fire Department W) 332z0o--59s7-72- 20:z4] PPhhoonnee NNuummbbeerr 60--1,o0-08 `DDaattee. EE-M-Maialil AAddddrreessss PLXlnog~; ............... rome: Phone: oo (31.639 7 006 TETek: 5910 Rice Creek Parkway 653..639.9449 / 800.477,7411 Fax: C1 e104} Suite 100 St. 651.639.9473 -- Paul, MR 55126 USA wauAAILasa. Com www.deltaenv.com 22223333..00222277 STATE 02827039 STATE_02827039 DELTA Crone) FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighti~ngFb~~ Use in-Fi~e Trai.~ing Spm tt cain rt nt oon Does your Department currently or has your Department historically used Class A or Class B foams for firefighting operations? ,~" Yes - Proceed to Question 2 it ooato rn / __ No - Sign the back of this form and return to Delta Consultants 2. How often is Class B or Class A foam used in response to fire calls? coe eta to nA) 8 i 0-25% offires 25-50% of fires 5000 75-100% of fires 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? + ars ogee Yes Ne How often is foam used in training exercises? __ Never __ Weekly __ Monthly __ Quarterly C Semidwualy XC Away Amal Semi-Annually 7,~' Annually __ Bi-Annually Ps __ Other (please specify): + vermin msassennst How much foam is used per training event? ..,>,-; Less than 5 gallons __ 5 gallons I __ More than 10 gallons (please specify): __ 5 to 10 gallons 6. IInn ttrraaiinniinngg,, wwhheerreeddooeess tthhee ssppeenntt ffooaamm ggoo?? Storm Sewer `SanitarySewer onsteSestc XC ound fo __ Storm Sewer __ Sanitary Sewer ter (please dose) Cadel pret. __ Other (please describe): __ On-Site Septic ,f? Ground Vi n m1 ye et ee r n ti i Where does/did the training take place? Please include address, intersection or other specific location Fore bowia ev gil SF ve information for current and past training areas. ~',-~. ~..~-~4--~__..od ,,~.,,~._. ,,, Bek Lod ~_,~" t "~'~ ,J~-~:-~ Ww, ort Sell on Ween Hee iw Lo oo ~]nJongogeenn"' Cede oo 5524697.1 034541 OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 65!.639.9473 www,deltaenv.cem 22223333..00222288 STATE_02827040 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5. Vint poa)n brand) of foam aro wre usd now a heat by the Dptmn, both ofr 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire nn tmaenny Pes hot h k ap. response and in training (if applicable)? Please check all that apply. Tipe ofFoam pamittom Tleeaams A-- "mDoody CUusreesn?t Hadtoerecsattly Type of Foam Gl8rewooeus Class B Aqueous ey om -- -- Film-Forming Foam ess (AFFF) Gl8Aeson QosBuet Class B AIcohoF Resistant (AR)- ReAFFF J Class B Protein GForoepneten (7) --_------ Class B = -- Fluoroprotein (FP) Gl8Fsan Class B FilmFam Forming Femme _-- -- -- -- -- Fluoroprotein fe (FFFP) TABI rere. mmm mma sn Class B AR-FFFP Gass ABH Class A-B Hi Eointoan - -- = Expansion Foam Jropy Ag ibCu obo a Yo adsiee f a Class A Tet TC Training Foam omer TT = Other Brand of Foam buy Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? Mo ake Thankyouforyour timed cooperation. Plas cot any Roig af Dla Cols (51607-6152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152o mam omy Soins a Heth CokAgr S87 300 8 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or Er Yo come res avon jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Plasto retur is questionntaoiDroets ConsublytJaunets6, 2008 re Please return this questionnaire to Delta Consultants by June 6, 2008 it] the enclosed stamped, splf......................... Be oo addressed envelope. QQuueessttiioonnnnaaiirree ccoommpplleetteedd bbyy: C eEhm, ui foeadl Faust Voges Name and Title FeaDae. Fro Depasmert Fire Department h dt C From Noor 342% 3500 ~ Phone Number oi9-10-03 Date --_ E-EM-aMlalil AAddddrreessss ee XInoJIngog~en_&'~ rea 5910 Rice Creek Parkway raee Suite 100 Ee-- St. Paul~ MR 55126 USA 22223333..00222299 stare 02827041 STATE_02827041 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 1: Someone carry orbs yor Corn tray id Gas cr Ofs ur 1. Does your Department currently or has your Department historically used Class A or Class B foams [or frothing operations? ee ea 2 Yor Procosdto Question? firefighting operations? Yes - Proceed to Question 2 fl. Clot B cal "--T-"ru~t~L% , ~t> ~,~ "_0 ~. I e._ LI ac~t(~ No Sign th back atis orm andrears Dts Consulints {+f wu secre] No- Sign the back of this form and return to Delta Consultants 2. How often is Glass ar GaAsfosam used in response to rc cals? 2. How often is Class B or Class A foam used in response to fire calls? 025% otras 25.50%of ras Ts 00% artres __ 0-25% of fires __ 25-50% of fires __ 75-100% of fires 4. Doosihe Department havea compressirfoam system (CAFS)witha bitin tank ons engine(s? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? ves NoYes No 4. How often' foam used in ining exercises? 4. How often is foam used in training exercises? New wey downy une __ Never __ Weekly __ Monthly __ Quarterly --semvamaly Away J" __ Semi-Annually __ Annually __ Bi-Annually wc oter(leaso spect _Pareloey poliw won teks. ~ Other (please specify): 5. Howmuch foam is usedporvaring oven? 5. How much foam is used per training event? Loss than' galons 5getons More than 10 galans (please specif): __ Less than 5 gallons __ 5 gallons __ More than 10 gallons (please specify): 51010 gators __ 5 apd to 10 gallons open sin Sp Sale d 7 6 Intraning where In training, where ddoouess tthheossppeennttffooaamm ggoo?? Co SomSewr ___SaniarySewsr __ Storm Sewer __ Sanitary Sewer __ Other (please descr be) ___OnSteS __ On-Site Septic rouna 7. VnWihbooerreerodomeiso/ddraidcutthhroeeoitnraiainnninngpotaasktoeapplnaaccgee?? rePelseaasssee clude include sccress, address, rsa intersection or or othrother spec specific acaton location Slo P --eolo| erm telrLrbCo rer o Ti ube e information for current and past training areas. Tarieo Nema Glos Xlnog$,,,q.', OOVVEERR-- EE 5910 Rice Creek Parkway Suil_e 100 St, Paul, MN 55126 USA ~~':- :-~q--- -.~ . ~ 22223333..00223300 STATE 02827042 STATE_02827042 DELTA FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training ww 5 Whatyousv ) andg bano) feoamsaoPveorse ursadcnhowhandsnth past byie Doparinon, bot for eo 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. Tipe Foam Bndotbon reJeoureaidnms AAmmOowunanty YCeCutvrseeeartnM"to iYse"tsVoeeinraadley Type of Foam FimFompafom Joss Gershon 25 nd CCllasasBsBsAquAqeueoouuss Film-Forming Foam fs (AFFF) Ga a8Ascasr et -- ---- ---- Class B Alcohol- Resistant (AR)- bdAFFF -- Class B Protein cCueesen ---------- ---- ---- ---- ---- Class B Fluoroprotein (FP) Gloss Fan Class B Filmet Forming | ------ ---- -- -- -- Fluoroprotein we (FFFP) SA mms mmm te Class B AR-FFFP GGushABH, -------- -- ---- ---- ---- Class A-B Hi Expansion Foam Css hase Gl-g 5 8 Class A rn _ Training Foam over oo = Other Brand of Foam Used in Training? Yes or No Amount Used Annually 5 Currently Used? Yes or No Historically Used? Yes or No Tharcyou'or ou mean coopran. Please coack Nar Ring a De Consults (05-697-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 aman Vovbvav sy mooeo ny 8 QvSsorare or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. PlPeleaassee return tthhiiss ququeessttiioonnnnaaiire self-addressed envelope. to DDeellttaa ConConssultants by ber 30, September 30, ie 200#-itl-ih~e enclosed stam -enclosed star~l~e~t~ N, ve self-addressed envelope. ~ kJ LJJ-. ~ RQauemsetotnmnaTtsekcomepekted: eTlo yplome Name and Title FreGGa5pe2ln5e7b-e4n75E 3 D _ G27.07 Fire Department PPhhoonnee NNuummbbeerr oo DDaattee EEMMaallil AAddddrreessss HXwIonoggeenw" Phone: 5910 Rice Creek Parkway 65~.639.9449 / 800.477.74~] Fax: TT Suite 100 St. 651.639.9473 oo Paul, re MN 55126 USA www,~eltaeav,cem. 22223333..00223311 stareo2sz7043 STATE_02827043 DDEELLTTA A Le bt FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAIInIRFEire Training LL Firefighting Foam Use in Fire Tra ir gl--- 1 ome bp cys Opty Ss Sent on Does your Department currently or has your Department historically use Class re ~ (Coon ~ firefighting operations? oassesoot ots Yes - Proceed to Question 2 ms for bt os rot st te __ No - Sign the back of this form and return to Delta Consultants 2. How often is Class E~ or Class A foam used in response to fire calls? TE 7~. 0-25% of fires 25-50% of fires 75-100% of fires 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes + vo= nt sgt 4. How often is foam used in trainin~ exercises? oo py __ Never __ Weekly __ Semi-Annually ._~ Annually in __ Other (please specify): mn sos ent How much foam is used per training event? nnMonthly __ cr __ Quarterly Bi-Annually ~ X)_ LeLsessstthah n55ga aglalloln onns.s __ 55ggalallloonnss __ 551t0o 1100ggaalllloonnss MoMroeretthhaann 1100 ggaalllloonnss ((pplleeassee ssppeeccififyy)):: inns ssp In training, where does the spent foam go? ne __ Storm Sewer __ Sanitary Sewer _cnsswe __ On-Site Septic ons __ Ground r im et eon i en te a te Other (please describe): 7. Where does/did the training take place? Please include address, intersection or other specific location informalteioansfor 1 ~ current A and past training areas. Votdtud-- XlnJIonoggte,n~' .............. OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www,deltaenv,corn 22223333..00223322 STATE_02827044 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5 What ype) and brand) of foam ae or were used now arn he pastby he Depart, both ar fro 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Tesora end in rani 1 appicaiey Passe creck al nt a5 response and in training (if applicable)? Please check all that apply. TUasmeidnign? AmUosuednt Curent Historically TTyyppeeooffFFooaamm BBrraannddooffFFooaamm Used in Training? TeYsesarortNioo Amount Used Currently AAnnnnuuaallllyy ~~ UUsseedd?? Historically UUsseedd?? Cr mtatn CClalassss BBAAqquueeoouus.s Film-Forming Foam Fp, (AFFF) Gloss Aohok Class B AlcoholSma Resistant (AR)erAFFF CossbPwn Class B Protein cose Class B fmoeton ep) ---- ---- ---- ---- Fluoroprotein (FP) Cla0Fsism Class B FilmForming Forming Hoan || mm Fluoroprotein ery (FFFP) Fe -- Class B AR-FFFP Coss rn Class A-B Hi Ervanton Foam em Expansion Foam Close A hogs So vg0eef Ma Nee Class A TomgFom oo Training Foam Other - _ __ -- Other Auge 32%% dE2 202Mu Nw Thank you fr your lime and cocperaton. Pease coniat Nancy RodingatDet Consults (351.697.5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or GE daise som) oo Stinger ong Mmescta Paluion CorolAgency (651 297 8685 o or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or rac @oie no) 104 hava ay ess regaring is cuesiannes jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PPlleeaassee rreettuurrnn tthhiiss qquueessttiioonnnnaaiirreettoo DDeellttaa CCoonnssuultltaannttss bbyyJJuunnee66,, 22000088iinntthhee eenncclloosseedd-~s-t{aammppeedd,,sseelflf:- ~~~. otassed anseions = addressed envelope. Questomace completedoy: _ om be kplan Questionnaire completed by: amTSaot5nead kTiloCgeueer .ikP+ Colton Name and Title FFiirree DDeeppaarrttmmeenntt To Fons Numbe5r 2233-1380 Phone Number B9ae -0-0 Date EEM-Maialil AAddddrreessss XlnIonog~ff. 22223333..00223333 STATE 02627045 STATE_02827045 FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNsseNeNAAiinInIRRFFiEEirree TTrraaiinniinngg DELTA CT es NOL 1. ows ywDepatmens coors you Deport ray cess An Sm BRT Does your Department currently or has your Department historically used Class A or Class 13 foams for firefighting operations? Yo process ocunmionz Toobin ><~ Yes - Proceed to Question 2 TT eave evar em tet Sal onsite /' __ No - Sign the back of this form and return to Delta Consultants 2. How often is Class B or Class A foam used in response to fire calls? em fo ---- 0-25% of fires 25-50% of fires 75-100% of fires 3. Doeswthe DreparL tmaevne 4T corsrssod ai foam system (CAFS) wih buttank on ts engine(s)? Does the Department have ~ co"m~_pre~sose&d__air foam system (CAFS) with a built-in tank on its engine(s)? Yes + N=orma How often is foam used in training exercises? ph or -- cry Never __ Weekly __ Monthly Teoma 5a ron nen __ Semi-Annually coi BE __ Other (please specify): ~ Annually ,/ __ Quarterly Bi-Annually 5. Howes ouninstaegvres How much foam is used per training event? 30 Term sguo os atone Ep /k<~ Less than 5 gallons 5 gallons __ 5to 10 gallons __ MMoorree tthhaann1100ggaalllloonnss ((pplleeaassee ssppeecciiffyy)): sans mae ear? In training, where does the spent foam go? i Samer ayo __onstosane Gore ~ Storm Sewer __ Sanitary Sewer viene J __. Other (please describe): __ On-Site Septic __ Ground 7. Wired erg kpc? la 5 0, rst tor petit Where doestdid the training take place? Please include address, intersection or other specific location a Hes 7 information for current and past training areas. Ee XKlinnoogg_e,nn,''_ ................................. OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA 22223333..00223344 STATE_02827046 DELTA FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training epeorkr PB ort 5. What ose) and rants) foam ar orwor used nw nha he Deparman,both or What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire Terman on so appa" lease heck a at a3 response and in training (if applicable)? Please check all that apply. Tipoot oan Bondotfoan TYUeesasdmoiirnndgo AAm"moeueudnlt CUusreesnrt HisUtsoreidca?lly Type of Foam ClCalassss BBAAqquueeoouuss Cet Shel JE Film-Forming Foam ree) (AFFF) CS l8Aacse h e' -- ---- --- Class B Alcohol- Resistant (AR)- aAFFF poo RA SON Class B Protein cFiunsopsrotin (7) ---- --_------ Class B Fluoroprotein (FP) Gla8sFism: Class B FilmFain | ---------- -- -- ---- ---- Forming Fluoroprotein Fe (FFFP) CBIR ee om em -- Class B AR-FFFP Ca oss ry 8H ---------- ---- -- ---- ---- Class A-B Hi Expansion Foam Gloss A ---- ee = ---- Class A i Training Foam oer = Other Brand of Foam i Used in Training? Yes or No Amount Used Annually Currently Used? Historically Used? e harkyn ou or yn our necnadmcoostpoestSitoon.oleos conWtaocntaNsetreyoRuodoinngCaoDnlvaAogennscuya(5t1s2(9571-09876-8o56152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or ki saa i ou hav ay quesions regarding ns csi jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. [-- P lPeleaasseerreettuurrnn tthhiiss qquueessttiioonnnnaaiirree ttoo DDeellttaa CCoonnssuultltaannttssbbyyJJuunnee66,, 22000088iinn tthhee eenncclloosseedd ssttaammppeedd,, self: self- `aaddddrreesssseeddeennvveellooppee.. Questionnaire completed by: SSuappirgole) NNaamm~eefl~aan~dd TTiittlee "- oo Fire Dep~r~e~ " F8ine34Nu6ri-oe215 oe H P-- EhaonreANA duambeF ---- eeeDate e eect E-Mail Address - Kuogerr XlnJIongogeenn'' e rene ere Te Te TL, Ce habeear sco.m Phone: 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA 65~-.639.9449 / 800.477.7453- Fax; 651.639.9473 www.deltaenv.cem 22223333..00223355 state 02827047 STATE_02827047 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 1. DraotsanyionurgoDoewpaarttomnesn?t curorhtas your Dapartmant istricaly sedClass Aor Class oars for Does your Department currently or has your Department historically used Class A or Class B foams for firefighting operations? No Sign tho backof this form and return t Dota Consultants _X~__ YYeess-- PPrroocceeeedd ttoo QQuueessttioino2n2 __ No - Sign the back of this form and return to Delta Consultants 2. Howoftnis ClassBo Cass A foar used in respons orocals? 2. How often is Class B or Class A foam used in response to fire calls? '" 0o-22s5w%ototf frireess X X__ 2255--5500%% ooff ffiirreess -- 7755-10-0%1o0offf0firree%ss 3. Doss the Department have compressedai foam system (CAFS) with abut tank os anginls? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? X ves NoYes No 3. Howalteis oam used in tring exercises? How often is Nfooavme used in training Wooly exercises? Monty Quareny __ NSeovmeirAnmualy __ Ao Weekly __ Monthly BrAmu_ aty_ Quarterly _S_ C vr loss spo Semi-Annually cyy _N_ BD Hk Annually eye prot xed puck __ Bi-Annually 5. Howmuch foam is ued pr rang ovnt? How much foam is used per training event? L Loss tans galons 5 gators ~_. Less than 5 gallons __ 5 gallons Moco than 10 gatos leasespecs __ More than 10 gallons (please specify): 5110 gal0ans __ 5 to 10 gallons 6. Inteaing, wherdocs tho sert foam 957 In training, where does the spent foam go? Sto Sewer __ Sanitary Sower __ Storm Sewer Sanitary Sewer Otner ease scr) __ Other (please describe): OniSeptic __ On-Site Septic - __ Ground 7. Whceormeatdoosnsflodrdctuetera3ininpg otaskealnacge? aleoaese include adres, intersection othr 3pecclacatn Where does/did the training take place? Please indlude address, intersection or other specific location information for current and past training areas. K~iInnootgzeernr" OOVVEER R 5910 Rice Creek Parkway Suite 100 St. Paul, MII 55126 USA Phone: 651.639.9449 / 800.4-77.7411 Fax: 651.639.9473 www.deltaenv.~:am 22223333..00223366 STATE 02627048 STATE_02827048 FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNssNeNeAAiinInIRRFFEEiirree TTrraaiinniinngg p tene aefs eer 88.. WWhahattttyyppee((ss)) aanndd bbrarnad(ns)odof(fffoosaa)mm aarreeoorrwweerreeuusseedd nnooww aanndd iinn tthhee ppaasstt bbyy tthhee DDeeppaarrttmmeenntt,, bbootthh ffoorr ffiirree response and in training (if applicable)? Please check all that apply. TyTyppeeooff FFooaamm matwn Class B Aqueous meses en! Film-Forming Foam (AFFF) Ceres Class B Alcoholgmemow Resistant (AR)- ygmemidtmm Brand oFf Fooaamm Used in Jong, Training? med YYeessoorrNNoo Amount AgUsed fal AAnnnnuaulallyly Guy Currently Used? YYeessoorrNNoo Historically weUsed? woseie YYeessoorr No AFFF Class B Protein nGEapy ------ -- -- -- -- Class B Fluoroprotein (FP) Class B Film- FCE rem -- -- -- Forming Fluoroprotein press(FFFP) er Class B AR-FFFP cgrmnan = -- -- Class A-B Hi pry Expansion Foam Class A TnngFoon eksubavasf JE EVA Training Foam -- pemee W -- Other ob Sure brand smell yy Tok gen en,Pose A ------ Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (65"1-697-5152 or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. solfaddrossed envelope. senpet PlPeleaasseerroettuurrnntthhiissqquuesetsitioonnnnaaiirreettooDDeellttaaCConosnuslutltaannttssbbyySSeepptteemmbbeerr3300,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,, self-addressed envelope. nmr crn Lm Questionnaire completed by: -- --Torl lateiEezsD () Name~---~d Tit~ t~d~ I'~_.O.~ Fin1-94-5240 Fire Department sete] Phone Number ,~-'~. % - 9-30 -0 Date EE--MMaaiill AAddddrreessss Inogen' Xlnog~Z~ ............. Phone: 5910 Rice Creek Parkway 653_.639.9449 / 800.477.7411 Fax: Suite 100 St. 651.639.9473 Paul, MN 55126 USA www.deltaenv.~;om 22223333..00223377 STATE_02827049 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training on! DELTA Ne ) A Sa 1. Doos your Deparment curanty or has your Dopatmant istrcaly vegGrmsns)Class 8 oars for Does your Department currently or has your Department historically use Class B foams for ratenng ooeaions? [ini firefighting operations? ~- 'V- wo No- Sign the backof thi form and return fo Dolta Consultants " ~ = YYeess -- PPrroocceeeedd ttoo QQuueessttioino2n2. __ No - Sign the back of this form and return to Delta Consultants 2. HowoheniCass Bor CsAfsoam used in response to fr cls? 2. How often is Class B or Class A foam used in response to fire calls? Se oaswties 25.50% of res T51o0fre0s ~ / 0-25% of fires __ 25-50% of fires __ 75-100% of fires 3. Dos the Dariment have a compressed a foam system (CAFS) with abulin tankons engines? 3. Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? vesYes Av /~ No 4. Howoten foam used naling execioes? How often is foam used in training exercises? Never [A --Y outer __ Never Weekly __ Monthly CT cemonunty noma 0 ouamuaty __ Semi-Annually __ Annually ,.2<~ __ Quarterly Bi-Annually OOtthheerr ((pplleeaassee ssppeecctitfyyy): 5. How much foami used or varing vont? How much foam is used per training event? 2 Less than' glons Sgalons Less than 5 gallons 5 gallons Nero than 10 gallos (peasespecty More than 10 gallons (please specify): S1t0galaore __ 5 to 10 gallons 6. nang. where dos the spoeangot? In training, where does the spent foam go? Stom Sewer ___ Santary Sewer __ Storm Sewer __ Sanitary Sewer TT overfpeasedesemer __ Other (please describe): ont Septic __ On-Site Septic Grouns __ Ground 7. WchromraetidoonTocoadrtehris anngpaasoaplracne? rleea.s Include odes, nrsecIiadno othr speci locaton A Bodea . obs Ae dcais sou ob Cland Where does/did the training take place? Please include address, intersection or other specific location otionn Loco ion coi information for current and past training areas. (q ./~ OOVVEER R Phen: 651.629.9485 180 477.74Fo1k: 251.605947) dbrlkiasne.iam 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.del~;#env,cem 22223333..00223388 sate 02827050 STATE_02827050 DELTA QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training Firefighting Foam Use in Fire Trainin_g . Ch Qe . rat pte rion 03ei dcd tor nidese Copan, bo fre 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. [--- roy TTyyppeeooffFFooaamm canara Class B Aqueous Seten| Zep TL Film-Forming Foam ne (AFFF) ou Class B Alcoholgm Resistant (AR)- AFFF aspen Class B Protein cot Class B FiFuluorooropprorotteeiinn ((FFPP)) Class B Filrn- 2 wy -- -- -- -- Forming Fluoroprotein ee (FFFP) re Class B AR-FFFP gmaen oo -- -- Class A-B Hi Expansion Foam ch Lhmgptine. Class A rn OPT TT TT Training Foam over i ------ Other BrBarannddooffFFooaamm .. V D-'" ~' Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? EE kT yu urte r cpr,P PescontaRe inOot Conan 651v0o7n5152 Thank you for yourtime and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 remota cont i Sek Nene an Con or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. prem . PPleleaasseerreettuurrnntthhiissqqueusetsitioonnnnaaiirreettooDDdltltaaCConosnuslutltaannttssb-byyJJuunnee66,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,, sseellff.- aaddddrreesssseeddeennvveellooppee.. Question.ha)re com pleted~y: T"~a'~mma~ an~ iIittlee"' Ceo. oplus bol Fer _ Fire Depart ent ZEI8-kJ7%- dd] G-o1%0-08 Phone Number Es E-Mail Address Kinogerr Xlnog~n' ............... . 4 To Date 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.~:om 2223333..00223399 STATE_02827051 FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNssNeeNAAiinInIRRFFEiEirree Tprairnintg xX 1. Dots or Dopmtent cent os ye Copan try idCl Ace Cl fm Does your Department currently or has your Department historically used Class A or Class B foams for ees firefighting operations? 5 en macs Guest .~ Yes - Proceed to Question 2 No-ign to bck fifr an tan 0 Dts Constants __ No - Sign the back of this form and return to Delta Consultants 2 Vowofenis Cass or Cats foamsinscals? 2. How often is Class B or Class A foam used in response to fire calls? oaseaims KX assonaies roots __ 0-25% of fires )~ 25-50% of fires 75-100% of fires . Cos Deptt ov cen yt (CAFS) i in rkon cg? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? veYes XnNo 4. Howeca ansg ccts? How often is foam used in training exercises? or ea ory cuts Never __ Weekly __ Monthly __ Quarterly Somaru X nanaty sty Semi-Annually ~ oer ae sss _ -- __ Other (please specify): Annually __ Bi-Annually 5. Hovmahosmis trang Loss hangators XS gallons How much foam is used per training event? __ Less than 5 gallons-~ - " 5 gallons or hn 10 ars os poh): -- More than 10 gallons (please specify): 5110 gat0ons __ 5to 10 gallons [A In training, where does the spent foam go? Somsev OC swmysonss__onstosoe _Fooms __ Storm Sewer - ,,~ Sanitary Sewer Ger ossdsr -- Other (please describe): __ On-Site Septic "~Ground 7. Wars dor trig Pee iiss, nscion or aterspcclocion Where does/did the training take place? Please include address, intersection or other sl~ecific location HR information for c~rrent and past training areas. Kinoger OOVVEERR-- -- ET 5910 Rice Creek Parkway Phone: 651.639.9449 / 800.477.741.[ Fax: nN i. Suite 100 St. Paul, MN 55126 USA 651,639.9473 www.deltaenv.em 22223333..00224400 stare aaros2 STATE_02 82 7052 FirefightinaQguUFeEosSatTmIiOUoNsneNnAianIrRFeEire Trai Firefighting Foam Use in Fire Trainirrgg Wins ye) and biragnc(a) fopam apoPreewaasracsrercoawoantd anph. pty 0 Deparman,both or re 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. TUasendgin? AmGoeusdnt CumemtUsoor TyppeeooffFFooaamm iss Aquoesn rFiyn | -- | -------- ------ ------ Class B Aqueous Film- Forming Foam (AFFF) Ca lase Aoe no: ------------ ---------- Class B Alcohol- Resistant (AR)-AFFF Close8 Proton J -- Class 13 Protein Glas Foren Class B Fluoroprotein IE _ (FP) Cn las Fiy m Forming ---------------- ---------- ------ Class B Film-Forming Fluoroprotein (FFFP) Tar meme serra ret mm Class B AR-FFFP Glss A310 Class A-B Hi Gy -------------------- Pash Expansion Foam ~Class A pon Training Foam - - Other BBrarndoaoffFnFooaadmm _slee Used in YesorMo Training? Yes or No Amount AAnnUnnusuaealdlllyy HistoricUse? Current Use or Historic Use? ye L5pl ak. Tehar nyoutcor oou meman coorspteoraStiton.iPmeasoeoconatacsNeyPRoodoinngCatoDnavtaAogennsclya(5t1s-2(95713689878-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or Er oma mn You Nov ay aves qr ne essanare jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. ~Plogso totum tis ausstionnsivto ltConsultsbyMay0. 200 i theanclosed stamped. salt: Please return this questionnaire to Delta Consultants by Mav 9, 2008 in the enclosed stamped, selfassedsnviore addressed envelope. Questonat compos Questionnaire completed by: FaOmeuagniiTeile_Petesor Name and Title Sect. sFeto aDgognearn bake Fro Nuroer 015) Fire Department 372 4a: Phone Number E5ool-08 -- en tetoni @@ fEuai ntiielsanecl th.ancettu E-Mail Address HKnogenr Phone: 59t0 Rice Creek Parkway 651,639.9449 / 800.477.7411 Fax: Suite 100 St. 651.639.9473 I Paul, NN 55126 USA www.deltaenv.com 22223333..00224411 sate 02827053 STATE_0 282 7053 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 1. DDeoofsegsshyyioonuugrroDDpeoeppraaarrttmomenensnt?t curentoyr currently or hasyour has your Department Department historically historically used used Class Class A A or or Class3 Class B foams foams for for X.__ firefighting opYeerastio-Pnrs?oceetdo Questio2n ~(~ NoYes -SiPgrnocteheedbtoaQoucfetshktiiosnf2orm and return to Deta Consultants __ No - Sign the back of this form and return to Delta Consultants _K oosmotmes ___ossomettes ___rsiomeaties 2. HHoowwootfetenniiss CCllaassss 5B.oorr CCllaassss Afoamused A foam used inresponse in response ofr calls? to fire calls? 2. ,/~ 0-25% of fires __ 25-50% of fires 75-100% of fires 3. Doss the Department have a compressed a oar system (CAFS)with abut arkons engine()? 3. Does the Department have a compressed air foam system CAFS) with a built-in tank on its engine(s)? Yes X_ noYes X No 4. How often s oom used in airing exercises? 4. How often is foam used in training exercises? Week Monthy __ Weekly semamaty XK aonuaty __ Semi-Annually __ Monthly /~ Annually overessespesty __ Other (please specify): Cuan __ Quarterly arama __ Bi-Annually 5. How much foam i usedporaig event? _K_ tesstansgalons How much foam is used per training X Less than 5 gallons ____ event? __ 5sggaalllloonnss oro than 10 gatos (lease speci: __ More than 10 gallons (please specify): __ stotogatens __ 5 to 10 gallons 6. Intring,where does te spefnoatm go? 'In training, Stom Sewer where does the __spent foaSmantgaor?y Sewer __ , Oter Storm Other (lease Sewer (please describe __ Sanitary describe): SS Sewer onstesepic __ On-Site Septic _X Ground f Ground 7. WWihnheoerrmroealddioooeenssf/doidcttahherttoaraiiainnnindggpataakskeeipplnlaaiccneeg??PalPrelesaa.sseeiinncclluuddee adds, address, inteororthesrseociitcloocanton intersection or other specific location information shir for current and of Sh, past training areas. ity pack. T Market spect TT _Stugontake mo 55783 Kinogen _ 5910 Rice Creek Parkway Suite 100 St. Paul, NN 55126 LISA Trane: 651.639.3005 1 800.573 F111 a: GELEPA) HaARIAMAomR Phone: 653..639.9449 / 800.477,742! Fax: 651.639,9473 www.deltaenv.~:em 22223333..00224422 STATE 02827054 STATE_02827054 DELTA " QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinng x We 8. W Whhaatt ttyyppee((ss)) aanndd bbrraanndd((ss))ooff ffooaamm a areor orrwwee erree susaedd nnooww aanndd iinn tthhee ppaassttbbyy tthhee Department, Department, both both for for fire fire : 8o emer nd vain Of apple} Pleas chock a hat spl. response and in training (if applicable)? Please check all that apply. rUoeaomdiinng? AGmoasnst Curenty Historically TTuypoeooffFFooaamm iss 8 Aus From foam Class B Aqueous Film-Forming Foam rn (AFFF) GGule8aBAMosbeosNr- w 3m /e we ess os yea Class B Alcohol- Resistant (AR)- f=AFFF eresI Sg Class B Protein GFodsrsontan (7) - -- Class B Fluoroprotein (FP) BBrraannddooff FFooaamm _Ensuivre 07C Used in YosorNo Training? Yes or No Ge Amount AAnnUnnusuaealdlllyy ame Used? Currently Used? wa Used? Historically Used? ae Cl8aFsi s Class B FilmFFoomnoegoen --_---- Forming Fluoroprotein re (FFFP) ean #157| emmmm--rees ee _ Class B AR-FFFP CassAs Class A-B Hi Gy -------- -- -- Expansion Foam Gass wen wa ame ym va Class A Tofeem wealTews wa Ma ya mo Training Foam E- EE Other Thankyouforyur te and coopraton. Poss cota Ny Roding a Dla Consular (6510975152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 To nena os Shing: ho Minos Poa Corr! Agen (651257 3886 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or sna vn) 4 You have on aun regarding is custome jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. lease re is questiontno aeiles ConstantsbyJune 6, 008i the enclosed stamped. sol: Please return zhis questionnaire to Delta ConsUltants by June 6, 2008 in the enclosed stamped, self- `aaddddrreesssseeddeennvveellooppee.. Questonnai compeedby Questionnaire completed by: C r. NNaammeea~nndd ~[Tiittllee " FroNDeepxaormmepnt Frog Fire Department Phos Rub Phone Number EEE nid E-Mail Address Himogen' Xlnog~2 .......... ~ Depremment Sate Date re Ee er SIO EF WR SSsTe 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA rome ee Pe TTT ER wisi Phone: 651.639.9449 j 800,477.741:1 Fax: 651.639,9473 www.deltaenv,corn 22223333..00224433 sate 02827055 STATE_0282 7055 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Traininghl ` Firefighting Foam Use in Fire Training \ / { 1. eDDlooosehss iyynooguurr DoDpeeeppraaarrtttimmoeennnst?t curanty currently orhas your or has your Degartmen: Department nstorcaly historically usedClass used Class A A or or Class Class 8foams B foams for for XX Yes-protocQuesetiosn 2 firefig~,~ No-Sign thebackofthsform opYereasti-onPsr?oceed to Question 2 and returnto Data Consultants __ No - Sign the back of this form and return to Delta Consultants 2. Howofenis Class 8o GassAfoam used inresponse to recalls? 2. How often is Class B or Class A foam used in response to fire calls? _X_ o0-a2s5s%ototf fvireess 25.50%offres __ 25-50% of fires 75:4o0f 0re%s 75-100% of fires 5. Doestho Deparimant have compressed afoam stam (CAFS) witha buitn tank ons engne()? Does the Department have a compressed air foam system (CAFS)with a built-in tank on its engine(s)? Yes ra Yes No 5. Vowolen' foam used nearing exercises? 4. How often is foam used in training exercises? Newer Weekly Monty Quarry __ Never Weekly __ Monthly __ Quarterly TT cemhmualy xX Amaly Ceram __ Semi-Annually ~ Annually __ Bi-Annually __OtOhtheerr ((pplleeaasseessppeceicfiyfy)):: Du% Avent 5. Howmuch foam is used per vaning overt? _ How much LesstanSoslors foam is used per training XS event? oalens __ oLerses tthhaann 510gaglalotnosrs (ple~aXse/ spe): 5 gallons __ More than 10 gallons (please specify): swings __ 5 to 10 gallons 5. IInnttaraininiinngg,,wwheherree ossdoes tthhee ssppeenntt ffooaamm 07go? __somSewer __ SeaySewr __ SotvoremrpSeemwseerce_ sem_beSranitary Sewer __ Other (please describe): ___Onstesestc __ On-Site Septic _X Ground // Ground 7. WiWnhfhooerrrmeeatddiooooenssf/idodiddctuthhreretrnraarainiixnnggpttaaatkkeeHaplilaanccieeng?? aPPrlleeeaaasssee include include adress, address, ntesacotriohoern intersection or other speci specific locaton location \iczoms information for current Eig and past Uses training Foam areas. cn Toei Buds, Gio hese eee or Uepeus bcavous Vicwma Fee does wor Yq To use comm oo Resulor Pump Tamweuuc becuse of locemons., Portus. Fize Calla will vagy on the use or Foam _ KXln(o Iongogsenn"r ' , OOVVEERR-- rane: 431.439,9005 850.r 033 TALe L Fels E0103 04%) ilbiiasnnca.m Phone; 5910 Rice Creek Parkway 651,639,9449 / 800.477.7451 Fax: ~ Suite 100 St. Paul, NN 55126 USA 651.639.9473 www.deltaenv.eem 22223333..00224444 STATE 02827056 STATE_02827056 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg my -------- 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire te response and in training (if applicable)? Please check all that apply. aUsayin AmToSunt comonty Holy TTyyppeeooffFFooaamm Class B Aqueous uprwns sm. Nw fae? le Me Film-Forming Foam = (AFFF) Gone Class B AlcoholURE me ee | Resistant (AR)- AFFF All sm mre mm am Class B Protein Ges = = Class B veFluoroprotein (FP) Phodgsony Class B Filmey Forming LI nn Fluoroprotein as (FFFP) TANI? comes. me sn nm Class B AR-FFFP Gere a8H Class A-B Hi rm -- --_ -- Expansion Foam Cason J Class A TAIN em mn J Training Foam omer EE -- Other `BBrraannddooffFFooaamm Used in YYTeroassinooirrnNgN?oo Amount AAnnUnnusuaealdlllyy Used? Currently Used? Used? Historically Used? Toa oyu te and coupraion. less conto ane ing Dea Corus (51007-5162 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 i sony rn Sings 3 Woon ales Com ory 570950 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or D ee r eas jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Pi urnthis questionnairteoDelta C in in the enclos - Please return this questionnaire to Delta Consultants by June 6, 2008 ir~.th~lo~ed stamped, self- Eigse sstnsateto etsCounsbene,0g Snclsedsma at addressed envelope. /~" -- wie Lleplone. Questionnaire completed by: Tree (lief ui Foon Til Name and Title FreTtale Tenet Fire Department 507. 553-5415 PPhhoonnee NNuummbbeerr 4-9-p% DDaattee EE-M-Maialil AAddddrreessss oo eee XlnJoIgno~gAen'"~ ........... 5910 Rice Creek Parkway Suite 100 St. Paul, MN meee 55126 LISA 22223333..00224455 stare 02827057 STATE_02827057 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training cw NoxSign the Baof tcis fkom and return 0 ta Gonstutants 1. Doaetsiyonugr oDpeupasritomnesn?t srt of ha yous earient hiloricaly used ClAaos CslasssB foams o 1. Does your Department currently or has your Department historically used Class A or Class B foams for TO 22 ves Proceetdo Questio2n firefighting operations? ~ Yes- Proceed to Question 2 No - Sign the back of this form and return to Delta Consultants 2 How oftenisClas 8aCass Atoam used i response orcas? How often is Class B or Class A foam used in response to fire calls? A oaswatwes ___zssowoifies " 0-25% of fires __ 25 50% of fires TS 00Kaffres 75-!00% of fires 5. Docs the Department havae compressed a foam system (GAS) wha lin bark ons engines)? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? veYes TeNo 4. Howaltn s foam used nvaaing exercises? How often is foam used in training exercises? J esky mony -- cumeny __ Never __ Weekly __ Monthly __ Quarterly SomiAnna XQ Analy Shsrrually Semi-Annually ~, Annually __ Bi-Annually Or iozso spot: -- E-- __ Other (please specify): 5. Howmuch foam usec por varing oven? How much foam is used per training event? Lesstnsoslons 5gators Less than 5 gallons P~ 5 gallons Mere than 10 galons (pease speci): __ More than 10 gallons (please specify): ___swt0gansJ __ 5 to 10 gallons 5. Intraing, here does thospot foam go? In training, where does the spent foam go? 0 Storm Sewer __ Santary Sewer ,,/~ Storm Sewer __ Sanitary Sewer Otter oaso dosrvel __ Other (please describe): onstesapic __ On-Site Septic __ Ground i__ Ground 7. Wfohromtaotdiooonsolridcrhoenr:aiannidngpeacktetaocnee?rceacsso incldo adress irs o ther specicacaion 7. Where does/did the training take place? Please include address, intersection or other specific location information for current and past training areas. --Negsou-sQe 00000000000 OOVVEERR-- r NKinogsn: e AA r o ET r Ee Tey Ee S TE XlnogsE............. 5910 Rice Creek Parkway Suite 100 St. Paul, P1N 55126 USA .. - 22223333..00224466 state 02827058 STATE_02827058 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training 5 What one) nd braanofdfeo )ssr orPveorss uhsodcnks taon nswt ast byte Daren, bol for re What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. compas Aueutibe Tymeot Foam Type of Foam Glass 8 ooue Class B Aqueous ro.am Brand of Foam Film-Forming Foam dis Segeed opr Usedin Amount Used in Toanng"boed Training? Yea. hs Amaly Yes or No Amount Used Annually Curent Currently Cleay' Used? Yosoro Yes or No torical Historically "sear Used? Yerorho Yes or No ((AAFFFFFF)) GSe8Aebsel ee ---- ------ ---- Class B Alcohol- Resistant (AR)- pesAFFF re Class B Protein cn uss y -------- -- ---- ---- ---- Class B Fluoroprotein (FP) Gass Fim Class B FilmCrs | -------- -- -- -- -- Forming Fluoroprotein w= (FFFP) AAAI? ome | eee ee Class B AR-FFFP GCasisAaBHn -------- IT oo Rs Class A-B Hi Expansion Foam aon Taiww hs bzw Jo Se Class A re IeI CN Training Foam Over -_ -- = __ = Other marcyfaor ydouratrmand coobpeervaotionS. ylesaascescoat rNaancny WRsiSnugspoPrDaorteConsular (651-697-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 or nrodning@deltaenv.com) if you have any questions regarding this questionnaire. P`slPeelleafa-ssaeedrdreretetsuusrrenndtthehinissvqequlueoespsteiti.oonnnnaaiirreettooDDeellttaaCCoonnsuslutltaannttssbbyySSeepptteemmbbeerr3300,, 22000088iinntthheeeenncclloosseedds.t.satammppeedd,; - N\ self-addressed envelope. Questornacrosmping ver Questionnaire completed by: mrne Rlapperict, Asst. Crand= -- & m Name and Title Fwre eepindert vend Fire Dep5ar0tm1en-t 527-2070 Fr owe Phone Number G-30-0% Date EE--MMaaiill AAddddrreessss HwXolnogge~9n~. TT reePhone: eee BA TL 5910 Rice Creek Parkway 653.639.9449 / 800,477.7411 Fax: TS Suite 100 St:. 652[.639,9473 Paul, MN 55126 USA www,deltaenv.com 22223333..00224477 stare 02827059 STATE_02827059 DELTA QQUUEESSTTIIOONNNNAAIIRREE Firefighting Foam Use in Fire Training NrGr phephoi) 1. Docs our Depormentcuenta hes your Deparment stray se issA Gass Bars a Does your Department currently or has your Department historically useid CI._ass_A_.A~ ~ass B f~ams for nat firefighting operations? 3 ves rondo Gusto Yes - Proceed to Question 2 H-bo tn n 0 Dot God rstats No- Sign the back of this form and return to Delta Consultants 2. Hooton esr Gs fos rd cpa ov 7 2. How often is Class B or Class A foam used in response to fire calls? 0 omnes ssa rose _~f~::)~ 0-25% of fires 25-50% of fires 75-100% of fires 33.. DDoooess tthhee DDeeppaarritmmeenntt hhaavveeaa ccoommpprreesssseeddaaiirrffooaamm ssyysstteemm ((CCAAFFSS)) wwiiththa but built-in ttaannkkoonn ittss eennggiinnee((ss))?? YoYes % No PR ------ How often is foam used in training exercises? or oor sy aunty __ Never __ Weekly __ Monthly __ Quarterly __SeSmeim-Ai-aAnnunaulalllyy ~3X0~ AAnnnnuuaallllyy Bi-Annually __ Bi-Annuaily rer oss sect _ __ Other (please specify): How mushtm dor rg ven? How much foam is used per training event? awn ges ls spy: YO LeLessss tt hanh55gga aalllloon nnss. __ 55ggalallloonnss. More than I0 gallons (please specify): __ 551t0o 1100 ggaalllloonnss. 6. InIntrtraaiinniinngg,, wwhheerree ddooeess tthheessppeenntt ffooaamm ggoo?? 2 Gam son Stay Sows __onstose Loans ~ Storm Sewer __ Sanitary Sewer oreado __ Other (please describe): On-Site Septic ~Ground 1. Wiroti ks ice snc sts, taocionr hrsoc sin 7. Where does/did the training take place? Please include address, intersection or other specific location aced a go Loa loqreseoanLXtd Code, agin pocedione. information for current and past training areas. bn oily gard Coon opr Coo. wworletgo SetSree, _ OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phone: 65:1.639.9449 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.com 22223333..00224488 STATE_02827060 DELTA Ye)oy FFiirreeffiigghhttiinnQQggUUFFEEooSSaaTmTmIIOOUUNNssNeNeAAiinInIRRFFEEiirree TTrraaiinniinngg. . Vhs te rd rat ams vo id ow nd inhumharn What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire pd or ervsr nd response and in training (if applicable)? Please check all that apply. tviett AATmount orn ray TTyyppeeooffFFooaamm agmperns 5S{ovex Lo Qed ps" Class B Aqueous Film-Forming Foam ((AAFFFFF)) od i C!es~ B Alcoho!Seppe Resistant (AR)2AFFF AClass B Proteir~ ame Class B FiFuluorooroprporoteteiinn ((FFPP)) Coan Class B Filmwy Forming 7 -- Fluoroprotein ee(FFFP) ww Class B AR-FFFP amnton, ------ -- -- -- Class A-B Hi Expansion Foam ar I - Class A TT Training Foam over ------ Other BBrraanndooffFFooaamm Used in Training? Yessoorr NNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsse ed? 0 aT sst uro an ccoomppoets rionn., PPeesscat ntr reyRn oio g stCornn s 51.45r7 5r152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 eG Sk hervo e airCn or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn:us) if you have any questions regarding this questionnaire. te try 1s ston Dt Coats 001.1 enclosed same sl Please return this questionnaire to Delta Consultants by June 6, 2008 in the enclosed stamped, selfSma addressed envelope. tarts ) Questionnaire completed by: TTiGm Yeaclar C hief Name and Title lwiilolnows River Fire Dept. Fire Department ENEs-a3A0c0-33y7%r 4S-300-T05OF Phone Number Date E-EM-Maialil AAddddrreessss KXlwnoogegn' enw - Phone: re PL 5910 Rice Creek Parkway 651.639.9449 / 800,477,7411 Fax: ET Suite 100 St. 651.639,9473 Ch Paul, MN 55126 USA www.deltaenv.cem 2223333..00224499 soecaszroes STATE_02827061 DELTA % QQUUEESSTTIIOONNNNAAIIRREE \ FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree rTreainiintgh, sad ef rryt otesC G rt Does your Department currently or has your Department historically used Class A or Class B foams for pons firefighting operations? to aon '~ Yes - Proceed to Question 2 rat acorns __ No - Sign the back of this form and return to Delta Consultants How often is Class B or Class A foam used in response to fire calls? oameates _ossoneties OC rstcceliies __ 0-25% of fires __ 25-50% of fires Z'~ 75-100% of fires + Svre------------------ Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes FoNo + bona sess How offers foam used in training exercises? paneer ow ~ Never __ __ Monthly __ Quarterly __ Semi-Annually Annually __ Bi-Annually __ OOtthheerr ((pplleeaassee ssppeecciiffyy:): ~~ + ormgtan pseb How much foam is used per training event? Fits Tous susie _~ Less than 5 gallons 5 gallons ~ ne er More than 10 gallons (please specify): __ 5 to 10 gallons + ites eset? In training, where does the spent foam go? __SStotormrmSSeewweerr __`SSaanniittaarryySSeewweerr re rete Fee __ Other (please describe): On-Site Septic __ On-Site Septic ZX GGrroouunndd 1 poe ets este Pete ton st enn 7. Where does/did the training take place? Please include address, intersection or other specific location es tsaveerste information for current and past training areas. Sines Xlnog$,~ ............. OVEERR-- POPPING. 4-84i8 EE PE A 5910 Rice Creek Parkway Suit:e 100 St. Paul, i'4N 55:126 USA Phone: 651.639.9449 / 800.477.74:1.1 Fax: 651,639,9473 www.deltaenv.~'om 22223333..00225500 STATE_0282 7062 QQUUEESSTTIIOONNNAAIIRREE FFiirreeffiigghhttiinngg Fooaamm Use iinn FFiirree TTrraaiinniinng ELTA Uy Qf Wiha yee) nd rarffes ewmre drrtoaowntr5o atbb DaprnerSt for Qt What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire response and in training (if applicable)? Please check all that apply. Wt -- A omoty Witty TTyyppeeooff FFooaamm GRA Class B Aqueous J CU Film-Forming Foam ne (AFFF) fDo I--N ns. ce ee em Class ~ A!coho!- Resistant (AR)- JAFFF EE fo rms eee ee Class B Protein qm Class B UE ney - --_ Fluoroprotein (FP) Gorm Class B FilmJe Forming ie ---------- -- -- Fluoroprotein Sr (FFFP) CRRA mom ee ee en em Class B AR-FFFP GGuonlsl -- -- -- -- Class A-B Hi Expansion Foam CCllaassss AA nT Training Foam over EE Other BBrraannddooff FFooaamm -------- Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? Infoorourtraagnd pecte , ee ss conWaecntoKseosyPdoiogCaoDetlaFCoonnus1 S(o51S0o07h5o152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 B EE E Abe linen or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PPlleeaasseerreettuurrnntthhiissqquueestsitioonnnnaaiirreettooDDeellttaaCCoonnssulutltaannttssbbyyJJuunnee66,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,,sseelflf.- aaddddrreesssseeddeennvveellooppee.. sty Steve "Toews Questionnaire completed by: Te1y DSS REAShes Name and Title chee Fo F Wilwsel d Flee e Deeppt Fire Department FoSorO7- 936-5335 4ou-33 -O% Phone Number Date ------------------------ E-Mail Address XInog~n" rane: snare an hae Gr rT Fak G91639.9473 mndsliatnv. om. Phone: 5910 Rice Creek Parkway 651.639.9449 / 800.477.741~ Fax: Suite 100 St. Paul, MN 55126 USA 651.639,9473 www.deltaenv,com 22223333..00225511 stare_oasar06s STATE_02827063 QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinng, 1. DrDooaeegss iyynoouugrr DDsepepupararartttmmoenensnt?t curently currently or or has has your your Department Department stray historically used used Cass Class AoA or GassB Class B cams foams orfor X_ firefighting oYpeersat-ioPnrso?ceed to Questio2n ~ YNeos- -SPigroncteheedbtaockQuofestthiiosnf2orm and return to Delta Consultants __ No - Sign the back of this form and return to Delta Consultants 2. HHooww ooffteenn'iss GCllaassss BB oorr CCllaassss AA ffooaamm uusseedd iinn rreessppoonnssee tfoofrfire cal? calls? Xam k~, 0-25% oorf tfirreess 2255-.5500%%ooff resfires 7755:-110000%%ooff ffirreess 3. DDooeess tthhee DDeeppaarrttmmeenntt hhaavvee aaccoommprpreesssseedd arair ffooaamm ssyysstteemm ((CCAAFFSS)) wwiithh a a bbuuiilltt-iinn ttaannkk oonn isits engino(s)? engine(s)? You LoYes No 4. Howofiens foam used in ining exercises? X_ Never Weekly How often is foam used in training exercises? ~" Never __ Weekly __ MMoonntthlyy __ QQuuaarrtteerrlyy _ semiAmaly ___ Amaly -- srAmualy __ Semi-Annually __ Annually __ Bi-Annually Over pleasespectyy __ Other (please specify): 5. How much foam is uso per raining event? _O Lessthansgalens How much foam is used per training ~ Less than 5 gallons event? __ 5Saglalolonnss More than 10 gaons please specify): __ More than 10 gallons (please specify): ___ Sti0galons __ 5 to 10 gallons -- 6. IInnttraaiinniinngg,, wwhheerree ddooeess tthhee ssppeenntt ffooaamm 07go? __SlomSewsr ___SanilrySewer OO __ 1~> over Storm Other proasedescaver Sewer __ Sanitary (please describe): Sewer ___OnSie Sepic __ On-Site Septic Ground __ Ground 7. VWiinhhfoeerrrmeeatddiooosenssf/idrdiddcutthrhreeetntrrtaaiainnniidnnggptaaasckteevppalaaicceen?? aPPrleleeaasa.ssee include include address, address, intersection intersection or or othr other speciicfocaion specific location information for current and past training areas. Xinogen OOVVEERR-- ToC Cre For SU 160 SE ,aul HA $5136 USE 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA Phan 453.639.3005 | 496 173 7111 Fok: CHR 639947)uwdsliasns.om Phone: 651.639.9449 / 800,477.74:!.1 Fax: 653..639,9473 www.deltaenv.com 22223333..00225522 STATE 02827064 STATE_02827064 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Vy Firefighting Foam Use in Fire Training Ter 5. 8. W Wehshasatet ttryypepees(ssn))daannddrbbararinand(ns1)dooafifoffospoaae)mmaeaaryree?oorPrwwaesersreeesucsareeddckonoaww haanntdd Piin Pthh.ee patpast bythe by the Departmen, Department, boboth for for frefire response and Typeot Foam in training (if applicable)? Please Brandof Foam checkTVTUUarooalsslsnieetnoihddirnanitihggnnao??pply.AAAnmmUUnosusoueaeulddnnltty CCUuusrrrenedtn>ltlyy HHiissttooUrsrieiccdaa?llllyy Type of Foam CHla8aAmquseaosusn Class B Aqueous Brand of Foam -------- Yes or No -- Annually, ---- Used? -- Used? -- (FFF) Film Forming Foam (AFFF) ClaB csohs Class B AlcoholpCr e Resistant (AR)- -- -- ---- ( ACFFoF ban om ---- ---- ---- Class B Protein Cn lase 8 y Class B ------------ ---- ---- ---- ---- Fluoroprotein ass Fim: Class B FilmFTormoing n Forming (FP) | ---------- ---- ---- ---- -- Fluoroprotein FCoeseBARFFER (FFFP) em ---- ---- ---- Class B AR-FFFP ClCorseaAm3tHon Class A-B Hi ---------- ---- ---- ---- ---- Class A Expansion Foam TCalanssnAgFoam | --_ a ------ -- -- ---- ---- -- ---- omer Training Foam em Other ThorhaanrSanriokddyynnoooinuuggffeG@ocorordoyyetoolkuaatuarratenmtenimsvem.ecc2ooaammnn))dd) ooccrooyaodJopipmmeuerhraSSaatottvoioconockn.ki.ainngPyPgelelerearaauaasseteestthcthcoeaonnnMtMstaiaicsnrctnent goeNNassaracondntticacanyygPPRRhoouolsldudartniGioinnnnuggCCaaeototrnsiDDtvareototlltlaa.AACCggeooennncsnysulut((a65ln51ts1s2-29((6987575-11-88-.066609697867-.5oo5f1r15522 jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Quesionnate completed by: PlPeleaasseerreettuurrnnttihissqquueesstitioonnnnaaiirreettooDDeellttaaCCoonnsuslutltaannttssbbyyJJuunnee66,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,,sseellff.: `aaddddrreesssseeddeennvveellooppee.. Questionnaire completed by: Fameeddand Tl_eEngec Name and Title FWirienDecpbaramegnet Fre Depobnent 5Fir0e D7ep-ar8tm9en3t -3515 Er R PWhionne Numi ber lAree n @SCypg ouftuiaunlce lsugee, oryong E-Mail Address -- oo 5-28-08 Date DT XIno~n" .......... rere PRE TT LS 59:[0 Rice Creek Parkway Suite 100 St. Paul, NN 55126 USA Phone: 651.639.9449 / 800.477.7451 Fax: 651.639.9473 www,deltaenv.co rn 22223333..00225533 STATE 02827065 STATE_02827065 QUESTIONNAIRE FFiirreeffiigghhttiinnQggUFFEooSaamTmIOUUNsseeNAiinnIRFFEiirree~ Ta ore p 1. DDrooocegsshyyioonuugrr oDDpeeeppraaarrtttmmoerensnt?t ccuurrrrennttlyy or or hos has your your Deparment Department isorial historically useused ClAaorsClsas Class A or Class 8 B foams foams fofor X__ firefighting opVeerast.ionPs?rotocQueesteiodn2 )~ NoYes S-iPgrnocteheedbtoaQoucfetshktiiosnf2orm and return to Dita Consultants __ No - Sign the back of this form and return to Delta Consultants 2. HHooww oofftteenn Glass is Class BB.oorr CCllaassss AA lfooaamm uusseedd iinn rreessppoonnsseeftooffriree ccaallllss?? 2. ~ A 0o-z2s5%ooffffrireess 2255.-5500%%ooffffiirreess 7510of0fir%es. 75-100% of fires 3. Coes Does tthnee DDeeppaarrttmmeenntt hhaavvee a ccoommpprreesssseedd aiair ffooaamm ssyysstieemm ((CCAAFFSS)) wihwith aa bullin built-in ttaannkk onfs on its oennggiinnee((ss)?? Yes XoYes "~ No 4. Howoften foam used in raining exrcses? 4. How often is Never foam used in training week exercises? Monty Quarry __ _XC_ SNOSeetevmemerri-AApnnlnneuuaaaslllelyysp_ oct_ yy _ WRe_ aecklyy __ nmused . Annually Monthly Duce _ cvi_ y __ Quarterly BTLahnucuealy years Bi-Annually % Other (please specify): ~-~',Afv u 5e~ 5. How much foam s used pr raring vent? A Lessth5gaallnons 5gallons 5. How much foam is used per training event? Less than 5 gallons __ 5 gallons LT __ More than 10 gallons (please specify): -- 51010 gallons. __ 5 to 10 gallons 5. In In waiing training, wwhheerree ddoocess tethe ssppeenntt ffooaamm 0g0o7? Stom Sewer __ SantrySewer __ SOttonremr S(leowaesre descr): __ Sanitary Sewer __ Other (please describe): onste sept __ On-Site Septic _X_ Ground "X . Ground 7. 7. W iWnhhfeeormroeatddiooocenssf/ioddriddchtrheeortnraaarinininndggptaaaskktoeappillaanccege?? aPPrelseaeas.see include include adess, address, nersecton intersection of or shorother speci specific coon location- 40 information pein for current S5an4td-._past S.training S. areasn. acbege Mr. S6OTE Kinogen Xlnog~,'~ .............. OOVVEER R onan: 31.6S35R1.89E055.0C35r7eS4F11 iFok: SS9Ae0370417350MSE Fo al WHM5513A 6e05K 5910 Rice Creek Parkway Suite 100 St. Paul, MI/ 55126 USA Phone: 651.639.9~-49 / 800.477.7411 Fax: 651.639.9473 www.deltaenv.{:om 22223333..00225544 STATE 02827066 STATE_02827066 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training DELTA Vhatpe(s and rand) foam ae wore usar ann ho ast bythe Dparimen, ot for fre 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire rreessppoonnssee aanndd iinn ttrraaiinniinngg ((iiff aapppplliiccaabbllee))?? PPlleeaassee cchheecckk aalll tthhaatt aapppplyly.. TUosneidnign? AmGoouudnt Curent Historical TyTyppeeooffFFooaamm Close Aavecus eee ee rm ---- Class B Aqueous Film-Forming Foam prs (AFFF) Giaym--o lal APO ps Mer Class B Alcohol- AFF Resistant AFFF (AR)- Cesbpoen oo EEE Class B Protein Cost Class B Sony -------- -- ---- ---- -- Fluoroprotein (FP) Goss Fim Class B Filmferon ---------- ---- ---- -- -- Forming Fluoroprotein fe (FFFP) FS Class B AR-FFFP Gosh Class A-B Hi Cito | ---------- ---- -- ---- Expansion Foam BBrraannddooffFFooaamm Used in Training? YYeessoorr NNoo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? Historically UUsseedd?? Cool -- tsiec Lael do was Uf qk Gfaoshnt | S mi --e -- ee s 5e e0Yas eS Training Foam oer = Other Thyaoufnor ykour tme nd cooperation. Pleas contact Nan Roding f Det Consultants (65 6075152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 oro cam oo Suing 31g Minhsta Poon Gankol Agency (31 297 98o8 or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or a oo) 30s ho hy els rn IS UBER jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. Plese stun tis cussionnie to ota Consultants by Jun,200i the ancloed stamped, sl: addressedenvelope. Please return this questionnaire addressed envelope. to Delta Consultants bv June 6, 2008 in the enclosed stamped, self- I . 2 Questionnaire completed by: wFm ive Ciel ibe Tyebeshe Le lepliona Name and Title Windhyintbree == )aoT-ed Fire Department 71-2514 Prone liar Bote Phone Number Q-12-0% Date EF--MMaaiill AAddddrreessss XInIonoRgeenn'" TT Phone: 5910 Rice Creek Parkway 651.639.9449 / 800.477.7411 Fax: Suite 100 S;:. 651.639.9473 - Paul, MN 55126 USA www.deltaenv.~cem 22223333..00225555 state 02827067 STATE_02827067 DDEELLTTA A FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training veo 1. Does your Deparment reornas your Danner stort lass Ar ls 8 ome Does your Department currently or has your Department historically used Class~A or Class B foams for atoning operators ' [I firefighting__ operations? [_ f}/~ _ ~ ~d~ Ves ProtcoQeuesetiodn2 ,~<~ Yes - Proceed to Question 2 No- Sign the baof hci korm and rettouDrotna Consultants __ No - Sign the back of this form and return to Delta Consultants 2. Howoen's Class Bor Cass A foam used in espanse of cals? 2. How often is Class B or Class A foam used in response to fire calls? oases ass0nottres Tsu otires /",x/ 0-25% of fires __ 25-50% of fires __ 75-100% of fires 3. Does the Department av compre essed a foam system (CAFS) wilh abul tank on engines? Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? XeYesYes 4. Howatten a foam sed in ang exrcses? How often is foam used in training exercises? Newer Weekly Monty Quartety __ Never __ Weekly __ Monthly __ Quarterly X_ sambamualy Aovualy avamually Semi-Annually __ Annually __ Bi-Annually ~ Ono ease spy: __ Other (please specify): 5. How uch foam i usd par raining sven? How much foam is used per training event? 50. Loss ran ators 5gators ,.,,,~:~ Less than 5 gallons __ 5 gallons Morothan togalors Gloasespoctys __ More than 10 gallons (please specify): 51010 gators __ 5 to 10 gallons 6. ntarwhieendocgs t,h spe foamgo? In training, where does the spent foam go? Stom Sewer __ aniary Swe __ Storm Sewer __ Sanitary Sewer ve lease desc: __ Other (please describe): onstesetc _ya Ground __ On-Site EEA Septic Ground 7. Where does th ring take lace? Peas includ ade, ersectan or ovr spec locaton Where does/did the training take place? Please include address, intersection or other specific location fom for cuter an post aig rea. information for current and past training areas. toned plant, So shock Ae-pEFF OVVEERR--, Hwogen Xlng~go .............. SE 5910 Rice Creek Parkway Suite z,30 St. Paul, MI~ 55126 USA non: 631.633.9945 / 500.475 7411 Fak: $91.699.9431wdaseltacasm Phone: 651.639.9449 / 800.477.7411 Fax: 651.639.g473 www.deltaenv.~:om 22223333..00225666 state 02827068 STATE_02827068 oo QQUUEESSTTIIOONNNNAAIIRREE 0% FFiirreeffiigghhttiinngg FFooaamm UUssee iinn FFiirree TTrraaiinniinngg 5 Wht pol) and rans)offama cr wre usd nw and inh as yhDeparment, boro 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, both for fire ing tape los cra a ot sp response and in training (if applicable)? Please check all that apply. TUruaodnign? Amaouent Cunt User Ga BAqus eouss Fine TTyyppeeooffFFooaamm Class B Aqueous Film- i Forming Foam (AFFF) S| = . BBrarndaooff FnFooaadmm GlBacsons Class B Alcoholry ------------------ ------------------------ Resistant (AR)-AFFF Glee 8 Proton J Class B Protein GlB Poorosraesin Class B Fluoroprotein ((FFPP)) ClFainFsarmsing Class B Film-Forming Froproen trey -------- Fluoroprotein (FFFP) 0 Class B AR-FFFP gusnan _ Class A-B Hi Secrlon foun ~ - Class A Expansion Foam " Class A silver fen o_o Training Foam Ober - Other Used in X YYTereassinooirrnNgN?oo Amount AAnnUnnusuaealdlllyy HCiHsuitsrroteornriitccUUUssseeeo??r LlessT|Ghoolann Yeady. of lesenloan Thar yo fr yourtieand csopraion. leasecontactNancy Haring Della Consultants 051-007-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 momo oo Sos sha Wepoans Pluio Carks une (315378060 o or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or so)Yo ove a aes endaur jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. PlPeleaasseerreettuurrnntthhiissqquueestsitioonnnnaaiirreettoo DDeellttaaCCoonnssuultltaannttssbbyyMMaayy99,, 22000088iinntthheeeenncclloosseeddssttaammppeedd,,sseleflf:- freer addressed envelope. P----" | Questionnaire completed by: y beae n Tie tRacy: hee cheb Name and Title \goelvlerton FIRE opr. Fire Department Pa2n1e5r-o9n95 - SAS Zo Phone Number EE E-Mail Address Date 9-83-08 Ninogen Xlnog~i ................ ----TTT 5910 Rice Creek Parkway TS TE. Suite 100 St. Paul, NN 55126 USA Phone: 651.539.9449 / 800.477,7411 Fax: 651.639.9473 www.deltaenv.em 22223333..00225577 stare 02827069 STATE_02827069 DELTA JF FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Trai g + QE ---------------- Does your Department currently or has your Department historically used Class A or Class B foams for Epp pment firefigh~,g operations? curs /& Yes - Proceed to Question 2 wens __ No - Sign the back of this form and return to Delta Consultants How often is Class B or Class A foam used in response to fire calls? eX stn ios __ 0-25% of fires X 25-50% of fires 75-100% of fires ri v A Does the Department have a compressed air foam system (CAFS) with a built-in tank on its engine(s)? Yes A <n -- How often is foam used in training exercises? rT en sor __ Weekly _,X)(_ Sseemmi-i-aAnnnnuuaallllyy __ Monthly __AnAcnunaulalllyy ini _ __ Other (please specify): Quarterly BBii--AAnnnnuuaallllyy = vormp-- How much foam is used per training event? _~X<"__ LLeessss tthhaann 5& ggaalllloonnss __ 55 ggaalllloonnss. reir, __ More than 10 gallons (please specify): 5t010galons __ 5 to 10 gallons FR In training, where does the spent foam go? gt cnn IC ou __ Storm Sewer __ Sanitary Sewer __ On-Site Septic X" Ground __ Other (please describe): E ISRT -------- Where does/did the training take place? Please include address, intersection or other specific location 2oT l thV e! 75 - holectlon = Gravel Red information for current and past training areas. Kiser Phone: 631.6291.89009.44157 4TH Fak: 591.635 9473musi.deltasns.com 5910 Rice Creek Parkway Suite 100 St. Paul, MR 55126 USA Phone: 651.639.94.49 / 800.477.7411 Fax: 651.639,9473 www.deltaenv,~:om 22223333..00225588 STATE_02827070 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam Use in Fire Training DELTA 5 Vihear brand) f foamac ar reuse ry an ast by fe Dp 8. What type(s) and brand(s) of foam are or were used now and in the past by the Department, oi 1 a Prose creck al ot 3p. response and in training (if applicable)? Please check all that apply. i Usedin Amount TyTpypeeooffFFooaamm gers paige) Sl 45 es CCllasasBsBsAquAqeuoeouuss ee dir 1may A Film-Forming Foam BBrarannddooffFFooaamm Used in Training? YYeessoorrNNoo fo Amount Used AAnnnnuuaallllyy Currently UUsseedd?? oh for ro both for fire -- Historically vUesed? e`s ~1S (AFFF) Gvas8Aso.nso ool. Class B Alcohol- Resistant (AR)- erAFFF Ran | oem om -- Class B Protein Goss Class B fn -------- ---- ---- ---- Fluoroprotein (FP) Class Fin: Class B Filmfo J Forming Fliraproten Fluoroprotein ee (FFFP) SN -- Class B AR-FFFP Crasetasrm ----------, A = J Class A-B Hi Expansion Foam Tp Frees cTarasa Foam Training Foam over Other ost Conloeat jus TT fo 50 Mas Yes Lave les FE peers ~159 Tahyduaoayrummecoamn)docraaopraSioank.inPlaeatsocgoMaitnhNoatnoayPRoionnCaonDtoll ACgenacyr(6s51 269571.684785o8152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 FraTouhn orsay Ques stions rego einghs un or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or esiomas jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. `addressedenvelope, JA 1s TM~ JPlease return this questiennnaaiirree ttoo.Delta nsultantsby Consultants bE June 6, June 6, 2008ir gonl eds,elf:~~. 2008 i~e"t~-d"~~i~;~ds-ta-m;~di-~;~ addressed envelope. Questomaiecompete Yt _pelghn Questionnaire cornpleted(L~y: ppealClheig FST.obe etenfson - NNaammee aannddTTiiltlee oo /~.. oo Frobepamon Fire Department FoewNuombler-71d- 3901 _ StGe -o-0 Phone Number Dste Ee E-Mail Address Awmogenw Xlnog.e.~i ............... rene eon en TT TOL EN5S saa--ntom 5910 Rice Creek: Parkway Suite 100 5L. Paul, MN 55126 USA Phone; 651.639.9449 / 800.477.74:11 Fax: 651.639.9473 www.deltaen~.,cem 22223333..00225599 state 02827071 STATE_02827071 DELTA QQUUEESSTTIIOONNNNAAIIRREE FFiirreeffiigghhttiinngg FFooaamm UUssee in in Fire Training. Fire_Training.._ NEL ie valgus gum 1. DDooeessyyoouurr D Depeartpmeantcr cuurrrrmeennte tllyyoonrrhhtaassyyoouurr DDeeppaarrttmmeenntthhisisttoorriiccaallllyy uussd ~!.CqllaassssAAl~..[ CCllasasBsBfsfg(~aammssffoorr firefighting operations? ~'~~"' ~.......;'~'~ 30 es prcesto uasion ~ Yes - Proceed to Question 2 ZT Snack th fm a mio Dt Constr __ No - Sign the back of this form and return to Delta Consultants 2 Howolini se 8or ls foamed espaol focal? 2. How often is Class B or Class A foam used in response to fire calls? C ommates soko rechten __ Frown 0-25% of fires SR_ as_ ud25l-k5y0% of fires __ 75-100% of fires 3. Does ieCeparm iE Grste em CARS)d ith 8bid takonfsy ens? Does the Departme"nth'lh'v-'e'~61hpressed air foa~ system (CAFS)with a built-in tank on its engine(s)? X YYeess ZwNo PT ------ How often is foam used in training exercises? __ Never __ Wee~,ly __ Monthly __ Quarterly pas__ SeSmeim-iA-Annnunaulalllyy __ AAnnnnuuaallllyy --_ ___ _ BBii--AAnnnnuuaallllyy ~ Ober Gas oc __ Other (please specify): FR -- How much foam is used per training event? . LLeessss tthhaann 55 ggaalllloonnss __ 55ggalallloonnss. rr eeeen __~ More than 10 gallons (please specify): __ 55 t0o 1100ggaallloonnss 6 Insanedos oatm su? In training, where does the spent foam go? Smoove Snaysovr__Onsiosot Grand __ Storm Sewer __ Sanitary Sewer ovripemesmorer __ Other (please describe): __ On-Site Septic __ Ground 7. Whe co vane ae? Pas kt is, ron thr sn Where does/did the training take place? Please include address, intersection or other specific location HERE information for current and pas, t trainin~ areas. Se ais Locedlongm uak on plbeo fcrmo Kinoger Xlnog$#~o ............. OOVVEERR-- 5910 Rice Creek Parkway Suite 100 St:. Paul, MN 55126 USA Phone: 651.639.9449 / 800.477.741! Fax: 651.629,9473 www.deltaenv,com 22223333..00226600 STATE_0282 7072 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEiEre Training Firefighting Foam Use in Fire Training 6. Vib pos) and brandi) foam rec ere us no and i host yh Deparment, bot rr 8. What type(s) and brand(s) of foam are or were used new and in the past by the Department, both for fire a he ey as chock a a ap response and in training (if applicable)? Please check all that apply. Tw offoam Bndotfoam TvUaesmeridonirgnN?e AAmUmoseaudnlt CVueresntt HisUtsoreisc?ally Type of Foam Brand of Foam CassB Aquos - Cosbawens| soitPrema Class B Aqueous Film-Forming Foam re (AFFF) Ga8Asonso! Class B AlcoholRe J Resistant (AR)peAFFF GAG. mies eee ee me remem Class B Protein cases CFFllluauoosrsrooppBrrootteeiinn ((FFPP)) ~~ GlossBin Class B FilmFare Forming etn mmm om mm Fluoroprotein [es (FFFP) Coma on Class B AR-FFFP Cassa ExCEpxlaapnsassniAsio-oBnn HFFiooaamm Cassa fle ~~ rinAge Dor nk Cfalasses A 2 T.r.aJ,,q~,g Fu~rrrr ~ oter sm Other Peres Used in Training? Yes or No Ap Amount Used Annually Currently Used? fh Historically Used? Nu a - TT -- [be -- T leTs wTaCtaeolwaerydtooy, No -- pe Na -- fl"Yuea Tank youfr your tim ond ccoergion. Pleas cortat Nancy ocringof Dla Consus (51697-5152 Thank you for your time and cooperation. Please contact Nancy Rodning at Delta Consultants (651-697-5152 e Brinn a tne ac)omTioou oSeveianygdoonesinrne iPo3l5leo sCoerktAgency (691-207-30oe 00 o or nrodning@deltaenv.com) or Jim Stockinger at the Minnesota Pollution Control Agency (651-297-8666 or jim.stockinger@state.mn.us) if you have any questions regarding this questionnaire. .................................................. BPIlease return this questitoionnnnaairiree to Delitta Consutltaanntts byJJuunnee 6, 200Y8~iin~ithe necnlcloosseedd ssttaarmrfppeedd,, self- I""N ~ ------ addressedenvelope. Questionnaire completed by: Aw l (on hd Te Name and Title "~(['C) ~" l I ( O..x.~._ ~.._ o eCobdy Wteutt) SoT-352-o1( FiFrireeDDeeppaarrttmmeenntt Fo Vie Clii f q.s0% Leola _ PPhhoonnee Nuknber - DDaattee Kinogen: E-EM-Maialil AAddddrreessss Xlnog~&'. ............. - 5910 Rice Creek Parkway Suite 100 St. Paul, MN 55126 USA 22223333..00226611 sate 02827073 STATE_02827073 FirefightinQQgUUFEEoSSaTTmIIOOUNNsNeNAAiInIRRFEEire Training Firefighting Foam UseinFire..Training DELTA se vee Lelgphonal 1. Dassyour Deparmentcurntyor ha yourDogorman tal usd Class Aor Clos Bfoams for Does your Department currently or has your Department historically used Class A or Class B foams for netghungoparsions? firefighting operations? 2 YNeo-s-SiPgn rtheobtaoccQcuoeesttheiiosdnform and return o Data Consultants ,Y Yes- Proceed to Question 2 No - Sign the back of this form and return to Delta Consultants 2. Howotlnis Class Bar lass Afoanused response ove call? How often is Class B or Class A foam used in response to fire calls? 0 ozone Bamottes ___rsiooattes .X~ 0-25% of fires __ 25-50% of fires 75-100% of fires 33.. DDooeess tthhee DDeeppaarrttmmeenntthhaavvee aa ccoommpprreesssseedd aaiirr ffooaamm ssyysstteemm ((CCAAFFSS))wwitithh aabubiulitlt--iinn ttaannkk onn titss ennggiinnee((s)?? veYes p= /,,.-~:~ No 2. Mowatis foam use naling evrcises? 4. How often is foam used in training exercises? Ao New Weakly Many cuneny ~ Never 7 somvtoaty __ saly Yes __ Semi-Annually Weekly __ Annually oveGemseseatn_________ __ Other (please specify): Monthly __ Quarterly __ Bi-Annually 5. Howmueh oa sed por vainng ave? How much foam is used per training event? Loss han' gotons Sgaons __ Less than 5 gallons __ 5 gallons S110 ans __ 5 to 10 gallons __MoMroreetthhaann 1100 ggaalllloonnss ((pplleeaasseessppeecctiyfyy):: [Tr p---------- In training, where does the spent foam go? StomSows Sana Sewer __ Storm Sewer Sanitary Sewer J -- __ Other (please describe): ___OnSieSeslo Grow _On-Site Septic = Ground 7. Wlharr cooforrdctehnat na gpaakteVapancne? ePldesase include adress, nersecton ihr sped locaton Where does/did the training take place? Please include address, intersection or other specific location information for current and past training.areas. XXilnnoogg$e&n~ OOVVEERR-- 5910 Rice Creek Parkway Suite 100 -- = St, Paul, MN 55126 USA 22223333..00226622 sate 02827074 STATE_02827074 AAppppeennddiixx BB GGIISS MMaapp ooff TTrraaiinniinngg SSiitteess,, FFiirree DDeeppaarrttmmeennttss aanndd SSW WAAAAss ((CCoommppaacctt DDiisscc)) 22223333..00226633 STSATATTEE0_208228277007755 AAppppeennddiixx CC UUppddaatteedd TTrraaiinniinngg SSiittee S,Suummmmarairieess ffrroomm JJuunnee 3300t"h RReeppoorrtt 22223333..00226644 STATE 02827076 STATE_02827076 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY AAlIbber~t LLeeaa 2AAl2lbb1eerrtt LLleeaaarkFFiirrSeetrDDeeeeptpaarrttmmeenntt Abert Lea, MN 56007 221 E. Clark Street Albert Lea, MN 56007 Fi5Fr0ire7e-CC3h7hi7eie-ff4J3Jaa4m0meess BBeerrgg alfre@uty.aberea ory 507-377-4340 alfire@city.albe rtlea.org TTrraaiinniinngg LLooccaatitioonn:: FFrraannkk AAvveennuuee,, nneeaarrtthhee ddoogg ppoouunndd Training Location Coordinates (XY): 470510.69, 4831974 89 Training Location Coordinates (X,Y): 470510.69, 4831974.89 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: Ansulte ARAFE Ansulite AR-AFF FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: 55 ggaatlloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground Ground AAnnnnuuaall ffooaamm uussee:: ClAAaRRs-AAsFFAFF-- 4110551gtoa0l22lo00nsggaalllloonnss Class A - 40 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: AAllbbeerrtt LLeeaa LLaakkee llooccaatteedd aapppprrooxxiimmaatteellyy 00..44 mmiileess eeaasstt NNeeaarreesstt wweettllaanndd:: AApppprrooxxiimmaatteellyy 117/22 mmiilee wweesstt--ssoouutthwweesstt Karst Area: Karst Area: TTrraaiinniinngg ssittee llooccaatteedd iinn ccoovveerreedd kkaarrsstt aarreeaa NNeeaarreessttwwaatteerrwwelelll:: <a<1/4 mmiilee nnoorrtthh Nearest Wellhead Protection Area: <1/4 mle southeast Nearest Wellhead Protection Area: <1/4 mile southeast NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilce SITE RANKING: Po SITE RANKING: 13 22223333..00226655 STATE02827077 STATE_02827077 SSiittee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoontnatcatc:t: SSIITTEE SSUUMMMMAARRYY AAppppllee VVaalllleeyy-- 114400t"~ SSttreeeett AA7p1pp0pl0lee 1VV4aa7lll"leeSyytrFFieirreeet DDWeeepspatarrttmmeenntt Apple 7100 Apple Valley. MN 147th Street Valley, MN 55124 West 55124 N9Ne5ea2al.loo9nn53TT.hh2oo6mm0p0sposonn,, DDeeppuuttyy CChhiieeff nthompsocni appie-valiey mn us 952-953-2600 nthompson@ci.apple-valley.mn, us TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: Nearest surface water: Nearest surface water: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: AAppppllee VVaalllleeyy cceennttrraall mmaaiinniteannaannccee ffaacciiliyty,, 66444422 114400tthh SSL.t. W. 448844446677.6.633,, 44995544773368..7733 CCClllaaassssss BBBAAAFRFFAFFFF:F: FAA:nngguuAssngus Tridex Glass Class Class A" Angus H-Combat B AR-AFFF: Angus Tridex A: Angus Hi-Combat BBii--AAnnnnuusallllyy 551to0 1100 ggaallloonnss Storm sever, santary sewer, ground Storm sewer, sanitary sewer, ground AAAFRFFAFFFF.F: F33.ggaal1lll5oonngassll((ohrniisss.ttoorriiccaal uussee oonnllyy)) Clas&s: 10gallons. AR-AFFF: 15 gallons Class A: 10 gallons UUnniiddeenntitiffiieedd ppoonndd aapppprrooxxiimmaatteelyl0y0..77mmilileess nnoorrtthh--nnoorrtthheeaasstt <1<1/4 mmiillee ssoouutthh-ssoouutthhwweesstt TTrraaiinniinngg stsite llooccaatetde iinn ccoovveerreedd kkaarrsstt aarreeaa.. <1 mil cast <1/8 mile east TTrraaiinniinngg ssiitee iis llooccaatteedd wwiitthhiinn aa WWPPAA Less than 1 mie Less than 1 mile 11s6 22223333..00226666 STSATATTEE0_208282277007788 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoontnatcatc:t: SSIITTEE SSUUMMMMAARRYY AAppppllee VVaalllleeyy-- HHaayyeess RRooaadd AA7p1pp0pl0lee 1VV4aa7lll"leeSyytrFFieirreeet DDWeeepspatarrttmmeenntt Apple 7100 Apple Valley. MN 147th Street Valley, MN 55124 West 55124 N9Ne5ea2al.loo9nn53TT.hh2oo6mm0p0sposonn,, DDeeppuuttyy CChhiieeff nthompsocni appie-valiey mn us 952-953-2600 nthompson@ci.apple-valley.mn, us TTrraaiinniinngg LLooccaatitioonn:: FFiiree SSttaattiioonn ##11, ,1155000000 HHaayyeess RRdd TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 449811663388..33,, 44995533776666..4483 TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: CCClllaaassssss BBBAAAFRFFAFFFF:F: FAA:nngguuAssngus Tridex Glass Class Class A" Angus H-Combat B AR-AFFF: Angus Tridex A: Angus Hi-Combat FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: BBii--AAnnnnuusallllyy FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: 551to0 1100 ggaallloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Storm sever, santary sewer, ground Storm sewer, sanitary sewer, ground AAnnnnuuaall ffooaamm uussee:: AAAFRFFAFFFF.F: F33.ggaal1lll5oonngassll((ohrniisss.ttoorriiccaal uussee oonnllyy)) Clas&s: 10gallons. AR-AFFF: 15 gallons Class A: 10 gallons Nearest surface water: Nearest surface water: AAllimmaaggnneett LLaakkee llooccaatteedd aapppprrooxxiimmaatteelyl0y0..77 mmiilleess nnoorrtthhwweesstt NNeeaarreesstt wweettllaanndd:: <<111/88 mmiillee nnoorrtthheeaasstt Karst Area: Karst Area: TTrraaiinniinngg stsite llooccaatetde iinn ccoovveerreedd kkaarrsstt aarreeaa.. Nearest water well: Nearest water well: <4 mi southwest <1/4 mile southwest NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: <<11//33 mmiilee ssoouutthrwweesstt NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: More than 1 mie More than 1 mile SSIITTEE RRAANNKKIINNGG:: 11s6 22223333..00226677 STSATATTEE0_208282277007799 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY AApppplleettoonn A2Ap3pp0lpeleWtt.oonnSFniFerilreeinDDgeeAppvaarerttnmmueeenntt `Appleton, MN 56208 230 W. Snelling Avenue Appleton, MN 56208 3RR2oo0mm2aa8nn6.RR1iidd3el6er3,r, Assistan Assistant Fire Fire Chief Chief foman_S6255@hotmail com 320-289-1363 roman_56255@hotmail.com TTrraaiinniinngg LLooccaatitioonn:: AAAppppppllleeetttooonnn PPuubblliicc W Woorrkkss bbuulilddiinngg,, 442277 SS.. MMuunnsstteerrmmaann SSttrreeeett,, Appleton TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y);): 262650.97, 262669.97, 500897271 5008972.71 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: AAClRRaA-sAFsFF&FF:F::AnAAsnnussluulSliliteeve33xx03 Class A: Ansul Silv-ex FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: SSeemmi-AAnnnnuualalllyy FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: GGrroouunndd AAnnnnuuaall ffooaamm uussee:: AACRlRa--sAAsFFFAF:EF::LeLLseesssssthttahhnaann151155gagglaallolllnoosnnss Class A: Less than 15 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: PoPommmmeeddee TTeerrrreeRRiviveerrllooccaatteedd aapppprrooxxiimmaatteelyly0.40.4 mmiileess eeaasstt Nearest wetland: Nearest wetland: 1/8 to 16 mil east 1/8 to 1/4 mile east NNeeaarreessttwwaatteerrwwelelll:: `AApppprrooxxiimmaatteellyy 11//44 memile ssoouutthheeaasstt Nearest Wellhead Protection Area: None within one mie Nearest Wellhead Protection Area: None within one mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilce SITE RANKING: " SITE RANKING: 11 22223333..00226688 STSATATTEE0_208282277008800 SSiittee NNaammee:: FFiirree DDoeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY BBeemmiidiji AAiirppoorrtt TTrraaiinniinngg SSiittee B5BemeimSdtijdriejieFtFii&reeADDmeeeprpaiarcrttammAeenvntetnue Bema, MN 56601 5th Street & America Bemidji, MN 56601 Avenue 2DDi1icc8kk.7SS5aa1tt.hh8ee0rr0s,1, Fire Fire Chief Chief 218-751-8001 TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: CC(llaaCssssl8ABafffosooaaamsmmttrrraaaiiinnniiningnggaatits BBueesmmeidiaddjji AAhpieroporRrtat load Steet sie) (Class A foam training is used at the Railroad Street site) 35445025, 52635583 354450.23, 5263558.3 CCClllaaassssss BAB: AAAFFnFFsF:u:l 3S3iMMv-LLeiiggxhhtt WWaatteerr Class A: Ansul Silv-ex AAnnnnuuaallllyy 551to0 1100 ggaallloonnss GGrroouwnnd AAClFFaFFsF:s:4aa-ppp1pr5rooxgxiaimmllaaotnteesl.lyy 55 ggaalllloonnss. Class A : 15 gallons EEcckkleess LLaakkee llooccaatteedd aapppprrooxxiimmaatteellyy 11//44 mmiillee ssoouutthhwweesstt AASdodjujaatcctewenentsttnnoorrtthh ooff tthhee arfed air field aanndd aapppprrooxxiimmaatteellyy 111/44 mmiilee southwest SSiittee iiss nnott llooccaatteedd iinn aa kkaarrsstt aarreeaa.. On-site at airport On-site at airport CClalssBaBtrtrasaiinnisinngg ssiitet llooccaatteedd wwiitthhiinn WWeellllhveeaadd PPrrootteeccttiioonn AArrceaa. Less than 1 mie Less than 1 mile 226 22223333..00226699 STATE02827081 STATE_02827081 Site Nome: Site Name: FiFriree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY Blackhoo! Blackhoof B1B7la5lc7kVhaaololcfeFFyikvrireieeDhwDeepRopaoarartodtmmeefnntt Bamum, MN 55707 1757 Valleyview Road Barnum, MN 55707 2RR1oo8yy-cc3ee64LL-aa4ttt9u,6,3FFiirree CChhiieeff Toyce atuugmsn com 218-384-4963 royce.lattu@msn.com TTrraaiinniinngg LLooccaatitioonn:: 33114488 CCoouunnttyy RRooaadd 55,, BBaarrnnuumm Training Location Coordinates (XY): 5352526, 515667155 Training Location Coordinates (X,Y): 535252.6, 5156671.55 TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FF-5050bbyy0HHaazz0aarrdd CCoonnttrrooll TTeecchhnnoollooggyy ((HHCOTT)) FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: `SSeemmi-AAnnnnuaulalllyyaassooff FFaallll 22000077;; nnoo ffooaamm uussee pprriioorrttoo FFaallll 22000077 FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground Ground AAnnnnuuaall ffooaamm uussee:: HHCCTT FF5-0500:0:22 ggalallloonnss. NNeeaarreesstt ssuurrffaaccee wwaatteerr:: EElIIlsstrtoomm LLaakkee llooccaatteedd aapppprrooxxiimmaatteellyy 11//33mmilileennoorrithwweesstt Nearest wetland: Nearest wetland: Approximately 113 mie west Approximately 1/3 mile west KKaarrsstt AArreeaa:: SSiitoeiiss nnoott llooccaatteedd iinana kkaarrsstt aarreeaa.. Nearest water wall: Nearest water well: Less than 1/4 mike southviest Less than 1/4 mile southwest Nearest Wellhead Protection Area: None within 1 mie Nearest Wellhead Protection Area: None within 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: More than 1 mic More than 1 mile SSIITTEE RRAANNKKIINNGG:: 7 22223333..00227700 STSATATTEE0_208282277008822 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY BBrreecckkeennrriiddggee 4BB2rree0cckNkeeenbnrrriiaddsggkeeaFFAiivrreeenDDueeep.paarrttmmeenntt Breckenridge, 420 Nebraska Breckenridge, IN 56520 Avenue MN 56520 B2Br1raa8dd.6WW4a3al.lll6, 9AA1ss0ssiisstiaannt Fire Fire Chie! Chief 218-643-6910 TTrraaiinniinngg LLooccaatitioonn:: 11331122 MMiinnnneessoottaa AAvveennuuee,, BBrreecckkeennrriiddggee TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y);): 222244223322.6689,, 55112296557744.9911 TTyyppee ooff ffooaamm uusseedd iinn ttraaiinniinngg:: AACFlFFaFsFFs::4:CChhCoehmmoggmuugaaurraddrd Class A: Chemguard FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: 551to0 1100 ggaallloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Som sever Storm sewer AAnnnnuuaall ffooaamm uussee:: AAClFFaFFsF:s:A55:ggaatglolaolrnlsosns, Class A: 5 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: OOtttteerttaalil RRiivveerr llooccaatteedd aapppprrooxxiimmaatteellyy 33/44 t1o0 11 mmiilee eeaasstt NNeeaarreesstt wweettllaanndd:: AApppprrooxxiimmaatteellyy 11 mmiillee eeaass:t Karst Area: Karst Area: Stes not located ian karst area. Site is not located in a karst area. NNeeaarreessttwwaatteerrwwelelll:: AApppprrooxxiimmaatteellyy 111/33 mmiilee ssoouutthmweesstt Nearest Wellhead Protection Area: More tha1n mie. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilce SITE RANKING: 7 SITE RANKING: 7 22223333..00227711 STSATATTEE0_208282277008833 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY Bufo Buffalo LLaakkee 2BBu1uf2fffaaCllooo nLLiaakakeeFAiFvierenuDDeeepNpaaErrttmmeenntt Bulfalo Lake, MN 55313 212 Central Avenue NE Buffalo Lake, MN 55313 GG3a2ya0ly8lee3D3D.ee2a3l,7FaFi4rireelGCrih.eieff bidrechiei@homail com 320-833-2374 blfdfirechief@hotmail.com TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: 3S3t11r55eeNNt.s.,MMBaauiifnnfaSSlttorreeLeeat,k, enneeaarr intersection intersection of of Main Main and and Church Church Streets, Buffalo Lake 337711999988.4.477,, 449955551199009.988. AAClFFaFFs:Fs:A33:MMAnLLgiigguhhstt WHWiaa-ttCeeorrmbat Class A: Angus Hi-Combat BBii--AAnnnnuusallllyy LLeessss tthhaann 55 ggaatlloonnss. Ssttoormm sseewveerr AACFlFFaFsFFs::&L'Loes5ss1s0tth1haa0nng55algglaaolnlllsoonnss Class A: 5 to 10 gallons OOtteterrttaalil RRiivveerr llooccaatteedd aapppprroosxiimmaatteellyy 33/44 ttoo 11 mmiilee eeaasstt AApppprrooxxiimmaatteellyy 11 mmiilee ecaasstt SSiittee iiss nnott llooccaatteedd iinn aa kkaarrsstt aarreeaa.. `AApppprrooxxiimmaatteellyy 111/33 mmiilee ssoouutthhwweesstt Noro within1 mie None within 1 mile Less than 122 mile Less than 1/2 mile 1s 15 22223333..00227722 STSATATTEE0_208282277008844 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY Bumsuile Burnsville B1Bu0um0msiCsiivvliillceeFGFieinreeteDDreePppaaarrrtktmmweaenyntt Bumsulle, MN 55357 100 Civic Center Parkway Burnsville, MN 55337 D9D5aa2nn.8HH9oov5ve.e,4,5AA7ss2ssiissttaanntt Fire Fire Chief Chief dan hove@ei bumsvile mn us 952-895-4572 dan.hove@ci.burnsville.mn.us TTrraaiinniinngg LLooccaatitioonn:: TTEraraagiiannniin.ngglfofaacccaiitliietydy ojaotniniltnlytyerooswwencnteeiddonbbyoyfCBBuiurrfrnsswRvioillaleed,, AAapnppdplRleeivVVeaarllleeRyyidgaaenn.dd Boulevard, Bumswile Eagan, located at intersection Boulevard, Burnsville of Cliff Road and River Ridge TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 477488.56, 4058806.18. 477488.56, 4958896.18 TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: AAClRRaA-sAFsFFAFF:F:A:nAAssnusluulSl AAeTTxCC 331/68 Training Class A: Training Foam: Ansul Foam: Ansul (istorc Silv-ex Ansul (historic uussee)) FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: 551to0 1100 ggaallloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: GGrroouunndd AAnnnnuuaall ffooaamm uussee:: ClAAaRRsA-AsFFFAFFF:1: 466000gggaaallllllooonnnsss Training Class A: Training Foam: 55 galons 140 gallons Foam: 55 gallons ((hsisttoorriec uussee)) Nearest surface water: Nearest surface water: An unnamed Gntermitent) stream ess than 1/4 milo cast An unnamed (intermittent) stream less than 1/4 mile east Nearest wetland: Nearest wetland: Less than 1/8 milwestnorthwest Less than 1/4 mile west-northwest Karst Area: Karst Area: SinotitreethaawppeppseetaarcrssomttooerbboeeflloDoccaaakttoeetddaiinnCossummnatalylll.rareeaa ooff aatcitivvee kkaarrsstt nintthhee northwest corner of Dakota County NNeeaarreesstt wwaatteerr wweellll:: LLeessss tthhaann 11//48 mmiillee ttoo tthhee nnoorrtthh--nnoorrtthheeaasstt aanndd oto tthhee ssoouutthwweesstt Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: TTrraaiinniinngg ssiitee llooccaatteedd wwiitthhiinn WWPPAA NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilee SSIITTEE RRAANNKKIINNGG:: z23 22223333..00227733 STSATATTEE0_208282277008855 SSIITTEE SSUUMMMMAARRYY SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: CCaassss LLaakkee CBGaoasxsss82LL0aakkee VVoolluunntteeeerr FFiirree DDeeppaarrttmmeenntt Cass Lake, Box 824 Cass Lake, IMNN 5566663333 TT2i1imm8o.ot3thh3yy5R.Re6ie1pi8pi5lninggere,r,FFitiree CChhiieeff Givegarg net 218-335-6195 clfire@arvig.net TTrraaiinniinngg LLooccaatitioonn:: RRaaiillrrooaadd irigghhtt-.oof-fwwaayy bbyy8 RRaalillrooaadd SSttrreeeett NNWW,, CCaassss LLaakkee TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 337788442269..6644,, 552244883377007.755. TTyyppee ooff ffooaamm uusedsiinntterraaiinndiinngg:: AACFlFFaFsFFs::8AA: nnSggiuuvssoFFxiirrsstt SSttrriikkee Class B: Silv-ex FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: 551to0 1100 ggaallloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground Ground AAnnnnuuaall ffooaamm uussee:: AAARFFAFFFF:F: F00.1to00551g0gaa5lglllaoolnnlssons Class 5:2010 25 gallons. AR-AFFF: 0 to 5 gallons Class B: 20 to 25 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: FoFoxxCCrreeeekk llooccaatteedd bbeettwweeeenn 117/22 aanndd 221/33 mmiillee ssoouutthh NNeeaarreesstt wweettllaanndd:: BBeettwweeeenn 117/22 aanndd 22/13 mmiiloe ssoouutthh Karst Area: Karst Area: Sieis nt located ian karst area Site is not located in a karst area Nearest water well: Nearest water well: Less than 1/8 mile northeast Less than 1/4 mile northeast Nearest Wellhead Protection Area: More than 1 mic. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: LLeessss tthhaann 11/84 mmiillee SITE RANKING: 1 SITE RANKING: 13 22223333..00227744 STATE02827086 STATE_02827086 SSIITTEE SSUUMMMMAARRYY SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: CCllaarreemmoonntt CCBlolaaxrreDemmoonntt FFiirree DDeeppaarrttmmeenntt CCBlolaaxrreeDmmoontn,t, MMNN 5555962244 JJSeeofrfff-CC5o2ow8we.le2ll7l,0221nd AAssssiissitssaanntt FFiirree CChheieff TTrraaiinniinngg OOfffficeerr 507-528-2701 TTrraaiinniinngg LLooccaattiioonn:: In foonfftr hall on Front Street, Claremont In front of fire hall on Front Street, Claremont TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 550000000023..9959,, 44887766776911..6677 Type of foam usinterainding: Type of foam used in training: ARAFFF 3M AR-AFFF: 3M FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: 55 ggaatlloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Storm sewer Storm sewer Annual foam use: Annual foam use: AACRlR-a-sAAsFFFAFF:F:: AAgapplploprnosrx,imoaxteilym22a00tggaeallllloonnyss Class A: 5 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: IIntteerrmmiittteenntt ssttrreeaamm 11//44 ttoo 117/22 mmlilee ssoouutthheeaasstt NNeeaarreesstt wweettllaanndd:: MMoorree tthhaann 11 mmiilee KKaarrsstt AArreeaa:: SSiittee llooccaatteedd iinn ttrraannssiittiioonnoorrccoovveerreedd kkaarrsstt aarreeaa Nearest water well: Nearest water well: Less than 1/8 mike southviest Less than 1/8 mile southwest NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: MMoorree tthhaann 11 mmiilee NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: Sites located within a SWAA. Site is located within a SWAA SSIITTEE RRAANNKKIINNGG:: 223 22223333..00227755 STATE02827087 STATE_02827087 SSIITTEE SSUUMMMMAARRYY SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoonntatactc:t: CCoottttaaggee GGrroovvee CC8o6to4ttt1aa3gg0ee"GGrSrootvveeeeFFit5irr.ee DDeeppaarrttmmeenntt Cottage Grove, MN 8641 80th Street S. Cottage Grove, MN 5555001166 B6Bo5o1bb.B4By5ey8re.lrl2yy6.,6FF0iire CChhiieeff 651-458-2880 TTrraaiinniinngg LLooccaattiioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddnnaatteess ((XX,,YY)):: Type of foam usinterainding: Type of foam used in training: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Annual foam use: Annual foam use: Nearest surface water: Nearest surface water: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: NNeeaarreesstt wwaatteerr wwaellll:: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeWaW:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: FFiiree SSttaattiioonn 22,, 88664411 80 SSttrreeeettS,.,CCototttaaggee GGrroovvee: 80th 505308.85, 4984453.13 505306.85, 4964453.13 ARAFFF 3M AR-AFFF: 3M VVeerryy sseellddoomm LLeessss tthhaann s5 ggaatlloonnss Ground Ground CAAlRRa-s-AAsFFAF:FFF:3:055gggaaalllolloonnnsss Class A: 30 gallons Itermitent stream ess than 114 mitolthee east Intermittent stream less than 1/4 mile to the east LLeessss tthhaann 11//48 mmiille 0to tthhee eeaasstt TTSroraauiitnnhiinwngegssstiietterenaaWppappseeaharirssngttotoobbneeCiionuaancctttyiivvee kkaarrsstt aarreeaa aalloonngg tthhee irivveerr iinn southwestern Washington County 17210 34 mi west 1/2 to 3/4 mile west Training sie is ino adjacentfo a WPA Training site is in or adjacent to a WPA More than 1 mic More than 1 mile z27 22223333..00227766 STSATATTEE0_208282277008888 SSIITTEE SSUUMMMMAARRYY Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: Dunnel Dunnell DPDuOunnBnnoeelxlIk-LL2aa1k6kee FFrreemmoonntt FFiirree DDeeppaarrttmmeennt Duell PO Box Dunnell, MN216 MN 5586112277 AA5l0laa7nn.6HH9ee5ll.mm2ere9st5s,0, Fie Fire Chief Chief 507-695-2950 TTrraaiinniinngg LLooccaattiioonn:: OOlid bbaallll ddiiaammoonnd,dN,N..SSeeaelleeyy AAvveennuuee,, DDuumnnneelll TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 335586558600..6644,, 44682244772211 Type of foam usinterainding: Type of foam used in training: AFFF: Specifiaed Silex, assumed unidentified AFFF: Specified as Silv-ex, assumed unidentified FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: LLeessss tthhaann s5 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground Ground Annual foam use: Annual foam use: AACFFFFlFFA((aSS(hiSlvvsi--eeexxs)t/uu:nniid2deengntatifeliedo)dn:)s:2200 ggaallolonnss. Class A (Silv-ex): 2 gallons Nearest surface water: Nearest surface water: Itermitent stream 1/4 to 113 mie to the southeast Intermittent stream 1/4 to 1/3 mile to the southeast NNeeaarreesstt wweettllaanndd:: 11//441to0 11/33 mmiilee 0to hthee nnoorrtthheeaasstt KKaarrsstt AArreeaa:: SSiitteeiss nnott llooccaatteedd iinn aa kkaarrsstt aarreeaa.. Nearest water well: Nearest water well: 1/310 12 mie southeast 1/3 to 1/2 mile southeast NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: MMoorree tthhaann 11 mmiilee NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: Less than 14 mie Less than 1/4 mile SSIITTEE RRAANNKKIINNGG:: 0 22223333..00227777 STSATATTEE0_208282277008899 SSIITTEE SSUUMMMMAARRYY SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: EElIlIssbbuurrgg E1El1IiI0ss2bbuuMrrgignVVkoolRluuonandtte.eeerr FFiirree DDeeppaarrttmmeenntt Cotton, MN 55724 1102 Mink Road Cotton, MN 55724 B2Br1raa8d.dy4y8MM2i.lile3ler7,r7, 7AAssssiissttaanntt FFiiree CChhiieeff 218-482-3777 TTrraaiinniinngg LLooccaattiioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): Type of foam used in training: Type of foam used in training: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Annual foam use: Annual foam use: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SITE RANKING: SITE RANKING: Melrudo Firo Hal, 1763 Molrudo Road, Melrude Melrude Fire Hall, 1763 Melrude Road, Melrude 554444008856..7766,, 55223322668844..5577 AFFF:US. Foam) AFFF: U.S. Foam AAnnnnuuaallllyy LLeessss tthhaann s5 ggaatlloonnss. Ground Ground AAFFFFFF:: nnoott ssppeecciiffiieedd UUnnnnaammeedd ccrreeeekk lleessss tthhaann 11//44 mmiillee ssoouutnh LLeessss tthhaann 11//46 ssoouutthh aanndd ssoouutthheeaasstt SSiitee iiss nnoott llooccaatteedd iinn aa kkaarrsstt aarreeaa.. 172161 mi northeast 1/2 to 1 mile northeast More than 1 mi More than 1 mile More than 1 mie More than 1 mile 9 22223333..00227788 STATE02827090 STATE_02827090 SSIITTEE SSUUMMMMAARRYY SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: EEvvaannssuviilllee EPEvvOaannBssovvxiilll3ee67FFriree DDeeppaarrttmmeenntt Evansvile, MN PO Box 367 Evansville, MN 5566332265 TT3i2im0m-AA8n3nd4de-er4rss9oo5nn5,, 22n~ AAssssiissttaanntt FFiiree CChhiieeff 320-834-4995 TTrraaiinniinngg LLooccaattiioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XX,,YY);): TTyyppee ooff ffooaamm uusedsiinnttreraaiinnidinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: BsBaeechhii(nnoddefwiirreoaddhhaialtlli,l,on11,0068eaSSstttaaoltefe tSSottwreene,ett,e, aEEsaatssettnSSdiiddoeef AAMdaddidinittiioSotnnreiiennt)aa culge- cul-de- sac (new addition, east of town, east end of Main Street) 229622778988.3322,, 55009988001199..6611 AARR--AAFFFFFF:: NNaattiioonnaall FFooaamm UUnniivveerrssaall GGoolldd 11 1to0 33%% AAnnnnuuaallllyy 55 ggaatlloonnss Ground, storm sewer Ground, storm sewer AARRA-AFFFFEF:: nnoott ssppeecciiffiieedd IIntteerrmmiittteenntt ssttrreeaamm 11//44 ttoo 111/22 mmiilee ttoo tthhee ssoouutthh--ssoouutthheeaasstt LLeessss tthhaann 11//48 mmiilee nnoorrtthh SSiitteeiss nnott llooccaatteedd iinn aa kkaarrsstt aarreeaa.. `AApppprrooxxiimmaatteellyy 117/22 mmiilee nnoorrtthhwweesstt LLeessss tthhaann 11//44 mmiillee nnoorrtthh More than 1 mie More than 1 mile "11 22223333..00227799 STATE02827091 STATE_02827091 SSIITTEE SSUUMMMMAARRYY Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: Fairmont Fairmont FPFaaOiirmmBooonxntt3F8Fi8irree DDeeppaarrttmmeenntt Faimont, MN PO Box ;386 Fairmont, MN 5565003311 NNoott pprroovviiddeedd,, bbaacckk seside ooff qquueessttiioonnnnaaiiree nnoott ccoommpplleetteedd Training Training LLooccaattiioonn:: Citityy sshhoopp ppaarrkkiinngg lloott., 441177 EE.. MMaarrggaarreett SSttrreeee,t, FFaaiirrmmoonntt TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 338822662288.441,1,44883366333300.6655 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttyyppee nnoott ssppeecciiffiieedd FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: QQuuaatrteedrlyy FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: LLeessss tthhaann s5 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground Ground Annual foam use: Annual foam use: NNoott ssppeecciiffiieedd NNeeaarreesstt ssuurrffaaccee wwaatteerr:: BBuulfffaalloo CCrreeeekk aapppprrooxxiimmaatteellyy 111/88 mmiilee tto tthhee nnoortthh Nearest wetland: Nearest wetland: `AApppprrooxxiimmaatteellyy 11/88 mmiilee nnoorrtthh KKaarrsstt AArreeaa:: SSiitee iiss nnoott llooccaatteedd iinana Kkaarrsstt aarreeaa.. NNeeaarreesstt wwaatteerr wweellll:: 11//331to0 117/22 mmiilee ssoouutthh Nearest Wellhead Protection Area: More than 1 mic. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: More than 1 mie More than 1 mile SITE RANKING: 2 SITE RANKING: 21 22223333..00228800 STATE02827092 STATE_02827092 SSIITTEE SSUUMMMMAARRYY SSiittee NNoammee:: FFiirree DDoeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: FFrriiddlleeyy 8FFr4rii3dd1lleeyyUnFFiiirrveeerDDseeippaaArrvttemmneeunnett NE Fridley, MN 55432 6431 University Avenue Fridley, MN 55432 NE JJ7oo6hh3nn.5BB7e2er.rg,3,61FFi0irree CChhiieelf bergi@e ridley mn.us 763-572-3610 bergj@ci.fridley.mn.us TTrraaiinniinngg LLooccaatitioonn:: N3No0or0rtt7hh1MM"eAetvtrreoonFFuieirre,s TTFrrraaiiindneiinnygg CCeenntteerr 300 71st Avenue, Fridley Training Location Coordinates (XY): 478469.41, 4993724 27 Training Location Coordinates (X,Y): 479469.41,4993724.27 TTyyppee ooff ffooaamm uusedsiinntterraaiinndiinngg:: AARRA-AFFFFFF:: 33MM ((hriissttoorricc)) FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: NNoott vveerryy oofldteenn FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaalllloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: RReetteennttiioonn ppoonndd AAnnnnuuaall ffooaamm uussee:: ClAAaRR-s-AAsFFAFF:FF:a: mhioissuotnortriccnoaatmmsoopuuencntitfnnieoodt ssppeecciiffiieedd Class A: amount not specified NNeeaarreesstt ssuurrffaaccee wwaatteerr:: RiRciceeGCrreeeekk lleassss tthhaann 11//44 mmiilee tfoo tthhee ssoouutthh--ssoouutthheeaassit NNeeaarreesstt wweettllaanndd:: LLeessss tthhaann 11//48 mimile ssoouutthheeaasstt KKaarrsstt AArreeaa:: SSMiiitseesiaasppspippeepaairrssRittvooerbbee iinnaartraannsitiosnoiorrcicoovvoeerrneedd Kkaarrsstt aarreeaa aalloonngg tthhee. Mississippi River Nearest water well: Nearest water well: Less than 1/4 mil northwest Less than 1/4 mile northwest Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: TTrraaiinniinngg ssittee llooccaatteedd wwiitthhiinn WWPPAA NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: LLeessss tthhaann 11 mmiiloe SITE RANKING: 2 SITE RANKING: 28 22223333..00228811 STSATATTEE0_208282277009933 SSIITTEE SSUUMMMMAARRYY Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatacct:t: Glenvlle Glenville GGGllloeennnvvivlillelee, FFMiirrNee DD5ee6pp0aa3rr8ttmmeenntt Glenville, MN 56036 CC5r0raa7ii-gg44RR8aa-yy3mm9a1an6n,, FFiirree CChheietf raymancg@geschools com 507-448-3916 raymanc@g eschools.com TTrraaiinniinngg LLooccaattiioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): Type of foam used in training: Type of foam used in training: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Annual foam use: Annual foam use: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: NNeeaarreesstt wwaatteerr wweellll:: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SITE RANKING: SITE RANKING: HHiigghh sscchhooooll ffooocttbbaalll fs, field, GGlleennvvililllee 447777778686..0089,, 44882233777790.7755 ARAFFF: Ansul AR-AFFF: Ansul AAnnnnuuaallllyy LLeessss tthhaann s5 ggaatlloonnss. Ground Ground AARRA-AFFFFFF:: lleessss tthhaann 5$ ggaalllloonnss. RRoocckk RRiivveerr lleessss tthhaann 11//44 mmiilee ttoo tthhee eeaasstt eto 1/4 to 11/22 mmiilee eeaasstt TTrraaiinniinngg ssittee sis llooccaatteeddiinn aa ttrraannssiittiioonn oorr ccoovveerreeddkkaarsrstt aarreeaa. LLoessss tthhaann 11/84 mmiille wweesstt More than 1 mi More than 1 mile More than 1 mie More than 1 mile 1s 13 22223333..00228822 STSATATTEE0_208282277009944 SSIITTEE SSUUMMMMAARRYY SSiittee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: GGoollddeenn VVaalllleeyy GG7o8ol0ldd0eeGnnolVVadalelllneeyyVFaFilirleeyDDReepopaaardrttmmeenntt Golden Valley, MN 7800 Golden Valley Golden Valley, MN 55427 Road 55427 M7M6aa3rr.kk5KK93uu.hh8nn0yly8,,0FFiirree CChhiieeff muni @ci gokden-valley mn us 763-593-8080 mkuhnly@ci.golden-valley.mn.us TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess:: TTyyppee ooff ffooaamm uusseedd iinn ttraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: 77880000 GGoollddeenn VVaalllleeyy RRooaacd,, GGooklddeenn VVaalllleeyy 4477002255775.511,,44998811447744.3322 AAClRRaA-sAFsFFAFF: F:A: nAAgnungsguuss. Class A: Angus SSeemmAi-nAnnunaulalllyy 551to0 1100 ggaallloonnss `SSttoorrmm sseewweerr., ggrroouunndd ClAAaRRsA-AsFFFAF:FF.5:022g00algglaaollllnoosnnss Class A: 50 gallons BBaasssseettt CGrreeeekk lleessss tthhaann 11//44mmililee 1to tthhee nnoorrtthh--nnoorrtthhwweesstt 11/d4 ttoo 117/22 mmiilee ssoouutthhwweesstt TTKarrraasiintniinangrgessaittee aappppeeaarrss ttoo bbee llooccaatteedd nin aa ttrraannssiittiioonn oorr ccoovveerreedd karst area Less than 18 mil north and south Less than 1/8 mile north and south TTrraaiinniinngg ssiitee iiss llooccaatteedd iinn aa W WPPAA LLeessss tthhaann 11 mmiiloe 222 22223333..00228833 STSATATTEE0_208282277009955 SSIITTEE SSUUMMMMAARRYY SSiittee NNoammee:: FFiirree DDoeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: HHaammbbuurrgg H1H8aa1mmbBbururorggadFFwiirraeeyDDAeevppeaanrruttmemeenntt Hamburg, MN 181 Broadway Hamburg, MN 55338 Avenue 55339 9BB5rra2ad.d4DD6r7roo.ee3gg2ee,3,2FFiirree CChhiieeff baroeges00@aol com 952-467-3232 bdroege500@aol.com TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XX,,YY):): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: Nearest surface water: Nearest surface water: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: 118811 BBrrooaaddwwaayy AAvve.e,., HHaammbbuurrgg 442233114466.66,, 44995533662200..9966 AARRF-FFFFFPP:: AAnngguuss AAnnnnuuaallllyy LLeessss tthhaann 55 ggaaollonnss. Ground Ground AARRF-FFFFFPP:: S5 ggaalllloonnss Itermitent stream ess than 1/4 mile west Intermittent stream less than 1/4 mile west LLeessss tthhaann 11//48 mmiilee ssoouutthheeaasstt TTrraaiinniinngg ssittee sis llooccaatteedd iinn oorr nneaeraa ccaoovveerrreedd Less than dik northeast Less than 1/4mile northeast MMoorree tthhaann 11 mmiilee Less than 1 mie Less than 1 mile 11s5 kkaarrsstt aarreeaa 22223333..00228844 STATE02827096 STATE_02827096 SSIITTEE SSUUMMMMAARRYY SSiittee NNoammee:: HHaarrmmoonnyy FFiirree DDoeppaarrttmmeenntt:: ~~ HPHaOarmmBaoonxnyy34FF4iirree DDeeppaarrtmmeenntt Harmony, MN PO Box 344 Harmony, MN 5555953399 SSiittee CCoonntatactc:t: 5BBi0ill7l -HH8aan8nl6ol-on4n,6, 0FF0iirreDe CC(h5hi2iee1f1f Hal) 5h0a7r-m8o8n6y-v4i6d0@0yDah(o5o21c1oHmall) harmenyvfd@yahoo.com TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: Karst Area: Karst Area: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: F0F1iir1er3hh9aal8l,l, GMMoaariidnnoAAnvveRednn.uuee SS..,,aanndd aa bbrruusshh dduummpp,, eeaasstt ooff iinntteerrsseeccttiioonn of 139 & Gordon Rd. 579975.49, 482223109 579975.49, 4822231.09 AAClRRaA-sAFsFF&FE:F:S: iAAknn-ssouuxllittee Otner: Aqua Eco Class A: $ilv-ex Other: Aqua Eco AAnnnnuuaallllyy 55 ggaalllloonnss GGrroouunndd,, ssttoorrmm sseewweerr AAGRlRa--sAAsFFFAFFF:u:nlledosesssr tt5hhagaannll55onggasalllloonnss. Other 1 Class A: Other: 1 stickunder stick 5 gallons IInntteerrmmiittteenntt ssttrreeaamm aapppprrooxximiamtaetlye11l//y44 mmiilee Ssoouutthh AApppprrooxxiimmaatteellyy 11//44 mmiilee ssoouutthh Training sie is located in an active karst area Training site is located in an active karst area 472101 ml to the cast and to the southwest 1/2 to 1 mile to the east and to the southwest MMoorree tthhaann 11 mmiicle. Seis located in a SWAA Site is located in a SWAA 119 22223333..00228855 STATE02827097 STATE_02827097 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY HHooyytt LLaakkeess. HCHiootyyyttHLLalaalkkeess FFiirree DDeeppaarrttmmeenntt Hoyt Lakes, City Hall Hoyt Lakes, MMNN 5555775500 SS2t1tee8vw.ee22SS6it.ook2ks0s,0, 0FFiirree Chief Chief 218-225-2000 TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: Nearest surface water: Nearest surface water: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: TTMreriipmplloeerbbiaaallilfDfieiellvddess,ooHrnoneyetaarLraHHkoeosyy.tt LLaakkeess ffiirree hhaallll,, 112233--111/22 KKeennnneeddyy Memorial Drive, Hoyt Lakes 564498.69,5263269.13 564498.69, 5263299.13 CCClllaaassssss 4AA-:8-BHAinHsiuEElxxtppeaannssioionn:: JJeott-xx CCCOtlllhaaaesssrsss: AAA:D:: aASSwininlkvs--udeeliixxtseh soap. Other: Dawn dish soap BBii--AAnnnnuusallllyy LLeessss tthhaann 55 ggaatlloonnss. Grou Ground AAClRRaC-sAAsFFF4FF-F:8: HlleiessEssxttphhaaannnsi55ogng:aallloonngssallons Class Class Class &: 20 gallons. A-B Hi Expansion: A: 20 gallons 5 gallons CCoollbbyy LLaakkee lleosss tthhaann 11//44 mmiilee nnoorrtthh LLeessss tthhaann 11//48 mmiillee nnoohrtnho-nrotrhtheeaasstt Sie is nt located ian karst area, Site is not located in a karst area. Less than 18 mil wost Less than 1/4 mile west MMoorree tthhaann 11 mmiiele. More than 1 mie More than 1 mile "11 22223333..00228866 STSATATTEE0_208282277009988 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY HHuuggoo-- 114400t"h SSttrreeeett NN.. H5H3uu2gg3oo 1FFi4irr0eeDDSeetppararetrtemmNet.netn.t Hugo, MN 5323 140th Hugo, MN 55038 Street 55038 N. 6RR5ao1nn.4GG2rra5ay.y.6,F3iF6ri8reeFFigighhtteerr hugio@comeastnet 651-429-6366 hugfd@comcast.net TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates 0CY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: 55222233 1"144001t0h SSUt.NN.., HHuuggoo 50013417, 5000140.01 500134.17, 5000140.01 AAClRRaA-sAFsFFAFF: F:A: nAAgnnuggsuuss Class A: Angus BBii--AAnnnnuusallllyy 551to0 1100 ggaallloonnss GGrroouunndg AACRlRa--sAAsFFF&F:FF::11110002ggaaglllalolonlnsosns Class A: 1 to 2 gallons IInntteerrmmiittteenntt ssttrreeaammlelessss tthhaann 111/44 mmiillee eeaasstt Less than 1/8 mie east Less than 1/4 mile east TTrraaiinniinngg tes site is llooccaatteedd iinnaa ttrraannssiittiioonnoor ccoovveerreeddkakarrssttaarreeaa.. Less than 14 mile noth and south Less than 1/4 mile north and south Loss than 1/4 mi north Less than 1/4 mile north Less than 1 mie Less than 1 mile 119 22223333..00228877 STATE02827099 STATE_02827099 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY HHuuggoo-- FFaabbllee CCoouurrttN.. H5H3uu2gg3oo 1FFi4irr0eeDDSeetppararetrtemmNet.netn.t Hugo, MN 5323 140th Hugo, MN 55038 Street 55038 N. 6RR5ao1nn.4GG2rra5ay.y.6,F3iF6ri8reeFFigighhtteerr hugio@comeastnet 651-429-6366 hugfd@comcast.net TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: 44663300 FFaabbllee RRdd CCLt.NN.., HHuuggoo 449988773355.3.344,, 44999959336666..1190 AAClRRaA-sAFsFFAFF: F:A: nAAgnnuggsuuss Class A: Angus BBii--AAnnnnuusallllyy 551to0 1100 ggaallloonnss GGrroouunndg AACRlRa--sAAsFFF&F:FF::11110002ggaaglllalolonlnsosns Class A: 1 to 2 gallons CClleeaarrwwaatteerr GCrreeeekk 110 1/4 to 117/22 mmiilee eeaasstt Less than 18 mile west Less than 1/4 mile west TTrraaiinniinngg tes site is llooccaatteedd iinnaa ttrraannssiittiioonnoor ccoovveerreeddkakarrssttaarreeaa.. Less than 14 mile noth and south Less than 1/4 mile north and south TTrraaiinniinngg ssiitee iis llooccaatteedd iinn aa W WPPAA More than 1 mie More than 1 mile 22O 22223333..00228888 STSATATTEE0_208282277110000 SiStitee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY HHuutchtinsconh-3iAAnvveesnnuuoeeSSnEE. - 3rd 2HHu0ult5cchh3iinnAssvooenn. FFSiirrEee DDeeppaarrttmmeenntt Hutchinson, 205 3rd Ave. Hutchinson, MNSE MN 5555335500 JJ3aa2mm0e2e3ssP4Po.po5pp6p,5,B3BaatttatlioanClChohiieneff JpoPp@Ci hutchinson mn.us. 320-234-5653 jpopp@ci.hutchinson.mn.us TTrraaiinniinngg LLooccaatitioonn:: 220055 35rrdd AAvv.. SSEE., HHuuttcchhiinnssoonn TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y);): 339911887733.3.344,, 44997711551155.9911 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: AAARFF-FFA:FF:F33FM:0 LL3iiMgghhtLtiWWgahatteteWrar,,tehhrii,ssttoohrriiiscctouurssieec use AClRa-sAsFAF:FA:n3sMulLSighkt W,atceurr, ehnitstoursice use Class A: Ansul Silv-ex, current use FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: QQuuaatrteedrlyy FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground, storm sewer Ground, storm sewer AAnnnnuuaall ffooaamm uussee:: AAARFFCFFEAF.F:FlFlee:sssslttohhsaasnnth11a00ngg1aal0llogonansls,l,onihsi,sstothiroisctouurssiece. se ClassA: 10gallons, AR-AFFF: less than Class A: 10 gallons, current use 10 gallons, historic current use use Nearest surface water: Nearest surface water: CCrrooww RRiivveerr aapppprrooxxiimmaatteellyy 111/22 mmiilee nnoorrtthheeaasstt NNeeaarreesstt wweettllaanndd:: AApppprrooxxiimmaatteellyy 11//22 mmiilee nnoorrtthheeaasstt Karst Area: Karst Area: Sie is nt located ian karst area, Site is not located in a karst area. Nearest water well: Nearest water well: LLeessss tthhaann 11//48 mmiille ssoouutthhwweessttooff 33rd AAvveennuee ssiittee Nearest Wellhead Protection Area: 3 Avenue site located in a WPA Nearest Wellhead Protection Area: 3rd Avenue site located in a WPA NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilee SSIITTEE RRAANNKKIINNGG:: 222 22223333..00228899 STATE02827101 STATE_02827101 SiStitee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY HHuutchtinsconh--AAiddaanmmsssStSortreeneett 2HHu0ult5cchh3iinnAssvooenn. FFSiirrEee DDeeppaarrttmmeenntt Hutchinson, 205 3rJ Ave. Hutchinson, MNSE MN 5555335500 JJ3aa2mm0e2e3ssP4Po.po5pp6p,5,B3BaatttatlioanClChohiieneff JpoPp@Ci hutchinson mn.us. 320-234-5653 jpopp@ci.hutchinson.mn.us TTrraaiinniinngg LLooccaatitioonn:: 11330000 AAddaammss SS1.t. SSEE,, HHuuttcchhiinnssoonn TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 339933888844..4422,, 44996699225588..2233 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: AAARFF-FFA:FF:F33FM:0 LL3iiMgghhtLtiWWgahatteteWrar,,tehhrii,ssttoohrriiiscctouurssieec use AClRa-sAsFAF:FA:n3sMulLSighkt W,atceurr, ehnitstoursice use Class A: Ansul Silv-ex, current use FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: QQuuaatrteedrlyy FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground, storm sewer Ground, storm sewer AAnnnnuuaall ffooaamm uussee:: AAARFFCFFEAF.F:FlFlee:sssslttohhsaasnnth11a00ngg1aal0llogonansls,l,onihsi,sstothiroisctouurssiece. se ClassA: 10gallons, AR-AFFF: less than Class A: 10 gallons, current use 10 gallons, historic current use use Nearest surface water: Nearest surface water: UUnniiddeenntitiffiieedd ppoonndd lleessss tthhaann 11//44 mmiilee wweesstt NNeeaarreesstt wweettllaanndd:: 11/d4 ttoo 11/22 mmiilee ssoouutthhwweesstt Karst Area: Karst Area: Sie is nt located ian karst area, Site is not located in a karst area. Nearest water well: Nearest water well: Less than 1/8 mil cast Less than 1/4 mile east NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: 11//441to0 11//33 mmiilee nnoorrtthh NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: More than 1 mie More than 1 mile SSIITTEE RRAANNKKIINNGG:: 221 22223333..00229900 STATE02827102 STATE_02827102 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY Linwood Linwood 22LLii8nnw1wo7oooTddypFFioirreCe rDDoeeeppakarrDttmimevenenttNE Stacy. 22817 Stacy, MN 85078 Typo Creek MN 55079 Drive NE sJJ1iim2m.SS0it6oo8cc.kki1inn5go2ee4r,r, FFiirree CCaappltaiinn 612-868-1924 TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusedsiinnttearianinidinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: BBeehhiinndd ssttaattiioonn,, 2222887700 TTyyppoo CCrreeeekk DDirivvee,, SSttaaccyy 449922110011..4466,, 55002244990077..1155 AAAFRFFCFFAF:F:FS3FM:M LLSiMiggIhhtLtWiWgahtatteWerartAAeTTrCCATC: AR-AFFF: 3M Light Water ATC AAnnnnuuaallllyy 551to0 1100 ggaallloonnss Ground Ground AAARFFAFFFF:F: F551.to0151100010gggaalalllolonnlssons Class 4: 2010 25 gallons. AR-AFFF: 5 to 10 gallons Class A: 20 to 25 gallons UUnniiddeenntitiffiieeddppoonndd lloessss tthhaann 11//44 mmiilee ssoouutthnwweesstt LLoessss tthhaann 11//48 mmiille ssoouutthheeaasstt aanndd ssoouutthhwweesstt Sieis nt located ian karst area Site is not located in a karst area Less than 1/8 mil east Less than 1/4 mile east More than 1 mic. More than 1 mile LLeessss tthhaann 11 mmiiloe 223 22223333..00229911 STSATATTEE0_208282277110033 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoontnatcatc:t: SSIITTEE SSUUMMMMAARRYY LLiitttlleeffoorrkk LPLiiOttklefBfooorxrkk3FF8ii7rree DDeeppaarrttmmeenn!t Litefork, MN PO Box 387 Littlefork, MN 5566665533 M2Mi1ci8chh.a2ae7el8lL.L8aa6Cl8l6iai,r, SSeeccrreettaarryy 218-278-6666 TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: NNeeaarreesstt wwaatteerr wwaellll:: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: Fite hal, comer of McPherson and 3 Avene, Fire hall, corner of McPherson and 3rd Avenue, 45855157, 5360557 458551.57, 5360557 NNoott ssppoecciifioedd,, 33MM ffooaamm uussee aassssuummeedd AAnnnnuuaallllyy LLeessss tthhaann 55 ggaalllloonnss Som sever Storm sewer NNoott ssppeecciiffiieedd LLiitttlee FFoorrkk RRiivveer elessss tthhaann 11//44mmilileewweesstt OOnn oorr aaddjjaacceennttttoo ctraaniniinngg ssiitee TTrraaiinniinngg ssittee nnoott llooccaatteedd nin aa kkaarrsstt aarreeaa.. Oonn oorr aaddajacceennttttoo ttrraaiinniinngg ssiitee More than 1 mie More than 1 mile Less than 18 mie Less than 1/4 mile 223 Litkfork Littlefork 22223333..00229922 STSATATTEE0_208282277110044 SSiittee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoontnatcatc:t: SSIITTEE SSUUMMMMAARRYY LLoorreetttoo 2LLoo5rr9ee.tttoo MFFeiirrdeeinDDeaegpSaatrrettemmleenntt Loretto, MN 58357 259 N. Medina Street Loretto, MN 55357 JJ7ee6f3fff-LL4ee7vue6re-,r3,0AA3ss6ssiissttaannttFiFrireeCChiheieff oretiopubliworks@notmai com 763-479-3036 Iorettopublicworks@hotmail.com TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water wall: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: 259 Medina SreeN!. Loretto 259 Medina Street N., Loretto 45004523, 986331.1 450045.23, 4989331.1 AFF aM AFFF: 3M AAnnnnuuaallllyy 55 ggaatlloonnss Som sever Storm sewer 5Sggaaltlonnss IInntteermrmitetenntt ssttrreeaamm 11//44 ttoo 11//33 mmiilee AApppprrooxxiimmaatteellyy 111/48 mmiilee nnoorrtthhwweesstt SSiitoeiiss nnoott llooccaatteedd iinana kkaarrsstt aarreeaa.. 114 to 13 mi east 1/4 to 1/3 mile east Trang sie located in WPA Training site located in WPA nnoorrtthhwweesstt More than 1 mic More than 1 mile 1188 22223333..00229933 STSATATTEE0_208282277110055 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY Mankato Mankato M7M1aa0nnkkFaartotoontFFiSirrTeereDDeeetppaarrttmmeenntt Mankato, MN 56001 710 Front STreet Mankato, MN 56001 AA5l0I 7RR-aat3zt6zl7loof-ff6f,,7DD0e3eppuuttyy DDiirreeccttoorr,, FFriree aratzofi@ety.mankato. mn us 507-387-8703 aratzloff@city.mankato.mn.us TTrraaiinniinngg LLooccaatitioonn:: FFiiree ssttaattiioonn ##11,,330000 MMaaddiissoonn AAvveennuuee,, MMaannkkaattoo TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 442200770088.1.189,, 44869911557777..55 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: AAARFFAFFF:FF: F33:MM,,AhhniissgttuoorsriiccAaalllcouussseeeal, curent use AClRa-sAsFAFFA:nsAunlgSusvAelc,osceuarl,enctururesent use Class A: Ansul Silv-ex, current use FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: Analy Annually FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: 551to0 1100 ggaallloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: stom sever Storm sewer AAnnnnuuaall ffooaamm uussee:: AAARFFAFFFFEF:F5:55t1o011100100gggaalalllloonlnsso,,nshhi,issttoocrruiicrcaaellntuussueese ClassA: 5gallons AR-AFFF: 5 to 10 gallons, Class A: 5 gallons current use Nearest surface water: Nearest surface water: Minnesota River 1/210 23 mie vest Minnesota River 1/2 to 2/3 mile west NNeeaarreesstt wweettllaanndd:: MMoorree tthhaann 11 mmiillee Karst Area: Karst Area: TTrraaiinniinngg ssiittee aappppeeaarrss ttoo bbee iinn aann aaccttiivvee kkaarrsstt aarreeaa Nearest water well: Nearest water well: AApppprrooxxiimmaatteellyy 117/22 mmiikleo wweesstt NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: MMoorree tthhaann 11 mmiiele. NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: Less than 122 mie Less than 1/2 mile SSIITTEE RRAANNKKIINNGG:: 221 22223333..00229944 STSATATTEE0_208282277110066 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY MMaarrsshhaallll 2MMa0ar1rsshEhaalSlllaFFriairrteeoDDgeaeppaarrttmmeenn!t Marshal, MN 56253 201 E. Saratoga Marshall, MN 56258 M5M0aa7rr-cc53KK2ilaa.it5thh1,4 1FFiirree Chet Chief marshalfre@nw net 507-532-5141 marshallfire@iw, net TTrraaiinniinngg LLooccaatitioonn:: MMaarrsshhaallll MMeerrriritt CCeenntteerr,, CCoouunnttyy RRooaadd 3333 ((11000011 WW.. EErriee RRooaadd)) Training Location Coordinates (XY): 275985 21, 926003.45 Training Location Coordinates (X,Y): 276985.21,4928003.45 TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: AATrRRaA-iAFniFFnFFgF:f:oa33mMM:,,Tuurassieenoiinn! trraaiinniinngg nnoott ssppeocsiifieodd Training foam: Trainol FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: QQuuaatrteerrlyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: GGrroouunndg AAnnnnuuaall ffooaamm uussee:: AACRlRa--sAAsFFFAF:EF::nonntoottsspsppeececiciiiffeiiededd Training Class A: Training foam15gallons not specified foam: 15 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: OOnn oorr aaddajacceenntt ttoo sstitee. Nearest wetland: Nearest wetland: OOnn oorr aagdajacceenntt ttoo ssiittee KKaarrsstt AArreeaa:: SSiittee iiss nnott llooccaatteedd iinn aa kkaarrsstt aarreeaa Nearest water well: Nearest water well: 1d to 172 mie east 1/4 to 1/2 mile east Nearest Wellhead Protection Area: More than 1 mic. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: More than 1 mie More than 1 mile SITE RANKING: 2 SITE RANKING: 21 22223333..00229955 STATE02827107 STATE_02827107 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY MMaayynnaarrdd MPMaOayyBnnoaarxrdd1FF5ii4rree DDeeppaarrttmmeenntt Maynard, MN PO Box 154 Maynard, MN 5566226600 SS3t2tee0vv3ee6nn7.LLi2inn1ddq4qu0iusits,t, FFiiree CChhiieeff 320-367-2140 TTrraaiinniinngg LLooccaatitioonn:: MMaabbllee SSttrreeeett aanndd SShheerrmmaann,, MMaayynnaarrdd TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 330044995577..7744,, 44997755556633.3322 TTyyppee ooff ffooaamm uusedsiinnttreraaiinnidinngg:: OOCtlthahesers:r:ACChhSieimmkg-ugoauxra,drcd.u,rhheiisnstttoorruiiscceaa:ll uussee,, ttyyppee AAFFFFFF aassssuummeedd Class A: Silv-ex, current use FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: BBii-AAmnnnuuslalllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Som sever Storm sewer AAnnnnuuaall ffooaamm uussee:: ClOOtathhseers:rA: :nnootnssoptpeesccpiieffciieiedfdied Class A: not specified NNeeaarreesstt ssuurrffaaccee wwaatteerr:: UUnniiddeenntitiffiieedd ccrreeeekk 11//44 t1o0 117/33 mmlilee wweesstt NNeeaarreesstt wweettllaanndd:: 11/4 ttoo 117/22 mmiilee ssoouutthheeaasstt Karst Area: Karst Area: Sie not located in a karst area. Site not located in a karst area. NNeeaarreessttwwaatteerrwwelelll:: LeLsesss tthhaann 11//44 mmiille eeaasstt Nearest Wellhead Protection Area: More tha1n mie. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: TTrraaiinniinngg ssittee sis llooccaatteedd win within aa SSW WAAAA SITE RANKING: 12 SITE RANKING: 12 22223333..00229966 STSATATTEE0_208282277110088 SSiittee NNoammee:: FFiirree DDoeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY MMiinnnneeaappoolliiss RMMoiinonnnmeeaa2p3p0oo,llissCFiFtiiryeeHaDDleelppaarrttmmeenntt Minneapols, MN 55415 Room 230, City Hall Minneapolis, MN 55415 WW3a5ia0llt5LL.ee5ee,", GCSatapeptlata,nin,iR, oEEnonggmiinn2ee3ee0rriinngg OOffffiicceerr,, FFiiree 63MMi51in0n2nn6See7.aa3p5pot2ohl0lisSs5,t,r0eMMeoNNft,fiR55ceo55o44m1155230 6w66a111l222t.--e677r711e838.--21e1088e555999 mcocioeflnfllinlceeapolis. mn us walter.lee@ci.minneapolis.mn.us TTrraaiinniinngg LLooccaattiioonn:: 22553377t"h AAvveennuuee NNEE., MMiinnnneeaappooliliss TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 447777099933.4411, ,44998666692299..22 TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: AAClFFaFsFFs: AS3: MMAnsul Class A: Ansul FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: GGrroounngd AAnnnnuuaall ffooaamm uussee:: AAARFF-FFAF:F:FaFa:pppprnoorxtiomspxaetcieilfmyi5ea5dgtgaaeillnlosny.s ClassA: approximately AR-AFFF: not specified Class A: approximately 5 ggaalllloonnss. NNeeaarreesstt ssuurrffaaccea wwaatteerr:: MMiissssiissssiippppii RRiivveer lleessss tthhaann 11//44 imlilee wweesstt Nearest wetland: Nearest wetland: 1 to 172 mie west 1/4 to 1/2 mile west Karst Area: Karst Area: TTrraaiinniinngg ssiitee iis llooccaatteeddiinnaa ttrraannssiittiioonn oorr ccoovveerreedd kkaarrsstt aarreeaa NNeeaarreesstt wwaatteerr wweellll:: AApppprrooiximmataetellyy 117/22 mmiilee ssoouuttheeaasstt Nearest Wellhead Protection Area: More tha1n mie Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilee SSIITTEE RRAANNKKIINNGG:: 119 22223333..00229977 STSATATTEE0_208282277110099 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY MMoonntteevviiddeeoo MPMoOonBntteoevxviidd5ee1oo7 FFiirree DDeeppaarrttmmeenntt Montevideo, PO Box 517 Montevideo, MMNN 5566226655 RfRioorbbebbdeGGpiiillk@kemeyoyntevideorn. org firedept@montevideomn.org TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XX,,YY);): TTyyppee ooff ffooaamm uusedsiinntterraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: Karst Area: Karst Area: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: Fir station, 103 Canton Avenue, Montevideo Fire station, 103 Canton Avenue, Montevideo 228855000000..9911,,44998800883388..0011 AAClRRaA-sAFsFFAFF:F:A:n33sMMulLLSiigghhhtot W Wxaatteerr AATTCC 33%%--66%% Class A: Ansul Silv-ex ""WWhheenn wwee hhaavvee aaolott ooffffooaamm"" 55 ggaatlloonnss Ground Ground AAARRRCC-AAAFFFFFFFFF ((3AOMMnsuLLliigtghhett3WW)a3at)et:e)0r:):ga22lglgaoalnlllsoonnss Class A: approximately 1 AR-AFFF (Ansulite 3x3): Class A: approximately 1 galon 0 gallons gallon Crihippppeewwaa RRiivveerr elessss tthhaann 11//44 mmiillee wweesstt Loss than 14 north Less than 1/4 north Sieis nt located ian karst area. Site is not located in a karst area. 1210 1 mie southeast 1/2 to 1 mile southeast More than 1 mic. More than 1 mile MMoorree tthhaann 11 mmiilee 717 22223333..00229988 STATE02827110 STATE_02827110 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatacct:t: SSIITTEE SSUUMMMMAARRYY MMyytrltlee MMMyyyiitrttllleee,FFUrirNee DD5ee6pp0aar7rt0tmmeenntt Myrtle, MN 56070 NNoott pprroovviiddeedd Training Location: Training Location: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess:: TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Annual foam use: Annual foam use: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: KKaarrsstt AArreeaa:: NNeeaarreesstt wwaatteerr wweellll:: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SITE RANKING: SITE RANKING: Nyt Myrtle baball folfield 487058.87, 4823399.48 487068.87, 4823399.48 NNoott ssppeecidffileedd,, uussee ooff 33MM AAFFFFFF aassssuummeedd AAnnnnuuaallllyy LLeessss tthhaann s5 ggaatlloonnss. Ground Ground NNoott ssppeecciiffiieedd IInntteerrmmiittteenntt ssttrreeaamm llooccaatteedd 117/221to0 33/44 mmlilee wweesstt More than 1 mie More than 1 mile "TTrraaiinniinngg ssiitet aappppeeaarrss 0to bbee llooccaatteedd iin aannaactcitivvee kkaarrsstt aarreeaa 117/22 t1o6337/46 mmiilee ceaasstt More than 1 mic. More than 1 mile Training ses located in a SWAA Training site is located in a SWAA 222 22223333..00229999 STATE02827111 STATE_02827111 Site Name: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY Noth St. Paul North St. Paul 2NN4oor0rtt0hh MSSLa.tr. gPPaaaruuelltFFSirrieeeDDleeppaarrttmmeenntt North 2400 North St. Paul, Margaret St. Paul, MN 55108 Street MN 55109 J6J5aa1ss.oo7nn4MM7.aa2ll5in5lg2eri, DDenepuptugytyFieFrireerCChhi.ieeff jmalinger@einorthsaintpaul mn us 651-747-2552 jmallinger@ci.north-saint-paul.mn.us TTrraaiinniinngg LLooccaatitioonn:: NNoorrtthh SSt.t. PPaauull PPuubblliicc WWoorkrkss,, 22330033 11st SSttrreeeteNNt..., NNoorrtthh SStt.. PPaauull Training Location Coordinates (XY): 500221.49, 49841672 Training Location Coordinates (X,Y): 500221.49, 4984167.2 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: AAClFFaFFs:Fs:Ac33MMaMLLiiggLhhitgthW WtaaWttaeetrrer (SFFF) Class A: 3M Light Water (SFFF) FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: SSeemmai-nannnuuaalllyy FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: 551to0 1100 ggaallloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: GGrroouunndg AAnnnnuuaall ffooaamm uussee:: AAClFFaFFsF:s:455 gg1aa5lllgooannllssons, Class A: 15 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: UUnnnnaammeedd ssttrreeaamm elessss tthhaann 11//88 mmiillee nnoorrtthheeaasstt NNeeaarreesstt wweettllaanndd:: 11/144t1o011/22 mmiilee wweesstt KKaarrsstt AArreeaa:: TTrraaiinniinngg ssiitee iiss llooccaatteedd iinnaa ccoovveerreedd kkaarrsstt aarreeaa Nearest water well: Nearest water well: Less than 18 mile southwest Less than 1/4 mile southwest Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: TTrraaiinniinngg ssiittee llooccaatteedd iinn oor aacdjjaacceenntt t0o.3a WWPPAA NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: LLeessss tthhaann 11 mmiiloe SITE RANKING: 2 SITE RANKING: 28 22223333..00330000 STSATATTEE0_208282277111122 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY NNoorrtthhrroopp NPNoOorrttBhhorroxopp2FF0i8irree DDeeppaarrttmmeenntt Nortiop, MN PO Box 208 Northrop, MN 5586007755 CC5a0or7rr.rii3ee9MM6a.ar3tr2tii2nns8soonn,, Fie Fire Chief Chief 5n0i7d-i3r9e9d-p3@2y2a8hoo.com nfdfiredp@yahoo.com TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water wall: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: BBeehhiinndd fiirree hhaalll,l, 221111 NN.. BBrriiddggeemmaann,, NNoorrtthhrroopp 384230.64, 464368971 384230.64, 4843689.71 OOtthheer:r: PPyyrrooccoomm SSiticckk BBii-AAmnnnuuslalllyy LLeessss tthhaann 55 ggaatlloonnss. Ground Ground OOtthheer:r: 11 ssttiicckk ((~55 ggaalllloonnss)) Lake Charlotte, more than 1 mi southwest Lake Charlotte, more than 1 mile southwest MMoorree tthhaann 11//44 ttootthhee eeaasstt aanndd wweesstt SSiitoeiiss nnoott llooccaatteedd iinana kkaarrsstt aarreeaa.. Less than 1/8 mie southeast Less than 1/8 mile southeast Trang sie located in WPA Training site located in WPA More than 1 mic More than 1 mile "11 22223333..00330011 STATE02827113 STATE_02827113 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY PPaayynneessvviilllee BPPaoayyxnn3ee4ssvuilllee FFiirree DDeeppaarrttmmeenntt Paynesvile, Box 34 Paynesville, MMNN 5556336622 JJ3aa2cc0kk24WWi3ni.nt3eter7,r1, 4FFiirree Chie! Chief jwinter@lakedaleink net 320-243-3714 jwinter@lakedalelink.net TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusedsiinnttreraaiinnidinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: Nearest surface water: Nearest surface water: Nearest wetland: Nearest wetland: Karst Area: Karst Area: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: CCiittyy aaiirppoorrt,, PPaayynneessuviilllee 36420233, 502603925 364202.33, 5026039.25 AAClRRaA-sAFsFFAFF:F:A:nCCshuholemmSgiguulaaerrxdd(AAuRse3R%in t((ruuassieeniiinnngtrnraaoiinniisnnpggecninfooittessd)ppoecciifiieedd)) Other: Class Other: Pyrocom TS-Eco (use A: Ansul Silv-ex (use in Pyrocom TS-Eco (use In training not specified) training not specified) in training not specified) BBii--aannnnuuaallly LLeessss tthhaann 55 ggaatlloonnss. GGrroouunndg AAGRlRa--sAAsFFFAFEF::nollteessssspetichiaafnnied11 ggaallloonn Other. not specified Class A: not specified Other: not specified NNoorrtthh FFoorrkk oofftthhee CCrroaww RRiivveerr,, lleossss tthhaann 11//44 mmiillee nnoorrtthhooff aakirppoorrtt Less than 1/4 mie noth Less than 1/4 mile north Stes not located in a karst area. Site is not located in a karst area. LLeessss tthhaann 11/88 mmiille ffrroomm aaiirppoorrtt TTrraaiinniinngg ssiitee llooccaatteeddiinn aa WWPPAA More than 1 mie More than 1 mile 116 22223333..00330022 STATE02827114 STATE_02827114 SSiittee NNoammee:: FFiirree DDoeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY PPeelcicaann RRaappiiddss P7Pe0el9lii5cca"annSRRtaapepitiddssSEFFiirree DDeeppaarrttmmeenntt Pelican Rapids, MN 709 5t~ Street SE Pelican Rapids, MN 5566557722 TT2r1ree8vv-oo8r6r 3SS-tt5ee2sev1ve1ess,, Fre Fire Chief Chief pridgioretel net 218-863-5211 prid@loretel.net TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: 22d AAvveennuueeNNWWaanndd 44t"h SSrtreeeet,, PPeelliiccaann 263129.29, 516226044 263129.29, 5162260.44 AACFlFFaFFsF:s:AUU: S.AS.n.sFFuiilrsstSt SSettriixkkeo Class A: Ansul Silv-ex BBii--AAnnnnuusallllyy LLeessss tthhaann 55 ggaalllloonnss Ground. som sewer Ground, storm sewer AAClFFaFFs:Fs:455 gg5aalglllaoolnnossns Class A: 5 gallons PPeelliiccaann RRiivveerr,, lleessss tthhaann 11//48 mmiille ssoouutthh LLeessss tthhaann 11//48 mmiilee ssoouutthh SSiittee iiss nnott llooccaatteedd iinn aa kkaarrsstt aarreeaa.. Aor adjacent to taining site At or adjacent to training site TTrraaiinniinngg sisite llooccaatteeddiinn aa WWPPAA LLeessss tthhaann 11 mmiiloe 116 RRaappiiddss 22223333..00330033 STATE02827115 STATE_02827115 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY PPiieerrzz PPPiiOeerrzBzoFFxiirre3e4DD0eeppaarrttmmeenntt Plerz, MN 55364 PO Box 340 Pierz, MN 56364 Br3Bi2rai0na-n4J6aJ8ay.y6BB6oo0vx8eer,r, FFriroe CChhiieelf plerzfie@mywdo com 320-468-6608 pierzfire@mywdo.com TTrraaiinniinngg LLooccaatitioonn:: IInntteerrsseeccttiioonn ooffHHiigghhwwaayyss 2255 aanndd 2277,, PPeierzrz.. LLaasstt trraaiinniinngg iinn 22000055,. Training Location Coordinates (XY): 41425267, 5091305.4 Training Location Coordinates (X,Y): 414262.67, 5091305.4 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: ARES AFFF: 3M FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: BBai-annnnuuaalllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground Ground AAnnnnuuaall ffooaamm uussee:: ClAAaFFFsFFsF:A: :nnoolt2ss5ppegeaccliliffoiienesdd. Class A: 25 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Skunk River, fess than 1/8 mie cast Skunk River, less than 1/8 mile east NNeeaarreesstt wweettllaanndd:: LLeessss tthhaann 11//88 mimile ssoouutthheeaasstt Karst Area: Karst Area: Stes not located ian karst area. Site is not located in a karst area. NNeeaarreessttwwaatteerrwwelelll:: AApppprrooxmimataetellyy 117/44 mmiillee wweesstt Nearest Wellhead Protection Area: More tha1n mie. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: TTrraaiinniinngg ssittee llooccaatteedd iinn aa SSWWAAAA SITE RANKING: 2 SITE RANKING: 22 22223333..00330044 STATE02827116 STATE_02827116 SiStitee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY PPiinnee RRiivveerr --FFaaiirr GGrroouunnddss. PPPiiOnneeBRRoixivve4er4r4FFiirree DDeeppaarrttmmeenntt Pine River, MN PO Box 444 Pine River, MN 5566447744 K2Ke1ei8itt.hh56FF7aa.rm2n1aa3m,1, Fie Fire Chief Chief prigse74@yahoo com 218-587-2131 prfd56474@yahoo.com TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: FFaaiirr ggrroouunnddss oonn 11sstt SSrtreeee,t, PPiinnee RRiivveerr 39226283, 517526130 392262.83, 5175261.39 AAClRRaA-sAFsFFAFE:F::AnAAsnnussluulSlititecv-((euuxssee iinn rtraaiinniinngg nnoott ssppoecciifiieedd)) Class A: Ansul Silv-ex LLeessss tthhaann BBii--aannnnuuaallly 551to0 1100 ggaallloonnss GGrroouunndg AACRlRa--sAAsFFFAF:FF::3n0noogttalsslppoeencsci,iffiieedd Class A: 30 gallons NNoorrwwaayy LLaakkee oouutltleet,t, 11/441t0o 117/22 memile 1to tthhee eeaasstt 11/4 ttoo 11/22 mimile ceaasstt Sieis nt located ian karst area. Site is not located in a karst area. 1110 172 mile westofboth taining sites 1/4 to 1/2 mile west of both training sites Sie s located ine WPA Site is located in a WPA MMoorree tthhaann 11 mmiilee 10 10 22223333..00330055 STSATATTEE0_208282277111177 SSiittee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY PPiinnee RRiivveerrSScchhooooll GGrroouunnddss. PPPiiOnneeBRRoixivve4er4r4FFiirree DDeeppaarrttmmeenntt Pine River, MN PO Box 444 Pine River, MN 5566447744 2KKe1ei8itt.hh56FF7aa.rm2n1aa3m,1, Fie Fire Chief Chief prigse74@yahoo com 218-587-2131 prfd56474@yahoo.com TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: Karst Area: Karst Area: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: S`Scchhooooll ggrroouunnddss oonn 1fsstt SSttrreeeet,, PPiinnee RRiivveerr 382348.93, 5175766.55 392348.93, 5175786.55 AAClRRaA-sAFsFFAFE:F::AnAAsnnussluulSlititecv-((euuxssee iinn rtraaiinniinngg nnoott ssppoecciifiieedd)) Class A: Ansul Silv-ex LLeessss tthhaann BBii--aannnnuuaallly 551to0 1100 ggaallloonnss GGrroouunndg AACRlRa--sAAsFFFAFF:F::3n0noogttalsslppoeencsci,iffiieedd Class A: 30 gallons NNoorrwwaayy LLaakkee oul, outlet, lleessss tthhaann l1f144 mmililee eeaasstt Loss than 178 mit cast Less than 1/4 mile east Sieis nt located ian karst area. Site is not located in a karst area. 1 10 172 mie west 1/4 to 1/2 mile west AAddjjaaccenetnttoto aaWWPPAA MMoorree tthhaann 11 mmiilee 113 22223333..00330066 STATE02827118 STATE_02827118 SSiittee NNaammee:: FiFriree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY PPoorrtteerr Po5Pr0ot5reteMrraFipFrlireeeDeDpeapratrtmmeenntt Porter, UN 505 Maple Porter, MN 5566228800 5PP0aa7trc-ic2kk96VV-il4aa4mmi7in5ncckk,, Fie Fire Chief Chief 507-296-4475 TTrraaiinniinngg LLooccaatitioonn:: Fir hal, 301 Lone Tree Street, Porter Fire hall, 301 Lone Tree Street, Porter TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XX,,YY):): 224488883344.8811,,44994477226644..55 TTyyppee ooff ffooaamm uusseedd iinnttrraaiinniinngg:: ~~ AAClRRaA-sAFsFFAFF:F.:AnCCshuhelemmSghguvua-arorxdd Class A: Ansul Silv-ex FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: SSeemmAi-nAnnunaulalllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Som sever Storm sewer AAnnnnuuaall ffooaamm uussee:: ClAAaRRsA-AsFFFA:FFF.:5g55algglaaollnlloosnnss Class A: 5 gallons NNeeaarreesstt sSuLrirffaaccee wwaatteerr:: NNeaoosrrttthh Branch Branch ofthe o[the Yellow Yellow Medicine Medicine River, River, less less than than 1/4 1/4 mile. mile east NNeeaarreesstt wweettllaanndd:: AApppprrooxxiimmaatteellyy 11//44 mmiilee ssoouutthh Karst Area: Karst Area: Sie is not located ian karst area. Site is not located in a karst area. Nearest water well: Nearest water well: Approximately 1 mie northeast Approximately 1 mile northeast Nearest Wellhead Protection Area: More than 1 mic. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilee SITE RANKING: SITE RANKING: 22223333..00330077 STATE02827119 STATE_02827119 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY PPrreessttoonn PPPrrOeeBssttoooxnn F2Fi1irr6ee DDeeppaarrttmmeenntt Preston, MN PO Box 216 Preston, MN 5555996655 JJ5ee0rr7rr.yy76OOl5lss.oo3nn8,,01FFiirr(eefrCCehhhiaieelff) J555l000s777o.--77n766605550-.-2333@833c022e177nt(((fhuhiroroemymoheela))lln)et jolson002@centu rytel, net TTrraaiinniinngg LLooccaatitioonn:: 1FF2iil.llmmPoorrreeestCConoouunnty FFaaiirrggrroouunnddss,, FFiilllmmoorree SSttrreeeett && CCoouunnty HHiigghhwwaayy 12, Preston TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 74550.31, 483674238 574569.31,4835742.38 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: TAArRRaAi-AFniFFnFEgF:F:oa3amMM: Clarey's Firs Stike Training Foam: Clarey's First Strike FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: TTwwoo ttimimeess iinnllaasstt1155yyeeaarrss FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: 55 ggaalllloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Grou Ground AAnnnnuuaall ffooaamm uussee:: AAClRRaC-sAAsFFFAF:FF::5 55gagglaaollnlloosnnss Training Class A: Training Foam: 5gallons 5 gallons Foam: 5 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: SSfaooiuurtgthhrouBBnrrdaasnn.cchh ooff tthhee RRoooott RRiivveerrllooccaatteedd aaddjjaacceennttnnootrhthoofftthhee fairgrounds Nearest wetland: Nearest wetland: Adjacent eastoffacgrourds Adjacent east of fairgrounds Karst Area: Karst Area: TTrraaiinniinngg ssiitet iis llooccaatteedd iinn aann aaccttiivvee kkaarrsstt aarreeaa NNeeaarreesstt wwaatteerr wweellll:: AAtt ffaiirrggrroouunnddss Nearest Wellhead Protection Area: Less than 1/4 mie southwest Nearest Wellhead Protection Area: Less than 1/4 mile southwest NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilee SSIITTEE RRAANNKKIINNGG:: 228 22223333..00330088 STATE02827120 STATE_02827120 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY RRoocchheesstteerr 2RR0oo1cch4he"esstSteetrrreFFeiitrreeSEDD.eeppRaaorrtotmmmeen1nt0t Rochester, MN 55904 201 4tn Street SE, Room Rochester, MN 55904 10 D5D0aa7nn.3SSl2laa8vv.iin2n.8,1DD3eeppaultyy FFiirer CChhiieeff a5s0i7a-3v2i8n-g2r8o1c3hestern gov dslavin@rochestermn.gov TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: Nearest surface water: Nearest surface water: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: 2021 41 Steet NW, Rochester 2021 41st Street NW, Rochester 540539.06, 876254.12 540539.06, 4879254.12 AAClFFaFFsEFs:A:a3MM3M Other. Class Other: HCT A: 3M HCT FF--550000 eemmuluslisfifiieerr AAnnnnuuaallllyy 55 ggaalllloonnss GGrroouunndg AAClFFaFFsF:s:455 gg5aalglloaonlnslso.ns Otner: 25 gallons Class A: 5 gallons Other: 25 gallons IInntteerrmmiittteenntt ssttrreeaamm 11//44ttoo 117/33 mmiilee wweesstt 11/7221to011 mmiiloe wweesstt Training sie i located in an active karst area. Training site is located in an active karst area. Less than 1/8 mil south Less than 1/4 mile south TTrraaiinniinngg ssiitee llooccaatteeddiinn aa WWPPAA More than 1 mie More than 1 mile x25 22223333..00330099 STATE02827121 STATE_02827121 SSiittee NNoammee:: FFiirree DDoeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY SSiilvveerrLLaakkee SS30iel8verWr.LLaaMkkaeeinFFiirree DDeeppaarrttmmeenntt Siver Lake, MN 308 W. Main Silver Lake, MN 5555338811 2DDa0all3ee2KK7oo-ss2eek4k,1, 2AAssssiissttaanntt Fire Fire Chi Chief dale kosek@mehsicom 320-327-2412 dale.kosek@mchsi.com TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: NNeeaarreessttwwaatteerrwwelelll:: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SITE RANKING: SITE RANKING: LPPauukbbellicc wwoorrkkss mmaateteririaall ssttoorraaggee aarreeaa,, 330055 EE.. Lake 440055665509.1.177,, 44997722991166..5588 AAFFFFFF:: AAnngguuss TTrriddeexx AAnnnnuuaallllyy LLeessss tthhaann 55 ggaatlloonnss. GGrroouwnnd AAFFFFF:: 331t0o5 5 ggaalolonnss Siver Lake, less than 114 mile southwest Silver Lake, less than 1/4 mile southwest AApppprrooxxiimmaatteellyy 11//44 mmiilee eeaasstt Site is not located ian karst area, Site is not located in a karst area. LLeessss tthhaann 11/84 mmiille nnoorrtthheeaasstt More tha1n mie. More than 1 mile LLeessss tthhaann 11/84 mmiilee 1s 15 MMaaiinn SSttreeeelt,, SSiillvveerr 22223333..00331100 STATE02827122 STATE_02827122 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY SStt. CCllaaier SSPLt.O. CCBllaoaixirr F1Fi8irr5ee DDeeppaarrttmmeenntt St. Cla, MN PO Box 185 St. Clair, MN 5566008800 NNoott pprroovviiddeedd,, ppaaggee wtwooooff qquueessttiioonnnnaaiirree nnoott ccoommpplleetteeds TTrraaiinniinngg LLooccaattiioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): Type of foam used in training: Type of foam used in training: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Annual foam use: Annual foam use: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: TATrsraasiiennsiinnsggmeSSinitttee AiinrneSSaoo?uu:rrccee WWaatteerr Assessment Area?: SITE RANKING: SITE RANKING: Cciittyy oorf Sst.t. cCllaairr Not specified, use of 3M foam in raining assumed Net spedfied, use of 3M foam in training assumed SSoemmi-AAnnnnuaulalllyy 55tto0 1100 ggaallloonnss Stom Sewer Storm Sewer NNoott ssppeecciiffiieedd LLeeSSuueeuurr RRiivveerr llooccaatteedd aalloonngg nnoorrt[hheeaass!t ssiiddeeooff otowwnn U1te4ttoo 117/33 mmiilee oouuttssiiddee ooff ttoowwnn TTrraaiinniinngg ssiitee iiss llooccaatteedd iinnaa ccoovveerreedd ekarrsstt aarreeaa Intown In town More than 1 mi More than 1 mile No No 2 22223333..00331111 STATE02827123 STATE_02827123 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY St Cl-41o"AuvenudeN St. Cloud - 41~t Avenue N. SS1L0t..1CC1l0loo"uuddAFFviirreeenDDueeNpep.aarrttmmeenntt St. Cloud, MN 56303 101 10th Avenue N. St. Cloud, MN 56303 D3Da2an0n6WW5i0oro.hb3bb5ee2ll8,, DDeeppuytyFiFriree CChhiieeff dean wrobbelge st-cloud mn us 320-650-3528 dean.wrobbel@ci.st-cloud.mn.us TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinnggLLooccaattiioonnCCooorodrdiinnaatteess ((XXY,Y):): TTyyppeeooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: Nearest surface water: Nearest surface water: Karst Area: Karst Area: Nearest wetland: Nearest wetland: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: OOppeenn ffiieelddnneeaarr SSttaattiioonn 22,,770000 4411sstt AAvveennuuee NN.. 4400S577676.71.11,1,55004466446633..1133 AATrRRaA-iAFniFFnFFgF:F:oaCCmhh:eemmCgghuueaamrrgdduard Training Foam: Chemguard AAnnnnuuaallllyy AATrRRa-i-AAnFiFFnFFgF.F:o2a20m0:ggaal4lll0oonngassllons Training Foam: 40 gallons Groung Ground AATrRRa--iAAnFiFFnFFgF:F:o2a20m0:ggaal4lll0oonngassllons Training Foam: 40 gallons UUnnnnaammeedd ppoonndd fleessss tthhaann 111/44 mmiilee nnoorrtthhwweesstt Sie is not located ian karst area. Site is not located in a karst area. 12101 mil south 1/2 to 1 mile south 11410173 mil southwest 1/4 to 1/3 mile southwest SStitee sis llooccaatteedd iinn oor aaddjjaacceenntt t1o0aa WWPPAA.. More than 1 mie More than 1 mile 116 22223333..00331122 STATE02827124 STATE_02827124 SSiittee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY SStt.. CClould --4o455t"hAuAvevendnuuee. SS1L0t..1CC1l0loo"uuddAFFviirreeenDDueeNpep.aarrttmmeenntt St. Cloud, MN 56303 101 10th Avenue N. St. Cloud, MN 56303 D3Da2an0n6WW5i0oro.hb3bb5ee2ll8,, DDeeppuytyFiFriree CChhiieeff dean wrobbelge st-cloud mn us 320-650-3528 dean.wrobbel@ci.st-cloud.mn.us TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinnggLLooccaattiioonnCCooorodrdiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: SSttaattiioonn 44,, 11555500 4455tthh AAvveennuuee SSEE ((aaiirrppoorrtt ssitatitioonn),), SStt. CClloouudd 44113~0370.76.644,, 55004444338666 AATrRRaA-iAFniFFnFFgF:F:oaCCmhh:eemmCgghuueaamrrgdduard Training Foam: Chemguard AAnnnnuuaallllyy AATrRRa-i-AAnFiFFnFFgF.F:o2a20m0:ggaal4lll0oonngassllons Training Foam: 40 gallons Groung Ground AATrRRa--iAAnFiFFnFFgF:F:o2a20m0:ggaal4lll0oonngassllons Training Foam: 40 gallons EEmlilkkleRRsiiovvueetrlhloooccfaatSteeaddtaiallnoonn4.gg ssoouutthh ssiiddee ooff saiirrppoortr,t, aapppprrooxxiimmaatteellyy 11 mile south of Station 4. LLeessss tthhaann 11//48 mmiillee wweesstt Sie is nt located ian karst area, Site is not located in a karst area. AApppprroodxiimmaatteellyy 11 mimile ssoouutthh MMoorree tthhaann 11 mmiiele. Less than 14 mie Less than 1/4 mile 11s5 22223333..00331133 STATE02827125 STATE_02827125 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY SStt. PPaauull SS1L0t.0.EPPaauull11FFiiSrceetDDeeeptpaarrttmmeenntt St.Paul, MN 55101 100 E. 1 lth Street St. Paul, MN 55101 6CC5lla1ar.ree6nn4cc4ee.9HH1aa3ww3kkiinnss Clarence hawkins@e stpaul mn us 651-644-9133 Clarence.hawkins@ci.stpaul.mn.us TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusedsiinntterraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: Nearest surface water: Nearest surface water: Nearest wetland: Nearest wetland: Karst Area: Karst Area: NNeeaarreesstt wwaatteerr wweellll:: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: 11868833 EEnneerrggyy PPaarrkk DDirivvee,, SS.t. PPaauull 485574.76, 979985.83 486574.76, 4979985.83 AAAFRFFCFFAF:F:FF33:MM LLSiiMgghhtLtiWWgahtatteWerartAAeTTrCCA((ThsCistt(ooirrsikctouurssece))use) Class 4-3 AR-AFFF: Class A-B Hi Expansion: Kidde 3M Light Water ATC Hi Expansion: Kidde HrEx (historic Hi-Ex use) AApppprrooxxiimmaatteellyy eevveerryy 1188 mmoonnththss,,wwhheenn tthheerree iissaa rreeccrruuiitt aaccaaddeemmyy 551to0 1100 ggaallloonnss GGrroouunndg AAAFRFF-FFAF:F:FF11.55 gg1aa5llllogonanlsslons GACCllRlaaas-ssAsssFAAAF--FBB:2HHg1ii5aEEglxxa: sll1o122nsoouunncceess Other. 5gatons (Ansuito Class A: 2 gallons Other: 5 gallons (Ansulite 33%%)) UUnniiddeenntitiffiieedd ppoonndd,, 11//44t0o 111/22 mmiillee ssoouutthwweesstt 112160 172 mie southwest 1/2 to 1/2 mile southwest TTrraaiinniinngg ssiittee aappppeeaarrss oto bbee llooccaatteedd iinn aannacatcitivvee kkaarrsstt aarreeaa LLeessss tthhaann 11//88 mmiilee ecaasstt More tha1n mie More than 1 mile MMoorree tthhaann 11 mmiilee 222 22223333..00331144 STATE02827126 STATE_02827126 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatacct:t: SSIITTEE SSUUMMMMAARRYY TTyylleerr TTTyyyllleeerrr,FFMiirrNee DD5ee8pp1a7ar8rt.tmmeenntt Tyler, MN 56178 5RRi0icc7hh-aa2rr4dd7-BB6oo5rrr5ree6sseenn,, Fire Fire Chief Chief 5a0n7e-@2f4r7-o5n5t5i6emet net ridiane@frontiernet.net TTrraaiinniinngg LLooccaatitioonn:: CCoomrneerr ooff BBrraaddlleeyy aanndd AApppplleebbeeee,, TTyylleerr TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y);): 22550103022888.844,, 44980077338900..3311 TTyyppee ooff ffooaammuusseeddiinnttrrianiniinngg:: ~~ AAClRRaA-sAFsFFAFF:F.:AnAAunlnggSuusis l((uuossee(uiinnsettraaiininntiirnnagginnnionotgt snspopeteccsiipffeiiecedidf))ied) Class A: Anul Silv-ex (use in training not specified) FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: QQuuaartreerlyry FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: 8800%% ttoo ggrroouunndd., 2200%% ttoo ssttoormr sseewweerr AAnnnnuuaall ffooaamm uussee:: ClAAaRRsA-AsFFFA:FE.F:nonntootstpsseppceeicciiieffiideedd Class A: not specified NNeeaarreesstt ssuurrffaaccee wwaatteerr:: CCoouunnttyy ddietcnh,, 172 1/2 to 11 mmiillee nnoorrtthheeaasstt NNeeaarreesstt wweettllaanndd:: 11/4 ttoo 117/22 mmiilee nnoorrtthh Karst Area: Karst Area: Stes not located ian karst area. Site is not located in a karst area. NNeeaarreessttwwaatteerrwwelelll:: AApppprrooxmimataetellyy 117/22 mmiilee nnoorrtthh aanndd ssoouutthh Nearest Wellhead Protection Area: More tha1n mie. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilce SITE RANKING: 5 SITE RANKING: 9 22223333..00331155 STATE02827127 STATE_02827127 Site Name: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY UUppssaallaa UPUpOpssaaBlloaaxFF1iirr6ee4DDeeppaarrttmmeenntt Upsala, PO Box Upsala, MN164 MN 556633884 JJ3aa2yy05BBa7ag3ggg4een1sn0is1otossss,,FFiriree CChheieff 320-573-4101 TTrraaiinniinngg LLooccaatitioonn:: 111100WW.. EEllmm AAvveennuuee,, UUppssaallaa TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 337777778833.9955,, 55007744002211.2289 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: CCllaassss AA.-BB HHii EExxppaannssioionn:: RRooyyaall CChheemmicicaall CCoo.. FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: SSeemmi-AAnnnnuaulalllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaaollonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Storm sewer Storm sewer AAnnnnuuaall ffooaamm uussee:: CCllaassss AA-BB HHIi EEXx.: 551to01100ggaalllloonnss. Nearest surface water: Nearest surface water: North Twin River, fess than 1/4 mile north North Twin River, less than 1/4 mile north NNeeaarreesstt wweettllaanndd:: LLeessss tthhaann 11//48 mmiilee nnoorrtthh KKaarrsstt AArreeaa:: SSiitteeiss nnott llooccaatteedd iinn aa kkaarrsstt aarreeaa.. Nearest water well: Nearest water well: Less than 1/4 mie north Less than 1/4 mile north NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: MMoorree tthhaann 11 mmiilee NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: Less than 122 mie Less than 1/2 mile SSIITTEE RRAANNKKIINNGG:: 11s5 22223333..00331166 STATE02827128 STATE_02827128 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY WWaacocnioa--nAAiriirppooarrtt RRooaadd 2WW6aaSc.coonnMiiaaapFFlieirreeStDDeeeepplaarrttmmeenntt Waconia, MN 55357 26 S. Maple Street Waconia, MN 55387 R9Ra5an2nd.da4al4ll2l .SS2oo3rre1en6nssoonn,, Fire Fire Chie! Chief fre@waconiaog 952-442-2316 fire@waconia.org TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: Karst Area: Karst Area: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: 77555500 AAiirppoorrtt RRooaadd,, W Waaccoonniiaa 44369499, 49655345 443694.99, 4965534.5 AAARFFAFFF:FF: FAA.nngguAusnsgus Class &: Angus AR-AFFF: Angus Class A: Angus AAnnnnuuaallllyy 551to0 1100 ggaallloonnss NNoott ssppeecciiffiieedd AAAFRFF-FFAF:F:FFlle.esssslttehhsaasnnth85aggnaal5lglloaonlnsslons Class &: more than50 gallons. AR-AFFF: less than 5 gallons Class A: more than 50 gallons PPlieerrssoonnss LLaakkee,, lleossss tthhaann 11//44 mimile ssoouutthhoeaasstt Less than 1/4 mie southeast Less than 1/4 mile southeast Site does not appear o be locatedin a karst area. Site does not appear to be located in a karst area. Less than 1/4 mil east, south and southwest Less than 1/4 mile east, south and southwest MMoorree tthhaann 11 mmiicle. More than 1 mie More than 1 mile 1133 22223333..00331177 STATE02827129 STATE_02827129 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY WWaaccoonniiaa-- MMaappllee SSttrreeeett 2WW6aaSc.coonnMiiaaapFFlieirreeStDDeeeepplaarrttmmeenntt Waconia, MN 55357 26 S. Maple Street Waconia, MN 55387 R9Ra5an2nd.da4al4ll2l .SS2oo3rre1en6nssoonn,, Fire Fire Chie! Chief fre@waconiaog 952-442-2316 fire@waconia.org TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: Nearest surface water: Nearest surface water: Nearest wetland: Nearest wetland: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: 2266:5 S. MMaappllee SSttreete,t, WWaaccoonniiaa 437498.01, 496667227 437498.01,4966672.27 AAAFRFFAFFFF:F: FAA.nngguAusnsgus Class &: Angus AR-AFFF: Angus Class A: Angus AAnnnnuuaallllyy 551to0 1100 ggaallloonnss NNoott ssppeecciiffiieedd AAAFRFF-FFAF:F:FFlle.esssslttehhsaasnnth85aggnaal5lglloaonlnsslons Class &: more than50 gallons. AR-AFFF: less than 5 gallons Class A: more than 50 gallons Lake Waconia, loss than 1/4 mie north Lake Waconia, less than 1/4 mile north MMaapplleo SSttrreeeett st:site: 111/441to0 111/22 mmiiloe wweesstt SSiittee ddooeess nnoott aappppeeaarr oto bbee llooccaatteedd iinn aa kkaarrsstt aarreeaa.. Less than 1/4 mile cast Less than 1/4 mile east SSiitee sis llooccaatteedd iinn WWeellllhneeaadd PPrrootteeccttiioonn AArreeaa Less than 122 mie Less than 1/2 mile 116 22223333..00331188 STSATATTEE0_208282277113300 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY WWaaccoonniia-a- PPaarraaddiissee LLaannee. 2WW6aaSc.coonnMiiaaapFFlieirreeStDDeeeepplaarrttmmeenntt Waconia, MN 55357 26 S. Maple Street Waconia, MN 55387 R9Ra5an2nd.da4al4ll2l .SS2oo3rre1en6nssoonn,, Fire Fire Chie! Chief fre@waconiaog 952-442-2316 fi re@wacon ia.o rg TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: Nearest surface water: Nearest surface water: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: 8075 Paradise Lane, Waconia 8075 Paradise Lane, Waconia 439790.58 4967181 439790.58 4967181 AAARFFAFFF:FF: FAA.nngguAusnsgus Class &: Angus AR-AFFF: Angus Class A: Angus AAnnnnuuaallllyy 551to0 1100 ggaallloonnss NNoott ssppeecciiffiieedd AAAFRFF-FFAF:F:FFlle.esssslttehhsaasnnth85aggnaal5lglloaonlnsslons Class &: more than50 gallons. AR-AFFF: less than 5 gallons Class A: more than 50 gallons Lake Waconia, less than 174 mi north Lake Waconia, less than 1/4 mile north PPaarraaddiissee LLaannee ssiitee:: lleessss tthhaann 11//44 mmiillee nnoorrtthheeaasstt Site does not appear 0 be locatedin a karst area. Site does not appear to be located in a karst area. Less than 1/4 mil southviest Less than 1/4 mile southwest SSiitee sis llooccaatteedd iinn WWeellllhneeaadd PPrrootteeccttiioonn AArreeaa More than 1 mie More than 1 mile 118 22223333..00331199 STATE02827131 STATE_02827131 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY W Waakdldoorrtf W WPaOalBdldooorxrffsFFriree DDeeppaarrttmmeenntt `WPWOaallddBooro!rx,f,8MMNN 5566009911 AA50dd7aa-mm23GG6r-ruu2ss2ik4ar8eeuu(ttfzzr,eFFihriareleC)Chiheie!f 555a000d777a.--m222a333@995m.--20y0211c422i844ea(((fhnhirovoemmaheeva))ell)net adamg@myclearwave, net TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Annual foam use: Annual foam use: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: NNeeaarreessttwwaatteerrwwelelll:: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SITE RANKING: SITE RANKING: MMaaiinn SSttrreeeett,, W Waaklidoorrtf 4444339999222.299,, 44896644669988..8677 AAFFFFFF:: RRooyyaall CChheemmicicaall BBmi-omnotnhthllyy LLeessss tthhaann 55 ggaatlloonnss. Ground. som sewer Ground, storm sewer AAFFFFF:: 55 ggaallloonnss, Cob River, 14 10 173 mle west Cobb River, 1/4 to 1/3 mile wes! AApppprrooxxiimmaatteellyy 11 mmiillee nnoorrtthhwweesstt TTrraaiinniinngg siittee iis llooccaatteedd iinnaa ccoovveerreedd kkaarrsstt aarreeaa eto 3/4 to 11 mmiille ssoouutthh More tha1n mie. More than 1 mile SSiitteeiss llooccaatteedd iinn @a SSWWAAAA 1s 16 22223333..00332200 STATE02827132 STATE_02827132 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY W Waasseeccaa WW1a1ass7ee2ccaaAFFviierrene uDDeeepSpaaErrttmmeenntt Waseca, MN 56083 117 2nd Avenue SE Waseca, MN 56093 G5G0aa7rr.yy6CC3o5on.nr3raa2nt1h,0, FFiiree CChhiieeff ganyc@ci waseca minus 507-835-3210 garyc@ci.waseca.mn.us TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: W Waasseeccaa CCoouunnttyy ffaaiirrggrroouunndd,, ggrraanndd ssttaanndd aarreeaa 459765.11, 881691.45 459765.11,4881691.45 Soe rand vot pected CCllaassss 8B PPrrootteinin:: bbrraanndd nnoott ssppeecciiffiiecda;; 33MM ddiidd nnoott mmaakkee pprrootteeiinn foam Class A: brand not specified AAnnnnuuaallllyy 551to0 1100 ggaallloonnss GGrroouunndg CCCllaalssss a8AB:PrPso5rtoegtsieanlin:l:ons1100 ggaalllloonnss Class A: 5 gallons CClleeaarr LLaakkee,, 111/44 ttoo 117/33 mmiillee eeaasstt Less than 14 mil northeast Less than 1/4 mile northeast "TTrraaiinniinngg siittee iis llooccastteedd iinn aaccoovveerreedd rst karst aarreeaa 1721013 mie north 1/2 to 1t3 mile north More than 1 mic. More than 1 mile Less than 14 mile Less than 1/4 mile 1s 13 22223333..00332211 STATE02827133 STATE_02827133 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY W Weellccoommee. WWPeOellcBcooomxmee37FF3iirree DDeeppaarrttmmeenntt `Welcome, MN PO Box 373 Welcome, MN 5566118811 Chsohi7rs-is12BB8oo.rr8cc8hh8ee2rrd,t, TTrraaiinniinngg OOffffiicceerr 507-728-8892 TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: NNoorrtthheeaasstt ccoormneerr ooff DDuuggaann SSttrreeeett SS.. aanndd MMiilll Str, Street, WWeellccoommee 338699337755..9977,, 44883366003300.8822 CCllaassss 8B PPrrootteeiinn:: NNaattiioonnaall FFooaamm AAnnnnuuaallllyy 55 ggaatlloonnss Ground Ground CCllaassss 8B PPrrootteeiinn:: 55 ggaallloonnss IIntteerrmmiittteenntt ssttrreeaammss 11//441to0 117/22 mmilei1to ltthhee wweesstt aanndd nnoorrtthheeaasstt LLeessss tthhaann 11//48 mmiilee ssoouutthh SStiteesis nnoottllooccaatteedd iinn aa kkaarrsstt aarreeaa.. Less than 14 mil northeast Less than 1/4 mile northeast MMoorree tthhaann 11 mmiilee Sieis located in a SWAA Site is located in a SWAA "14 22223333..00332222 STATE02827134 STATE_02827134 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY WWiinnoonnaa - 3 SSttreeett - 3rd 4WWi5inn1ooEnnaa3FFiirrSeetrDDeeeeptpaarrttmmeenntt `Winona, MN 55387 451 E. 3rd Street Winona, MN 55987 E5E0qd7KK-r4raa5ll7l,,-8FF2ire6e6CChhiieeff ekrali@eiwinona mus 507-457-8266 ekrall@ci.winona.mn.us TTrraaiinniinngg LLooccaatitioonn:: CentralFire Station, 451 E. 3 Stet Central Fire Station, 451 E. 3rd Street Training Location Coordinates (XY): 60950338, 46764739 Training Location Coordinates (X,Y): 609503.38, 4878473.9 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: ARAFFE: Ansulte ARC AR-AFFF: Ansulito ARC FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground. sion sewer Ground, storm sewer AAnnnnuuaall ffooaamm uussee:: ClAAaRRsA-AsFFFA:FF.F:5g44a55lggoaanlllsloonnss. Class A: 5 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: MMiissssiissssiippppii RRiivveerr,, aapppprrooxxiimmaatteellyy 11//44 mmiillee NNEE NNeeaarreesstt wweettllaanndd:: AApppprrooxxiimmaatteellyy 11 memile ssoouutthh KKaarrsstt AArreeaa:: TTrraaiinniinngg ssittee sis llooccaatteedd iinn aann aaccttivvee Kkaarrsstt aarreeaa NNeeaarreessttwwaatteerrwwelelll:: AApprrooxxiimmaatteelyy 11//44 mmiillee nnoorrtthh Nearest Wellhead Protection Area: Site is locatedin a WPA Nearest Wellhead Protection Area: Site is located in a WPA NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilce SITE RANKING: 1 SITE RANKING: 19 22223333..00332233 STATE02827135 STATE_02827135 SSiittee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY WWiinnoonna-a- HHoommeerr RRooaadd 4WWi5inn1ooEnnaa3FFiirrSeetrDDeeeeptpaarrttmmeenntt `Winona, MN 55387 451 E. 3rd Street Winona, MN 55987 E5E0qd7KK-r4raa5ll7l,,-8FF2ire6e6CChhiieeff ekrali@eiwinona mus 507-457-8266 ekrall@ci.winona.mn.us TTrraaiinniinngg LLooccaatitioonn:: TTeecchhnniiccaall CCoolllleeggee,, 11225500 Training Location Coordinates (XY): 611155.16, 487513008 Training Location Coordinates (X,Y): 611156.16, 4875130.08 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: ARAFFE: Ansulte ARC AR-AFFF: Ansulite ARC FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaalllloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground. sion sewer Ground, storm sewer AAnnnnuuaall ffooaamm uussee:: ClAAaRRsA-AsFFFA:FF.F:5g44a55lggoaanlllsloonnss. Class A: 5 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: UUnniiddeenntitiffiieedd ssttrreeaammss aanndd NNeeaarreesstt wweettllaanndd:: OOnn ccaammppuuss ooff TTeecchhnniiccaall Karst Area: Karst Area: TTrraaiinniinngg ssiittee iis llooccaatteedd iinn NNeeaarreessttwwaatteerrwwelelll:: WWeellllss oonn ccaammppuuss Nearest Wellhead Protection Area: More tha1n mie. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilce SITE RANKING: 1s SITE RANKING: 16 HHoommeerr RRooaadd,, WWiinnoonnaa ppoonnddss oonn ccaammppuuss ooff TTeecchhnniiccaall CCoolllleeggee: aann aaccttivvee kkaarrsstt aarreeaa CCoolllleeggee 22223333..00332244 STSATATTEE0_208282277113366 AAppppeennddiixx DD MMuunniciciippaall FFiirree DDeeppaarrttmmeenntt TTrraaiinniinngg SSiittee PPrrooffiilleess ffoorr SSiitteess RRaannkkeedd PPoosstt--JJuunnee 3300t"h RReeppoorrtt + Albom AAllbexoarnndria Alexandria + Cannon Falls BrBoroookkllyynn CCeenntteerr ++ CCCCllaleoengaanurrobebntrroooFokkalls ++ CCCDrilroowoqsossrusitelaahtkkee ++ EGDEloliyylowssdiioavarnntihew ++ LaGKKkeeonneoyydoovJnnioehwanna ++ LLLLaaaunknveeeessmJbboeoohrraoonna Luverne + MMaapplleettoonn ++ NNNNNeoeeewrwwwifffooYYiloleoddrlreekdknnMMililllss ++ NPNNeooorrrrwthwhaoofimooeddldYYoouunngg ++ PRPPalelynyrmdhmaaoolumultthh ++ RRRRiiaicccnhhhfdfimiaeeolllldndd Rosemount Richmond Rosemount + Wolverton SaSrtaertlelll LLeeSSaauukk Wolverton AAmmeerriiccaa 22223333..00332255 state 02827137 STATE_02827137  AAllbboorrnn HHiigghhwwaayy 77 o SSeevviillllee RRooaadd 22223333..00332266 STSATATTEE0_208282277113388 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY AAllbboron-m- HHiigghhwwaayy 77. A6A9llb5bo5ommStFFioirrneeeyDDeBeprpaoarorttkmmReenontat d Albom, MN 55702 6955 Stoney Brook Albom, MN 55702 Road JJ2aa1yy8.TT3rr4ee5mm.bb6la3lay5y.8, T(Trtraaaiiinnniiinnnggg oOOffffffciicecnee)rr 22a2111b888o.--m333i44455r5--.e666@333s511o844l(((cftfirroraeeimnccihnhigieenfo))fficer) busyboy2228juno com albornfire@aol.com busyboy222@juno.com TTrraaiinniinngg LLooccaattiioonn:: AADellbmbooornnmstFFrriareetiHHoanalll,e, n66d3399t00raiHHniiiggnhghwwsaatyy. 77 Demonstration and training site TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 553322882268..9988,, 55220022224477..9955 TTyyppee ooff ffooaamm uusseedd iinn ttraaiinniinngg:: ClCCallaassssss BABAAFAFFnFFsF:u:l AASnhnsswuuEllxittee Class A: Ansul Silv-Ex FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: Amal Annually FFooaamm uussee ppeerr ttrraaiinniinngg eevveennt:t: LLoessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: GGrroouunndd AAnnnnuuaall ffooaamm uussee:: ClCCalaslsssaBAB"AAsF1FF5FsFgF:a:ll5o5nggsa.lallloonnss. Class A: 15 gallons Nearest surface water: Nearest surface water: AArrtiicchhookkee RRiivveerr llooccaatteedd aapppprrooxximiamtaetlye111l/4y4 mmiilee wweesstt Nearest wetland: Nearest wetland: Approximately 114 mie west Approximately 1/4 mile west Karst Area: Karst Area: TTrraaiinniinngg ssittee nnoott llooccaatteedd iinn aa kkaarrsstt aarreeaa NNeeaarreesstt wwaatteerr wweellll:: AApppprrooxxiimmaatteellyy 11/44 mmiilee nnoorrtthh Nearest Wellhead Protection Area: More tha1n mie Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilee SSIITTEE RRAANNKKIINNGG:: "11 22223333..00332277 STSATATTEE0_208282277113399 ALBORN HIGHW7ACWYI ll Vp ALBORN - HIGHWAY 7 CWI Well Map { Cmdr fem ety FEAEg if IER RII RrE n S aG e E SN ANN CE ET C z OW 2! VSoN PL eO OY Ji SaBneddraa) Re0y )I [LSif wr B ANLYo aDd anhte e N REETy TDoRrEdNwa oif beFs ahea y PLao vil (FDS Kon AR | TnFi LNpee Ae J BOeTl Sn LA Salm ne erating Bier ANCE SE Fea IEE ELL LA Wb er Re EG awl 7 23 hy 2 bE pd) mE oe RE enh Re Se Reena se ae Fooos fer Te foo. a nien't {s Hai| be lo e pi Soe Tl LEY "odyes pyAN 1gRTo en dgey a e Ye AEaa d 4B \/ | 4 1 A A in" 80, RhyAT AACbi E iEE1ak wVotSR BY JS iA PL sereOyen ntere mes, ern epoc[a] TL Ar b= i 22223333..00332288 stare casio STATE_02827140 gm 9s i : | Faiy ddtdiimlibheadat L|E eT | 1 GE Ni |\ fliwr , N Qes FA 5 I<1 NOS ROS Bo : nN i Ag ' / $s in SE ie i Wwe Now NER kil 2233.0329 STATE_02827141 | Alborn-Highway 7 What's In My Neighborhood Map | Sib Pre I FBoiy met rrreeeaa pes TW %1 i | % ee] Fre | HCop LE F at Hl frm} | | me Lias || F7inSsSITE=|Festi | Ee tFholdas s ihlinehy bk iE | -- | 7 St | Fimiiiist hii | |= i/ Htin pe mr i | rn 3 TM~ { desi : ;i s-- m = | rBomeuetatsaoeotSumpesraioar Disclaimer: Map aud site itffo~lnation is believed to bc accurate but accuracy is uot guaranteed. No portion er eso of the informntion should be considered to be, or used as, ~ legal document The information is pro~:ided [Emr ene ay wae subject to the express condition that the user knowingly waix,es any and all claims fbr clamages against MPC,\ that may arise from the use of this data. || @Minnesota Pollution Control Agency | a PcreinRneceSiuBnpuarpiournidnd st GoovaLawsiio Vou estzion P RERAMp otiondSwany 22223333..00333300 STATE 02827142 STATE_02827142 Well Repo 06a Well Log Report - 0066088 l woes]w.m Minnesota Unique Well No. 660881 County Quad Quad ID see St Louis Alborn 246A Well NameGOUER, JULIE L Dn Wu KC Cem -ownehip Range Dir Section Subsections Elevation 52 18 W 24 ACC Elevation Method Well Address 6386 CHURCH RD ALBORN MN 55T02 WEBLLL IATNDRBOONRNING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~]~[} BORI]~G ~CO~ Minnesota Statu~es Chapter 1031 SCImOMUSGSTIM t342 fl Calc from DEM (USGS 75 mn or equi~ ', Well Depth 137 ft Depth Completed 137 ft. man Entry Date Update Da:e Received Dote ume 06110f2002 04/1 ~/2008 Date Well Completed 09/2112001 Em -- Drilling Fluid -Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Steel(black or Iowcarbon) Joint W'elded Drive Shoe? No Above/Below it [] Yes [] Casing Diameter Weight Hole Diameter 6 in. to 137 ft. 18.97 Ibs./ft. 6 in. to 137 ft. Open Hole Screen NO from it. Make In ft Type Geological Material SAND CLAY/SAND El CLAY SAND GRAVEL Color Hardness From To BROWN MEDIUM 0 40 BROWN MEDIUM 40 90 SEL BROWN BROWN BROWN MEDIUM MEDIUM MEDIUM 90 120 130 120 130 137 NO REMARKS Diameter Slot/Gauze Length Static Water Level 4) fl from I end surface Date Meas~Jred PUMPING LEVEL (below land surface) 100 ft. after 4 hrs. pumping 12 g.p.m. 0917"/~001 o[saotoins Poi t Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No Set Between Located Minnesota Deparlment of Heallh Unique Number Verification N/A ,System UTM - Ned83, Zone15, Meters Method GPS SAOff(averaged) Dale X: 533051 Y: 5202681 First Redr~k tir vwates nen + Last Strat Unknowr depoaittype Aquifer Depthto Bedrock ft. County Well Index Online Report County Well Index Online Report A ircoe rk Te Ne Nearest Known Source of Coatamination 120 fcct N direction So#tie lank, draitt field type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufaclurer'sname Model number__ HP_ Volta Length of drop Pipe_ft. Capacity_g.p.m Type Material AbandonedWells Does property have any not in use and not sealed well(s)1 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification Da'4daon R Well Co. f66r6600m88m68r11rnd License Business Name 570:32 GRAVES. A. Saw Se Lic Or Reg. No. Name of Driller Printed 5/2/2008 Printed 9t2/2OO8 HE-01205-07 le A DP ON 0.30 mri lam TI 0g pe 204GS1 i027 3008 4356 AN tile:///JI,'... pVAppendi~%20D%20Muni%20FD%20 g ire%20 S m~marie s/Alborn/Hwy%207,~Well%20Log%20Report%20-%2000660881, htm[ 10/27/2008 9:43:56 AM] STAT 02627143 STATE_02827143 22223333..00333311 WallogReport 1515 Well Log Report - 00139515 1E395S15 Minnesota Unique Well No. wmCounty Quad Quad ID see St Louis Alborn 246A Well Name LI ND, BRJCE Dn ww m0 cme -ownship Range Dir Section Subsections Elevation 52 18 W 24 BDD Elevation Method WEBLLLIATNDRBOONRNING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 mn Entry Date Update Da:e Received Date ge 02124/1988 04/1Y/2008 SCImOMUGSTIM 1350 ft Calc from DEM (USGS 75 m n or equiv ', Well Depih Depth Completed Date Well Completed 106 ft 106 ft. 10/1511977 ~:~!!~!~ ~!~: ~!~ ~o.~!........................................................................................................................... Em -- Drilling Fluid -Use Domestic I Well Htdrofractured? ] From :t to Ft [] Yes [] No Casing Type Steel(black or Iowcarbon) Joint Threaded No Above/Below 1 5 ft Drive Shoe? [] Yes [] Casing Diameter Weight Hole Diameter 7 in. to 106 ft. 23 Ibs./ft. ass ens Geological Material SAN D GRAVEL CLAY Gr,Color BROWN BROWN BROWN es Hardness peFrom To 0 23 23 99 99 108 REMARKS LOC: NORTHERLY 550FT OF EASTERLY 500FT ts vert Located Minnesota Depadment of Health Unique Number ~/aritication N/A we System UTM - Ned83, Zone15, Meters es 5 iy Method GP Differentially Corrected Date N/A X: 532995 Y: 5202578 First Redrrr:,k tir vwates nen + Last Strat Unknowr deposit type Aquifer Depthto Bedrock ft. CountyWel Index Online Report County Well Index Online Report Open Hole from it. Cum Screen NO Make Diameter 1o [t Sues Type Slot/Gauze Legh Sa etven Length Set Between Static Water Level 50 fl from I end sarfane Date Maas~Jred PUMPING LEVEL (below land surface) 10 ft after 3 hrs. pumping 5 g.p.m. 10115/1977 o[saotoins Poi t Well Head Completion Pitless adapter manufacturer Modal []Casinq Protecfien [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No Nearest Known Source of Contamination _feet __direction __type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufaclurer'sname Model number__ HP_ Volta Length 01drop Pipe_ft. Capacity_g.p.m Type Material AbandenedWells Does property have any not in use and not sealed well(s)1 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Well Contractor Certification Hole In One Drillino 113399551155an License Business Name Le, 69442 Lc. Or Peg No. Yes [] No DORN GILBERT Ree Name of Driller Primed S208 Printed 9t2/2OO8 HE-01205-07 le A DP ON 0.30 miAlam TI 0g pe 20436018013 027 3008 43.7 AN tile:///J[,'.., pVAppendi~:%20D%20Muni%20FD%20 g ire%20 S m~marie s/Alborn/Hwy%207,~Well%20Log%20Report%20-%2000139515, htm[ 10/27/2008 9:43:57 AM] STATE 02627144 STATE_02827144 22223333..00333322 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY AAllbboormn -- Seve Seville RRooaadd,, SSaaggiinnaaww A6A9llb5bo5ommStFFioirrneeeyDDeBeprpaoarorttkmmReenontat d Albom, MN 55702 6955 Stoney Brook Albom, MN 55702 Road JJ2aa1yy8.TT3rr4ee5mm.bb6la3lay5y.8, T(Trtraaaiiinnniiinnnggg oOOffffffciicecnee)rr 22a2111b888o.--m333i44455r5--.e666@333s511o844l(((cftfirroraeeimnccihnhigieenfo))fficer) busyboy2228juno com albornfire@aol.com busyboy222@juno.com TTrraaiinniinngg LLooccaattiioonn:: AADlelbbmrrooonocskktrSSaccthhiooooonll,,s77t442277 SSeevviilllee RRooaadd,, SSaaggiinnaaww,, MMNN 555777799 Demonstration site TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 554411117711..66,, 55116888885577..0066 TTyyppee ooff ffooaamm uusseedd iinn ttraaiinniinngg:: ClCCallaassssss BABAAFAFFnFFsF:u:l AASnhnsswuuEllxittee Class A: Ansul Silv-Ex FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: Amal Annually FFooaamm uussee ppeerr ttrraaiinniinngg eevveennt:t: LLoessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: GGrroouunndd AAnnnnuuaall ffooaamm uussee:: ClCCalaslsssaBAB"AAsF1FF5FsFgF:a:ll5o5nggsa.lallloonnss. Class A: 15 gallons Nearest surface water: Nearest surface water: JJoohnnssoonn CCrreeeekk llooccaatteedd aapppprrooxxiimmaatteellyy 11 mmiiloe ssoouutthmweesstt Nearest wetland: Nearest wetland: Less than 1/8 mile to the south and to the north Less than 1/4 mile to the south and to the north Karst Area: Karst Area: TTrraaiinniinngg ssittee nnoott llooccaatteedd iinn aa kkaarrsstt aarreeaa NNeeaarreesstt wwaatteerr wweellll:: 117/221to0 33/44 mmiilee nnoorrtthheeaasstt Nearest Wellhead Protection Area: More tha1n mie Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilee SSIITTEE RRAANNKKIINNGG:: 7 22223333..00333333 STATE02827145 STATE_02827145 AALLBBOORRNN -- SSEEVVIILLLLEE RROOAADD CCWWII W Weellll MMaapp. nyt VE Sa By El fe SET emg a NonohUeos FR OFAFL Fro FE 5SY NhiustiT : ] Sy . aR RLal gHem 1 ; = J / is,HBN ol|h ie M WyEE Trp ~edn i op ER oo ee RAAyG: nAT l iEaRYey ade] Pn 7 A A s ee n ISST0 EN0Sy Er cul AT Rite AY LRfh Er RY Fa = YETI BoE RAF i Ce EE= BGPRERa SAFNA A PEmEma cab ayyTEEANlIE So TE 17 et een > BA Del Rc ESlaiEluL laiEnet IR[VE iPseteinnidia atRiIanNE nLAiNG iS e i i - FHElSaSl e nT n a UY oli i L LeNw e A es Rh EhE5 alan NRE UE ab Se NERM A LNnATSeBiele aeT RRDAZA Lioill]: RA: E BR Va aTa i be =PNte as ALsER NeSTbpee 0n)T neESAAAGAYSE ER s e=snt RGeX sM e lhe oats NiA ned hi EAt N y Tere 5 TT Mermspmmty:Seren covenazyi.e) i- L NS--E S ey n ore 22223333..00333344 state 02827146 STATE_02827146 q i ' AT a> (8 Hh omy | iddtilihedt L PT 46-52-0N 46-51-80 N TR 46-51-0 N 46-50-30 N . IT. = 2 pI E EL Y= 4a w Bt geSt E: 4 bt a Pg Pi yi = : gl & aa rs `g) 2B = ~9~g 7 f~@3~{~ ~ )7~f,~ ,, ~>~ "aa .................................................................... oe . f oy | 9. EE. Ie Ta.| Y oem 4 Gi ie 8 il 13 3 i" T i Kote api 4 "J $l ai( 94 IR WAT 2 #9 s g |i 0) (i |2 s [IV Alert]| of ii N0-lI-9f N 0I-lI-9f N t ~I-9f I Of-O-9f oo 2233.0335 orSTATE_02827147 |I E Anlboern-tSeville Rd Wh\at's> In My Neighborhood Map kIa 3pl iAT e EENi G enpring a i - [| rear ra ih J v Babin ee co : fet ry apn i 1 | 5 || || i\ ElkCEA i Eyg | !\ firm | A Fi Thy | Wend eB i { | Ha I | 3 I3 X Fre -- > ||| 29 : : \| |11 4 \ mm | |i = rBeteotsmatsuuotrsasSwuapasorsun Disclaimer: Map aud site itffo~lnation is believed to bc accurate but accuracy is uot guaranteed. No portion |RELI TE SRI S I"| weseniraunpe of the informntion should be considered to be, or used as, ~ legal document The information is pro~:ided | wae subject to the express condition that the user knowingly waix,es any and all claims fbr clamages against ||| o Fcaoewtacsiuteuppeorrntaind MPC,\ that may arise from the use ofthis data. Sites. || @Minnenseostoata Pollutionn ControlControlAgeAngency | JRC SVoeumngSarpy woessat.on 4sReEmRrAosMsmoestit Cshtuaorunp 22223333..00333366 STATE 02827148 STATE_02827148 Well Lg Ror 822 Well Log Report - 00430822 we] Minnesota Unique Well 430822 No. wEm isee County Quad Quad ID St Louis Saginaw 245C Well Name SCHEPER, MAX Www w oanneg -ownship Range Dir Section Subsections Elevation 51 17 W 36 Elevation Method WEBLLL IATNDRBOONRNING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Slt DRUSGS 3m 1350 ft Calc from DEM (USGS 7 5 m n or equiv } Well Depih 28 ft " Depth Completed 28 ft. man Entry Data Update Da:e Received Date 11107/1990 11/1512007 Date Well Completed 06/2211988 FPDrilling Fluid Water Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or Iowcarbon) Joint W'elded Drive Shoe? No Above/Below 1 ft [] Yes [] Casing Diameter Weight Hole Diameter 6 in. to 28 ft. 18.97 Ibs./ft. 6 in. to ft. Well Address 4665 VIBERT RD SAGINAW MN 55779 GGeeoollooggiiccaall MaMtaetreiriaall SAN D LOAM BE GRAVEL SANDY GRAVEL COARSE GRAVEL CCoolloorr HaHradrdnneessss. BROWN SOFT mow BROWN BROWN BROWN HARD HARD HARD REMARKS LOC: 200 FT SOUTH FROM 4665 VIBERT RD SAGINAW, MN 55770. FFrroomm 0 32 15 20 Open Hole from it. 1o [t Screen NO Make Type TToo | DDuiaam meetteerr 2 215 20 28 atu Slot/Gauze bu Length Static Water Level 8 fl frnm I and surface Da-e Meas~]rad PUMPING LEVEL (below land surface) 25 ft after 1 hrs. pumping 30 g.p.m 0617711,988 oso ons Well Head Completion Pitless adapter manufacturer otModel []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No RS ad Set Between Te Located Minnesota Depadment of Health Unique Nu'~ber Varilication N/A System UTM - Ned83, Zone15, Meters I Method GPg SAOff(averaged) Date N/A X: 542229 Y: 5189552 First Redr~k sors Gm on + Last Slrat Gravel(larger) Aqu~er Depth to Bedrock ft County Well Index Online Report County Well Index Online Report Nf pe ceritt "B be BAe Nearest Known Source of Contamination 100 fcct Nori]~ West direction Scutic lank/drain field Well disinfected upon completion? [] Yes [] No type Pump [] Not Installed Date Installed Manufaclurer'sname Model number__ Length ol drop Pipe _ft. Capacity_g.p.m HP_ Volta Type Submersible Ma:edal AbandonedWells Does property have any not in use and not sealed well(s)1 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Well Contractor Certification Sunnarbora Well Co. 41S 33008822o 22 License Busineas Name udm09437 Lic. Or Reg. No. Yes [] Ho SUNNARBORG C Seem Name o1 Driller Printed 5/2/2008 Printed 9t2/2OO8 HE-01205-07 le ppd7 EP SSS At Ses SORIA 0p 204000 027 208-4735 AM] tile:///Jl,'...ppendi~oJ~20Dovg")_0Munio%O-0FDovoO_0Siteoo20Summaries/Alborn/Sevilleo,/o20Rd /Wello%9_0Logo,zo20ReportcA;~'i,0-o~;~~, 00043082O~.htm[l 0/27/2008 9:47:_q; 8 AM] STATE 02627149 STATE_02827149 22223333..00333377 * AAlleexxaannddrriiaa 22223333..00333388 STSATATTEE0_208282277115500 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY Alexandria Alexandria AA3l0lee2xxaaFnnidldrmraaorFFeiirrSeetDDeeeeplpaarrttmmeenntt Alexandita, IN 56308 302 Fillmore Street Alexandria, MN 56308 3DDe2en0nnn7ii6ss 3SS8tta4arr8kk.6, Fire Fire Chet Chief 320-763-6488 TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: Karst Area: Karst Area: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: VVbuaarrnriisoo.uussR,,aiinnnkccillunuddgiinnbggasVVeaodTTeeoccnhhMaSScgchheaoolloa,ln, MMtaaagngekellfllaaannmttalaonnckkatffiaaornrm.m,, aanndd velive burns. Ranking based on Magellan tank farm location. 314446.7, 5085004.48 314446.7, 5085004.48 AACFlFFaFEsF:s: AFFiirFreiccehhciiehfifeuufnnussnuusrreuerooeff offfooafamomabbmrraabnnrdad,n, d33WMk-bbrraanndd assumed assumed Class A: Fire chief unsure of foam brand AAnnnnuuaallllyy LLeessss tthhaann 55 ggaatlloonnss. SSttoorrmm sseewweer,r,ocyity hhaass ssttoormmawaatteerr rreetteennttiioonn ppoonndd ssyysstteemm AACFlFFaFsFFs::4l:leossmssotrthheaannth11a00n gg1aa0llglloaonlnslsons Class A: more than 10 gallons LLeessss tthhaann 11//48 mmiilee ssoouutthheeaasstt eto 122 mie north 1/4 to 1/2 mile north Sieis nt located ian karst area Site is not located in a karst area Less than 1/8 mile northeast and southwest Less than 1/4 mile northeast and southwest TTrraaiinniinngg sisite iiss llooccaatteedd wwiitthhiniana WWPPAA "TTrraaiinniinngg ssiittee iis llooccaatteedd win within aa SSW WAAAA 222 22223333..00333399 STATE02827151 STATE_02827151 AALLEEXXAANNDDRRIIAA CCWWII W Weellll M Maapp SE ie We el ome ree gJ ro]e L [ee S eolA F Lh a] mar een YL LE ERR T Ta aad] dy S oi G a DaEtE en (gSgmaS,te|e)l] 5 Flay (| es SET TNT THE WaEn ReORs T apr NE A mE TR ES gelEaER0 rrA AY eon s Seel eWh EL el ah FF Bole |b Soke p ladle ERE ~ iy Lal SC ARS EdOeEt Eki QPi. E HE D peTe Ye fe glen side i = SI PE be hope a Fel Hin fee Te NR fees on] farT EES D TT ELEA iee peeerohd wesc,hee.abe PYIL arl n F# A I Car a banre et LE a5 gefeot(eFRrEodRi e er gL oA npA TeENLLAr24 s@ ami efU0 nign- oT e Se OIR eAe Se L L Pi ra Spba s sse0m0ea nA eaon Sn orgl en Bf Ad eECd E CE ) TE 22223333..00334400 [p-- STATE_02827152 or | Eddie gE, dn boa | Joy nl i Ty sdidp, BB tif om en een ee ad7 I Fe $ i wl | f: 2 2 HEE 8 HORE X iE 5 PEoggRiRY | [i J Tah galt de of iE 5i < LA hy 2| bl i hi3lT i.gee 4 siiEl [1] 22223333..00334411 sare cari STATE_02827153 "Alexandria What's InMyNeighborhoodMap TET ET (FT A a FC A] s Tg mT ~u i4, = Nene LB \ | Wi | Sa ypEET A ] Chip Foi e IT L. a BL Abe.. fe { i rrr fed lf BD - Ir t--e -c ii sis dike sled LE T Hi Bebliatie rh LE Nl ETT `ZViy n i 1 hile Bn pBeoaarmStsnpsorns Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion SESS| tnadtargs of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided ARES III | subject to the express condition that the user knowingly waives any and all claims for clamages against ocFreoracamunntupsrin ]VIPCA tha! may arise from lhe use of this data. @Minnesota Pollution Control Agency h vom s m mason +R RaRAR TWAoDrotA eosn Chats 4sus peossommns 22223333..00334422 sTaTe 02827154 STATE_02827154 WallogReport 021475 Well Log Report - 00214750 Minnesota Unique Well No. 214750 | zi. 214750 County Quad Quad ID omDouglas Alexandria West 180B MINNESOTA DEPARTMENT OF HEALTH RECORD ~7~L~LL iJll]~[} BORING I~J~C O~a~ Minnesota Statules Chapter 1031 Well Name LAND O' LAKES 1 By -ownship Range Dir 128 3~ W Section 18 on Subsections CBCCDA ween Elevation Elevation Method Lr 1402 ft 7 5 minute topographic map (+/- 5 feat) Well Depih mmm108 ft Depth Completed 108 ft. =n. Entry Date Update Da:e Received Date 04107f1988 03/1112005 Date Well Completed 0010011943 Drilling Fluid -- {ee Use Commercial ~ Well Htdrofractured? [] 'Yes [] No J From :t to Ft Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? [] Yes [] A EE No Above/Below it Casing Diameter Weight Hole Diameter 12 in. to 92 ft. Ibe./ft. Well Address ALEXANDRIA MN 56308 Er Geological DRIFT Material mm Color Hardness From 0 To 108 NO REMARKS Open Hole from it. to ft You Screen YES Diameter 12 So Make Type brass Slot/Gauze sagtLength 16 SP, oe Set Between 92 ft. and 108 ili Static Water Level 40 fl from Land surface Date Measured 00100/1943 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. Well Head Completion Brenan seangtoun Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Located Minnesota Geological Survey at, Unique Number Verification Information from c,wner System UTM - Ned83, Zone15, Meters = Method Digitized Table) scale 1:24,000 or larger (Digitizing Tn Data N/A X 314904 Y: 5084956 ran ute ot sci First Bedrock Nor WR 8. Last Slral Unknowr deposit type Aquifer Quat. BuriedArtes. Aquifer Depth t3 Bedrock ft. County Well Index Online Report County Well Index Online Report Nearesl Known Source of Conlaminalion __feet _direction _type i vu Well disinfected upon completion? [] Yes Pump [] Not Installed Date Installed 04107/1944 A WT Manufacturer'sname POMONA Model number Length 01drop Pipe_ft. Capacity500 g.p.m Type Be [] No HP 40 Volts Tur3ine Material Abandoned Wells Does property have any not in use and not sealed well(s)~ [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification Tas Po Mccarthy Well Co. 27022 ee BB en License Business Name Lic Or Reg. No. [] No Name of Driller 221144775500 Prinntteedd S9i/1t2a/220000e8 HE 01205 07 el. Append aF154 Sms ln Wl Lg XReer 303 2002750037 2083035 AN) ti~e:///J~/~..p%20Rpt/Appendix%20D%2~Muni%20FD%20Site%2~Summaries/A~eandria~we~%2~L~g%2~Re1~rt%20-%2~214750.htm[10/27/2008 9:50:33 AM] 233.0043 state 02827155 2233.0343 STATE_02827155 log hn 21751 Wcll Log Rcport - 0021475 l Minnesota Unique Well No. 22144775511 Jz.Caunty Quad Quad ID omDouglas Alexandria West 180B MINNESOTA DEPARTMENT OF HEALTH RECORD ~7~z~LL iJll]~[} BORIN{~ 1~1~ C O~]~ fbi Entry Date Update Da:e Received Date 04107f1988 03/11/2005 Minnesota Statules Chapter 1031 Well Name LAND O' LAKES 2 -ownship 128 vw Range Dir 3~ W Section 18 oe Subsections CBCDBB oven Elevation Elevation Method Well Depih Depth Completed Date Well Completed SFmmm] 1395 ft 7 5 minute topographic map (+/- 5 feet) 140 ft 131 ft. 0410011947 Well Address moesn ALEXANDRIA MN 56308 Geological Material SAND AND GRAVEL BLU E CLAY HARDPAN SAND - SOME GRAVEL SAND & GRAVEL SAND AND SOME GRAVEL FINE SAND SAND AND CLAY vp BOE Color Hardness Fmm To 0 40 40 88 88 96 96 112 112 122 122 133 133 135 135 140 Drilling Fluid -- Ft Use Commercial ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or lawcarbon) Joint No Information Drive Shoe? [] Yes [] A EE No Above/Below ft Casing Diameter Weight Hole Diameter 20 in. to 96 ft. Ibs./ft. Ere Open Hole from it. In ft Screen YES Make Type [FEE mewn Diameter Slot/Gauze Length Set Between 12 26.7 96 ft. and 131 Static Water Level 36 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 58.8 ft. after 5 hrs. pumping 542 gp.m 04100/1947 Cs m-- REMARKS -HIS IS A ,.GRAVEL PACK WELL. Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade Bren rerio yen [] At-grade (Environmental Wells and Borings ONLY) Ce ms rsa Gre Grouting Information WelIGrouted? [] Yes [] No oe ens Located Minnesota Geological Survey Unique Number Verification Information from -owner System UTM - Ned83, -Zone15, Meters Dc 00 ee Method D igitized - scale 1:24,000 or larger (D igitizing Table) - Date N/A X 314980 : 5084989 Nearesl Known Source of Conlaminalian __feet __direction __type i vw Be Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed D4100/1947 By ae 10 hz Manufacturer'sname PAMONA Model number HP 30 Molts 220 pL MTL Length of drop Pipe 90 ft. Capacity400 g.pm Type Turbine Material Steel/black or low carbon/ Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No First Bedr~k ans corse Ena Last Slrat Clay & sand Aquifer Quat. BuriedArtes Aquifer Depth ~o Bedrock ft. County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHferthiswell? [] Yes [] No ee Wall Contractor Certification Keys Well Co. License Business Name 221144775511 cS 62012 Lic Or Reg. No. em WALIN. C. Name of Driller he Printed 9/12/2008 HE-01205-07 el. Append aF154 Sms ln Wl Lg XReer 303 200214751 10372083035 AN) ti~e:///J~L.~%2~Rpt/Appendix%2~D%2~Muni042~FD%2~ite0/;2~Summaries/A~eandria/wel~%2~L~g%2ORe~rt%20-%2~021475 l.htm[10/27/2008 9: 50:33 AM] 2233.0344 STATE02827156 ~33.0344 STATE_02827156 log hn 23140 Wcll Log Rcport - 0022140 l Minnesota Unique Well No. 22211440011 zi.County Quad Quad ID Douglas Alexandria West 180B MINNESOTA DEPARTMENT OF HEALTH RECORD ~7~z~LL ~I1~]~[} BORI]~G ~C O~I~ Minnesota Statu~es Chapter 1031 Well Name ALEXAND RIA TW-4 By -ownship Range Dir 128 3~ W Section 18 oes Subsections CCABBD een Elevation Elevation Method Lr 1395 ft 7 5 minute topographic map (+/- 5 feet) Well Depth mmm115 ft Depth Completed 115 ft. =n. Entry Date Update Da:e Received Date 04107f1988 03/1112005 Date Well Completed 1110011954 ------------ Drilling Fluid -Use Test well ~ Well Htdrofractured? [] Yes [] No J From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below ft. Casing Diameter Weight Hole Diameter Well Address ALEXANDRIA MN 56308 Geological Material TOP SOIL SAND & GRAVEL Fy CLAY CLAY & GRAVEL SAND & GRAVEL FINE SAND Color Hardness From To 0 4 4 35 Tr 35 70 70 95 95 110 110 115 Open Hole from it. to ft Screen Make Type Diameter Slot/Gauze Static Water Level ft. from Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. Length Set Between -- NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade ae [] At-grade (Environmental Wells and 3oringe ONLY) Grouting Information WelIGrouted? [] Yes [] No ct npr Located Minnesota Geological Survey =on.Uo ts Unique Number Verification Informatian from owner System UTM Ned83, Zone15, Meters lt 2m On Method D igitized - scale 1:24,000 or larger (D igilizing 3hr0.03 Table) Date N/A X: 315085 Y: 5084873 Vo irr Nearest Known Source of Corlamination _feet _direction _type Well disinfected upon completion'? @ v0 [] Yes 8 [] No Pump [] Not Inetalled Date Installed Manufacturer's name Length of drop Pipe_ft. Model number_ Capacity_g.p.m HP_ Type Volts Materiel Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No rare oo First Bedrcck ee see Sma + LastStrat Sand Aqur~er Depth to Bedrock ft. County Wall Index GriineReport County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification te a aes. Keys WellCo. 62012 ete cle ei License Business Name Lic Or Reg. No. [] No KEMPER R Name of Driller 222211440011 PPrriinntteedd S9/I1T2Z/22000088 HE-01205-07 el. Append aF154 Sms ln Wl Lg XReer 304 2002140 10372085054 AN) tile:///JI,'...p%20Rpt/Appendix%20D%20Muni%20FD%20Site%20Sumtnaries/Aleandria/Well%20Log%20Report%20-%2000221401, htm[10/27/2008 9:50:34 AM] 2233.0045 state 02827157 2233.0345 STATE_02827157 Well Log Report - 00250767 2B50o767e], Minnesota Unique Well No. County Quad Quad ID Douglas Alexandria West 180B HLS MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Entry Date Update Da:e Received Date 09105/1996 08/29/2001 Well NameALEXANDRIA EXTRUSION I -ownship Range Dir Section Subsections Elevation 128 38 W 13 ADCCDA Elevation Method 1398 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 100 ft Depth Completed 100 ft. Date Well Completed = Drilling Fluid -Use Industrial I Well Htdrofractured? [] Yes [] No ] From :t to Ft Casing Type Steel(black or lawcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below ft Casing Diameter Weight Hole Diameter 6 in. to it. Ibe./ft. Well Address tg 401 22 CR NW AALUEEXAAANIDORRIAAAMMNS5e683068: Geological Material NO RECORD Color wpm Hardness From 0 Open Hole from it. to ft Screen YES Make Type Oiameter Diameter `Slouauze. Slot/Gauze To 100 Length SetBetween Length Set Between Ere REMARKS ONLY ONE WELL ACTIVE NO2 OWNER 6 8 2001. I Located Minnesota Geological Survey Method Digitization (Screen) -- Map (1:24,000) Unique Nuqnber ~/eritication Information from owner Date N/A System UTM - Ned83, Zene15, Meters X: 314564 Y: 5085325 First Redrrr:k rr REET Last Slrat Unknowr depoeit type Aquifer Quat. BuriedArtes. Aquifer Depth ta Bedrock ft. "County Well Index Online Report County Well Index Online Report Static Water Level fi from Dale Measured PUMPING LEVEL (below land surface) EE ft. after hrs pumping g.p.m. Well Head Completion Pitless adapter manufacturer Model os Be T []Casincl Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No Nearest Known Source of Contamination _feet __direction __type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufaclurer'sname Model number__ HP_ Volts Length 01drop Pipe_ft. Capacity_g.p.m Type Materiel AbandonedWells Does property have any not in use and not sealed well(s)1 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification Minnesota Deoh of Natural Resources MNDNR TE wm License Business Name Lic. Or Reg. No. Name of Driller 225500776677 Printed 9/7212008 Printed 9/12/2OO8 HE-01205-07 sme arise tile:///J],'.., p%20Rpt/Appendix%20D%20Muni %20FD%20 S ite%20Summaries/A leandria/Well%20Log%20Report%20-%200025,3767, htm[ 10/27/2008 9:50:34 AM] STATE_02827158 22223333..00334466 Well Log Report - 00250768 Bore], Minnesota Unique Well No. 250768 Caunty Quad Quad ID Douglas Alexandria West 180B HLS MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Entry Date Update Da:e Received Date 09105/1996 08/29/2001 Well NameALEXANDRIA EXTRUSION 2 -ownship Range Dir Section Subsections Elevation 128 38 W 13 ADCCDB Elevation Method 1398 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 110 ft Depth Completed 110 ft. Date Well Completed = Drilling Fluid -Use Industrial I Well Htdrofractured? [] Yes [] No ] From :t to Ft Casing Type Steel(black or lawcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below ft Casing Diameter Weight Hole Diameter 6 in. to it. Ibe./ft. Well Address tg 401 22 CR NW AALUEEXAAANIDORRIAAAMMNS5e683068: Geological Material NO RECORD Color wpm Hardness From 0 Open Hole from it. to ft Screen YES Make Type Oiameter Diameter `Slouauze. Slot/Gauze To 110 Length SetBetween Length Set Between i -- REMARKS ONLY ONE WELL ACTIVE WELL NO.2 OWNER 6 8 20Cl. I Located Minnesota Geological Survey Method Digitization (Screen) -- Map (1:24,000) Unique Nuqnber ~/eritication Information from owner Date N/A System UTM - Ned83, Zene15, Meters X: 314505 Y: 5085353 First Redrrr:k rr REET Last Slrat Unknowr depoeit type Aquifer Quat. BuriedArtes. Aquifer Depth ta Bedrock ft. County Well Index One Report County Well Index Online Report Static Water Level fi from Dale Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. EE Well Head Completion Pitless adapter manufacturer Model a Ta []Casincl Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) os Be T Grouting Information WelIGrouted? [] Yes [] No Nearest Known Source of CoNamination _feet __dkection __type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufaclurer'sname Model number__ HP_ Volts Length 01drop Pipe_ft. Capacity_g.p.m Type Materiel AbandonedWells Does property have any not in use and not sealed well(s)1 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification Minnesota Deoh of Natural Resources MNDNR TE wm License Business Name Lic. Or Reg. No. Name of Driller 725500776688 Fed Sree Printed 9/12/2OO8 HE-01205-07 sme arise tile:///J],'.., p%20Rpt/Appendix%20D%20Muni %20FD%20 S ite%20Summaries/A leandria/Well%20Log%20Report%20-%200025,3768, htm[ 10/27/2008 9:50:34 AM] STATE_02827159 22223333..00334477 log Rn 045567 Well Log Report - 00455667 Minnesota Unique Well No. 456667 | ez, 455667 Caunty Quad Quad ID iDouglas Alexandria West 180B MINNESOTA DEPARTMENT OF HEALTH RECORD WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Well Name LEE, WAYNE -ownship Range Dir Section Subsections Elevation 128 3~ W 18 CBDADB Elevation Method 1390 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 81 ft Depth Completed 81 ft. =n. Entry Date Update Da:e Received Date 01113/1992 08/28/2001 Date Well Completed 04/2111989 Well Address 707 VAN DYKE RD ROS Re ALEXANDRIA MN 56308 asa us Geological Material TOPSOIL SAN D z SAN [] CLAY CLAY SAND crColor BLACK BROWN GRAY BROWN GRAY GRAY te Hardness SOFT SOFT SOFT MEDIUM MEDIUM MEDIUM teFrom 0 1 NY4 16 32 62 Drilling Fluid Revert Eo ---------- Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Steel(black or lawcarbon) Joint W'elded Drive Shoe? EE No Above/Below 1 5 ft [] Yes [] Casing Diameter Weight Hole Diameter 8 in. to 71 ft. Ibs./ft. 12 in. to 81 ft. Emer Open Hole from it. to ft Screen YES Make COOK Type stainless steel en To 1 Diameter 4 8 BlotlGauze 70 Length 10 Set Between 71 ft. and 81 16 32 62 81 Static Water Level 19 fl from Land surface Date Measured 0412'/1989 PUMPING LEVEL (below land surface) 41.1 ft. after 7 hrs. pumping 425 gp.m -- NO REMARKS Well Head Completion C Brrenan seangtoun Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No ct rity Located Minnesota Geological Survey Unique Nu'~ber Merilication Information from owner System UTM-Ned83, Zone15, Meters hs Opt ve Method Digitization (Screen) Date 08/17/2001 X: 315101 Y: 5085049 4 Map (1:24,000) First Bedrc~k ioe 4 LastStrat Sand-gray Aquifer Quat Buried Arte~. Aquifer Depthto Bedrock ft. County Well Index Online Report County Well Index Online Report Grout Material: Well grouted, type unknown from to ft. Nearesl Known Source of Contaminalion __feet __d~rcction __type Vii 0 501 3c Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed 05/26/1989 a ere Manufacturer's name VALLEY Model number 8SC450 HP 15 Volts 46,_~.0 E RE E r LBan| LengtholdropPipeS0 ft. Capacity._gp.m ype Submersible Material Steel /black or low carbon/ Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No ie, Well Contractor Certification Traut S.m. Well Co. License Business Name 445555666677 Sh 21535 Lic Or Reg. No. NEYENS. J. Name of Driller Printed S/12/2000 Printed 9/12/2OO8 HE-01205-07 el. Append aF154 Sms ln Wl 3g XReer 304 20067 0372083035 AN) tile:///Jl~..p%2~)Rpt/Appendix%2~D%20Muni%20FD%20Site%2~Summaries/A~eandria~we~%2~L~g%2~Rep~rt%2~-%2~0455667.htm[~ 0/27/2008 9:50:35 AM] 233.0048 sate 02827160 2233.0348 STATE_02827160 Pr---- Wcll Log Rcport - 00633973 "6S3e37n3s||x, Minnesota Unique Well No. 633973 Caunty Quad Quad ID Si e Douglas Alexandria West 180B WRrLeNcDoRrOnRNG MINNESOTA DEPARTMENT OF HEALTH ~7ELL/~]~[} I}ORII~G ~CO~ Minnesota Statutes Chapter 1031 Well Name SH ERIFF'S MAINTENCE BLDG -ownehip 128 Range 38 noDir Section W 13 onSubsections CDADDC oven Elevation Elevation Method Sere fn 1378 ft 7 5 minute topographic map (+/- 5 feet) Well Depth 101 ft Depth Completed 101 ft. fEw. Entry Date Update Da:e Received Date 0711712000 03/11/2005 Date Well Completed 09/2111999 Et] Drilling Fluid Bentonite Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Plastic Joint No Information Drive Shoe? []Yes [] No AbovelBelow ft. Casing Diameter 4 in. to 97 ft. Weight Ibs./ft. Hole Diameter 8 in. te 101 ft. rtwoe Geological TOP SOIL oe GRAVEL CLAY Material GRAVEL CLAY CLAY DIRTY GRAVEL SAN D Gr fg Color BLACK BoB. BROWN GRAY Hardness SOFT SOFT M EDI U M BROWN SOFT GRAY M EDI U M TAN M EDI U M GRAY SOFT GRAY SOFT Gm J (gen pen ge From To 0 1 2 Toon 1 10 10 22 Open Hole from it. to ft Screen YES Make COOK Type stainless steel Diameter 4 Slot/Gauze 12 Length 4 ogee Set Between mre 97 ft. and 101 22 27 27 34 34 50 Stagc Water Level 50 60 15 ft from Land surface Date Measured 09t2'/1999 60 101 PUMPING LEVEL (below land surface) 100 ft. after 2 hrs. pumping 150 gp.m. rr NO REMARKS Located A Minnesota Geological Survey Unique Number Verilication Tag on well System UTM - Ned83, Zone15, Meters Method -- Digitization (Screen) Map(1 24,000) Date N/A X: 313998 Y 5084747 Fadel First Bedrock ESL Last Slral Sand-gray Rute Cunt Bw tes Ate Aquifer Quat BuriedArtes. Aquifer rlepth fe R~dreck ft County Well Index Online Report County Well Index Online Report Well Head Completion ET en un Pitlees adapter manufacturer MAAS Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No Grout Material: Bentonite from 0 to 30 ft. Nearesl Known Source of Contaminalion _feet _direclion _lype ieee 8 10 8 0 Well disinfected upon completion'? [] Yes [] No Pump [] Not Installed Date Installed 0212812000 [rE T a eE I i CERY i Ti Manufacturer's name AEROMOTOR Model number A+12-50 HP 0 5 Veils pte eoes| Length of drop Pipe 40 ft. Capacity20 g.pm Type Submersible Material Abandoned Wells Does property have any eel in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No "Blusenwica Well Contractor Certification Traut S m Well Co License Business Name 663333997733 ee Zan 21535 Lic Or Reg. No. re Name of Driller PPrriinntteedd 991/1122//22000088 HE 01205 07 stare o2s27161 tile:///J~.p%2~)Rpt/Appendix%2~D%20Muni%20FD%20Site%2~Summaries/A~eandria~we~%2~L~g%2~Rep~rt%2~-%2~06339~3.htm[~ 0/27/2008 9:50:35 AM] STATE_02827161 22223333..00334499 WeogRelport 0065777 Wcll Log Rcport - 00657977 6i57977 Minnesota Unique Well No. County Quad Quad ID Douglas Alexandria West 180B Riimane MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i1~]~[} BORI]~[C~ ~C O~I~ Minnesota Statules Chapter 1031 Well Name SWEDBURG WOOD PRODUCTS -ownehip Range Dir Section Subsections Elevation 128 38 W 13 COB Elevation Method 1380 ft Calc from DEN (USGS 75 m n or equi~ ', Well Depih 78 fl Depth Completed 78 ft. omEntry Date Update Da:e Received Date 04105/2002 03/1112005 Date Well Completed 06/1912001 Ee Drilling Fluid Bentonite Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Plastic Joint Solvent Welded Drive Shoe? []Yes [] No Above/Below ft. Casing Diameter 4 in. to 74 ft. Weight Ibs./ft. Hole Diameter 7 in. to 78 ft. Well Address 1420 82 CR W ALEXANDRIA MN 56308 BFGeological Material GRAVEL SAN DY CLAY CLAY SAN D PELE Color BROWN YELLOW BLU E Hardness MEDIUM SOFT M EDI U M From To 0 35 35 56 56 67 G RAY SOFT 67 78 Open Hole from it. to ft Screen YES Make JOHNSON Type stainless steel Diameter 4 SlotlGauze 15 Length 4 Set Between 74 ft. and 78 Stagc Water Level 16 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 40 ft after 1 hrs. pumping 40 g.p.m 06/19/2001 To NO REMARKS Well Head Completion Pitlees adapter manufacturer Model []Casing Protection [] 12 in. above grade Brun tnt er rao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No oct ere Located Minnesota Depadment of Heallh Unique Number Merilication N/A System UTM - Ned83. Zone15. Meters ons os cten| Melhod GPS SAO1f(averaged) Date N/A X: 313927 Y: 5084904 First Bedrock m ses xts + Last Slral Aqu ifar Depth tn Redreck ft `County Well Index Online Report County Well Index Online Report otrn: Ctrn Grout Material: High solids bentonite Grout Material: Cuttings wnfrem frem 0 on 0 to 30 ft. 30 to 70 ft. 3 bags ecb ve Nearesl Known Source of Contaminalion 50._.Q~feet W direction Set, tic tank/drain field Well disinfected upon completion'? [] Yes BD 0 type [] No Pump [] Not Installed Date Installed Manufecturer's name Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No [ smb = = rT = =] Variance WasavariancegrantedfromtheMDHforthiswell9 [] Yes Well Contractor Certification Weisel K m Well Co 21532 License Business Name Lic Or Reg. No. [] No WEISEL K Name of Driller 665577997777 Pima tienan Printed 9/12/2008 HE 01205 07 1.2 PM EOFSSame ld Wel Lg SOR. 06ST {1027 2085036 AI tile:///J~/~.~p%2~Rpt/Appendix%2~D%2~Muni%2~FD%2~ite%2~Summaries/A~eandria/~e~%2~L~g%2~Rep~rt%2~-%2000657977.htm[~0/27/2008 9:50:36 AM] 2233.0350 state 02827162 2233.0350 STATE_02827162  BBrrooookkllyynn CCeenntteerr o BBrrooookkllyynn BBoouulleevvaarrdd o DDuuppoonntt AAvveennuuee 22223333..00335511 STATE 02827163 STATE_02827163 SSiittee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: Site Contact: Site Contact: SSIITTEE SSUUMMMMAARRYY BBrrooookklyynn CCeenntteerr-- BBrrooookkilyynn BBoouulleevvaarrdd 6BB3rr0oo1ookkSlyyhnninCCgeleennttCeerreFFeiikrreePDDaerepkpawararttymmeenntt Brookyn Center, MN 55430 6301 Shingle Creek Parkway Brooklyn Center, MN 55430 Not specified Not specified TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XX,,YY):): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: Nearest surface water: Nearest surface water: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: FFiirree SSttaattioonn 11,,66225500 BBrrooookkllyynn BN, Blvd., BBrrooookkllyynn CCeenntteerr 447744222200..9955,, 4499990066040.848 NNoott ssppeecidffiieedd,, uussee ooff 13M ffooaamm iinn ttrraaiinniinngg aassssuummeedd QQuuaanrteerrlyy 551to0 1100 ggaallloonnss Ground. stom sewer Ground, storm sewer NNoott ssppeecciiffiieedd Twin Lakes River located 1/210 34 mle soutwest Twin Lakes River located 1/2 to 3/4 mile southwest AApppprroodxiimmaatteellyy 117/22 mmiilee 0to hthee wweesstt aanndd 1to0 tthhee eeaasstt TTrraaiinniinngg ssittee llooccaatteedd iinn ttrraannssiittiioonnoorrccoovveerreedd kkaarrsstt aarreeaa <1 mie south <1/4 mile south SSiitee sis llooccaatteedd wwiitthhiinn aa W WPPAA More than 1 mie More than 1 mile 228 22223333..00335522 STSATATTEE0_208282277116644 BBRROOOOKKLLYYNN CCEENNTTEER-R- BBRROOOOKKLLYYNN BBLLVVDD CCWWII W Weellll MMaapp 5[wieli d THEndLEEgTan ETETRRE thhel NNeste etohteecatidon 8 Brookiyn Park 12 FT 3 hiiid i SEOR e sl CUTIETy [ON PAT 1O RL LP eh = TRIER EMR TN YY ml PBT ariees B I T RO LYO NHK NT TIRAeCRaaGNuG wen ily i S B pLCa Pe PsR eNRelB8eUsCTe H yy Seed 12 EE=eiSdblilR gR oUns SeAMB eUeSESTE0 7oF al= Eusit NE E SE pd Hon CE ene Cith 1 sage E ERl E a LEAT e aealt TEaaaey i EEL CTE Lo A He Sp fae 5 ii E TSCamiL 5de 7LOT RIo E TeLRZea e A rf i # C1 EA T W en e | fe rrr ElT n 13 i Eel ie) WreUnEeea,EgunmR encE armozgyE SaY WoLn Pg Jello Lagain 22223333..00335533 state canaries STATE_02827165 : i : TE : 5.3 Ei:in ii sisi3 2i i Vv nsdildy,n5 {illariii.bafliiin a 2 ---- i : Wr 5 ii ml 0)Wn AghAgleLWH iign ES ileSi EaS g gfJ =A z a!a E / 98 j \E \ KH AJ Eley fT) |afhata e{1 entitle z Sly D> 28 TT & 3 oH hb i 2 rel El @ 7 I= i =| ! afl: fi < +AN buod I| 81: 7 Loy | aly i io = ml I iT (54 reer] IHii% 22223333..00335544 Jp-- STATE_02827166 [7 BBroroookkilyynnCCeentneterr-- BBrrooookkilyynnBBilvvdd. . | i WWhhaatt''ss IInn MMyy NNeeiigghhbboorrhhoooodd MMaapp | NG FF Amp fa Belial ego || trie eM Tn h e m re e LE id XN rien Nee || nm EE a INET 7 h| d1 | EE I oe, Se |hieee || a 7bep Vissi] ZfIoIEoY || yp \ IFis find | ins `A 3 rt rat re ft 3 | (RE RT NE || fret: Hfei FYEi,/ A/ fIli;rs us)Cl yen, | iwi oe LL sm mmm, Sea Sites |Dim opsnd sitenmi civ be acurebut cscy is otsarc No pion Disclaimer: Map and site infon'nation is believed to be accurate but accuracy is not guaranteed. No portion | fibers hea oecnt ob or wn. gldamn.The oman pres of the infolrnation should be considered to be, or used as, a legal document. The infolmation is provided subject to the express condition that the user knowingly waives any and all claims for damages against SERRA Ee Sen Eee | 1VIPCA that may arise from the use of this data. waa n aUvnopoindmeoaDbunigs. | | @Winnesota Pollution Control Agency | + as .- J a |Frames Cp 22223333..00335555 STATE 02827167 STATE_02827167 Well Log Report - 00168744 116687844744]or, Minnesota Unique Well No. County Quad Quad ID imHennepin Minneapolis North 120D WELLrAecNoDrnBORING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL/~]~[} BORING ~J~C O~J~ Minnesota Statules Chapter 1031 Well Name BROOKLYN CENTER ARBORETU -ownship Range Dir Section Subsections Elevation 119 21 W 34 CCBDBC Elevation Method 859 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 114 ft Depth Completed 114ft tBneh, Entry Date Update Da:e Received Date om 08124/1991 04/20/200T Date Well Completed 10/1311980 | Drilling Fluid ~ Wall Htdrofractured? -- J From :t to Ft Use Other (specify in remarks) [] Yes [] No Well Address 62ND AV sore go BROOKLYN CENTER MN 55429 Geological Material Color SAND BROWN SAND & GRAVEL BLACK CLAY BLACK ae SAND & GRAVEL CLAY WATERSAND GRAVEL BROWN BROWN TAN BROWN WATER SAND TAN SANDSTONE TAN en Hardness on 7p From To 0 10 10 25 25 31 | 31 58 58 64 64 77 77 80 80 107 107 114 Casing Type Steel(black or lawcarbon) Joint Threaded No Above/Below 1 fl Drive Shoe? [] Yes [] Casing Diameter Weight Hole Diameter 4 in. to 106 ft. 11 IbsJft. 4 in to 114 ft. [PERRET Open Hole from 108 fl. to 114 fl. Screen NO Make Type Diameter Slot/Gauze Length Set Between Static Water Level 8 fl from I and surface De-e Measnred 1011311,980 PUMPING LEVEL (below land surface) r rr s Shs ft. after 4 hrs. pumping 35 g.p.m. Well Head Completion Pitless adapter manufacturer Modal []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) NO REMARKS Grouting Information WelIGrouted? [] Yes [] No Located Minnesota Geological Survey Unique Number Merification Address verification System UTM Ned83, Zone15, Meters Method Digitized - scale 1:24,000 or larger (Digitizing Table) Date N/A X: 473356 Y: 4990560 Fimt Redr~k St Peter a a Ee Last Strat St.Peter Aquifer St Peter Depth to Bedrock 107 ft. County Well Index Online Report County Well Index Online Report Grout Material: Bentonite from to ft. Nearest Known Source of Contamination _feet __d~rection __type SET = i TL Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed 10100!1980 Manufacturer's name RED JACKET Model number 80C HP 1 Length of drop Pipe 63 ft. Capacity21 g.pm Type Submersible Volts 230 Material Galvanized AbandonedWells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDFIforthiswell? [] Yes [] No Well Contrador Certification Penner E.h. & Sons 11S66887a7444l4. e License Business Name fe, 02015 Lic. Or Reg. No. gums SIGAFOOS R Name of Driller Fives Printed 8/28/2OO8 HE-01205-07 stare o2s27168 tile:///J1'...20Muni o,a20FDo,/a20Siteo420Summaries/Brooklyno/o,3~, 0Center'Brooklynoza")~0Blvd/Wello,zo20Logoz;"_) 0Reporto/a20-o;/2000168744.htm[10/_')7,~008 9:58:46 AM] STATE_02827168 22223333..00335566 Wcll Log Rcport - 00203457 200384547 7]o,r Minnesota Unique Well No. County Quad Quad ID Hennepin Minneapolis North 120D WEMLLaAcNoD BORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 fBr h Entry Date Update Da:e Received Date AE 08124/1991 09/1111991 ns en Well Name HOWARD LAMKE -ownship Range Dir Section Subsections 118 21 W 3 ABBBDC onan Elevation Elevation Method Sree lo 862 ft 7 5 minute topographic map (+/- 5 feet) Well Depih Depth Completed Date Well Completed 125 ft 125 ft. 08/1111959 ~[!!I!9~g_M!P~ = :2............................................................................................................................................. fp , Drilling Fluid -Use I Wall Htdrofractured? [] Yes [] No ] From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 4 in. to 102 ft. Weight Ibs./ft. Hole Diameter Well Address 3700 COMMODORE BROOKLYN CENTER MN Open Hole from 102 fl. to 125 ft. Screen NO Make Type Geological Material NO RECORD a MUDDY SAND & GRAVEL SAND ROCK CLAY 8HALE SAND ROCK Color Hardness From To 0 82 TER 82 8 89 100 100 103 103 109 109 125 Diameter Slot/Gauze Length Static Water Level 40 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 0 ft. after hrs. pumping 15 g.p.m. 08t1~/1959 Set Between ms NO REMARKS Well Head Completion Pitless adapter manufacturer Model EET []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No anLocated Minnesota Geological Survey ATA Method Digitized - scale 1:24,000 or large[ (Digitizing Table) Unique Number Verification N/A Date NtA System UTM-Nad83, Zone15, Meters X 474112 Y 4990206 i Nearest Known Source of Cor~amination _feet _direction _type Well disinfected upon completion? oun[] Yes [] No Er Pump [] Not Inetalled Date Inetallad Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Fospes First Bedrcck es No Record pion tied) Last Strat St.Peter roe sae Aquifer St.Peter Depth to Bedrock ft. `County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification te Aamot Well Co. 220033a445577n License Business Name 2227062 Hn wie Lic Or Reg. No. Name of Driller Printed 812872008 Printed 8/28/2008 HE-01205-07 22223333..00335577 stare 02827169 STATE_02827169 WolLogReport 0203458 Wcll Log Rcport - 00203458 2o03i458s]B , f Minnesota Unique Well No. County Quad Quad ID Hennepin Minneapolis North 120D WEPLL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~]~[} ]~OR[]~C~ ~O~ Minnesota Statules Chapter 1031 Well Name Te 0 ws amen woes -ownship Range Dir Section Subsections Elevation 118 21 W 3 ABBBDC Elevation Method p=emmomenseis| LE 8 862 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 83 fl = Depth Completed 83 ft. A pi Entry Date Update Da:e Received Date 08124/1991 09/11~1991 mE Date Well Completed 12/1311955 _-------------------- Drilling Fluid -Use I Wall Htdrofractured? ~ Yes ~ No I From :t ~o Ft CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/Below0 ft. Casing Diameter Weight Hole Diameter Well Address 3700 COMMODORE DR BROOKLYN CENTER MN Geological Material PIT SAN DY CLAY Ei GRAVEL & CLAY GRAVEL & STONES PACKED CLAY & GRAVEL DECOMPOSED LIME & GRAVEL ST. PETER SANDSTONE 4 in. to &. Ibs./ft. Open Hole from it. to ft Screen YES Make JOHNSON Type Color Hardness From To 0 5 5 25 Diameter 2 Slot/Gauze Length Set Between 7.2 0 ft. and ft. BY 25 35 35 45 45 80 80 83 Stagc Water Level 83 83 40 fl from Land surface Date Measured 12t13/1955 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. To NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No Lote es tpt. tos gti. 340 Ot Located Minnesota Geological Survey Method Digitized scale 1:24,000 or larger(Digitizing Table) Unique Number Verilication N/A Date NIA System UTM- Nod83, Zone15, Meters X 474111 Y 4990230 teas - First Bedrock usr sow Eonar + Last Slral St.Peter Aquifer Depth -r) Redrock ft County Well Index Online Report County Well Index Online Report Nts Nearesl Known Source of Contaminalion _feet _direclion _lype Well disinfected upon completion'? 0 ve [] Yes 0 [] No ASR Se Pump [] Not Installed Date Installed Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m Bh Bh HP 0 Type Volts Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification pe Aamot Well Co orm bam tors License Business Name Sowms e 27062 Lic Qr Reg. No. [] No toma Name of Driller 220033445588 kes 2 Printed 8/28/2008 HE 01205 07 le. 20D0 20Sais 20 sola BIA lL gh Regt 20.200020{3124758 20085.44 AM 22223333..0033,5588 STATE 02827170 STATE_02827170 log Ron Wcll Log Rcport - 00203459 [220063445988|]z,i. Minnesota Unique Well No. 203459 County Quad Quad ID iison Hannepin Minneapolis North 120D WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 A fbi Entry Data Update Da:e Received Date 0812411991 09/1111991 Well Name nus -ownship Range Dir Section 118 21 W 3 en Subsections ABBCCB een Elevation Elevation Method Well Depih Depth Completed Date Well Completed Lr em 862 ft 7 5 minute topographic map (+/- 5 feat) 201 ft 201 ft. 11/1911955 ~[!!I!9.g..M!P~ = :2............................................................................................................................................. lee] Drilling Fluid I Well Htdrofractured? -- I From :t to Ft Use Other (specify in remarks) [] Yes [] No CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Well P.ddreas 6018 ADMIRAL PL BROOKLYN CENTER MN cs Geological Material PIT Se SAN D SAN DY CLAY CLAY & COARSE 8AND CLAY & SAND Bs HARDPAN SHALE SAND ROCK & SHALE Heme SAND ROCK & SHALE SAND ROCK & SHALE ROCK SHALE & SANDROCK c-oColor GRAY RED YELLOW RED WHITE BrBROWN BROWN Hardneas gonFrom To O 5 5 5 25 25 40 40 70 70 98 i 98 102 102 114 114 134 BE 134 162 162 184 184 201 Casing Diameter 4 in. to 183 ft. Weight Ibs./ft. Open Hole from it. to ft [om Screen Make Diameter swore Type Slot/Gauze tm Length Static Water Level 25 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 0 ft. after hrs. pumping 18 g.p.m. 11t19/1955 Hole Diameter suse Set Between -- NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade ae [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No es es tS. Stn i 4 Gi Located Minnesota Geological Survey Method Digitized - scale 1:24,000 or large[ (Digitizing Table) HEISE Unique Number Verification N/A System UTM- Nad83, Zone15, Meters Date NtA X 474042 Y 4990141 i rote sre First Bedrcck ee aw ree) Last Strat St.Peter Aquifer el.Peter Depth:o Bedrock ft County Wall Index nine Report County Well Index Online Report Nearest Known Source of Cor~amination _feet _direction _type Natant 181 Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Inatallad a Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Wall Contractor Certification To is, P= Aamot Well Co. 27062 te Foe erm License Business Name Lic Or Reg. No. [] No Name of Driller 203459 Printed BZ972008 Printed 8/28/2008 203459 HE-01205-07 el. 02000SehCn ee2l0 2g 22223333..00335590 Report 20 SOO M02 2089457 AN sate 02827171 STATE_02827171 Wcll Log Rcport - 00203460 220034560460]or, Minnesota Unique Well No. County Quad Quad ID Hennepin Minneapolis North 120D WEMLLaAcNoD BORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota S~atutes Chapter 1031 fBr h Entry Date Update Da:e Received Date AE 08124/1991 09/1111991 nn Well Name -ownship Range Dir Section Subsections 118 21 W 3 BAADCB ween Elevation Elevation Method rere 862 ft 7 5 minute topographic map (+/- 5 feet) Well Depih Depth Completed Date Well Completed 153 ft 153 ft. 11/1111957 ~[!!I!9.g..M!P~ = :2............................................................................................................................................. fp , Drilling Fluid -Use I Wall Htdrofractured? [] Yes [] No ] From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Well Address 6019 PEARSON DR ---- BROOKLYN CENTER MN Geological Material PIT CLAYISH SAN D CLAYISH SAND 5 SAN DY CLAY & GRAVEL CLAY SAN D & GRAVEL WHITE SAND & SHALE CLAY RED, WHITE, BLUE BROWN SAND & SHALE COARSE SAND SHALE & SAND Casing Diameter Weight Hole Diameter orColor BROWN RED & BROWN GRAY BROWN BLU~/HT on Hardness SOFT gon 72 From To 0 5 5 24 24 37 :37 68 91 100 68 91 100 112 112 114 114 128 128 153 [ERR Open Hole from it. to ft Screen YES Make JOHNSON Type Diameter Slot/Gauze Length Static Water Level 18 ft from Land surface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 11t1~/1957 Set Between ms NO REMARKS Well Head Completion Pitless adapter manufacturer Model EET []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No anLocated Minnesota Geological Survey ATA Method Digitized - scale 1:24,000 or large[ (Digitizing Table) Unique Number Merilication N/A Date NtA System UTM- Mad83, Zone15, Meters X 473943 Y 4990143 i Nearest Known Source of Cor~amination _feet _direction _type Well disinfected upon completion? oun[] Yes [] No Er Pump [] Not Installed Date Installed Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No fase First Bedrcck ey WO 1... Last Strat Unknowr deposit type Autor QuatBaretseAlses Aquifer Quat. BuriedArtes. Aquifer Depthto Bedrock ft. `County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No " "panics Well Contractor Certification Aamot Well Co. 22e 00334466n 00 License Business Name am 27062 Hn wie Lic Or Reg. No. Name of Driller Printed 812872008 Printed 8128/2OO8 HE-01205-07 22223333..00336600 [Ep -- STATE_02827172 log hn 255738 Wcll Log Rcport - 00255726 [C2o6o72r6s] 5|i,. Minnesota Unique Well No. 255726 County Quad Quad ID Eo Hennepin Minneapolis North 120D WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} ]~ORIN-C~ ~O~ Minnesota Statules Chapter 1031 Well Name EARL BROWN FARM 13-ownship 119 uu Range Dir Section 21 W 34 wen Subsections ADCCDD een Elevation Elevation Method Well Depih Sr em 860 ft 7 5 minute topographic map (+/- 5 feet) 148 fl Depth Completed 148 ft ffbmi Entry Date Update Da:e Received Date mm 11105/2001 04/20~200~ Date Well Completed Drilling Fluid -- E-- E ---------- Use Irdgafion I Well Htdrofractured? ~ Yes ~ No I From :t ~o Ft Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? ~ Yes ~ by No Above/Below # Oasin9 Diameter Weight Hole Diameter 10 in. to 109 &. Ibs./ft. Well Address 3200 65TH ST N BROOKLYN PARK MN 55429 (3eological Material Bs GLACIAL DRIFT ST. PETER SANDSTONE PRAIRIE DU CHIEN GROUP rer REMARKS GAMMA LOGGED 11 5 2001. te noir Located Minnesota Geological Survey Unique Nu'~ber Varilication Address verification System UTM - Ned83, Zone15, Meters Open Hole from 109 fl. to 148 fl. Cums Screen NO Make Diameter Swans Type Slot/Gauze Color Hardness From To "Ed - 0 85 114 65 114 148 Static Water Level )) fl from I end surface Date Meas~Jred PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. leh Length 111051#001 oGsoommones Bsowtomen Well Head Completion Pitless adapter manufacturer Modal []Casing Protection [] 12 in. above grade EE a []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No te Ste Se 40) Method Digitization (Screen) Map (1:24,000) Date N/A X: 474577 Y 4991109 Nearest Known Source of Contamination _feet __direction __type Well disinfected upon completion? [] Yes [] No SuBeen Set Between Pump [] Not Installed Date Installed Manufaclurer'sname Model number__ HP_ Volta Length 01drop Pipe_ft. Capacity_g.p.m Type Material AbandenedWells Does property have any not in use and not sealed well(s)1 [] Yes [] No First Redrce, k St Peter ri pean 205 Last Slrat Prairie Du Chien Group Aquifer St.Peter-Prairie Du Chien Depth to Bedrock 85 ft. County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification Minnesota Geoloaical Survey 22555e 5772266e License Business Name MG~S pin wives Lic. Or Reg. No. Name of Driller Printed 8/28/2008 Printed 8/28/2008 HE-01205-07 el. 02040Seh Cn eel 20 2g 22223333..00336611 Report 20 50S26 02 2085548 AN state 02827173 STATE_02827173 Well Log Report - 00417038 ae] Minnesota Unique Well 417038 No. g=,,County Quad Quad ID J Hennepin Minneapolis North 120D WEHLLiANvDIBONRIG MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} ]}ORI]~G 1~1~ C O~]~ Minnesota Statules Chapter 1031 EfmR Entry Date Update Da:e Received Date on08124/1991 04/20/2007 VVell Name LES CAULT, JOHN -ownship Range Dir Section Subsections Elevation 119 21 W 34 DCDBAB Elevation Method Well Depih Depth Completed Date Well Completed 860 ft 7 5 minute topographic map (+/- 5 75 ft 75 ft. 06/1911985 feet) ffm ------ Drilling Fluid -Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or bwcarbon) Joint Threaded No Above/Below 1 ft Drive Shoe? [] Yes [] Casing Diameter Weight Hole Diameter Well Address 3507 62ND AV N m%as EBae PBRROOOOKKLAYNN cCErNTTeERR tMnN 5420 55429 Geological Material SAN D & GRAVEL Color BROWN CLAY BLU E SAN D YELLOW SAN DY CLAY G RAY SAN D BROWN ROCK BROWN SAN DROCK WHITE EmrLD0 Hardness SOFT From 0 M EDI U M 19 SOFT 30 M EDI U M 34 SOFT 53 HARD 60 SOFT 63 4 in. Lo 70 ft. 12 Ibs./ft. Le ---- Open Hole from it. to ft Screen YES Make JOHNSON Type stainless sleel To E3 le a we ween 19 Diameter SlotlGauze Length Set Between 30 2 8 5 70 ft. and 75 34 53 60 63 75 Static Water Level 20 fl from Land surface Date Measured 06119/1985 PUMPING LEVEL (below land surface) 20 ft after 2 hrs. pumping 30 g.p.m oe NO REMARKS EEel ianD Well Head Completion Pitless adapter manufacturer WATERWATER []Casing Protection [] 12 in. above grade Model [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No SU55 os res amis Located Minnesota Geological Survey www Unique Number Verilication Address ,~erification ,System UTM - Ned83, Zone15, Meters 0 sn 2400rpy| Gt a enn Method Digitized scale 1:24,000 or larger(Digitizing Grout Material: Neat Cement Grout Material: Bentonite from 0 to 55 ft. fons from 55 to te:70 ft. von ves Table) Date N/A X: 474311 Y: 4990482 Nearesl Known Source of Conlaminalion 50_.9._feet N direction Septic tank/drain field Er Well disinfected upon completion? [] Yes type [] No Pump [] Not Installed Dale Installed 06120!1985 Coteil Srme rn Manufaclurer'snameAERMCTOR Model numberSD1250 HP0.5 Volts 11~5 Length of drop Pipe 40 ft. Capacity12 g.pm Type Submersible Material Plastic Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No First Bedrock St Peter Aquifer St Peter `County Well Index Online Report Last Slral St.Peter Depth to Bedrock 63 ft. County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Mc Aleine's Well Co. 27186 MCALPINE G. 441177003388 License Business Name Printed 572072008 Lic Or Reg. No. Name of Driller Printed 8/28/2008 HE 01205 07 sme camara tile:///JI '...20Muni oJ;20FDo,/;20Site o420Summaries/Brooklyno/,o,3~, (ICenter'Brooklynoi;~~0Blvd/Well o~zo20Log oz;9_0Reporto/~20- o/;20004 ] 7038.htm[10/_')7,~~)008 9:58:48 AM] STATE_02827174 22223333..00336622 Site Name: Site Name: FFiirree DDeeppaarrttmmeenntt:: Site Contact: Site Contact: SSIITTEE SSUUMMMMAARRYY BBrrooookkilyynn CCeenntteerr-- DDuuppoonntt AAvveennuuee NNootrthh 6BB3rr0oo1ookkSlyyhnninCCgeleennttCeerreFFeiikrreePDDaerepkpawararttymmeenntt Brookyn Center, MN 55430 6301 Shingle Creek Parkway Brooklyn Center, MN 55430 Not specified Not specified TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: FFiiret SSttaattioonn 22,, 66550000 DDuuppoonntt AAvveennuuee NNoorrtthh,, BBrrooookkllyynn CCaanntteerr 447768882277.4477,, 44999911110089..8811 NNoott ssppeecidffileedd,, uussee ooff 13M ffooaamm iinn ttrraaiinniinngg aassssuummeedd QQuuaanrteerrlyy 551to0 1100 ggaallloonnss Ground. stom sewer Ground, storm sewer NNoott ssppeecciiffiieedd MMiissssiissssiippppii RRiivveerr llooccaatteedd 112/221to033/4 mmiille eeaasstt 111/221to0 33/64 mmiilee wweesstt TTrraaiinniinngg ssittee llooccaatteedd iinn ttrraannssiittiioonnoofrccoovveerreedd Kkaarrsstt aarreeaa. <1 mie south <1/4 mile south SSiitee sis llooccaatteedd wwiitthhiinn WWPPAA More than 1 mie More than 1 mile 228 22223333..00336633 STATE02827175 STATE_02827175 (CEBBRROOOOKKLLYYNN CCEENNTTEERR-- DDUUPPOONNTT AAVVEENN CCWWII WWeellll M Maapp ERs ova = Cl Ll LT ea raCChepl hAeN PR- Pitta anil ony DNhe dal re Te ; Ye SPE iE ie EL A > E' em3 mi NEi E EPeeL B himh B NEaSeTEME AE ees EHRaLy yf lire w Pal l A aE nE ell ga ErEeE megemrea. T +h erd rr Um RE LY i" i! my nd Lo oT ! id 8 8 I'm rpmsupateocoresen EL] [lod LCE in 22223333..00336644 STATE_02827176 i Vv 5 1| ny. =E| lf 8| Esl 2zifd Z| : i : al 3 3&,5, 5, 3i: fil ii til3 :i dGdir,gjiig hPi aiak b d3fei3s iiss a wen some on 7 \{ : 38 l 13 Ll re PRHN QWiE ER Nee .aanidt: l} Se Ema h -- lge--_i ---- Fati| [|: of:: HE FE 3 2g 31 8| bBarin a)on dletiaISag ww = 5 ORof ok 4 Ny ! N\I| Nad fi das 18 FH FS isffm Kg gsaS % i \ iiB NOEN:E | | = = ow 2 22223333..00336655 stareo2827177 STATE_02827177 [ BBroroookkilyynnCCenetnetrer-- DDuuppoonnttAAvveennuuee NN.. i Sinaia Ni WWhhaatt''ss IInn MMyy NNeeiigghhbboorrhhoooodd MMaapp i EEE Blast { TY || L2Y . ~i p TodT | , perk Lo aL os Se hes i i THA Yoriihed | ; 1 rl rene iy hdd ESE Ee A. ii Zr ETE bi i BALL ITY / /i 7z || 7 i ified Fine gn ery 1 f - i Ly lib ii7 SS e T tn di mSee Raia Sra fidiarc) W edE e TRYT Sf A ERT Disclaimer: Map and site information is believed to be accurate but accuracy is not guaranteed. No portion IRENE IS I| of the infolrnation should be considered to be, or used as, a legal document. The infolmation is provided subject to the express condition that the user knowingly waives any and all claims for damages against | IRIRy em am dn 1VIPCA that may arise from the use of this data. a Sot Sitespets =Poianasown vsommsacungs. wes: ocoro ] @innesota Pollution Control Agency | JPEa + ReRaTaRFacies +FsSeR soesssommmonsn&Carp 22223333..00336666 STATE 02827178 STATE_02827178 Well Log Report - 0014983 l 11449988331 Minnesota Unique Well No. o|r,County Quad Quad ID =Hennepin Minneapolis North 120D WEMLLaAcNoD BORING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} I}ORI]~G I~J~C O~a~ Minnesota Statules Chapter 1031 Well Name CISON, LEONARD -ownehip Range Dir Section Subsections Elevation 119 21 W 36 DCBCCB Elevation Method 841 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 124 ft Depth Completed 124 ft. Btneh, Entry Date Update Da:e Received Date 4s 08123/1991 041201209T Date Well Completed 07/1311978 SEE Well Address 6218 CAMDEN AV N BROOKLYN CENTER MN 55428 Em, Drilling Fluid -Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or bwcarbon) Joint Threaded No Above/Below 1 ft Drive Shoe? [] Yes [] Casing Diameter Weight Hole Diameter rree------| 4 in. [o 97 ft. 10.79 Ibs/ft. Open Hole from 9T ft. to 124 fh 4 in. te 124 ft. Screen NO Make Type Geological Material Zn SAND GRAVEL GLENWOOD SANDSTONE PLATTEVILLE Color Hardness From To TEE 0 18 97 120 18 97 120 124 Diameter 0 Slot/Gauze Length 1 Set Between 2712 ft. and 2778 ft. Static Water Level 25 ft from Land surface Date Measured PUMPING LEVEL (below land surface) ft. after 3 hrs. pumping 40 g.p.m. 07113/1978 ms NO REMARKS everest Located Minnesota Geological Survey Method Digitized Table) scale 1:24,000 or larger(Digitizing wri Unique Number Merilication Address verification ,System UTM - Ned83, Zonal5, Meters ie ws Date N/A 477292 Y: 4990544 atsestin J First Bedrock St Peter my Last Slral Prairie Du Chien Group Aquifer St.Peter-Prairie Du Chien Depth to Bedrock 97 ft. County Wel Index Online Report County Well Index Online Report Well Head Completion Le o o ma Pitless adapter manufacturer CLAYTON-MARK []Casing Protection [] 12 in. above grade Model [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Grout Material: Bentonite from to ft. BT Co Nearesl Known Source of Conlaminalion __feet _direction _type Well disinfected upon completion? Gun[] Yes ith[] No mE Ce hi Pump [] Not Installed Dale Installed 07113!1978 Manufacturer's name RED JACKET Model number 8CC HP 1 Length of drop Pipe 54 ft. Capacity20 g.pm Type Submersible Volts 23._D.0 Material Galvanized Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification at wm Rennet E.H & Sons 27015 Sm ZB, Sm License Business Name Lic Or Reg. No. [] No WOLTERS P Name of Driller 114499883311 PrPirnintteedd 9917227/22000088 HE 01205 07 stare 0287179 ti~e:///J~..~;2~lMt~ni~/~2~lFD?/~2(lSite~2~S~nmaries/Br~k~n~/~2~lCenter/Dt~p~nt~2~)A~'~w~e~/~2(lL~g~2l)Rep~rt('/"2(l-~2~l~l(l~49831 .htm[10/27/2008 10:04:09 AM] STATE_02827179 22223333..00336677 Wcll Log Rcport - 00203322 2003383222 Minnesota Unique Well No. o|r:County Quad Quad ID iHennepin Minneapolis North 120D WELLrAecNoDrnBORING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~i~D I}OR[]~C~ ~O~ Minnesota Statules Chapter 1031 tBneh, Entry Data Update Da:e Received Date om 08124/1991 04/20~200~ Well Name NELSON, A. 1 cm ee -ownehip Range Dir Section Subsections Elevation 119 21 W 36 CACBBD Elevation Method Well Depih Depth Completed Date Well Completed preenstlp 850 ft 7 5 minute topographic map (+/- 5 114 ft 114ft 08/1511959 feet) ~=~ ~ = ~P~5~........................................................................................................................... Drilling Fluid -Use Domestic t=I Well Htdrofractured? I From :t to Ft ~ Yes B No Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? ~ Yes ~ No Above/Below # Casing Diameter Weight Hole Diameter 3 in. to K. Ibs./ft. Well Address 6407 DUPONT AV N BROOKLYN CENTER MN 55430 Open Hole from it. 1o [t Screen NO Make Type Geological Material SAN D Ee CLAY SAN D 8AN D & CLAY SAN DSTON E Oolor =BLUE BROWN YELLOW Hardness From To 0 14 fi 14 52 52 68 68 90 90 114 rT REMARKS DRILLED BY C. WUNDERLICH. everest Located Minnesota Geological Survey Method Digitized Table) scale 1:24,000 or larger(Digitizing Unique Number Merilication Address verification Date N/A System UTM - Ned83, Zone15, Meters 476869 Y: 4990838 First Redr~k St Peter a a Si. Last Strat St.Peter Aquifer StPeter Depth to Bedrock 90 ft. County Well Index Online Report County Well Index Online Report Diameter Slot/Gauze Length Set Between Static Water Level 31~ fl from I and surface Date Meas~Jred (~8115/195 PUMPING LEVEL (below land surface) 30 ft after 2 hrs. pumping 30 g.p.m reeee so Well Head Completion Pitless adapter manufacturer Modal rs Shs []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) REE Grouting Information WelIGrouted? [] Yes [] No cotta writin Grout Material: Well grauted, type unknawn 0 8 from to ft. Nearest Known Source of Contamination _feet __direction __type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufacturer's name Model number__ HP_ Volts Length of drop Pipe_ft. Capaci~y_g.p.m Type Material AbandonedWells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contrador Certification Minnesota Deob of Natural Resources 2200333322s22 s License Business Name 8 MNDNR Lic. Or Reg. No. nw Name of Driller Fives Printed 8/28/2008 HE-01205-07 22223333..00336688 stare 02827180 STATE_02827'180 Wcll Log Rcport - 00203327 2008333277 Minnesota Unique Well No. oJr,Caunty Quad Quad ID Hennepin Minneapolis North 120D WEMLLaAcNoD BORING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~i~[} I}ORII~G ~O~ Minnesota Statules Chapter 1031 Etne., Entry Data Update Da:e Received Date om 08124/1991 04/20~200~ Well Name STARK, DON Well Depih Depth Completed Date Well Completed 10 com pt ent -ownship Range Dir Section Subsections Elevation 119 21 W 36 CDAADB Elevation Method 838 ft 7 5 minute topographic map (+/- 5 110 ft 110 ft. 08/161195~ feet) ~=~ ~ = ~e~ ..................................................................................................................................... , Drilling Fluid -Use Domestic I Wall Htdrofractured? ~ Yes ~ No I From :t to Ft Casing Type Galvanized Jont No Information Drive Shoe? ~Yes ~No AbovetBelow Casing Diameter Weight Hole Diameter 2 in. to ~. Ibs./ft. Well Address 6306 CAMDEN AV N fp ow BROOKLYN CENTER MN 55430 Geological Material Color SAND CLAY BROWN SAN D BROWN SANDSTONE wg Hardness From To 0 18 18 79 79 101 HARD 101 110 Trem REMARKS WELL DRILLED BY C. WUNDERLICH. Located Minnesota Geological Survey Unique Nu'~ber Verification Address verification System UTM - Nad83, Zone15, Meters A Method Digitized Table) -- scale 1:24,000 or larger(Digitizing Date N/A )~: 477216 Y: 4990639 rr --_---- First Bedrcck St Peter ns i. Last Slrat St.Peter Aquifer St Peter Depth to Bedrock 101 ft. `County Well Index Online Report County Well Index Online Report Open Hole from it. Screen NO Make Diameter nn to ft Type Slot/Gauze wnLength seo Set Between Static Water Level 29 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 29 ft after 2 hrs. pumping 10 g.p.m 08t16/1956 Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade oom rer Vee [] At-grade (Environmental Wells and Grouting Information WelIGrouted? GeBorings [] Yes GeONLY) [] No Grout Material: Well grouted, type unknown from to ft. i Nearest Known Source of Cortamination _feet _direction _type Well disinfected upon completion'? oun[] Yes [] No Pump [] Not Installed Date Installad Manufacturer's name Length of drop Pipe_ft. Model number_ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification basins, 18. Minnesota Deoh of Natural Resources MNDNR fr ry 5 License Business Name Lic. Or Reg. No. Name of Driller 220033332277 Printed 91272008 Printed 9t2/2OO8 HE-01205-07 22223333..00336699 [p-- STATE_02827181 Well Lg Ror 020528 Wcll Log Rcport - 00203328 [2200338288],|i. Minnesota Unique Well No. 203328 County Quad Quad ID ii se Hannepin Minneapolis North 120D WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL/~]~[} I}ORII~G ~J~C O~J~ Minnesota Statules Chapter 1031 fobyi Entry Data Update Da:e Received Date um 08124/1991 0412012007 Well Name ov -ownship Range Dir Section 119 21 W 36 ove Subsections CDACDB vee Elevation Elevation Method Well Depih Depth Completed Date Well Completed RFmm] 840 ft 7 5 minute topographic map (+/- 5 feat) 106 ft 106 ft. 10/2111955 Em e-- Drilling Fluid -Use Domestic ~ Wall Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Galvanized Jont No Information Drive Shoe? []Yes []No AbovetBelow ft. Casing Diameter Weight Hole Diameter 2 in. to ft. Ibe./ft. Well Address 6221 CADMEN AV N esos es coven BROOKLYN CENTER MN 55430 Geological Material Color Hardness SAND CLAY BROWN SAND GRAVEL SANDSTONE ponFrom To 0 39 39 84 84 96 96 108 rrTT---- REMARKS WELLDRILLEDBYC. WUNDERLICH. ct nett Located Minnesota Geological Survey Unique Nu'~ber Marilication Address verification System UTM - Mad83, Zone15, Meters Ws Method Digitized Table) nas scale 1:24,000 or larger(Digitizing Date N/A )~: 477221 Y: 4990575 rr --_---- First Bedrcck St Peter xo sew San Last Slrat St.Peter Aquifer St Peter Depth to Bedrock 96 ft. County Well IndexOnline Report County Well Index Online Report Open Hole from it. Cur Screen NO Make Diameter to ft Saas Type Slot/Gauze lah Length SuBaen Set Between Static Water Level 29 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 29 ft after 1 hrs. pumping 10 g.p.m 10t2~/1955 Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade a Gr [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Grout Material: Well grouted, type unknown from to ft. Vor siren_@ v8 Nearest Known Source of Cortamination _feet _direction _type Well disinfected upon completion'? [] Yes xe [] No Pump [] Not Installed Date Installed Manufacturer's name Length of drop Pipe_ft. Model number_ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification RL Minnesota Deoh of Natural Resources MNDNR a ote msi License Business Name Lic. Or Reg. No. Name of Driller 220033332288 Prinled 5/2/2008 Printed 9t2/2OO8 HE-01205-07 lMFY03ST30s Dien 00 l SqnL 204 OOS 1037 20810310 AM) sare 02627182 STATE_02827182 22223333..00337700 Wall Lg Ror 0203529 Wcll Log Rcport - 00203329 [2200338298],|i. Minnesota Unique Well No. 203329 County Quad Quad ID ii E Hannepin Minneapolis North 120D WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~i~[} I}ORING ~J~C O~J~ Minnesota Statules Chapter 1031 fobyi Entry Data Update Da:e Received Date um 08124/1991 0412012007 Well Name ov -ownship Range Dir Section 119 21 W 36 cvs Subsections CDADAB vee Elevation Elevation Method Well Depih Depth Completed Date Well Completed BFmm] 840 ft 7 5 minute topographic map (+/- 5 feat) 110 ft 110 ft. 09/2911955 Em e-- Drilling Fluid -Use Domestic ~ Wall Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Galvanized Jont No Information Drive Shoe? []Yes []No AbovetBelow ft. Casing Diameter Weight Hole Diameter 2 in. to ft. Ibe./ft. Well Address 6227 CADMEN AV N esos es co BROOKLYN CEN,ER MN 55430 Geological Material Color SAND CLAY BROWN SAND GRAVEL SANDSTONE van Hardness pom To From To 0 41 41 86 86 101 101 110 em REMARKS WELLDRILLEDBYC. WUNDERLICH. ct nett Located Minnesota Geological Survey Unique Nu'~ber Marilication Address verification System UTM - Mad83, Zone15, Meters Ws Method Digitized Table) nas scale 1:24,000 or larger(Digitizing Date N/A )~: 477204 Y: 4990594 ct se resr First Bedrcck St Peter xo sew paint Last Slrat St.Peter Aquifer St Peter Depth to Bedrock 101 ft. County Well IndexOnline Report County Well Index Online Report Open Hole from it. Cur Screen NO Make Diameter to ft Saas Type Slot/Gauze lah Length SuBaen Set Between Static Water Level 29 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 29 ft after 1 hrs. pumping 10 g.p.m 09t29/1955 Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade oem ms Voce [] At-grade (Environmental Wells and Grouting Information WelIGrouted? GoBorings [] Yes GeONLY) [] No Grout Material: Well grouted, type unknown from to ft. Vor siren_@ v8 Nearest Known Source of Cortamination _feet _direction _type Well disinfected upon completion'? [] Yes xe [] No Pump [] Not Installed Date Installed Manufacturer's name Length of drop Pipe_ft. Model number_ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification RL Minnesota Deoh of Natural Resources MNDNR esa ote msi License Business Name Lic. Or Reg. No. Name of Driller 220033332299 Prinled 5/2/2008 Printed 9t2/2OO8 HE-01205-07 lMFY 03ST 30s Dien 00 l SqnL 204 O05 i107 20810311 AM tile:///JI,'...%20Muni%20FD%20Site%20Summaries/Brooklyn%20Center/Dupent%20Av/Well%20I=og%20Report%20-%2000203329.htm [10/27/2008 10:04: ll AM] sTaTe 02627183 STATE_02827183 22223333..00337711 log hon Wcll Log Rcport - 00203330 [2200383330 0]J,z. Minnesota Unique Well No. 203330 County Quad Quad ID ii se Hennepin Minneapolis North 120D WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~i~[} BORIN(~ ~O~ Minnesota Statules Chapter 1031 ffbmi Entry Date Update Da:e Received Date WE 08124/1991 04/20~200~ Well Name 13-ownship 119 un Range Dir Section 21 W 36 ons Subsections CDADDC een Elevation Elevation Method Well Depih Depth Completed Date Well Completed LT em 841 ft 7 5 minute topographic map (+/- 5 105 ft 105 ft. 08/1911955 feet) ~=~ ~ = ~e~ ..................................................................................................................................... C-- R -------- Drilling Fluid -Use Domestic I Wall H/drofractured? ~ Yes ~ No I From :t to Ft Casing Type Galvanized Jont No Information Drive Shoe? ~Yes ~No AbovetBelow Casing Diameter Weight Hole Diameter 2 in. to ~. Ibs./ft. Well Address 6215 CADMEN AV N TERRA BROOKLYN CENTER actos aes eeological Material Slberone SAND CLAY SANDSTONE ase MN 55430 [Epolor BROWN From To io 0 35 35 88 88 105 pos Open Hole Screen NO from it. Make Diameter to ft Type Slot/Gauze om Length Static Water Level 29 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 29 ft after 1 hrs. pumping 10 g.p.m 08t19/1955 Set Between rrTT---- REMARKS WELLDRILLEDBYC. WUNDERLICH. cet Located Minnesota Geological Survey Unique Nu'~ber Verification Address verification System UTM - Mad83, Zone15, Meters BiMethod Digitized Table) tn scale 1:24,000 or larger(Digitizing Date N/A )~: 477231 Y: 4990557 ea e er First Bedrcck St Peter reiad Aquifer St Peter County Wall Index rine Report Last Slrat St.Peter Depth to Bedrock 88 ft. County Well Index Online Report Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade ae [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Grout Material: Well grouted, type unknown from to ft. Na tant Nearest Known Source of Cortamination _feet _direction _type Well disinfected upon completion'? 181 [] Yes [] No Pump [] Not Installed E, ete Installed Manufacturer's name Length of drop Pipe_ft. Model number_ Capacity_g.p.m HP_ Type Volts Materiel Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification ee eae Minnesota Deoh of Natural Resources MNDNR esa ote msi License Business Name Lic. Or Reg. No. Name of Driller 220033333300 Pred S208 Printed 9t2/2OO8 HE-01205-07 el. 20 EP 0500S mei Cont op0A el Lg Reet 204 20005530027 00 160.11 AM) tile:///Jl/...%20Muni?/;20FD%20Site%20Summaries/Brooklyn%20Center/Dupont%20Av/Well%20Log%20Report%20-%2000203330.htm [10/27/2008 10:04: ll AM] 2233.0072 state 02827184 2233.0372 STATE_02827184 log hn 30530 Wcll Log Rcport - 0020333 l [220038333181]J,z Minnesota Unique Well No. 203331 County Quad Quad ID iwise Hennepin Minneapolis North 120D WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL/~]~[} ~0~-~]~- ~O~ Minnesota Statules Chapter 1031 ffbmi Entry Date Update Da:e Received Date WE 08124/1991 04/20~200~ Well Name MORKLEY, GENE -ownehip 119 Range 21 Dir Section W 36 etJ Subsections Elevation CDBCCB Elevation Method Well Depih Depth Completed Date Well Completed A 1. ------ 846 ft 7 5 minute topographic map (+/- 5 58 ft 58 ft. 09/151195~ feet) ~=~ ~ = ~e~ ..................................................................................................................................... C-- R -------- Drilling Fluid -Use Domestic I Wall Htdrofractured? ~ Yes ~ No I From :t b Ft Casing Type Galvanized Jont No Information Drive Shoe? ~Yes ~No AbovetBelow Casing Diameter Weight Hole Diameter 2 in. to &. Ibs./ft. Well Address 6218 DUPONT AV N TEA mason BROOKLYN CENTER MN 55430 gpa Geological Material SAND & GRAVEL CLAY en sean sano WATER BEARING SAND wo -- Color oeBLUE From FI0 19 50 foes Open Hole from Screen Make Diameter it. 1o Type ft Slot/Gauze om Length To 19 50 58 Static Water Level 32 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 33 ft after 1 hrs. pumping 15 g.p.m 09t15/1956 Set Between -- NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade ae [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No ct nt Located Minnesota Geological Survey oo ot ts Unique Nu'~ber Merification Address verification System UTM Ned83, Zone15, Meters 20 er Method Digitized - scale 1:24,000 or larger (Digitizing Table) 0 Date N/A X: 476886 Y: 4990566 i rut ct eee re First Bedrcck we NGS LastStrat Sand Aquifer Quat. BuriedArtes. Aquiler Depthto Bedrock ft. County Wall ndex Online Report County Well Index Online Report Nearest Known Source of Cortamination _feet _direction _type Vor siren_@ v8 xe Well disinfected upon complehon? [] Yes [] No Pump [] Not Installed Date Installed a Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification is a po Pumarlo Well Co. 27023 err She mene License Business Name Lic Or Reg. No. [] No PUMARLO. M Name of Driller 220033333311 PPrrinetedd S9t22/20OO88 HE-01205-07 el. 20 EP 0500S mei Cont op0A el Lg Reet 204 20020551 bn 029 00 160.11 AM) tile:///Jl,'...%20Muni%20FD%20Site%20Summaries/Brooklyn%20Center/Dupont%20Av/Well%20Log%20Report%20-%2000203331 .htm [10/27/2008 10:04:11 AM] 2233.0073 state 02827185 2233.0373 STATE_02827185 WallogReport Wcll Log Rcport - 00203333 [2200383338 8]|,i. Minnesota Unique Well No. 203333 County Quad Quad ID iwise Hannepin Minneapolis North 120D WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~i~[} I}ORII~G ~J~C O~J~ Minnesota Statules Chapter 1031 fobyi Entry Data Update Da:e Received Date um 08124/1991 0412012007 Well Name STRUCK, DON nv -ownship Range Dir Section 119 21 W 36 om Subsections DCBBCC vies Elevation Elevation Method Well Depih Depth Completed Date Well Completed SFmm] 838 ft 7 5 minute topographic map (+/- 5 feat) 105 ft 105 ft. 05/1711956 Em e-- Drilling Fluid -Use Domestic ~ Wall Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Galvanized Jont No Information Drive Shoe? []Yes []No AbovetBelow ft. Casing Diameter Weight Hole Diameter 2 in. to ft. Ibe./ft. Well Address 6230 CADMEN AV N esos es co BROOKLYN CEN,ER MN 55430 Geological Material Color SAND CLAY BROWN SAND & GRAVEL SANDSTONE van Hardness pom To From To 0 31 31 85 85 91 91 105 rrTTT---- REMARKS DRILLEDBYC. WUNDERLICH. ct nett Located Minnesota Geological Survey Unique Nu'~ber Marilication Address verification System UTM - Ned83, Zone15, Meters Ws Method Digitized Table) nas scale 1:24,000 or larger(Digitizing Date N/A )~: 477246 Y: 4990614 rr --_---- First Bedrcck St Peter xo sew Rana, Last Slrat St.Peter Aquifer St Peter Depth to Bedrock 91 ft. County Well IndexOnline Report County Well Index Online Report Open Hole from it. Cur Screen NO Make Diameter to ft Saas Type Slot/Gauze lah Length SuBaen Set Between Static Water Level 29 ft from Land surface Date Measured PUMPING LEVEL (below land surfaae) 29 ft after 2 hrs. pumping 10 g.p.m 05t17/1956 Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade a Gr [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Grout Material: Well grouted, type unknown from to ft. Vor siren_@ v8 Nearest Known Source of Cortamination _feet _direction _type Well disinfected upon completion'? [] Yes xe [] No Pump [] Not Installed Date Installed Manufacturer's name Length of drop Pipe_ft. Model number_ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification RL Minnesota Deoh of Natural Resources MNDNR esa ote msi License Business Name Lic. Or Reg. No. Name of Driller 220033333333 Prinled 5/2/2008 Printed 9t2/2OO8 HE-01205-07 lMFY 03ST 30s Dien 00 l Sqn 2L 04 OOS i107 20810312 AM tile:///J~..~2(lMt~ni~/~2~lFD?/~2(lSite~2~St~nmaries/Br~k~n~/~2(lCenter/Dt~p~nt~2~A~'~w~e~/~2(lL~gq~2l)Rep~rt('/"2(l-q~2(l(l(l2~t3333~htm[~ 0/27/2008 10:04:12 AM] STATE 02627186 STATE_02827186 22223333..00337744 WallogReport. Wcll Log Rcport - 00203334 [2200333344],|. Minnesota Unique Well No. 203334 County Quad Quad ID iwise Hennepin Minneapolis North 120D WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~i~D I}OR[]~C~ ~O~ Minnesota Statules Chapter 1031 ffbmi Entry Date Update Da:e Received Date WE 08124/1991 04/20~200~ VVell Name 13-ownehip 119 un Range Dir Section 21 W 36 oe Subsections DCBCBB ween Elevation Elevation Method Well Depih Depth Completed Date Well Completed Lr em 840 ft 7 5 minute topographic map (+/- 5 111 ft 111 ft 12/2911955 feet) ~=~ ~ = ~e~ ..................................................................................................................................... Drilling Fluid -- ree Use Domestic I Wall H/drofractured? ~ Yes ~ No I From :t to Ft Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? ~ Yes ~ by No Above/Below # Casing Diameter Weight Hole Diameter 2 in. to K. Ibs./ft. Well Address 6224 CADMEN AV N tes ni res BROOKLYN CENTER MN 55430 Geological Material Color seme SAND CLAY SAND GRAVEL SANDSTONE BROWN pon gp From To Low 0 38 38 81 81 100 100 111 Ei -- REMARKS DRILLEDBYC. WUNDERLICH. ct en rpt Located Minnesota Geological Survey Unique Number Merilication Address verification System UTM - Ned83, Zone15, Meters dO Method Digitized Table) 20 r scale 1:24,000 or larger(Digitizing Date N/A 477275 Y: 4990588 First Redr~k St Peter ee EN we Last Strat St.Peter Aquifer St Peter Depth to Bedrock 100 ft. County Well Index Online Report County Well Index Online Report Open Hole from it. [Pe Screen NO Diameter Make 1o [t etn Type Slot/Gauze ow Length sat Set Between Static Water Level 2g fl from I end surface Date Meas~Jred lP179/1955 PUMPING LEVEL (below land surface) 29 ft after 1 hrs. pumping 10 g.p.m oGsoommones Bsowtomen Well Head Completion Pitless adapter manufacturer Modal []Casing Protection [] 12 in. above grade EE a []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No ms. Wo tein Grout Material: Well grauted, type unknawn a from to ft. Nearest Known Source of Contamination _feet __direction __type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufacturer's name Model number__ HP_ Volts Length of drop Pipe_ft. Capaci~y_g.p.m Type Material AbandonedWells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contrador Certification Minnesota Deob of Natural Resources 220033333344 ---- License Business Name MNDNR Shen essa Lic. Or Reg. No. Name of Driller EE] Printed 9t2/2008 HE-01205-07 el. EP 0500S mei Cont op0A el Lg Reet20420003534027 0 16012AM) state 02827187 22223333..00397755 STATE_02827187 Wallog Report 35 Wcll Log Rcport - 00203335 [22003383835 8]|,. Minnesota Unique Well No. 203335 County Quad Quad ID iwise Hannepin Minneapolis North 120D WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~i~[} I}ORII~G ~J~C O~J~ Minnesota Statules Chapter 1031 fobyi Entry Data Update Da:e Received Date um 08124/1991 0412012007 Well Name STARK, DON ov -ownship Range Dir Section 119 21 W 36 ow Subsections DCBCCB vee Elevation Elevation Method Well Depih Depth Completed Date Well Completed SFmm] 841 ft 7 5 minute topographic map (+/- 5 feat) 114 ft 114 ft. 0510811956 Em e-- Drilling Fluid -Use Domestic ~ Wall Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Galvanized Jont No Information Drive Shoe? []Yes []No AbovetBelow ft. Casing Diameter Weight Hole Diameter 2 in. to ft. Ibe./ft. Well Address 6218 CAMDEN AV N esos es coven BROOKLYN CEN,ER MN 55430 Geological Material Color Hardness SAND CLAY BROWN SAND & GRAVEL SANDSTONE ponFrom To 0 36 36 88 88 91 91 114 rrTTT---- REMARKS DRILLEDBYC. WUNDERLICH. ct nett Located Minnesota Geological Survey Unique Nu'~ber Marilication Address verification System UTM - Mad83, Zone15, Meters Ws Method Digitized Table) nas scale 1:24,000 or larger(Digitizing Date N/A )~: 477283 Y: 4990560 rr --_---- First Bedrcck St Peter xo sew Rana, Last Slrat St.Peter Aquifer St Peter Depth to Bedrock 91 ft. County Well IndexOnline Report County Well Index Online Report Open Hole from it. Cur Screen NO Make Diameter to ft Saas Type Slot/Gauze lah Length SuBaen Set Between Static Water Level 29 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 29 ft after 2 hrs. pumping 10 g.p.m 05t08/1956 Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade a Gr [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Vor siren_@ v8 Nearest Known Source of Cortamination _feet _direction _type Well disinfected upon completion'? [] Yes xe [] No Pump [] Not Installed Date Installed Manufacturer's name Length of drop Pipe_ft. Model number_ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification RL Minnesota Deoh of Natural Resources MNDNR esa ote msi License Business Name Lic. Or Reg. No. Name of Driller 220033333355 Prinled 5/2/2008 Printed 9t2/2OO8 HE-01205-07 lMFY 03ST 30s Dien 00 l Sqn 2L 04 OOS i107 20810315 AM ti~e:///J~..~2(lMt~ni~/~2~lFD?/~2(lSite~2~St~nmaries/Br~k~n~/~2(lCenter/Dt~p~nt~2~A~'~w~e~/~2(lL~g~2l)Rep~rt('/"2(l-~2(l(l(l2~t3335~htm[~ 0/27/2008 10:04:13 AM] sraTe 02627188 STATE_02827188 22223333..00337766 log on 02320 Wcll Log Rcport - 00226206 Minnesota Unique Well No. oe |222266220066 | Tr County Quad Quad ID -- w= -- Hennepin Minneapolis North 120D MINNESOTA DEPARTMENT OF HEALTH RECORD WELL ~7~L~LL AND iJll]~[} BORING I}ORII~G ~O~ Minnesota Statules Chapter 1031 Well Name 1s-ownship 119 un Range Dir Section 21 W 36 on Subsections CDDBAA een Elevation Elevation Method Lr em 842 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 112 fl Depth Completed 112 ft rfobmei Entry Date Update Da:e Received Date Sy 08124/1991 04/20~200~ Date Well Completed 03/2011961 Drilling Fluid -- ree Use Domestic I Wall Htdrofractured? ~ Yes ~ No I From :t ~o Ft Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? ~ Yes ~ FA No Above/Below 0 ft Oasin9 Diameter Weight Hole Diameter 3 in. to 106 ft. Ibs./ft. Well Address 800 62ND AV N BROOKLYN CENTER MN 55430 Open Hole from it. to ft Screen YES Make JOHNSON Type stainless sleel Geological SAND CLAY SAND SAND Material a. Color Hardness From To RED O 45 EI} B LU E GRAY G RAY 45 90 105 90 105 11 2 Diameter 1.25 Slot/Gauze 105 Length 4 Set Between 108 ft. and 112 ft. Static Water Level 40 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 40 ft after hrs. pumping 20 g.p.m. 03120/1961 -- NO REMARKS Well Head Completion C Brrenan seangtoun Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No ct en rpt Located Minnesota Geological Survey dO Method Digitized Table) 20 r scale 1:24,000 or larger(Digitizing po Sy Unique Number Verilication Address verificetion gystem UTM - Ned83, Zone15, Meters Date N/A 477155 Y: 4990460 rss ET First Bedrock fete Sno Last Slral Sand gray Aquifer Quat BuriedArtes. Aquifer Depth to Bedrock ft. County Well Index Online Report County Well Index Online Report i Nearesl Known Source of Conlaminalion __foot __direction __type Well disinfected upon completion? Be [] Yes Be [] No teen Corey pre Pump [] Not Installed Date Installed Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m i es HP 0 Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification "cca Deoendable Well Co. 22F2266e22r00r66er) License Business Name PA mae 27143 TWEED R. S80. SER Lic Or Reg. No. Name of Driller Pred 722008 Printed 9t2/2008 HE 01205 07 el. EP 0500S mei Cont op0A el Lg Reet2042001230 027 00 16013AM) state 02827189 2233.0077 STATE_02827189 2233.0377  CCaannnnoonn FFaallllss 22223333..00337788 STSATATTEE0_208282277119900 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY Gannon Falls Cannon Falls CC32aa0nnnnWooennstFFaaHllollssffFFimirraeenDDeeppaarrttmmeenntt Cannon Falls, MN 320 West Hoffman Cannon Falls, MN 5555000098 JJ5oo0hh7nn.2tM9i1lill.lee0rr,6, 4FF3iiree Chief Chief cannonfalsid@hatmil com 507-291-0643 cannonfallsfd@hotmail.com TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: CCaannnnoonn VVaalllleeyy FFaaiirrggrroouunnddss,, CCaannnnoonn Fal Falls 505774., 492601320 506774.4, 4929013.29 CCClllaaassssss BAB:AAFAFFnFFgF:u:sAAnngguuss Class A: Angus AAnnnnuuaallllyy LLeessss tthhaann 55 ggaatlloonnss. GGrroouunndg CCClllaaassssss B"BlAAeFFFsFFsF::thllaeenssss5tthghaaalnnlo5snsggaallloonnss Class A: less than 5 gallons C(Gaannnnoonn RRiivveerr llooccaatteedd lleessss thhaann 11//48 mmiilee eeaasstt `AApppprrooxxiimmaatteellyy 11/44 mmiilee nnoorrtthh TTrraaiinniinngg stsite llooccaatteedd iinn aann aaccitivvee kkaarrsstt aarreeaa 11 mie0 172 mile nofth-northeast 1/4 mile to 1/2 mile north-northeast Loss than 1/4 mi east Less than 1/4 mile east LLeessss tthhaann 112/22 mmiillee 118 22223333..00337799 STATE02827191 STATE_02827191 CCAANNNNOONN FFAALLLLSS CCWWII WWeellll MMaapp Lanny x inal Ge foesN Seer wipea] bE i ros, O yTlE aN lee CogaTE n oa ai ]Reape id sS A em a e W nB n x E ii ee En NC S e S Lhs l Es G r Sham ERE ae Loman No i Se e pe eeeogee C3 FLeot i}del pUaNCrEeR e dg: d "oh LAnNGsmhA = G SIlEs ioigsysfhtd sie i SEAL PIE emg he ; Lo aw Ta 0 hyRp Eo EE aie a RR 0 ome DN i En NRE TE BE a CRE gg ag LL NE ER aeR p= ed Nel PER Breed NDE GE ay CATE NR aS Le a ANEe CY RET et rnp,Demise,Sorry FOE DrE e dm 22223333..00338800 p-- STATE_02827192 : i : al : 3,5, 5, 3i: fil ii til3 :i i Vv dGdir,gjiig hPi aiak b d3fei3s iiss a pv rs 3: 44-32 N 44-31 N 44-30 N K ot \2 8 : | g | i HlUL 3 IN ai \\ {haTde a \ AA Es 52 NoiREBEY he: I 5: aEs 73 i| &| 1 : | 3 =ii Ef: | c2 / HE 7 oO |} , / J oa n 3 | 2w8i /| wo 22 La\} |A er be oh He 5aCE i|is : ue FH fit er Hl 22223333..00338811 stare 02827103 STATE_02827193 {on 5 Cannon Falls What's In My Neighborhood Map Jay it Lnnidi 1a Jim m. Sal pii fi \ bg 3 RX LN = | - Ee e= oh 2 i snie et o* ch sAiEa \ E BY O fea SHE " 15 nt 3% SITE-- iN] :hE i ; Nef dre | / Xa hn |A i is \ Peimemrinly Neen | Disclaimer: Map aud site itffo~lnation is believed to bc accurate but accuracy is uot guaranteed. No portion |Bm nm, SESE AEII | of the informntion should be considered to be, or used as, ~ legal document The information is pro~:ided | subject to the express condition that the user knowingly waix,es any and all claims fbr clamages against | MPC,\ that may arise from the use of this data. i" BottSioteesS.tupsoruan = remusa somawass. woaeeemnarasunge ocenecSuepariund | @Minnesota Pollution Control Agency | SVeomSnpIomssotaia.ton 4RRSRERRTASMOFmaecsietsit Cshtuaorunp 4sem rosso 22223333..00338822 STATE 02827104 STATE_02827194 Wcll Log Rcport - 00418670 48670] Minnesota Unique Well No. 418670 5,County Quad Quad ID on. Goodhue Cannon Falls 87C WEMLLaAcNoD BORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota S~atutes Chapter 1031 Well Name CEMSTONE READY MIX PLANT -ownehip Range Dir Section Subsections Elevation 112 1T W 7 BABCDB Elevation Method 855 ft 7 5 minute topcgraphic map (+/- 5 feet) Well Depih 340 ft Depth Completed 340 ft. Bgeh, Entry Date Update Da:e Received Date 22 1013011990 11/22/1994 Date Well Completed 06/1411985 Well Address CANNON FALLS MN 55009 Geological Material BAND LIME Ea SANDROCK Color BROWN YELLOW B WHITE REMARKS FORMERLY WELCC, CEMENT. Drilling Fluid -Use Domestic ~ J , Well Htdrofractured? [] Yes [] No From :t to Ft Casing Type Steel(black or Iowcarbon) Joint Welded Drive Shoe? No Above/Below 0 ft [] Yes [] Casing Diameter Weight Hole Diameter 8 in. to 15 ft. Ibs./ft. 12 in to 15 ft. 4 in. to 300 ft. Ibs./ft. 8 in. to 300 ft. ows wn Open Hole from 300 ft. to 340 ft. Screen NO Make Type Diameter Blot/Gauze senLength Hardness From To MEDIUM 0 15 HARD 15 280 B MEDIr UM= E 280 E340 Static Water Level 75 fl from I and earfane Date Msas~Jred (:6114/1985 PUMPING LEVEL (below land surface) r er s Shs 30 ft after hrs. pumping 50 g.p.m. Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade wes Set Between []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No a. Located Minnesota Geological Survey Unique Number Merilication Information from cwner System UTM - Ned83, Zone15, Meters Method Digitized scale 1:24,000 or larger (Digitizing Table) Data N/A X 506905 Y: 4930462 First Redr~k Prairie DiJ Chien GroiJp He pr Last Strat Jordan Aquifer Jordan Depth to Bedrock 15 ft. Gounty Wall Index Online Report County Well Index Online Report Grout Material: Neat Cement from 0 to 300 ft. Nearest Known Source of Contamination 100 fcct ~& dircction Septic tank/drain ficld type Se mar, Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed 07116!1985 yn 7 TT Manufacturer's name GRUNDFOS Model number SP-2-18 HP 1 Volts 23._~.0 Soop ShSaena, Length of drop Pipe 42 ft. Capacity 12 g.pm Type Centr#uaal Material Galvanized AbandonedWells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDNforthiswell? [] Well Contrador Certification Kimmes Bauer 44e 1886677y 00 License Business Name ok, 19521 Lic. Or Reg. No Yes [] No ANDERSON. L. gm Name of Driller Printed 9222008 Printed 912/2008 HE-01205-07 stare o2s2710s tile:///Jl/~..pt/Appendi~%2~D%20Muni%2~FD%2~ite%2~St~m~rie~/Cann~n%2~Fa~s/We~%20L~g%2~Rep~r~%2~-%2Q~418670.htm[10/27/2008 10:18:52 AM] STATE_02827195 22223333..00338833 Wl Lg Ror 526185 Wcll Log Rcport - 00426186 a 426186 Minnesota Unique Well No. 5FECounty Quad Quad ID 5Goodhue Cannon Falls 87C WEBLLL IATNDRBOONRNING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Well Name CROWE, RYNE -ownship Range Dir Section Subsections Elevation 112 1T W 7 CAACAD Elevation Method 809 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 95 ft Depth Completed 95 ft. man Entry Date Update Da:e Received Date 04105/1989 11/22/1994 Date Well Completed 11/0311986 Em -- Drilling Fluid -Use Domestic ~ Well Htdrofractured? J From :t to Ft [] 'Yes [] No Casing Type Steel(black or lawcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below 0 fl Casing Diameter Weight Hole Diameter 4 in. to 76 ft. Ibs./ft. 4 in. to 95 ft. aston es Geological Material Se SAN D CLAY GRAVEL ROCK co wn Color Hardness REMARKS ST. CLAIRES TERRA HAUTE ADD BLK 8. gon 1 From To 3 0 20 20 32 32 78 78 95 Open Hole from T8 ft. to 95 ft. Cum Screen NO Make Diameter Sues Type Slot/Gauze Legh Length Static Water Level 6 fl from I and surface Da-e Meas~Jred PUMPING LEVEL (below land surface) 0 ft. after hrs. pumping 40 g.p.m. 11/0311,986 ssono g YATEWTER Well Head Completion Pitless adapter manufacturer WHITEWATER Model []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Sa etven Set Between I Located Minnesota Geological Survey Unique Number Verification Information from cwner System UTM - Ned83, Zene15, Meters Method Digitized scale 1:24,000 or larger (Digitizing Table) Data N/A X 507131) Y: 4929651 First Redr~k Prairie. Di] Chien GroiJp ri preva La Last Strat Prairie Du Chien Group Aquifer Prairie Du Chien Group Depth to Bedrock 78 ft. County Wal index Gis Repor County Well Index Online Report Grout Material: Neat Cement from 0 to ft. Nearest Known Source of Contamination _feet __dkection __type R EEa R w=r eh o3 uneens Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed 1110511986 Manufac~urer'sname DEMMING Model number HP 0 Volts Length of drop Pipe 42 ft. Capacity_gp.m ype Submersible Ivlaterial Galvanized AbandonedWells Does property have any not in use and not sealed well(s)1 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification Toreerson Well Co 442256118866 rs License Business Name 27056 OTTEN. D. See So Lic Or Reg. No. Name of Driller Fired 922008 Printed 9t2/2008 HE-01205-07 le AP ON 0.30 i Cot WL Rep0o00r61tS 027068 1018.2 AN t~e:///JlL..pt/Appendi~%2~D%2~Muni%2~FD%2~ite%2~St~marie~/Cann~n%2~Fa~s/We~%2~L~g%2~Rep~r~%2~-%2(~426~ 86.htm[10/27/2008 10:18:52 AM] STATE 02627196 STATE_02827196 22223333..00338844 Sg Wcll Log Rcport - 00441882 a441e882 Minnesota Unique Well No. |,County Quad Quad ID on. Goodhue Cannon Falls 87C WEMLLaAcNoD BORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Well Name LI ND EMAN, D EAN -ownship Range Dir Section Subsections Elevation 112 18 W 13 ABAABC Elevation Method 812 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 340 ft Depth Completed 340 ft. Btneh, Entry Date Update Da:e Received Date um 04114/1990 11/23/1994 Date Well Completed 08/1811988 , Drilling Fluid Foam Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or lawcarbon) Joint W'elded Drive Shoe? No Above/Below 1 ft [] Yes [] Well Address RR4 CANNON FALLS MN 55009 5GGeoeloologgicicaall MMataeteririaall CLAY LIME LIME oNLIME SANDROCK LIME SANDROCK SANDROCK I CCoolloorr YELLOW YELLOW HHaarrddnneessss. SOFT MEDIUM YELLOW HARD Pe YELLOW BROWN BLUE BLUE HARD SOFT HARD HARD BLUE MEDIUM A fFroomm TToo 0 7 7 120 120 140 22 140 200 200 220 220 280 280 310 310 340 Casing Diameter Weight 8 in. to 7 ft. Ibe./ft. 4 in. to 324 ft. Open Hole from 324 ft. to 340 ft. [CT Screen NO Make od Type Ibe./ft. Diameter Blot/Gauze Hole Diameter 12 in. to 7 ft. 8 in. to 324 ft. Length Set Between Static Water Level 0 fl tram I and sarface De-e Measnred PUMPING LEVEL (below land surface) 100 ft. after hrs. pumping 40 g.p.m. 0811811,988 I rrr REMARKS STATIC WATER LEMEL DOES NOT AGREE WITH DROP PIPE LENGTH oem Located Minnesota Geological Survey vt Method Digitized Table) scale 1:24,000 or larger(Digitiziqg Unique Number Merilication Other, nolo in remarks Date N/A System UTM - Ned83, Zone15, Meters X: 505953 Y: 4928948 First Redrrr:k Prairie. Di] Chien GraiJp Ho f.. Last Strat Jordan AqLifer Jordan Depthto Bedrack 7 ft. Gounty Wall Index Onin Report County Well Index Online Report Well Head Completion Pitless adapter manufacturer WHITEWATER Model SU4X5 5 []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and Borings ONLY) Como Vasa Be BE Grouting Information WelIGrouted? [] Yes [] No Sori tory Grout Material: Neat Cement from OST 0 to 324 ft. 1 0 yrds. Nearest Known Source of CoNamination lO0 fcct S dh'cction ScDtic tanb'drain field t)pc tn Sit Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed 09120!1988 Es oIsT Manufacturer's name GRUNDFOS Model number SP-2-12 HP 0.5 Volts 23._.0.0 [ SonneE rief e n rnet e,, | Length of drop Pipe 48 ft. Capacity10 g.pm Type Submersible Material Galvanized AbandonedWells Does property have any not in use and not sealed well(s)'~ [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Well Contractor Certification Kimmes Bauer 44e 44118886y 22 License Business Name ok, 19521 Lic. Or Reg. No Yes [] No ANDERSON. L. gm Name of Driller Pied 522008 Printed 9t2/2OO8 HE-01205-07 stare o2s271s7 tile:///J],'.., pVAppendi~c%20D%20Muni%20FD%20 g ire%20 S m~marie g/Ca nnon%20F a 11 s/Well %20Log%20Reporl%20-%2000441882. htm [ 10/27/2008 10:18:53 AM] STATE_02827197 22223333..00338855 Wcll Log Rcport - 00558279 556279 Minnesota Unique Well No. 558279 |,Caunty Quad Quad ID on. Goodhue Cannon Falls 87C WEMLLaAcNoD BORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Well Name SANDSTROM, ANDY -ownehip Range Dir Section Subsections Elevation 112 18 W 12 DDCBDB Elevation Method 799 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 300 ft Depth Completed 300 ft. Bneh, Entry Date Update Da:e Received Date 42% 11121/1995 01/20/1996 Date Well Completed 08/1411995 , Drilling Fluid Foam Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Steel(black or lawcarbon) Joint Welded Drive Shoe? No Above/Below 0 ft [] Yes [] Well Address 30127 59THAVE. WA CANNON FALLS MN 55009 Casing Diameter 4 in. to 286 ft. Weight Ibs./ft. Open Hole from 286 ft. to 300 ft. Screen NO Make Type Hole Diameter 12 in to 15 ft. 8 in. to 286 ft. Geological Material SOIL E COARSE GRAVEL LIMESTONE LIMESTONE SANDSTONE Color Hardness BLACK SOFT BE BROWN BROWN GRAY LT. GRY MEDIUM HARD HARD SOFT From To 0 1 LG 1 15 200 240 15 200 240 309 Diameter Slot/Gauze Length Static Water Level -?0 fl from I and surface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. ~1711711995 Set Between rerREMARKS WELL FLOWS. Well Head Completion Pitless adapter manufacturer WHITEWATER Model Cr []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No LocsinMimGeoog sSary Neth Died sca" 24000 vgs (Daankg) test omen Located Minnesota Geological Survey Method Digitized scale ':24,000or larger(DigitizingTable) Grout Material: Neat Cement from 0 to 286 ft. Unique Number Verification Tag on well Date N/A System UTM-Nad83, Zone15, Meters X: 506082 Y: 4929157 Nearest Known Source of Contamination 150 fcct g dircction Sc#tic tanlddrain field typc Be ie ea Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed 07112!1995 EE srs Manufacturer'sname JACUZZI Model number 1S4257B HP 1 Soper Length of drop Pipe 63 ft. Capacity25 g.pm Type Submersible Volts 23._.~.0 Material AbandonedWells Does property have any not in use and not sealed well(s)? [] Yes "yrds. [] No First Redrrr:k Prairie Du Chien GroiJp He pr Last Strat Jordan Aquifer Jordan Depth to Bedrock 15 ft. "County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Carlson Well Drill 555588a227799, License Business Name 19649 J. Se Lic Or Reg. No. STATE. M. Name of Driller Printed 9/2/2008 Printed 9t2/2OO8 HE-01205-07 stare ozs21ss t~e:///J~/~vAppendiK%2~D%2~Muni%2~FD%2~ite%2~Sm~marieg/Cann~n%2~Fa~s/Well%2~L~g%2~Re~r~%2~-%2~558279.htm[~ 0/27/2008 10:18:53 AM] STATE_02827198 22223333..00338866  CClleeaarrbbrrooookk 22223333..00338877 STSATATTEE0_202882277119999 SSiittee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY CClleeaarrbbrmoook.k CCPlOleeaaBrrobbxrroo3oo0kk8FFiiree DDeeppaarrttmmeenntt Clearbrook, PO Box 306 Clearbrook, MMNN 5566663344 JJ2ee1ff8ff 7BB7aas6si.inn3go1eer4.r4, Fre Fire Chief Chief 218-776-3144 TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: Tf`Taaarnnmkk, ffsaparemmntaatft ossaooumutthsh eecnnaddugoohfftttooowwnnn.t.oTTpoarafiinnthwweiittfhhloCCaltliaanssgssi8Bdsffoooanammthaaett ttaannkk tfaanrmks,. sTpheentffooaammbirsacnadusgahrteonnottokpnoofwtnhebyfloFartiengChliidats.on the tanks. The foam brands are not known by Fire Chief. 318971.12, 526444338 318971.12, 5284443.38 AAClFFaFFs:Fs:Abbrraabnnrddanuudnnkuknnnokownwnon,w,n33MM bbrraanndd aassssuummeeddffoor rraannkkiinngg Class A: brand unknown AAnnnnuuaallllyy 551to0 1100 ggaallloonnss SSppeenntt ffooaamm ccaauugghhtt oonn t(oopp ooffttaannkkss bbyy ffllooaattiinngg dslids AAGFlFFaFsFFs::Alleesslssesttshhahannan11001gg0aaglllaloolnnlssons Class A: less than 10 gallons LLeessss tthhaann 117/88 mmiilee ssoouutthheeaasstt Less than 1/8 mil south and southeast Less than 1/8 mile south and southeast SSiittee iiss nnott llooccaatteedd iinn aa kkaarrsstt aarreeaa Less than 18 mie Less than 1/8 mile More than 1 mic. More than 1 mile Less than 1 mie Less than 1 mile 223 22223333..00338888 STATE02827200 STATE_02827200 CCLLEEAARRBBRROOOOKK CCWWII W Welelll MMaapp B fTiASiEN)TY . NeeaNyniodt |fe lia SL CsoTidPp Bihv a1 hTracly] enESs T a an gd e 5 ESE a eaSATE rel] a WSYE E2RE fo SoeCT IIda WESsdCoAABeRENAwe 0 rESi Sat + EE ITE E GENS FBre e SER {TERE e Ns ee oLe oF m BBa nga 1) oh L9E0 Peo ne AEA BE Se 2 Is CA OAUeR RIEEBEEe T n Lb ae lon i afes e aaNe rTg PoLdLdaddETs gare YA ALofern1R eg T N NTE L R T PE efP oe m Eme Be aSeT aJ en WEA 8 { a ee) da Ue ee IR Ss NN TE) oA he Aer ER ISIE A gl Tea NEIdl SEEN 1 rniTeEES NBEeTmEaRmaadeUL Amo A RAS OMNHE C BTpRe A REI IAT E FL EC Rki]a ASeLniYRanPoE ET ne ER A 0 Cara ne . tae oOablEYaT tionebL o S SPELR aSirc UY TAs ON Nire eoe e Ebd RT te oy Fen fdFCse momentsdundee,copacn [05 Cet em 22223333..00338899 stare oas27201 STATE_02827201 5 3 ogric|| Edqdm]ie ! fAoTtyR [i1% 5 4 5 Hiigh EL hitl 3 . 18 ha, ee | IANO wel, s ' : le 3 , 1 4. 0 [5] i i% HE am 3 : iE ES a ly TN El ol Es& 33 | S4 hhd Eel dy i Ry, cf AeERl JgsH 7 Ea gAl |i|ed ANAT I tap sf fe idi 4. i Ae le 1 . li iP i ae --v----y_----l.i 22223333..00339900 rare casera STATE_02827202 |"Clearbrook What's In My NeighborhoMoadp | I| fre1t | ik, | NNeea a R| y | I Lsiidees gre | [ EE | oi | || el a | 5 SITE re (on . = ||| | | oy | [|| Disclaimer: Map and site information is believed to be accurate but accuracy is not guaranteed. [mm te of the information should be considered to be, or used as, a legal document. The information is subject to the express condition that the user knowingly wai,,-es any and all claims for damages J ||| MPCA that may arise from the use of this data. = | No portion provided against || @Minnesota Pollution Control Agency || "Sis =PeetmatoasttesSaugssrriaund emanates catoianmor roeSaportn 2EF e r RTy Sve Pan es, 4 i oossore 22223333..003399'11 sate 02827203 STATE_02827203 WollogRpt 012554 Wcll Log Rcport - 00128544 Toa] Minnesota Unique Well 128544 No. FEr LE County Quad Quad ID Clearwater Clearbrook 331B yn on wma Well Name MINNESOTA PIPELINE -ownehip Range Dir Section Subsections Elevation 149 3~ W 29 COB Elevation Method Sm RUS mn 1342 ft Calc from DEM (USGS 75 m n or equi~ ', WEPLL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH V~TELL flI~ND BORI]~C~ R~(~ ORD Minnesota Statules Chapter 1031 Well Depih Depth Completed 51 fl 51 ft. mpni Entry Data Update Da:e Received Date 04107f1988 01/06/2005 Date Well Completed 07/2111979 = Drilling Fluid -Use Domestic I Well Htdrofractured? [] Yes [] No I From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below 1 ft. Casing Diameter Weight Hole Diameter 3 in. to 42 ft. 7.7 Ibe./ft. cigs ers Geological Material CLAY CLAY SAND & GRAVEL GeColor R ED GRAY BROWN pes Hardness SOFT SOFT HARD Open Hole from it. 1o ft poe Cum Sou gah Syben From Screen YES Make JOHNSON Type stainless steel Diameter 2 To SlotlGauze Length 4 Set Between 47 ft. and 51 0 36 36 47 47 51 Stagc Water Level 31 fl from Land aurface Date Measured 07t2'/1979 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. i -- REMARKS VILLAGE OF CLEABBROOK S LOT/GAUZE 10/60 ct ot Crs Located Clearwater Cry. Soil & Water Cons. Dist. Unique Number Merification N/A System UTM - Mad83, Zone15, Meters thd G8 Sn Method GPS SA On (averaged) Date N/A X: 318812 Y: 5283998 First Bedrock [i ts + Last Slral Aqu ifer Depth tn Redrock ff County Well Index Online Report County Well Index Online Report Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No Nts Nearesl Known Source of Contaminalion _feet _direction _type Well disinfected upon completion'? 0 ve [] Yes 0 [] No Pump [] Not Installed Date Installed Manufacturer's name Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No [rer Well Contractor Certification Holm'sWell Co License Business Name 112288554444 some 15398 Lic Qr Reg. No. toma HOLM D Name o1 Driller PPrrinted 9/12//220008 HE 01205 07 le. 520 App 0 FP20mm Clb Nl Lg Report 20 0001 2544 nf1027 2008 102024 AN) tile:///Jl,'.../;_0Rpt/Appendix ,o20D o20Muni ,o20FD ,o20Site/;_0Summarie~ Clearbrook/Well %20Log ,vo~OReport 020-,;2000128544.htm[lO/27/2008 10:20:24 AM] 2233.0392 STATE 02827204 2233.0392 STATE_02827204 WolLogReport 0463908 Wcll Log Rcport - 00462903 dos] Minnesota Unique Well 462903 No. EFr,County Quad Quad ID EEClearwater Clearbrook 331B WEPLL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 mpain Entry Data Update Da:e Received Date 08113/1991 03/1112005 Well Name MN PIPELINE COMPANY -ownship Range Dir Section Subsections Elevation 149 3T W 29 Elevation Method 1350 ft Calc from DEN (USGS 7 5 m n or equi~ ', Well Depih Depth Completed Date Well Completed 75 ft 60, ft. 08/0811990 ~=~!!~!~ ~!~ = ~b!~5o~!........................................................................................................................... = Drilling Fluid Water Use Industrial I Well Htdrofractured? ] From :t 1o Ft [] Yes [] No Casing Type Plastic Joint Welded Drive Shoe? [] Yes BNo Above/Below ft. owrcs Geological Material CLAY CLAY CLAY GRAVEL GRAVEL/COBBLES SAN D SILTY SAN D SILTY SAN D/CLAY =GrColor GRAY GRAY GRAY GRAY GRAY G RAY BROWN BROWN wes Hardness irn ETo From To 0 22 22 26 26 45 45 55 55 58 58 63 63 75 75 Casing Diameter Weight Hole Diameter 14 in. to 38 ft. 54.6 Ibs./ft. 8 in. to 48 ft. 49.6 Ibs./ft. Open Hole from it. to fl ome Screen YES Diameter 7.5 S%one lW en SO ameT 6a Make JOHNSON Type stainless steel SlotlGauze 30 Length 15 Set Between 45 ft. and 60 ft Stagc Water Level 15 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 18 ft after 60 hrs. pumpin~c 60 gp.m 08t0'/1990 rrREMARKS HEIGHT ABOVE/BELOW: 14"-2, 3-8" WORK PERFORMED UNDER ENGINEERING OF E HICKOK OF J.MONTGOMERY. ct ot Crs Located Clearwater Cry. Soil & Water Cons. Dis1. thd G8 Sn Melhod GPS SA On (averaged) pt. Unique Number Verification N/A System UTM - Ned83, Zone15, Meters Date N/A X: 319094 Y: 5284301 First Bedrock [i ts + Last Slral Aqu ifer Depth tn Redrock f1 County Well Index Online Report County Well Index Online Report Well Head Completion Pitless adapter manufacturer Model []Casing Protedien [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and 3orings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No Grout Material: Neat Cement from 0 to 43 ft. 25 bags Nts Nearesl Known Source of Coataminalion _feet _direction _type Well disinfected upon completion'? 0 ve [] Yes 0 [] No Pump [] Not Installed Dale Installed Manufeciurer'sname Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No orm baer Well Contractor Certification Renner E H Well License Business Name 446522990033 Ome 71015 Lic Or Reg. No. twain COX A Name of Driller PPrriinntteedd 991/1122//22000088 HE 01205 07 e150 App 2000 Sc Sis Clin NelLg Regr 3044004601 Hl1077 2008 10-3034 AM) t~e:///Jl~..~2~lRp~/Appendix~/~2~lD~/~2~tMt~ni~/~2~FD~/~2~)Site~i~2~)St~mn~ariea/C~earbr~k/~e~/~2~lL~g~2~Rep~rt~42(l-~2~t~l(l4629(~3~htm[~/2~/2~8 10:20:24 AM] 2233.0393 STATE02827205 2233.0393 STATE_02827205 Well Lg Ror 9124 Wcll Log Rcport - 00469124 doi Minnesota Unique Well 469124 No. JFEr,County Quad Quad ID EEClearwater Clearbrook 331B Well Name MAEN, RICHARD -ownehip Range Dir Section Subsections Elevation 149 3T W 34 Elevation Method 1346 ft Calc from DEM (USGS 7 5 m n or equi~ ', WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH V~TF~LL flI~ND BORI]~[~- R~(~ ORD Minnesota Statules Chapter 1031 Well Depih Depth Completed 200 ft 197 ft. man Entry Date Update Da:e Received Date ym 08129/1991 12/20/2007 Date Well Completed 06/0511991 -- EF ------------ Drilling Fluid Revert Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Plastic Joint Ko Information Drive Shoe? []Yes [] No AbovelBelow 1 ft. Casing Diameter 4 in. to 188 ft. Weight Ibs./ft. Hole Diameter 7 in. to 200 ft. Geological Material CLAY CLAY & GRAVEL i CLAY ROCK CLAY SAND & CLAY FINE SAND SAND SAND Color Hardness From To BROWN MEDIUM 0 17 BROWN MEDIUM 17 44 EEL BLU E GRAY BROWN M EDI U M V.HAR [] M EDI U M 44 56 56 57 57 66 BROWN MEDIUM 66 175 RED MEDIUM 175 180 BROWN MEDIUM 180 197 RED MEDIUM 197 200 Open Hole from It. to ft Screen YES Make COOK Type stainless steel Diameter 2 Slot/Gauze 12 Length 9 Set Between 188 ft. and 197 ft. Stagc Water Level 75 fl from Land surface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping 60 g.p.m. 06105/1991 -- NO REMARKS ts CurvOey SiG 54 Located Clearwater Cry. Soil & Water Cons. Dist. poems Unique Number Merilication N/A System UTM - Ned83, Zone15, Meters Md Go| Melhod GPS SA On (averaged) or Date NIA X: 319833 Y: 5283813 =ise First Bedrock ow ates .ono Aquifer + `County Well Index Online Report Last Slral Unknowr deposit type DeFfht~ Redrock ft County Well Index Online Report Well Head Completion Pitlees adapter manufacturer MAASS Model JC4 []Casing Protection Y [] 12 in. above grade Beri tre ot ok an [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No Grout Material: Cuttings Gt ti. ho Goran Grout Material: Neat Cement at va sae Grout Material: Bentonite from 0 to 10 ft. wn 10 0 from 10 to 30 ft. on 20 t from 30 to ft. Nearesl Known Source of Coataminalion 65.~__feet Ldirection Barnyard ici B10 Well disinfected upon completion'? type [] Yes [] No Pump [] Not Installed [,ale Installed C,610711991 [ r aE E a ,BaA Rrr e pa si esawze| Manufeciurer's name AERMCTOR Model number AB1250 HP 0 5 Veils 23._.0.0 Length of drop Pipe 100 ft. Capacity 12 g.pm Type Submersible Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification sormbarmsture alm o-n Holm'sWell Co 15398 [] No HOLM D License Business Name 446699112244 Lic Or Reg. No. Name of Driller Priinmtead t9/i12e/n20a0n8 HE 01205 07 e150 App 2000 Sc Sis Clin NelLg Regn 304 004912 Hl1027 208 103035 AM) tile:///JI/.., s;_ORpt/Appendix ,o20D o20Muni ,o20FD,o20Site/;_0Summarie~ Clearbrook/Well %20Log/~0Report 020-,;2000469124.htm[10/27/2008 10:20:25 AM] 2233.0304 STATE 02827206 2233.0394 STATE_02827206 WolLogRepo 05357 Wcll Log Rcport - 00535567 ower] Minnesota Unique Well 535567 No. wmCaunty Quad Quad ID own Clear~vater 331b ne Well Name MW-2 -ownehip Range Dir Section Subsecfione Elevation 149 3T W 29 Elevation Method Spinnin 1343 ft Calc from DEN (USGS 7 5 m n or equi~ ', WEPLL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~]~[} BORI]~IG ~CO~ Minnesota Statules Chapter 1031 mpni Entry Date Update Da:e Received Date 06123/1994 OTI13/200T Lo] Well Depih 14 fl Depth Completed 13.3 ft. Date Well Completed 09/0811993 ---- Drilling Fluid -Use Monitor well I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Plastic Joint Threaded Drive Shoe? [] Yes []No Above/Below ft. Casing Diameter 2 in. to 3.3 ft. Weight 0.69 Ibs./ft. Hole Diameter 8.25 im to 13.5 ft. Well Address arson es CLEARBROOK MN Geological Material CLAY CLAY CLAY 56634 wo Color OLV/BRN G RAY BROWN was Hardness HARD ponFrom 0 8 12 Open Hole from it. to ft po| Cum Screen YES Diameter To 2 Sone LeTng ISTtS es a Make JOHNSON Type plastic Slot/Gauze 10 Length 10 Set Between 3.3 ft. and 13.3 ft. 8 12 14 Static Water Level 12.2 ft. [ram Land surface Date Measured 09/09/1993 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. REMARKS MW-2 93364 te cory vars Located Clearwater Cty. Soil & Water Cons. Dist. Unique Number Verification Tag on well - System UTM - Ned83, Zone15, Meters ts horn) Method GPS SAOn (averaged) Date NIA X: 319907 Y: 5284T02 First Bedrock [i ts + Last Slral Aqu ifer r)epfh fn Redrock ff County Well Index Online Report County Well Index Online Report Well Head Completion Pitlees adapter manufacturer Model Dyan oto epson []Casing Protection Y [] 12 in. ab3ve grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No | cos tent cone Grout Material: Bentonite Grout Material: CONCRETE ron 18 from 1.8 to 2.8 ft. from to 1.6 ft. Nts Nearesl Known Source of Coataminalion _feet _direction _type Well disinfected upon completion'? 0 ve [] Yes 0 [] No Punrp [] Not Installed Date Installed Manufacturer's name Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any hal in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No or bam tor Well Contractor Certification Bay West License Business Name 553355556677 Soe MO 120 Lic Qr Reg. No. tema Name o1 Driller Printed k9/12a2/20,08 HE 01205 07 le. 520 App 0 FP20mm Clb Nl Lg Report 20 SH00S567 nf1027 2008 102025 AM tile:///JI1...~2(~Rp~/Appendixq/"2(~D~/~2(tMt~niq/"2~FD~/"2~)Site~2(~St~mn~arie~/C~earbr~k/~e~"/"2~L~g~2~Rep~rt~42(~-~"2~t(~(~535567.htm[10/27/2008 10:20:25 AM] 2233.0395 STATE 02827207 2233.0395 STATE_02827207 WollogRp 05358 Wcll Log Rcport - 00535568 owes]F,r Minnesota Unique Well No. 535568 County Quad Quad ID 5Clearwater Clearbrook 331B | Well Name MW-3 -ownahip Range Dir Section Subsections Elevation 149 3T W 29 Elevation Method Sommer 1339 ft Calc from DEN (USGS 7 5 m n or equi~ ', WEPLL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~]~[} BOR[]~C~ ~J~C O~J~ Minnesota Statules Chapter 1031 mpni Entry Date Update Da:e Received Date 06123/1994 OTI13/200T Lr o e] Well Depih 13 25 ft Depth Completed 13 ft. Date Well Completed 09/0811993 ---- Drilling Fluid -Use Monitor well I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Plastic Joint Threaded Drive Shoe? [] Yes []No Above/Below ft. Casing Diameter 2 in. to 3 ft. Weight 0.69 Ibs./ft. Hole Diameter 8.25 in. to 13.2 ft. Well Address arson es CLEARBROOK MN Geological Material CLAY CLAY CLAY wo Color OLV/BRN GRAY DK. CRY ws Hardness ponFrom 0 8 12 Open Hole from it. 10| Cum Screen YES Make Diameter To 2 8 12 13 Stagc Water Level to ft StWw ns JOHNSON Type SlotlGauze 10 LeWng O Se BE ann plastic Length 10 Set Between 3 ft. and 1 ft. from Land surface Da:eMeasured 09/09/1993 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. wa13 ft. rrREMARKS MW-3 93364 te cory vac Located Clearwater Cty. Soil & Water Cons. Dist. Unique Number Notification Other, note in remarks System UTM - Mad83, Zone15, Meters nen sxc) Method GPS SA On (averaged) Date N/A X: 318856 Y: 528484~ First Bedrock [i ts + Last Slral Aqu ifar r)epfh fe Redrock ff County Well Index Online Report County Well Index Online Report Well Head Completion Pitlees adapter manufacturer Model []Casing Protection Y [] 12 in. ab3ve grade Dyan oto epson [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No | cos tent couRETE Grout Material: Bentonite Grout Material: CONCRETE [TN from 1.5 to 2.5 ft. from to 1.5 Nts Nearesl Known Source of Contaminalion _feet _direction _type Well disinfected upon completion'? 0 ve [] Yes 0 [] No Pump [] Not Installed Date Installed Manufacturer's name Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No or bam tor Well Contractor Certification Bay West License Business Name 553355556688 Soe M0120 Lic Qr Reg. No. tema Name o1 Driller Printed k9/12a2/20,08 HE 01205 07 le. 520 App 20 FP20mm Clb Nl Lg Report 20 1005568 nf1027 208 10:23:26 A tile:///JI/...~2~lRp~/Appendix~/"2(lDq/~2~tMt~niq/"2~FDq/"2~Site~i~2~)St~mn~arie~/C~earbr~e~"/"2~lL~g~2~Rep~rt~42(l-~2~t~l(l535568.htm[10/27/2008 10:20:26 AM] 2233.0396 STATE02827208 2233.0396 STATE_02827208 Wallog Report 05556 Wcll Log Rcport - 00535569 5s35m569 Minnesota Unique Well No. FJrECounty Quad Quad ID 5Clearwater Clearbrook 331B Well Name MW-4 I -ownahip Range Dir Section Subsections Elevation 149 3T W 29 Elevation Method 1337 ft Calc from DEN (USGS 7 5 m n or equiv ', WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~]~[} BORI]~JG ~CO~ Minnesota Statules Chapter 1031 Well Depih Depth Completed 13 25 ft 13 ft. mn Entry Date Update Da:e Received Dote 06123/1994 OTI13/200T Date Well Completed 09/0811993 Ee Drilling Fluid -Use Monitor well I Well Htdrofractured? [] Yes [] No I From :t to Ft Casing Type Plastic Joint Threaded Drive Shoe? [] Yes []No Above/Below ft. Casing Diameter 2 in. to 3 ft. Weight Ibs./ft. Hole Diameter 8.25 in. te 13.2 ft. Well Address CLEARBROOK MN ha Geological Material pm SILTY CLAY CLAY wom Color RED Hardness SOFT GRAY From 0 4 Open Hole from it. to ft Screen YES or Spmetr Diameter 2 To 4 Make JOHNSON Type plastic 'Sefonzs $1otlGauze 10 'Lngn Length 10 13 SBueen Set Between or 3 ft. and 13 ft. Static Water Level 2 ft. [rom Land surface Da:eMeasured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 09/09/1993 REMARKS MW-4 93364 ots con saberon Located Clearwater Cty. Soil & Water Cons. Dist. - Unique Number Notification Tag on well System UTM - Ned83, Zone15, Meters eos ossncnmens Method GPS SAOn (averaged) Date NIA X: 318760 Y: 5284729 First Bedrock ses Eas + Last Slral Aqu ifer r)epfh fn Redrock ff `County Well Index Online Report County Well Index Online Report Well Head Completion Bron rerasocoken Pitleas adapter manufacturer Model []Casing Protection Y [] 12 in. ab3ve grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No |ao an conenere Grout Material: Bentonite Grout Material: CONCRETE neat from 1.5 to 2.5 ft. from to 1.5 Vor ison Nearesl Known Source of Coataminalion _feet _direction _type Well disinfected upon completion'? @ 10 [] Yes @ se [] No Punrp [] Not Installed Date Installed Manufacturer's name Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any hal in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No sorbate Well Contractor Certification Bay West License Business Name 553355556699 ElmM0120 Lic Qr Reg. No. wo Name of Driller PPrrintteed 9//1122//22O0O08 HE 01205 07 lp App SP305 Smt Cel Nel 20 Regn 3020053560 1077208 103026 AN tile:///JI/...~2(~Rp~/Appendix~/"2(~D~/~2~tMt~niq/"2~FDq/"2~)Site~2~St~mn~arie~/C~earbr~k/~e~"/"2~L~g~2~Rep~rt~42(~-~"2~t~(~535569.htm[10/27/2008 10:20:26 AM] STATE 02827209 STATE_02827209 22223333..00339977 ts R---- Well Log Report - 00636509 636509 | zFir. Minnesota Unique Well No. 636509 Caunty Quad Quad ID Clearwater Clearbrook 331B Well Name MN PIPELINE CO. -ownship Range Dir Section Subsections Elevation 149 3T W 32 AAA Elevation Method 1350 ft Calc from DEM (USGS 7 5 m n er equi~ ', WE|LLRAENcDomByO,RING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~i~D I}ORI]~G ~CO~ Minnesota Statu~es Chapter 1031 Well Depth Depth Completed 142 ft 141 ft. [mLno Entry Data Update Da:e Received Date gw 02114/2000 03/1112005 Date Well Completed 09/0111999 ee Drilling Fluid Bentonite Use Industrial I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Steel(black or lawcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below it Casing Diameter Weight Hole Diameter 12 in. to 111 ft. Ibs./ft. 18 in. to 142 ft. open 6eologial Material CLAY Shp a anaver SAN D & GRAVEL CLAY SAN D & GRAVEL SILTY SAN D SAND & GRAVEL CLAY SAN D geColor GRAY Snow BROWN GRAY BROWN BROWN BROWN GRAY BROWN wenons Hardness From To 0 44 44 55 55 57 57 61 61 88 88 134 134 135 135 142 Open Hole from it. to [t Screen YES Make JOHNSON Type stainless sleel [TT Diameter |W = WA ne 0 12 Slot/Gauze 65 Length 30 Set Between 111 ft. and 141 ft. Static Water Level 10 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 141 ft. after 6 hrs. pumping 250 gp.m. 0910'/1999 NO REMARKS te Gute Subscon 1 Located Clearwater Cry. Soil & Water Cons. Dist. hnt o5 hp Method GPS SA On (averaged) A Unique Nu'~ber Verilication Tag on well System UTM - Ned83, Zone15, Meters Date N/A X: 319121 Y: 5284319 ooi e First Bedrock Ef Aqu ifer CountyWell Index Online Report Last Slral Depth to Bedrock ft. County Well Index Online Report Well Head Completion i or Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No | Sot br: Sn Grout Material: Neat Cement Grout Material: Bentonite meat from D to 30 ft. from 30 to 40 ft. wm 2 yrds. 30 bags Te Eno Nearesl Known Source of Contaminalion __fcet _direction _type Well disinfected upon completion? 1 [] Yes G8[] No Pump [] Not Installed Date Installed Manufaclurer'sname Length oldrop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)~ [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification Ra - Traut M.i. Well Co. 715:36 rh Te License Business Name Lic Or Reg. No. [] No Name of Driller 536509 Printed 91272008 Printed 9/12/2008 636509 HE 01205 07 es. Apt CNL Ren O08 04290 ti~e:///J~/~..%2~Rp~/Appendix%2~D%2~Muni%2~FD%2~Site%20Sumn~ariea/C~earbr~We~%2~L~g%2~Rep~rt%2~-%2~636509~htm[~ 0/27/2008 10:20:26 AM] sate 02827210 STATE_0282 7210 22223333..00339988  CCllooqquueett 22223333..00339999 state 02827211 STATE_0282 7211 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY CCllooqquueett CC5l0loo8qqCuuleeottqFFuiierrete ADDveeep.paarrttmmeenntt Clog, MN 55720 508 Cloquet Ave. Cloquet, MN 55720 JJ2ii1mm8L-L8aa7n6ng:ge6n5e1b4rnunbnreru,FiFnrireneCeChrhiie,eff jj2aa1mm8ee-8ss7__9lla-an6ng5ge1en4nbbrruunnnseerr@@hhaomtmaialil.ccoomm TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: GGrraavveell ppiit nneexxt 0to cciittyy ggaarraaggee aalt 441100 540964.06, 5172861.85 540964.06, 5172881.85 AAClRRaA-sAFsFFAFF:F::AnAAgnnuggsuuss Otner: Class Other: Dawn dish A: Angus Dawn dish ssooaapp BBii--AAnnnnuusallllyy 551to0 1100 ggaallloonnss GGrroouunndg AACRlRa--sAAsFFFAF:EF::Llleeossssss ttthhhaaannn 111000gggaaallllllooonnnsss Class A: Less than 10 gallons UUnnnnaammeedd ssttrreeaamm aapppprrooxxiimmaatteellyy 117/22 OOnn oorr aaddjjaacceenntt ttoo ssiittee SSiittee iiss nnott llooccaatteedd iinn aa kkaarrsstt aarreeaa.. 11d to 172 mi west 1/4 to 1/2 mile west Sito is located ina WPA Site is located in a WPA AAmrmoorryy RRooaadd,, mmiillee ssoouutthh CCllooqquueett More than 1 mie More than 1 mile 12 12 22223333..00440000 STSTAATTEE0_202882277221122 CCLLOOQQUUEETT CCWWII W Weellll MMaapp. a HTTyElRTa)o pase ga 47 scoiopgbununtCAC aI s Ee e SR A | arb teaannSeah g ae esal Taste Li No i ee TRAN ETT {PFCEech saRi fA f70 ud 1a1e sk ipd th LEi Eex e da!waTd E ITa LAR Pa RE Rae RE S Ee TLode (He : ornaE er] Ee noe Ll Fae Thi EE . aie 3 dort waged Sa EN eT SANT wr Ej anv a 3 A Bo tf QI Noe ie Ais ee= | : v i| n ress ean me VE 2. BEC a PRS FN at oi e: l ne stnrndsrHhCoP GT Ae) COR ERS ei oon.J SePl NTeatEE oiol 3 ii T5g cdi to 22223333..00440011 soe aserzss STATE_0282 7213 *| hiial ;i z: T0hty |[IF ihe sdadp, HBiiH t agBE i wowfowaen 46-43-20 N 46-43-0 N waon 46-42-40 N wan 46-42-20 N Swonaaaron 46-42-0 N 46-41-40 N } Eli gLaLl}i a=geA eegO B bulliFdF A R o6faN 4l i Ja i lFlE So Thow ePoV fSrEeRe m( dSe5 e? ,~ ~ .<:::~....... ....................................................................... ............. S| Tic 8),Wu fn ED: "NE Lrla N 0Z-gt-9~ N 0-st-gt Pie o 1 ae a AaN]BB 5 8, eee el N 0~-zt-gt N 0Z-gt-gt N 0-zt-gt Jz | N 0f ~t-gt 22223333..00440022 STATE_0282 7214 [Cloquet What's In MyNeighborhMoapod | i| SAA v5 pee me |j enfi i iIl arA b e AE LE] iia argent I TEE Ilehi ph Ir wl iyoeeike1 I = i vif J et = Sym wie k fp|er ii fx | | | s/eFmreAumNeFo a t 5 i1 oSil Fe TTS A BE i 8| ep |[ BEm Tsez| | s-- J Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion ee of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided subject to the express condition that the user knowingly waives any and all claims for clamages against |||| me~s ptmconvo ger ]VIPCA tha! may arise from lhe use ofthis data. .parnes a msRoii-- omeescrn 22223333..00440033 p-- STATE_0282 7215 Well Log Report - 00498239 Minnesota Unique Well No. 440988223399 JezCounty Quad Quad ID om Carlton Cloquet om224B Well Name REYNOLDS, JACK -ownehip Range Dir Section Subsections Elevation 49 1T W 22 DDDDCA Elevation Method WE|LLRAENcoDmByO,RING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~]~[} ]}ORING ~O~ Minnesota Statu~es Chapter 1031 1270 ft 7 5 minute topographic map (+/- 5 feet) Well Depth 122 ft Depth Completed 122 ft. [a Lo Entry Date Update Da:e Received Date Sms 01127f1993 05/30f2006 Date Well Completed 03/2711992 Well Address 1209 OAK ST S CLOQUET MN 55720 i GeGoeloologgicicaall MMataeteririaall COARSE GRAVEL SAND SAN DY GRAVEL Rr FINE SAND MEDIUM SAND CLAY & ROCKS SAND & FINE GRAVEL SLATE ROCKS Eom cCoolloorr BROWN BEMHaagrdnneessss HARD RED SOFT BROWN HARD ME RED BROWN RED BROWN SOFT SOFT MEDIUM SOFT GRAY MEDIUM EE -- Drilling Fluid Water Use Domestic ~ Well Hfdrofractured? ~ Yes ~ No I From :t to Ft Casing Type Steel(black or bwcarbon) Joint Welded Drive Shoe? No Above/Below 1 ft ~ Yes ~ DRain9 Diameter Weight Hole Diameter 6 in. to 119 ft. 18.97 Ibs./ft. 6 in. to 122 ft. DE FFrroomm TToo 0 22 22 25 25 37 EE 37 80 80 105 105 115 115 119 119 122 L[0l oed on Open Hole from 119 fl. to 122 ft. Screen NO Make Type Diameter Slot/Gauze wnLength Static Water Level 70 fl from I and surface Date Meas~Jred PUMPING LEVEL (below land surface) 119 ft. after 1 hrs. pumping 7 g.p.m. 031771199) ston Set Between = NO REMARKS Poevacate Well Head Completion Pitless adapter manufacturer ost Modal ae []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No RR, Located Carlton Cry Soil & Water Cons Dist Methcd Digitizaticn (Screen) - Map (1:24,0D0) Unique Number Merification N/A Date 08127/2004 gystem UTM - Ned83, Zone15, Meters X: 54,3399 Y: 5172764 lo Nearest Known Source of Coatamination 100 fcct N direction Se#tie lank drain field Well disinfected upon completion? [] Yes type [] No Pump [] Not Installed Date Installed Manufaclurer'sname Model number__ HP_ Volta Length at drop Pipe_ft. Capacity_g.p.m Type Material AbandonedWells Does property have any not in use and not sealed well(s)1 [] Yes [] No First Redr~k Thnmsnn Formation Aquifer Thomson Formation County Well Index Last Slrat Thomsor Formation County Well Index OOnnlliinnee Report Depth to Bedrock Report 119 ft. Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification Sunnarbore Well Co. 09437 SUNNERBORG C 498239 License Busineas Name 498239 Lic. Or Reg. No. Name of Driller hai Printed 9/19/2OO8 HE-01205-07 22223333..0044004 sate 02827216 STATE_0282 7216 WellogReport Wcll Log Rcport - 0061794 l bins Minnesota Unique Well 617941 No. Jwm Eom County Quad Quad ID Carllon Cloquet 224B Well Name MARTIN, STEVE -ownship Range Dir Section Subsections Elevation 49 1T W 23 CCCCBB Elevation Method WEBLLLIATNDRBOONRNING MINNESOTA DEPARTMENT OF 14EALT14 ~7~z~LL ~I~]~[} BORING ~O~ Minnesota Statu~es Chapter 1031 1281 ft 7 5 minute topographic map (+/- 5 feet) Well Depth 136 ft Depth Completed 136 ft. man Entry Date Update Da:e Received Dote me 01110f2080 05/30f2006 Date Well Completed 11/2311998 FPDrilling Fluid Water Use Domestic ~ Wall Hfdrofractured? ~ Yes ~ No I From :t to Ft Casing Type Steel(black or bwcarbon) Joint Welded Drive Shoe? No Above/Below # ~ Yes ~ Oasin9 Diameter Weight Hale Diameter 6 in. to 136 ft. 18.97 Ibs./ft. 6 in. to 136 ft. Well Address 1210 OAK ST S CLOQUET MN 55720 Geological Material GRAVEL Lo SAN D GRAVEL CLAY Color Hardness From To BROWN HARD 0 25 BFL} BROWN BROWN SOFT HARD 25 132 132 138 NO REMARKS Open Hole from 136 fl. to 136 ft. Screen NO Make Type Diameter Slot/Gauze Length Static Water Level 6,5 fl from I end surface Date Msas~Jred PUMPING LEVEL (below land surface) 120 ft. after 1 hrs. pumping 15 g.p.m. 11174/1998 o[saotoins Poi t Well Head Completion Pitless adapter manufacturer Modal []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No Set Between Located Minnesota Geological Survey Unique Nu'~ber Verification Tag on well gystem UTM - Ned83, Zone15, Meters Method Digitization (Screen)- Map(124,000) Date C,7J18/2005 X: 540467 Y 5172814 First Redr~k irs rosyiyin SE Last Strat Pebbly sand/silt/clay brown Aquifer Quat. Water Table Aquifer Depth to Bedrock ft. County Well Index Online Report County Well Index Online Report et eo BB vo Nearest Known Source of Contamination 50._9.~lbct E direction Sc#tic lanD'drain field Well disinfected upon completion? [] Yes typc [] No Pump [] Not Installed Date Installed Manufaclurer'sname Model number__ HP_ Volta Length 01drop Pipe_ft. Capacity_g.p.m Type Material AbandenedWells Does property have any not in use and not sealed well(s)1 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification Sunnarbora Well Co. 66S 11779944o 11 License Business Name 09437 udm PrintedS57e19e12008 Lic. Or Reg. No. SUNNARBORG 14 Name o1 Driller Printed 9/19/2008 14E-01205-07 le 100 Ape 201 Nm R050 Clg Wel a Raper 353001741 1037300 02155 AM) ti~e:///J~L..up%2~Rpt/Appendi%2~D%20Muni%2~FD%2~Site%2~lSmnmaries/C~quet/we~%20L~g%2~Rep~r~%2~-%2~6~794~ .htm[10/27/2008 10:21:55 AM] sare 02827217 STATE_0282 7217 22223333..00440055 * CCrroossssllaakkee 22223333..00440066 stSaTAtTeE_0022882277221188 SSiittee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY CCrroossssilaakkee CC3i7roo0ss2ss8ilaaCkkoeeunFFitirryee RDDoeeappdaar6rtt6mmeenntt Crossiake, MN 56442 37028 County Road 66 Crosslake, MN 56442 K2Ke1ei8itt.hh6WW9.2..AA3n5nd5de8errssoonn,, Fire Fire Chief Chief cla@erossiie net 218-692-3558 cfd @crossfi re. n et TTrraaiinniinngg LLooccaatitioonn:: JJooiinnt cciittyy/lccoouunnttyy mmaaiinntteennaannccee ffaacciiiltityy,, 1133887700 WVhVihpipppllee TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 4411550011224.466,, 55116668111177..9988 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: AARR--AAFFFFFF:: NNoottssppeecciiffieedd,, uussee ooff 3MMkb-brraanndd ffooaamm aassssuummeedd.. FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: SSaanntitaarryy SSeevweerr Annual foam use: Annual foam use: AARRA-AFFFFFF:: 1100 ggaalllloonnss NNeeaarreesstt ssuurrffaaccee wwaatteerr:: CGmrirooesssseaLLsaatkkee,, less less than than 1/4 1/4 mle mile wes! west and and Pine Pine River River less less than than 14 1/4 mile east KKaarrsstt AArreeaa:: SSiitoeiiss nnoott llooccaatteedd iinana kkaarrsstt aarreeaa.. Nearest wetland: Nearest wetland: OOnn oorr aaddajacceennttttoo ssittee Nearest water well: Nearest water well: On or adjacent to ste On or adjacent to site Nearest Wellhead Protection Area: More than 1 mic. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: LLeessss tthhaann 11 mmiiloe SITE RANKING: 2 SITE RANKING: 21 22223333..00440077 STATE02827219 STATE_0282 7219 CCRROOSSSSLLAAKKEE CCWWII W Welelll MMaapp ey a ra (ns ie BEEaE EeR r ae nhe 7 i lb i: eae Pa GE rey ASA a ne a i FEL ly SA Hata FEAL EceantCEfL ElCl EeURleToAhea ewa R emTeLeO s sege a he CAEHRNNEES ES elssaln,e aLr SieTse rm TO Shy be Sa To SR ve Dass Le eaTR LE L e Slee pk i jog LITLE ANE [en En eeEie n CEE EES -- pTlTn hE eee Tne FLOR Sel Sele EAT NE Gop wes mgd dee ol LRU RAE aw J Tt SN Roda els LEB TRL SG oreo Te Ea-IEd Tae fh eA of tem BROEOPHERE aT ae Si fToEnLeE. G "s yt 4 TN "Jee Aa rms Sirgov cen 25 eelLoa 22223333..00440088 stare ozs27220 STATE_02827220 Tn eri> Wwa46-41-0 N I I ~ ..... I ...... i ......... I yl | : ood i . gs 5 si i i i 3 hf lahat ---------- 46-40-30 IN 46-40-0 N 46-39-30 N 46-39-0 N ~ '~ ~ i~ ~ ............... ........... ............................. .... ........... ~ .......... ~,~ ~u~ I ~ ~ ~ ~I ~ ~ ~, } I r; y ~, ~ ... ~I~ ~~ ~ ~~ ~{~ s~: ~ >~~X~X~~S{~#{~................................. 4 CY~>.. ~ F~ yB LL | ~ ~S~ . . . . . . . . :~ . . . . ~ . . . . . . ~% ....~ I ~............................... ............... a~ 65~ ~{{qS~~;~~*@~}s}~ ............. ............. ~ ................ ~ .............................. [9 gfN~}~ i: 2 ... .... " l Ff A JF ~ .. ... ........ ~~ ~ ~~:~: : ...... .... a: >| | ~ I Ss obs b, ..... ....................................................... N 0-L~-9~ N 0-0V-9~ th : N 0-0~-9~ Hu on ~ ................ ....................... N 0-65-9~ N 0-6~-9~ ; li i |i i 2223233..004409 SSTTAATTEE0_202882277222211 ~ Crosslake What'sIn MyNeighborMahpood DAb,, ifSe a EA W us FzT /7 {wer/Big hi )i 4 ae prt te re cn ) a7 id / LN /7 of Pee i SET Juan N eel . | No 3 FE # I / 3 ; i kn ened bs 2 Pu Toe ET ETTrl| Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided subject to the express condition that the user knowingly waives any and all claims for clamages against ]VIPCA tha! may arise from lhe use of this data. = rS[omtacnaasroanseaonrr o aanrnnd reomitupraa @Minnesota Pollution Control Agency repp 2+rSRoumaomTsreoeno.s Gras 22223333..00441100 stareo28z7222 STATE_02827222 WllogReport -0452570 Wcll Log Rcport - 00432570 443322557700 Jez, gone Minnesota Unique Well No. Caunty Quad Quad ID Well Name CLEATH, JIM E TUEE -ownship Range Dir Section Subsections Elevation Crow Wing Cross Lake 231A 137 2~ W 21 CCCBDC Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING man gm WELL AND BORING RECORD fbi RECORD Minnesota Statutes Chapter 1031 1241 ft Feeder = 7 5 minute topographic map (+/- 5 Well Depih 54 ft Depth Completed 54 ft. Entry Date Update Da:e Received Date 02118/1991 01/23/2008 Date Well Completed 08/2111987 feet) ------ Drilling Fluid Bentonite Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Plastic Joint ko Information Drive Shoe? []Yes [] No AbovelBelow ft. Casing Diameter 4 in. to 54 ft. Weight Ibs.lft. Hole Diameter 7.5 in. to 54 ft. ree Geological Material SAND SAND CLAY SAND gmColor BROWN BLUE BLU E LIGHT me Hardness MEDIUM SOFT SOFT SOFT peopl From To 0 12 12 33 33 47 47 54 Open Hole from it. In ft cp Screen YES Diameter 2 Make JOHNSON Type stainless steel Sone apa SyBaan SlotlGauze toon meme 15 Length 8 Set Between 50 ft. and 54 Stagc Water Level 18 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 40 ft after 1 hrs. pumping 8 g.p.m. 08t2'/1987 FL ---- REMARKS BOWER'S ADD/OUTLOT A PART OF LOT 5 -Located Unique Number Verilication Information from owner System UTM - Nad83, Zone15, Meters ascot ncn Method GPS SA On (averaged) Date NtA X: 414809 Y: 5168153 Fidos First Bedrock foro fei Last Slral Sand Faster Cutt Brest Aquifer Quat. BuriedArtes. Aquifer Depthto Redrock ft `County Well Index Online Report County Well Index Online Report Well Head Completion Pitless adapter manufacturer WHITEWATER Model []Casing Protection [] 12 in. above grade Bron rerun [] At-grade (Environmental Wells and Borings ONLY) on rs sas Bre EI Grouting Information WelIGrouted? [] Yes [] No Grout Material: Neat Cement from 6 to 40 ft. 0.33 yrds. Nearesl Known Source of Contaminalion 80._.Q~feet N direction Seotictank/drain field Nor irmeeee 1 B xe Well disinfected upon completion? [] Yes type [] No Pump [] Not Installed Dale hlstalled C,8/21!1987 Bi rn oawn Manufeciurer'sname MEYERS Model numberS Jll HP 05 EE ri CE, Length of drop Pipe 40 ft. CapacityS_._g p.m Type Submersible Volts 11~5 Material Plastic Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No "smrmabcem,re Well Contractor Certification Lambert WellCo License Business Name 443322557700 a wiye 18434 Lic Or Reg. No. teow LLAaMmBEERRLTYV. Name of Driller Fined tian Printed 9/16/2008 HE 01205 07 lp Agen Sa2078S Coe Wel 30g Report 1 057 {1037908 102335 AN ti~e:///JlL..p%2~Rpt/Appendix%2~D%2~Muni%2~FD%2~Site%2~Summaries/Cr~s~ake/We~%2~L~g%2~Rep~%2~-%2~43257~htm[~ 0/27/2008 10:23:25 AM] sare 0227223 STATE_02827223 22223333..00441111 Well Lg Ror 67413 Well Log Report - 00467443 r46744E3 ,Go Minnesota Unique Well No. County Quad Quad ID g5 n Crow Wing Cross Lake 231A WERLiL iANmDaBOnReING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~i~[} ]}ORI]~C~ ~CO~ moomn Entry Date Update Da:e Received Date wn 04116f1992 02/1312002 Tr Well Name RIVERWOOD PARTNERS -ownehip Range Dir Section Subsections Elevation 13T 2T W 21 CDBABA Elevation Method Breede 1231 ft 7 5 minute topographic map (+/- 5 feet) Minnesota Statules Chapter 1031 Well Depih 80 fl t= Depth Completed 80 ft. Date Well Completed 08/2311990 E-- e------------ Drilling Fluid Bentonite Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Plastic Joint No Information Drive Shoe? []Yes [] No AbovelBelow ft. Casing Diameter 4 in. to 72 ft. Weight Ibs.lft. Hole Diameter 8.5 in. to 80 ft. Well Address BOX 48 NIDSWA MN 56468 Geological SAN D SAN D CLAY SAND Material Color BROWN GRAY BLU E RED Hardness SOFT SOFT SOFT SOFT From 0 32 44 70 Open Hole from it. to ft Screen YES Make JOHNSON Type stainless steel Diameter To 2 32 SlotlGauze 12 44 70 80 Stage Water Level Length 8 Set Between 72 ft. and 80 6 ft. from Landsurface Da:eMeasured 08/23/1990 PUMPING LEVEL (below land surface) 35 ft after 1 hrs. pumping 40 g.p.m -- NO REMARKS Well Head Completion Pitlees adapter manufacturer WHITEWATER Model []Casing Protection [] 12 in. above grade Brun tner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No STEEL cts Mer Gta ee Oden foe ts 15) Located Minnesota Geological Survey Method DLcitization (Screen) Varro eet ma nt OA EA Unique Number Merilication Information from neighbor Date N/A Map(l:24,000) System UTM-Nad83, Zone15, Meters X 415301 Y 5168383 Grout Material: Neat Cement from 6 to 40 ft. 0.33 Nearesl Known Source of Coataminalion 100 feet N direction Sentie lank,/drain field type Nhe eps Bt Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Dale Installed C,812311990 = Manufacturer's name MEYERS Model number SD75 HP 1 5 ASRS Sr EE Cl Wn Length of drop Pipe 60 ft. Capacity30 g.pm Type Submersible Volta 22._.0.0 Material yrds. Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No First Bedrock isi sess ay LastSlral Band-red Aquifer Quat. Buried Arras. Aquifer D~plhloRedmck fl `County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No sombre Well Contractor Certification Lambert WellCo License Business Name 446677444433 Tr 18434 Lic Qr Reg. No. LAMBERP V Name of Driller FPirinteed t9/1i6/a20n08 HE 01205 07 e.g PM EOFSSame Crs Wel Lg Reps203467 {1037 208102335 ANI t~e:///J~/~..p%2~)Rpt/Appendix%2~D%2~Muni%20FD%20Site%2~Summaries/Cr~s~ake/~Ve~%2~L~g%2(~Rep~rt%2~-%2~467443~htm[~/27/2~8 10:23:25 AM] 2233.0412 state 02827224 2233.0412 STATE_02827224 Well Lg Ror 55572 Well Log Report - 00590372 5W90n372 Minnesota Unique Well No. JECounty Quad Quad ID g e Crow Wing Cross Lake 231A Tre Well Name SVEDVIK, ROY AND AN N -ownship Range Dir Section Subsections Elevation 137 2T W 21 CDCABA Elevation Method WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~]~[} ]}ORI]~G ~CO~ mn Entry Date Update Da:e Received Date 0210711997 02/1312002 Bed e 1225 ft 7 5 minute topographic map (+/- 5 feet) Minnesota Statules Chapter 1031 Well Depih 86 ft Depth Completed 86 ft. Date Well Completed 11/0611996 E-- e------------ Drilling Fluid Bentonite Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Plastic Joint No Information Drive Shoe? []Yes [] No AbovelBelow ft. Casing Diameter 4 in. to 81 ft. Weight Ibs./ft. Hole Diameter 8 in. to 86 ft. Well Address HCR 3 CROSSLAKE MN 56442 BEER 35202 RIVERWOOD TR Geological Material SAN D Fa CLAY odSAN D Color eeHardness no BROWN GRAY WH ITE SOFT MEDIUM SOFT Open Hole from it. to ft ge [TM WT From 0 rz tr 34 B08 80 Screen YES Make JOHNSON Type stainless steel Diameter To 2 34 80 86 SlotlGauze 12 Length 5 Set Between 81 ft. and 86 Stagc Water Level -1 ft. from Land surface Date Measured 11/06/1996 PUMPING LEVEL (below land surface) 20 ft after 1 hrs. pumping 85 g.p.m -- NO REMARKS Well Head Completion Pitless adapter manufacturer BAKER Model BOLT ON []Casing Protection [] 12 in. above grade Bron rerun [] At-grade (Environmental Wells and 3orings ONLY) on rs sas Bre EI Grouting Information WelIGrouted? [] Yes [] No cts Mer Gta a cette Located Minnesota Geological Survey Method DLcitization (Screen) Varro eet ma nt OA EA Unique Number Merilication Information from neighbor Date N/A System UTM- Nod83, Zone15, Meters X 415287 Y 5168199 First Bedrock orp prin LastSlral Sand-white Aquifer Quat. Buried Arras. Aquifer Deplhtn F~edrock ft `County Well Index Online Report County Well Index Online Report 00) Map(l:24,000) Grout Material: Neat Cement from O to 80 ft. 18 bags Nearesl Known Source of Coataminalion 90._.Q~feet S_~direction Se~tie tank/drain field Norenti i ta ve Well disinfected upon completion'? [] Yes type [] No Pump [] Not Installed Date Installed 11106/1996 rian a hog 0s. Manufaciurer'sname MEYERS Model numberS Jll HP 0 5 ae i Hl Length of drop Pipe 40 ft. Capacity 12 g.pm Type Submersible voVolts 220 Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No semitone Well Contractor Certification Lambert WellCo License Business Name 559900337722 wie 18434 Lic Or Reg. No. teow LAMBERT V Name of Driller Fined tian Printed 9/16/2008 HE 01205 07 lp Agen Sa2078S Coe Wel Lg Report 1 09057 {103790 102336 AN tile:///J]/...p%20Rpt/Appendix%2~D%20Muni%20FD%20Site%2~Summaries/Cr~s~ake/~Ve~%20L~g%2(~Rep~rt%2~-%2~59~372~htm[~ 0/27/2008 10:23:26 AM] state 02827225 STATE_0282 7225 22223333..00441133 WeLoglRolr 192 Wcll Log Rcport - 00641199 6i41e199 Minnesota Unique Well No. GoCounty Quad Quad ID gn Crow Wing Cross Lake 231A Tr Well Name BACKDAHL, JOHN -ownehip Range Dir Section Subsections Elevation 13T 2T W 21 CDBCAC Elevation Method WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~]~[} ]~ORI]~C~ ~J~C O~J~ mon Entry Date Update Da:e Received Date com 07106f20g0 03/1112005 Bede == 1238 ft 7 5 minute topographic map (+/- 5 feet) Minnesota Statutes Chapter 1031 Well Depth 94 fl Depth Completed 94 ft. Date Well Completed 02/2112000 E-- e------------ Drilling Fluid Bentonite Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Plastic Joint iko Information Drive Shoe? []Yes [] No AbovelBelow ft. Casing Diameter 4 in. to 90 ft. Weight Ibs./ft. Hole Diameter 8 in. to 94 ft. Well Address 14031 RIVESWOOD LA espe wt CROSSLAKE MN 56442 Geological Material SAN D CLAY SAN D our Color BROWN G RAY GRAY mes Hardness SOFT HAP D SOFT rnFrom 0 26 86 Open Hole from it. to ft no Cum So* ne LaT na ST un wn Screen YES Make JOHNSON Type stainless steel Diameter To 3 SlotlGauze 12 Length 4 Set Between 90 ft. and 94 26 86 94 Stagc Water Level 10 fl from Land surface Date Measured 0212'/2000 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. -- NO REMARKS Well Head Completion Pitlees adapter manufacturer BAKER Model BULLDOG []Casing Protedion [] 12 in. above grade Brun tner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No cts Mer Gta hts Otten tom 14) Located Minnesota Geological Survey Method DLcitization (Screen) Varro eet ma tO tA Unique Number Merilication Information from neighbor Date N/A Map(l:24,000) System UTM- Ned83, Zone15, Meters X 415219 Y 5168289 Grout Material: High solids bentonite from 0 to 60 ft. Nearesl Known Source of Coataminalion 50 feet North F,ast direction Sentic tank/drain field ~pe cites BvD Well disinfected upon completion'? [] Yes [] No Pump [] Not Installed Dale Installed 0212112000 ra Manufaciurer's name STA-RITE Model number HP 0 5 Vol~s 23._0.0 a AEoe A UE Length of drop Pipe 75 ft. Capacity._gp.m -ype Submersible Platerial 8 bags Abandoned Wells Does property have any nol in use and not sealed well(s)') [] Yes [] No rites ate ct pecs rate First Bedrcck isi soso any Last Slral Sand-gray Aquifer Quat BuriedArtes. Aquifer IQepth tn Redreck ft `County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes j smse Well Contractor Certification Nnrihland Drillina Inc License Business Name al=m49697 Lic Qr Reg. No. maacsh [] No PUGH G Name of Driller 664411119999 FPirinteed te/1i6/a20n08 HE 01205 07 e.g PM EOFSSame Crs Wel Lg Reprs2030006119 {1037 2008 102336 ANI t~e:///J~/~..p%2r)Rpt/Appendix%2~D%2~Muni%20FD%20Site%2~Sumrnaries/Cr~s~ake/~Ve~%2~L~g%2(~Rep~rt%2~-%2~641199.htm[10/27/2008 10:23:26 AM] 2233.0414 STATE 02827226 2233.0414 STATE_02827226 WeLoglRolr srs1 Wcll Log Rcport - 00656154 Bist]G,o Minnesota Unique Well No. 656154 County Quad Quad ID g5 n Crow Wing Cross Lake 231A TE Well Name KURILLA KIN -ownehip Range Dir Section Subsections Elevation 13T 2T W 21 CCBCCA Elevation Method WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} ]~ORIN-C~ 1~1~ C O~]~ mon Entry Date Update Da:e Received Date mm02120/2001 03/1112005 Feede=r = 1237 ft 7 5 minute topographic map (+/- 5 feet) Minnesota Statutes Chapter 1031 Well Depth 78 fl Depth Completed 78 ft. Date Well Completed 09/2712000 E-- e------------ Drilling Fluid Bentonite Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Plastic Joint Ko Information Drive Shoe? []Yes [] No AbovelBelow ft. Casing Diameter Weight Hole Diameter 4 in. to 74 ft. Ibs./ft. o=ss Geological Material SAN D SAN D CLAY SAN D CLAY SAN D CLAY/ ROCKS SAND/ ROCKS g Gremmes Color BROWN Hardness SOFT GRAY SOFT GRAY SOFT GRAY SOFT GRAY MEDIUM GRAY SOFT GRAY HARD GRAY MEDIUM OfonTLTo From To 0 6 6 25 25 32 32 34 34 45 45 50 50 71 71 78 Open Hole from it. to ft [om Screen YES Diameter 3 San rT on agT en Make JOHNSON Type stainless steel SlotlGauze 15 Length 4 Set Between 74 ft. and 78 Stagc Water Level 10 fl from Land surface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping 12 g.p.m. 09127/2000 -- NO REMARKS Well Head Completion Pitlees adapter manufacturer BAKER Model BULLDOG []Casing Protection [] 12 in. above grade Brun tner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No cts Mer Gta hts Otten tom 14) Located Minnesota Geological Survey Method DLcitization (Screen) poermmangr AI Unique Number Merilication Information from neighbor Date N/A Map(l:24,000) System UTM - Ned83, Zone15, Meters X 414786 Y 5168247 Grout Material: High solids bentonite from 0 to 40 ft. Nearesl Known Source of Coataminalion 44.~_feet N direction Seotictank/drain field Nici pies Bre 8 0 Well disinfected upon completion? [] Yes type [] No Pump [] Not Installed [,ale Installed 10/05!2000 rs ale ies toss wag Manufaciurer's name STA RITE Model number HP 0 5 Volts 230 aA er SB Length of drop Pipe 58 ft. Capacity 10 g.pm Type Submersible Material 6 bags Abandoned Wells Does property have any eel in use and not sealed well(s)? [] Yes [] No rites ateot nok hte First Bedrock ise soso any Last Slral Sand & larger-gray Aquifer QuaL BuriedArtes Aquifer D@fhto Redmck It `County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes E smsr Well Contractor Certification Nnrihland Drillina Inc License Business Name a=lm 49697 Lic Qr Reg. No. vmaam [] No PUGH G Name of Driller 665566115544 FPirinteed t9/1i6/a20n08 HE 01205 07 e.g PM EOFSSame Crs Wel 20g Reps204000541 {1037 2008 102336 ANI t~e:///J~/~..p%2~Rpt/Appendix%2~D%2~Muni%20FD%20Site%2~Summaries/Cr~s~ake/~Ve~%2(~L~g%2(~Rep~rt%2~-%2~656~ 54.htm[10/27/2008 10:23:26 AM] 2233.0415 state 2827227 2233.0415 STATE_02827227 Well Repo dom Wcll Log Rcport - 0072002 l wo] Minnesota Unique Well 720021 No. E,County Quad Quad ID ge Crow Wing Cross Lake 231A WEHLLiANlD BaORING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL flll]~D ]~ORI]~C~ 1~1~ C 0~]) Minnesota Statutes Chapter 1031 Well NameOLSON, DAVID & KATHY -ownehip Range Dir Section Subsections Elevation 13T 2T W 21 CCBD Elevation Method 1238 ft Calc from DEM (USGS 75 m n or equi~ ', Well Depth 63 fl Depth Completed 63 ft. mmnm Entry Date Update Da:e Received Dote oogm03110f2095 05/1812096 01t2512005 Date Well Completed 09/2312004 E-- e------------ Drilling Fluid Bentonite Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Plastic Joint Ko Information Drive Shoe? []Yes [] No AbovelBelow ft. Casing Diameter 4 in. to 58 ft. Weight Ibs./ft. Hole Diameter 8 in. to 63 ft. Well Address 10304 SQUAW POINT RD MN Geological Material SAN D CLAY SAN DY CLAY SAN D Color BROWN GRAY G RAY GRAY Hardness SOFT MEDIUM M E DIU M SOFT From 0 10 25 55 Open Hole from it. to ft Screen YES Make JOHNSON Type stainless steel Diameter To 2 10 SlotlGauze 12 Length 5 Set Between 58 ft. and 63 25 55 63 Static Water Level 3 ft. from Land surface Da:e Measured 09/23/2004 PUMPING LEVEL (below land surface) 50 ft after 1 hrs. pumping 25 g.p.m -- NO REMARKS Well Head Completion Pitlees adapter manufacturer BAKER Model BOLT ON []Casing Protection [] 12 in. above grade Brun tner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No cts Urns Located Minnesota Deparlment of Heallh Unique Number Merilication N/A System UTM - Ned83, Zone15, Meters hts cosh Hires Melhod GPS SAO1f(averaged) Date 03/08/2005 X: 414933 Y: 5168361 First Bedrock Aqu ifar `County Well Index Online Report Last Slral Depth tn Redrock ft County Well Index Online Report Grout Material: High solids bentonite from to 45 ft. 5 bags Nearesl Known Source of Coataminalion 0_.~feet _direction _type ite ees 0 vB Well disinfected upon completion'? [] Yes [] No Pump [] Not Installed Dale Installed C1912312004 res a1e 38 vi Manufacturer's name JACUZZI Medal number _ HP 0._~_6 Molts 22._.~.0 ed eB Length of drop Pipe 40 ft. Capacity 12 g.pm Type Submersible Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Lambert WaterWells Inc 18691 LAMBERT [ License Business Name 772200002211 Lic. Or Reg. No Name of Driller Fined tian Printed 9/16/2008 HE 01205 07 e.g PMEOSF ameS Crs Wel Lg Reps203000021 {1037 2008 102337 ANI t~e:///J~/~..p%20Rpt/Appendix%2~D%2~Muni%20FD%20Site%2~Summaries/Cr~s~ake/~Ve~%2(~L~g%2(~Rep~rt%2~-%2~72~'321 .htm[10/27/2008 10:23:27 AM] 2233.0416 state 02827228 2233.0416 STATE_02827228  DDiillwwoorrtthh 22223333..00441177 STSATATTEE0_208282277222209 SSIITTEE SSUUMMMMAARRYY Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: Dilworth Dilworth D7D0ii9lww1o"orrtthhAvFFei.irreeNDDeWeppaarrttmmeenntt Dilworth, MN 56529 709 1at Ave. NW Dilworth, MN 56529 K2K1uu8rrt.2KK8ee7nn.nn2eed2dy4y,8, FFiirree CChhiieeff 218-287-2248 TTrraaiinniinngg LLooccaattiioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water wall: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: Fire hal, 708 1 Ave. NW Fire hall, 709 1~t Ave. NW 221177002200..0055,, 55116988226666..1144 CGGllalassassBAsB:HsHAiinsEEuxxlppaaSnntssviioeonnx FFooaamm:: AAnnssuull 33-66%% Class A: Ansul Silv-ex AAnnnnuuaallllyy LLeessss tthhaann 55 ggaalllloonnss GGrroouunndd CCGlllaaassssss 8AB HHliiosEEsxxptpahaannnssii5oonnGaFFlolooaanmms:: 5 ggaalllloonnss Class A: less than 5 gallons DDrraaiinnaaggee ddiitcchh lleessss tthhaann 111/48 mmiilee nnoorrtthh 11td4 ttoo 117/22 mmiilee ssoouutthhwweesstt SStitee iiss nnoott llooccaatteedd iinn aa kkaarrsstt aarreeaa Less than 1/4 mike southviest Less than 1/4 mile southwest More than 1 mie More than 1 mile Less than 122 mie Less than 1/2 mile "11 22223333..00441188 STATE02827230 STATE_0282 7230 DDIILLWWOORRTTHH CCWWII WWeellll MMaapp. . emp mem------ Li3)ES ---- od}{ b ; AS E ] Sl . ho yw ol | : FN FoooeogmeT Mle oT ! ls 0 kong ogy TT gELe) egph} e FR it sored rt | p= e T | TT | a pa hAtFt is d i n8 t oo _| SITfprE: |pWuES HYh Ee" SesleBnn 0 S ird a |fLL eTe P heR at t 5Ny T i mR a TEpg reanBlilAe |CTcrRCeT g T d | p0 !e elu bk: ,CT T . e 2 e ] = pm i ] i @ I : J | : { MevescaDcprtnert dost Onionof EnmersHoh Coor20g07 1 V--------04Tm 22223333..00441199 sate 2827s STATE_0282 7231 til i . 1 Hl i J Fi ang HHHIND OiE hil] 3i wJE.R | gillian !E;: =46-54N 246-53 N ap46-52 N wn 3 46-51 N 3 1 5 ; | il | wl! Z g1d. a 1 pie 1 = | I o1 r 1diNu e i J i TT Ww id i : i1 w|i 22223333..00442200 SSTTAATTEE_0022882277223322 | DiDlilwwoorrtthh WWhahta't'ss IInn MMyy NNeeigihgbohrhbooodrMMhaapop od | NE IT Lo lis % A ~r | Ee) ] fui { | || em| {i S TT L dqI| itn fs fo|imet? fowedden SyFE--y HE FEE fs ali 17] od 1% { H| epo L fT ee ) | | | Fo Be |i be rn )|[Bm Disclaimer: Map and site information is believed to be accurate but accuracy is not guaranteed. of the information should be considered to be, or used as, a legal document. The information is |S ER AEE subject to the express condition that the user knowingly wai,,-es any and all claims for damages | MPCA that may arise from the use of this data. | | No portion provided against || @Minnesota Pollution Control Agency | | PDeerlRaSmo toenaiNtupaos tsrtieudnd mweemes: ctaeinors roeSaportn r eyes a 44RRERiRAATowSosDsFseaoctirleaiotn ohannsa 22223333..00442211 sare 02827233 STATE_0282 7233 Wallog Report: Wcll Log Rcport - 00222094 Zee Minnesota Unique Well 222094 No. w JE. o County Quad Quad ID Clay Sabin 262C Well Name DILWOR-H ICE HOUSE maw -ownahip Range Dir 139 48 W Section 11 we Subsections BBCDDD oven Elevation Elevation Method WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} I}ONI]~G ~0~ Minnesota Statules Chapter 1031 mn Entry Data Update Da:e Received Date 04107f1988 05/06~2005 Well Depih Depth Completed Date Well Completed Sr mm] 906 ft 7 5 minute topographic map (+/- 5 feet) 263 fl 180 ft. 03/0911953 vss Well Address Drilling Fluid -Use Abandoned I Well Htdrofractured? I From :t to Ft Status Sealed ~ Yes ~ No CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/BelowO ft. DILWORTH MN Geological Material TOP SOIL CLAY STICKY SHALE SILTY SAND + WATER ome - SHALE BED ROCK SAND + WATER SHALE a COARSE SAND + SILT 8 SHALE SAN D SHALE SHALE 4- SAND SHALE SHALE SHALE SHALE A -- REMARKS WELL SEALED 01 22 1992 BY 71015 ORIGINAL USE CO COMMERCIAL Color BLACK YELLOW GRAY Hardness HHAARRDD HARD wmHARD peHARD HARD HARD HARD Casing Diameter Weight From To 0 4 4 18 18 100 EEoF100 101 1101 111 111 118 118 122 122 134 134 139 BOE 139 179 179 180 180 212 212 225 225 235 235 238 238 258 258 263 6 in. to 183 ft. Ibs./ft. Open Hale from 183 fl. to 263 ft. Screen NO Make [ ome Diameter Type `StovGauze. Slot/Gauze Length Length Static Water Level 113 ft. from Land surface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 03/07t1953 Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade a Gr [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Hole Diameter SetBetween Set Between J Located Minnesota Geological Survey Unique Number Merilication Other, nolo in remarks Ea rT s 30 $90 System UTM - Ned83, Zone15, Meters Method Digitized scale 1:24,000 or larger(Digitiziqg Table) Date N/A X: 217093 Y: 5191747 Nearest Known Source of Cor~amination _feet _direction _type Vor siren _@ v8 xe Well disinfected upon completion? [] Yes [] No Pump [] Not Inatalled Date Installed Ee ar TI Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No First Bedrcck Cretacaous,Undiff eer vrannn roan Last Slrat Cretaceous,Undiff. Aquifer Quat. BuriedArtes. Aquifer Depth to Bedrock 180 ft. County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification 222222s009a944tan License Business Name com etm Lic Or Reg. No. BODIN. E. Name of Driller Printed 9/7212008 Printed 911212008 HE-01205-07 le 00 Ape 201 Nm RDS Hl0p30400 2 205 81029 458) state 02627234 STATE_0282 7234 22223333..00442222 Witton. o07s76 Wcll Log Rcport - 00478747 Minnesota Unique Well No. a4r7e8r7a4r7 Jwez,on County Quad Quad ID Clay Dilworth 262B Well Name MN DOT TRUCK STATION nav sn ee -ownehip Range Dir Section Subsections Elevation 139 48 W 11 BBAACA Elevation Method WE|LLRAENcDomByO,RING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Well Depih Le ee 905 ft 7 5 minute topographic map (+/- 5 14 ft feet) Depth Completed 14 ft. [maLno Entry Data Update Da:e Received Date 11125/1992 02/04/2008 Date Well Completed 03/0411992 Drilling Fluid -Use Abandoned ~ Well Htdrofractured? J From :t to Ft Status Sealed [] Yes [] No Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below ft Casing Diameter Weight Hole Diameter Well 10 sess Address HY DILWCRTH MN 56259 2 in. to 4 ft. Ibe./ft. 2 in. to 14 ft. Erm Open Hole from it. to ft Screen YES Make JOHNSON Type stainlesssleel Geological Material BLACK TOPSOIL TO BLK/GRY CLAY GRAYIYELLOW SILTY CLAY a GRAY/YELLOW SILTY CLAY YELLOWIBROWN WET CLAY Color Hardness From To 0 2 SOFT 2 4 ER SOFT 4 1D 10 14 Diameter 2 SlotlGauze 20 Length 10 Set Between 4 ft. and 14 ft. Static Water Level 63 ft. from Land surface Date Measured 03104/1992 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. re REMARKS WELL SEALED 07-15-1996 BY 27058 ORIGINAL USE MW - MONI IrjH, WELL nhrioumsgoemisos Located Minnesota Depadment of Health Unique Number Verification N/A System UTM - Ned83, Zone15, Meters erga Method Digitization (Screen) - Map (1:24,000) Date 07122/2904 X: 217275 Y 5198075 o--iFirst Bedrock iE"f Aquifer County Well Index Online Report Last Slral Depth to Bedrock ft. County Well Index Online Report Well Head Completion Ci EPitless adapter manufacturer Model []Casing Protection Y [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Grout Material: Neat Cement from to 2 ft. Te Eno Nearesl Known Source of Conlaminalion __feet __d~rcction __type Well disinfected upon completion? 1 [] Yes G8[] No Pump [] Not Installed Date Installed Manufacturer's name Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volta Material Abandoned Wells Does property have any not in use and not sealed well(s)'~ [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification Ri eee Thein Well Co 34050 ee ul, License Business Name Lic. Or Reg. No. [] No HERRBOLDT. N. Name of Driller 417788774477 PPrriinntteedd 997/1122/722000088 HE 01205 07 el. R Ap20 e NESS nel 2ggr KOSS 127208 19209 sate 02827235 STATE_0282 7235 22223333..00442233  EEllyyssiiaann 22223333..00442244 STATE02827236 STATE_0282 7236 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoonnttaacctt:: SSIITTEE SSUUMMMMAARRYY EEllyyssiiaann 2EEl0lyy2ssiiEaannMFFaiiirrene DDSetepepaearlrttmmeenntt 2BEBl0ooy2xxsisE9a.n,MMaiNn Street 56028 Elysian, MN 56028 5FFi0irr7ee-CC3h2hi7iee-f3fJ0Ja7as1soonn JJaammeess 507-327-3071 TTrraaiinniinngg LLooccaatitioonn:: Fi hal, 202 & Main Street Fire hall, 202 E. Main Street Training Location Coordinates (XY): 445216.8, 4894163 44 Training Location Coordinates (X,Y): 446216.8, 4894163.44 TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: AAClFFaFFs:Fs: A:uunnsusunursreeurooeff obbfrraabnnrdda,,ndddooecsns't belive believe ever ever uso use 3M 3M brand brand Class A: unsure of brand FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: GGrroouunndg AAnnnnuuaall ffooaamm uussee:: AACFlFFaFsFFs::ALLoeLssosssttshhaatnhna5n gg5aalglllaoolnnlsos.ns. Class A: Less than 5 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: LLaakkee EEllyyssiiaann lleessss tthhaann 11//44 mmiilee ssoouutthheeaasstt Nearest wetland: Nearest wetland: Loss than 178 mi northeast Less than 1/4 mile northeast Karst Area: Karst Area: Steis located in a covered karst area. Site is located in a covered karst area. Nearest water well: Nearest water well: 12101 mie east 1/2 to 1 mile east Nearest Wellhead Protection Area: More than 1 mic. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SSiitteeiss llooccaatteedd nin aa SSWWAAAA SITE RANKING: 1 SITE RANKING: 16 22223333..00442255 STATE02827237 STATE_0282 7237 EELLYYSSIIAANN CCWWII W Weellll MMaapp SEo7 E ReT aal) ON We LA Yan eat E RENTS CsASa mE Fen Fh TSa E oven T NEA SEAS Hoaibg i ne SIONTPERLeAe I CrseUR]BE keSetwee Ri onfo aCE g pn RAISE ON iL TE pl 3p LwdY Wi ITgYpm EE SO)1 RS ee tal dR Shas LHeETLd TSA iREdEea hrm arl aE ggnovE n CL] Copeman Ql A TT TT LAS Take oT Nas ES re se Lie kWl oolas! SE Awe y evn eatLS 5 aegd lee aJt Cn [iTen7 2 [ANY Wo S"E7 AA z ff oid MriOmiratdlst indGrNosh, Cop C27 iy LSR50 Cheng IX 7 FR Fae cainLIF 8 Ane Sgr Gee Lo 22223333..00442266 sare 282723 STATE_0282 7238 We f Wo TO died HFEL IRIN i IHi;i ideHH i Pie IY 7 3 1 Qh a I] Ris 3! ~ i4 a) i Ld WI Sa ay tii. g pail 2 p : fy 4 | id | g Hig | i ii | fk Ii 8 32 | If ay I E . If G& EE 3 iia 2233.0427 -- STATE_0282 7239 Elysian What's In My Neighborhood Map EyEy \ nN Th he 2\ 7 Xi { i1\ oul] L| I Al 1 yy sor & aE ol J / ier fe m E sree . ; : I Err andE y hy 3 ili / A J 1 Sits. SUSIE SS | *OFutunmoamnmasastoeiaaSewunaposernu.ns Disclaimer: Map and site hffo~lnation is believed to bc accurate but accmacy is not guaranteed. No portion LE eonEm | ww of the information should be considered to be, or used as, a legal document. The information is provided subject to the express condition that the user knowingly waives any and all claims for damages against 1VIPCA that ]nay arise from the use of this data. o Setaxteeusporin Foamisusriung @Minnesota Pollution Control Agency rEemmeosrt 4reRatanrocins +RouRmAsweeosrtcoosrtmomnsCharan 22223333..00442288 STATE 02827240 STATE_02827240 WallogReport 51132 Wcll Log Rcport - 00511329 sim Minnesota Unique Well 511329 No. wJmECounty Quad Quad ID si e Le Sueur Elysian 54B Well Name SCHULTZ, WEST -ownship Range Dir Section Subsections Elevation 109 24 W 36 DCCBBC Elevation Method WEBLLLIATNDRBOONRNING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 1023 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 100 ft Depth Completed 100 ft. man Entry Data Update Da:e Received Date gw 1011011991 07/23/2002 Date Well Completed 05/1611990 pm Well Address RFD ELYSIAN MN T= Geological Material SAND CLAY SAND LAYERS SAND + GRAVELERS BT Color GRAY GRAY GRAY Hardness SOFT SOFT SOFT riFrom 0 45 83 To 45 83 100 ---- Drilling Fluid Bentonite Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below 1 ft Casing Diameter Weight Hole Diameter EEr-------- 4 in. [o 95 ft. Open Hole from it. In ft 11 Ibs./ft. 6 in. to 95 ft. Screen YES Make JOHNSON Type stainless sleel Diameter 3.5 Slot/Gauze 10 Length 7 Set Between 95 ft. and 100 Static Water Level 4 ft. from Landsurface Da:eMeasured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 05/16/1990 -- NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade Bren rerio yen [] At-grade (Environmental Wells and Borings ONLY) Ce ms rsa Gre Grouting Information WelIGrouted? [] Yes [] No ts versity Located MinnesotaGeologicalSurvey Unique Nu'~ber Varilication Address verification System UTM- Ned83, Zene15, Meters Semin Son 400 Method Digitization (Screen) Map(l:24,000) Date 06/24/2034 X: 447553 Y 489z.037 FestBucs First Bedrock iss sos SET Last Slral Sand & larger gray Had ea Suw s Kiaker Aquifer Qual. BuriedArtes Aquifer Depthto Bedrock it. County Well Index Online Report County Well Index Online Report Grout Material: Cuttings from 0 to 95 ft. the eather Bo Be Nearesl Known Source of Conlaminalion 80._.Q~fct W direction SePtic tank/drain field t3~pe Well disinfcctod upon completion? [] Yos [] No brioo ro RM ad Pump [] Not Installed Dale Installed Manufacturer'sname FLINT+WALLING Model numbe" HP (I.5 Volts22,_,O.O Length 01drop Pipe_ft. CapacitylO_~_,g p.m ype Submersible Material Abandoned Wells Does property have any not in use and not sealed well(s)~ [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification 55o11r11m33b22u99mre License Business Name a 42198 5, BEMIS. B. SR. SEL Lic Or Reg. No. Name of Driller Printed 1032008 Printed 1013/2008 HE 01205 07 le a Rp Append DN TP 34 SnareLag Reon3530081 529102700 103700 AN tile:///J~wup%2~Rpt/Ap~endix%2~D%2~Muni%2~D%2~Site%2~Summarie~/E~ysian/We~%2~L~g%2~Rep~rt%2~-%2~51 ] 329.htrn[10/27/2008 10:27:09 AM] STATE 02827241 STATE_02827241 22223333..00442299 Wl Lg Ror 51359 Wcll Log Rcport - 00511339 sis Minnesota Unique Well 511339 No. wJmECounty Quad Quad ID &Waseca Elysian 54B 2a een Well Name JAMES, DON -ownahip Range Dir Section Subsections Elevation 108 24 W 2 BBADDA Elevation Method WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~]~[} BORIN-C~ ~J~C O~J~ Minnesota Statules Chapter 1031 mn Entry Date Update Da:e Received Dote 0112811992 03/1112005 Bo) 1044 ft 7 5 minute topngraphic map (+/- 5 feet) Well Depih 120 ft Depth Completed 120 ft. Date Well Completed 08/3011990 Ee Drilling Fluid Water Use Domestic ~ Wall Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Wood Joint Threaded Drive Shoe? []Yes [] No Above/Below 1 ft. Well Address RFD 1 esses wt ELYSIAN MN 56028 Geological Material CLAY CLAY GRAVEL LAYER + CLAY con Color YELLOW BLUE BLUE pen Hardness SOFT SOFT MEDIUM omFrom 0 20 40 Casing Diameter Weight Hole Diameter 4 in. to 115 ft. 11 Ibs/ft. 6 in. to 115 ft. 4 in. to 120 ft. Open Hole from it. to fl 10|Cum Screen YES Diameter To 3.5 St0one LuTgo EStTSeren Make JOHNSON Type stainless steel Slot/Gauze 10 Length 4 Set Between 115 ft. and 120 ft. 20 40 120 Stagc Water Level 55 fl from Land aurface Date Measured 08t30/1990 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. -- NO REMARKS Well Head Completion Pitlees adapter manufacturer MONITOR Model []Casing Protection [] 12 in. above grade Bruntner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No ots Mepis Located Minnesota Geological Survey Unique Number ~/erilication Other, note in remarks System UTM- Ned83, Zone15, Meters ots oes M12 Melhod Digitization (Sc'ean) Map(1 24,009) Date 06/2412904 X: 445468 v 4893705 First Bedrock isn rer smion AaSa Last Slral Pebblysand/silt/clay-gray Aquifer Quab BuriedArtes. Aquifer Depthte Bedrock ft `County Well Index Online Report County Well Index Online Report Grout Material: Bentonite from to ft. ritepe ve Nearesl Known Source of Coataminalion 200 feet Soulh East direction Se~tictank/drainfield type Well disinfected upon completion'? [] Yes [] No a AS epSIE Pump [] Not Installed Date Installed Manufacturer's name FLINT + WALLING Model numbe" NP 0 75 Volts 220 Length of drop Pipe _ft. Capacity 10_~_,g p.m -ype Submersible Platerial Stainless Steel Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No sombre Well Contractor Certification BemisWell Co License Business Name 551111333399 alm40198 Lic Or Reg. No. men BORN M Name of Driller FPrrinpted V10t3o/20n08 HE 01205 07 1g AppSUM TPSOScari Esa Wel SLRen2?04308 439 1027 2008 102709 A tile:///J~wup%2~Rpt/Ap~endix%2~D%2~Muni%2~D%2~Site%2~Summarie~/E~ysian/We~%2~L~g%2~Rep~rt%2~-%2~51 ] 339.htrn[10/27/2008 10:27:09 AM] 2233.0430 state 02827242 2233.0430 STATE_02827242 + GGooooddvviieeww 22223333..00443311 state 02827243 STATE_02827243 SSiittee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY GGooooddvviieeww 4GG1oo3ood5dvWvi,ieeww5FFiiSrrieereDDeeelppaarrttmmeenntt `Winona, 4135 W. Winona, MN 55987 5th Street MN 55987 R5Ri0icc7kk.3BB1aa2mm.b0ba0en3ne1ekk., Fire Fire Chiat Chief 507-312-0031 TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y);): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: Across fom fire station,at4140 W. 8" Sireet, Goodviow Across from fire station, at 4140 W. 5th Street, Goodview 860044447788,, 44887769775511..1111 AACFlFFaFsFFs::A:AAnnAssnuusllu((lhhiiSssittovorriiioccxuus(sheei))storic uso) Other. Class Other: HCT F-500 A/S A: Ansul Silv-ex HCT F-500 A/B foam sicks (current (historic use) foam sticks (current uussee)) AAnnnnuuaallllyy 55 ggaalllloonnss Ssttoormm sseevweerr AAClFFaFFsF:s:&22002gg0aallglloaolnnlssons Other: Havent used Class A: 20 gallons Other: Haven't used yyee,t, sswwiittcchheedd ftoo AA//BS sttiicckkss iinn MMaarrcchh 22000088 MMiissssiissssiippppii RRiivveerr bbaacckkwwaatteerrss,, aapppprrooxxiimmaatteellyy 11/44 mmiilee nnoorrtthh AApppprrooxmimataetellyy 11/t44 mmiilee nnoorrtthh SStitee sis llooccaatteedd iinn aann aaccttiivev kkaarrsstt aarreeaa Less than 1/4 mil north Less than 1/4 mile north Sito is located ina WPA Site is located in a WPA Less than 1 mie Less than 1 mile 221 22223333..00443322 STATE02827244 STATE_02827244 SS SS pl RTE GGOOOODDVVIIEEWW CCWWII W Weellll M Maapp f= PRN LINER NL a Fa ST aeall EBoidn o ui Awwm ner,eedoE rSyod Poa aLSan ST ESei he edal|e NUN .he 8 aoSsEWHdEe po pR SE TSe e SU Fo CAN Ea he | ELOY Fi ey PYTIOR | Men Bre BALL ont le ee TAt)UOaTyNwTgaSiEeEeeS eee e HERR LARC ARES i ba [fe Mat Sy Re ma ped| CHESNEY Go HE San {rare HOEY en "CERNTEASon BF "i Ea SENET EGE C Bo) T Cif E Ye a fhe Tien EONR. ,RMIONY e NSEe E ee e IWeeltihlaahN ead: = SS ond i ORYN Toni fBiEiT plndI qurTae een fos on ING EE A( bend SN | NNC y E ey E di I gel DLOgG E ee a )gl WAG ne FR =ERIN NVSOSIA NG SgEe Moder n,Dune der eCon rgan SURJ Raaa t Sigh 22223333..00443333 stareo2sz7245 STATE_02827245 gh ; BE, dn La hf lahat . LA ie. \& + id 8 ] af7l;or h S a N2S04,; 4 i ii | dy LIAS ih A go re i4 Weak i 14 g/l VI sd3 . fa = a 0o)/s id CL -- CLE ]i : iiet i |i |2: 2223333..00443344 STSATTAET_E0_022882277224466 _GoodviewWhat'sIn MyNeighborhood Map nl hb REaSs, } \ en NT ee Slide Sib er ag dT ERE NY ie he =3 ~ ESA a gy > | gy Ba i 7 TE yi farce | | ! /os+ Leh - | 4 LEEgli ITini {een pg rd NS Ad a, i rnili-- g ln SEET ETT || Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided subject to the express condition that the user knowingly waives any and all claims for clamages against ]VIPCA tha! may arise from lhe use of this data. =rSaomsaecaasviaasnornr caonerinnd reomitupraa @Minnesota Pollution Control Agency T rep P +sRnaMe meseor rnas Gras 22223333..00443355 stareo28z7247 STATE_02827247 WelogReport 056563 Wcll Log Rcport - 00563630 Co563m630 e =Jz,. Minnesota Unique Well No. 563630 County Quad Quad ID =~ Winona Winona West 46C SHIREMCORD MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} ]~ORIN-C~ 1~1~ C O~]~ Minnesota Statules Chapter 1031 Well Name EMD ASSOCIATES INC. ov -ownship Range Dir Section 10Y 7 W IT onSubsections CDB een Elevation Elevation Method Well Depih Ler lemme 658 ft 7 5 minute topographic map (+/- 5 feet) 66 ft Depth Completed 66 ft. m=nm. Entry Data Update Da:e Received Date ow0311411997 11/30/200T Date Well Completed 02/151199~ Well Address 4065 THEURER BL WINONA MN ri Geological Material SAND GRAVEL Gow Color BROWN iow Hardness MEDIUM 0 From 0 Drilling Fluid ~ Well Htdrofractured? [] Yes [] No -- J From :t to Ft EE Use Heat pump Casing Type Steel(black or bwcarbon) No Above/Below it Joint Threaded Drive Shoe? [] LI Yes [] Casing Diameter Weight Hole Diameter 6 in. to 52 ft. 19.45 Ibs./ft. 10 in. to 8 ft. 6 in. to 66 ft. Open Hole from it. to ft a Screen YES Diameter 6 po TT Make WESCO Type stainless steel SlotlGauze 15 Length 14 Set Between 52 ft. and 66 ft To 66 -- NO REMARKS -Located IEEE Unique Nu'~ber ~/eritication N/A System UTM - Ned83, Zone15, Meters te Coens Method Digitization (Screen) Date N/A X 604~.91 : 4879996 200 Map (1:24,000) -- First Bedrock ti IE n s Aquiter County Well Index Online Report Last Slral Sand & larger Depthto Bedrock ft. County Well Index Online Report Static Water Level 17 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 21 ft after 1 hrs. pumping 110 g.p.m. 02113/1996 Well Head Completion C Brrenan sangtoun Pitless adapter manufacturer WHITEWATER Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No PAT500 eB Sr Nearesl Known Source of Conlaminalion 60_.9._feet North West direction Tanks Well disinfected upon completion? [] .~yp Yos [] No Pon vni So Ete te Pump [] Not Installed Dale Installed 02113!1996 Manufacturer's name GOULDS Model number 90L07 HP 7.5 Volts 46,_,0.0 Length of drop Pipe 42 ft. Capacity 110 g.pm Type Submersible Material Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification FE a Hartert Well 79609 te LS. SE License Business Name Lic Or Reg. No. [] No HARTERT. E Name of Driller 553630 Prrted 72472008 Printed 9/24/2008 563630 HE 01205 07 el. pend 0a OFSXSi GoudiLeog Report5SGO220812845 AN) state 02827248 22223333..00443366 STATE_02827248 log Rn ss Well Log Report - 00563642 Co56s364i2 ],|i. Minnesota Unique Well No. 563642 County Quad Quad ID mm Winona Winona West 46C SEORWESCROORDNNG MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJlii~D ]~ORI]~G 1~1~ C O~]) Minnesota Statules Chapter 1031 Well Name EMD ASSOCIATES INC. ov -ownship Range Dir Section 107 7 W IT onSubsections CDC een Elevation Elevation Method Well Depih Germ lemme 657 ft 7 5 minutetopegraphic map(+/- 5 feat) 43 ft Depth Completed 43 ft. m=nm. Entry Date Update Da:e Received Date 0311411997 11/30/2007 Date Well Completed 11/1211996 Well Address 4065 THEURER BL WINONA MN Coen Geological Material SAN D GRAVEL Gow Color BROWN ft Hardness SOFT mE From To 0 43 Drilling Fluid -- ree Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or bwcarbon) Joint Threaded Drive Shoe? EE No Above/Below it [] Yes [] Casing Diameter Weight Hole Diameter 4 in. to 34 ft. 11 Ibe.fft. 8 in. to 8 ft. 4 in. to 43 ft. Open Hole from it. 1o Screen YES Diameter 4 aT Make WESCO Type stainless steel SlotlGauze 15 Length g Set Between 34 ft. and 43 ft a NO REMARKS -Located tte Method Digitization (Screen) A Unique Nu'~ber Veritication N/A System UTM - Ned83, Zone15, Meters Date N/A X 604677 Y: 4879919 S40 Map (1:24,000) o repe First Bedrock -Horn: Aquifer County Wel Index Online Report Last Slral Sand & larger brown Depth to Bedrock ft County Well Index Online Report Static Water Level 15 ft from Lend surface Date Measured PUMPING LEVEL (below land surface) 18 ft after 2 hrs. pumping 25 g.p.m 11112/1996 Well Head Completion C Brrenan seangtoun Pitless adapter manufacturer MONITOR Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No teeEee gygr, Nearesl Known Source of Conlaminalion 139 feet E direction Sentic tenD'drain field type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufaclurer'sname Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Volts Type Submersible Ma:erial Abandoned Wells Does property have any not in use and not sealed well(s)~ [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification a a Hartert Well 79609 te LS. SE License Business Name Lic Or Reg. No. [] No HARTERT. E Name of Driller 555633664422 PPrrrintteedd 792/2447/22000088 HE 01205 07 el. pend 0a OFSXSi Goudie Log Report 25S 2208128.45 AN) state 02827249 22223333..00443377 STATE_02827249  Keennyyon 22223333..00443388 STATE02827250 STATE_0282 7250 Site Nome: Site Name: FFiirree DDoeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY KKeennyyoonn KPKeeOnnByyooonnxSFFiirree DDeeppaarrttmmeenntt Kenyon, PO Box Kenyon, 6MMNN 5555934465 D5Do0ou7ug-g83NN8ooa-ah9h,6,5FF7iirree CChhiieetf 507-838-9657 TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusedsiinnttreraaiinnidinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt sSuLrirffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: FFiirree ssttaattiioonn,, 771144 22n7~" SSttrreeeett 5500112200869.911,,44980022111190 AAFFFFFF:: vvaarriieess,, mmoossttllyy 33MM-bbrraanndd ffooaamm BBai-annnnuuaalllyy LLSeehssosswtthshayasnnt55emggaahllollooonkns-s;u;pon,nltlyyhrreuunntaffoionaamwmiuuhnntwtilatitercc.oommeess oouutt nnoozzzzllee ttoo show system hook-up, then train with water. Ground Ground AACFlFFaFFsF:s:A2200lggesaasllllotohnnassn gatons Class A: less than 5 gallons TT11ardibbumuttiaarreyyot0ohttehheeeaNNsootrrthh FFoorrkk oofftthhee ZZuummbbrroo RRiivveerr,, aapppprrooxxiimmaatteellyy 1/4 mile to the east 111/4d ttoo 11/22 mmiilee nnoorrtthn SSiitteo aappppeeaarrss tto bbee llooccaatteedd iinn aann aaccttiivvee kkaarrstt aarreeaa Less than 18 mile west Less than 1/4 mile west More than 1 mic. More than 1 mile SSiitteeiss llooccaatteedd nin aa SSWWAAAA zr 27 22223333..00443399 STATE02827251 STATE_0282 7251 Rt fT ck KKEENNYYOONN CCWWII W Weellll M Maapp . smn LYRE I = E pald ] ees Mee e amS e oea Ae UT e aedSg SSEELRRA LL TT Ry AN ies I De EE SSB rene fT ee =, Gr AE en or ND BE oy 2 La Ci A l i nCRt nin= o oT riA CSe ETEam|T TE i w Ry2 LieaEdTSeOTe R$7n wl A IPy Aa S L eLoEnt T Eeea R ee GEN T e i a)CO E EsR BE TE EEER PR3E. FLEE ToIN te Voi ER ay NS anne biel 7 CToT ENLReaTaEan, EmreRARR al Ny aydw FTE itil Cg eR CE oi ana CURSE Hs RE ey B AnUARQTSTE EE R N er Hee AEA LPCoartE n, FFOeNaO|sSeeL tge T UsSn hT BRaN ly fr Li ET r 0e CIEE TT A TTY UR CRB Ne = fn ([ ram I NUTR weg: Suntan capone [7 17}ada 22223333..00444400 stareo28z7252 STATE_0282 7252 Ghyr le iiilA }: i ey HS i! Pog i ig Filan, Bi Ha iid : wen wwePipwEeiwrRaInaaEwnnHg MwBeerRHaEvies .&7 44-17-30IN 44-17-0 N 44-16-30 N 44-16-0 N 44-15-30 N 44-15-0 N ,. 3 o~-:o~ Foul | bLW l go Ju~ .......... {77 A3 os h /: g A 3 4 5 | :g J 3i ~ ~ ........... ~ / ~ 43 II ANA T sgg P2 ol ~ ........................ .......... .........>~,=: ~ ~ .......................... ........ .................. .................. g Lire bi ~....... .......... 2 ii i iis ....................................................................... ........ 33S| of | ! i FO i8s g { 3 1169}2 HE 3 \ % f 2 re | e h e % [i1] 22223333..00444411 stare oz72s3 STATE_0282 7253 -- f KKeennyyoonn WWhhaatt''ss IInn MMyy NNeeiigghhbboorrhhoooodd MMTaaarpp 1 | | j| = EU Fide /- it I =: SHE i | Hm ; \ |A I = Sim |1 || uPDomemeRlsaotbse atNiut paesrtid sund Disclaimer: Map and site information is believed to be accurate but accuracy is not guaranteed. No portion | SE I II S A | unemasaange of the information should be considered to be, or used as, a legal document. The information is provided | SEER SEE ee subject to the express condition that the user knowingly wai,,-es any and all claims for damages against |||| @ninnosota pollution Control Agency ||||" ocrbp ooemtemciamssouspog arttuannaeae i MPCAthat may arise from the use ofthis data. | SumoSuperiuna | | | 4 eRaranracies | reramostsczroanne l 4sue roossommne 22223333..00444422 state 02827254 STATE_0282 7254 WallogReport 56570 Wcll Log Rcport - 00564370 Minnesota Unique Well No. 556644337700 FACounty Quad zz.Quad ID wwGoodhue Kenyon 70C Well Name SECURITY STATE BANK -ownehip 109 wc Range Dir Section 18 W 4 om Subsections DCBACA een Elevation Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~7~L~LL filliP[} ]~ORI]~G RECORD I~J~C O~a~ Minnesota Statules Chapter 1031 Lr 1154 ft 7 5 minute topngraphic map (+/- 5 feet) Well Depih mm17 ft Depth Completed 17 ft. man Entry Date Update Da:e =n. Received Date 11121f1995 12/12/1995 Date Well Completed 0510111995 Well Address 602 2ND ST FoKENYON MN ee Geological Material SHALE wm ome Color GRAY Hardness HARD From 0 Drilling Fluid -- C-- R ---------------- Use Elevator ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or Iowcarbon) Joint W'elded Drive Shoe? A No Above/Below 0 ft [] Yes [] Casing Diameter Weight Hole Diameter 20 in. to 6 ft. Ibs./ft. 20 in. to 17 ft. 16 in. to 17 ft. Iba./ft. Open Hole from it. In ft Screen Make Type Cums Swans Diameter Blot/Gauze 3To 17 leh Length SuBeen Set Between NO REMARKS Located Minnesota Geological Survey Unique Nu"nber Verification Address verification System UTM Ned83, Zone15, Meters Method Digitized - scale 1:24,000 or larger (Digitizing Table) Date N/A X: 500912 Y: 4902125 Fimt Redr~k ee re Bes 0 Last Strat Clay gray Aqu iler Depth ~o Bedror;k ft. County Wel Index Online Report County Well Index Online Report Static Water Level fi frcm r3ale Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. oGsoommones Bsowtomen Well Head Completion Pitless adapter manufacturer Modal []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No Grout Material: Neat Cement from 0 to 17 ft. 14 bags Nearest Known Source of Contamination _feet __direction __type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufacturer'sname Length 01drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification 55e56e44e33p77o00rte Licenae Business Name LO002 i Lic. Or Rag. No STANGRET M Name of Driller Prirted 9242008 Printed 9/24/2008 HE-01205-07 hl. Ape 0m S051 Sms Keo Wel Tog 20egr 30 OSE (10272008 10305 AM) state 02827255 2233.0043 STATE_0282 7255 2233.0443 * LLaakkee JJoohhaannnnaa 22223333..00444444 STATE 02827256 STATE_0282 7256 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY LLaakkee JJoohhaannnnaa L5Laa5kk4ee5LJJeooxhhnaagnninnoaanFFiAirrveeeDD.eeNp.paar~tmmeenntt Shoreview, UN 5545 Lexington Shoreview, MN 55125 Ave. N. 55126 T6T5iim1m-BB4o8os1eh-hi7lkk0ee2,,4FFiirree Chef Chief 651-481-7024 TTrraaiinniinngg LLooccaatitioonn:: FFiirree SSttaattioonn 33,, 55554455 LLeexxiinnggttoonn AAvvee.. NN.,., SShhoorreevviieeww Training Location Coordinates (XY): 488316 27, 498501077 Training Location Coordinates (X,Y): 488316.27, 4995010.77 TTyyppee ooff ffooaammuusseeddiinntrtraaiinniinngg:: AAClFFaFFsF:s:AAA: nnAgngusususl3-S63i6%v%ox Class A: Ansul Silv-ex FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: AApppprrooxxiimmaatteellyy 4400 ggaalllloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground. sion sewer Ground, storm sewer AAnnnnuuaall ffooaamm uussee:: ClAAaFFsFFsF:A: :22001gg0aa0llllgooannlslsons: Class A: 100 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: TTuurrttllee LLaakkee fleessss tthhaann 11//44 mmiillee ssoouutthheeaasstt NNeeaarreesstt wweettllaanndd:: LLeessss tthhaann 11//48 mmiillee ssoouutthh aanndd eeaasstt Karst Area: Karst Area: Seis located in a covered karst area Site is located in a covered karst area NNeeaarreessttwwaatteerrwwelelll:: LLeessss tthhaann 117/88 mimile nnoorrtthh Nearest Wellhead Protection Area: More tha1n mie. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilce SITE RANKING: 1s SITE RANKING: 15 22223333..00444455 STSTAATTEE0_202882277225577 LLAAKKEE JJOOHHAANNNNAA CCWWII W Weellll MMaapp. ETE RY ad i) ok Bel hea ih wv Tg Yo Ag Gl eel ES PAT ARE meenLSI CE GA YE TN ee ee Tatdls Sok 18 EERE ATF No [AERA re NCE AAE Aases dahgabd)Lse| V gE JiEoimtE dm meR n 5AWNN TiDg)ed wd Wie EEE J Ie { Vallee, S meEb i BEER Won fc "iTgHEPRasEsi TprLoj [4 bRk CmeFe5e WEEEEm 142~ a won| Pe Y JA i 7 Beh SJ Ss.h| eAe R SadO AB aEoEr ReE ie cE bhfeE EE i de ldeig ad r een qn aTAi UdEe e C dooryC06a f&aa d1] W erem nt uongeSrUCoroNnEWoYh p8eMaw ma an 22223333..00444466 Jp-- STATE_0282 7258  wl s 0mTyy |[IE ihe sdidp, HBiBlh gitif ron soon son san H AL CI Re FB hainBD | | : [Ta Tr RH reid|na2 nal1 3 = d F21FdL aha,nDeXes = | 3gsPoreTmT RE.ta +Ee EJ,f| |ie Loa Rs I fF :. an 4 ds pl wi | 22223333..00444477 STATE_02827259 Lake JohannaWhat's InMyNeighborhoodMap | Alle ifigs1 ie E38 pipes MAA | ibanate SEN Pnmeresbamen Pusg i gl rer oh # oe if as 0y ra b i eT RE [Est engi hm2 miny Ligiei r) [ren SITE EFi - -TH | |lLwy | /A Hy| | |bet ft En = Liistd |. L ie T : | l [ mE s EE | Disclaimer: Map and site information is believed to be accurate but accuracy is not guaranteed. No portion of the information should be considered to be, or used as, a legal document. The information is provided uPrDepnoeinalRraao tuehnNt augapeos rriudnd subject to the express condition that the user knowingly wai,,-es any and all claims for damages against | MPCA that may arise from the use of this data. coo cetroctunor @Minnesota Pollution Control Agency | ees a A ARSRinAfeoor CHa 22223333..00444488 stare 2827260 STATE_02827260 WelLogReport 0112752 Wcll Log Rcport - 00112732 T112e732 wJmE EF WEPLL ALND BEORING Minnesota Unique Well No. County Quad Quad ID Ramsay New Brighton 119C MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~]~[} ]~ORI]~G ~O~ Minnesota Statules Chapter 1031 Well Name MICHAEL P. QUISBERG m5 nw E -ownahip Range Dir Section Subsections Elevation 1 com wt =pemmomenseis| ee0 = 30 23 W 2 CCDBCD Elevation Method 897 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 90 fl Depth Completed 90 ft. mpain Entry Date Update Da:e Received Date 08114f1991 08/23~1991 -- Date Well Completed 12/0811975 = Drilling Fluid -Use Domestic I Wall Htdrofractured? ~ Yes ~ No I From :t ~o Ft CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/Below0 ft. Casing Diameter Weight Hole Diameter 4 in. to 88 &. Ibs./ft. cies ers Geological Material SAND CLAY WATER SAND Gor wes Color Hardness pom To From To 0 20 20 70 70 90 To NO REMARKS ce ppt Located Minnesota Geological Survey ts as Unique Number Verification Address verification System UTM - Ned83, Zone15, Meters Op Method Digitized Table) 24 scale 1:24,000 or larger(Digitizing a tos Date N/A )~: 488630 Y: 4995083 First Bedrock Aquifer Quat. BuriedArtes. Aquifer County Well Index Online Report Last Slral Sand Depthfo Bedrock ft County Well Index Online Report Open Hale from it. 1o ft on Screen YES Diameter 2 Make JOHNSON Type other SlotlGauze 18 Length 6 Rw Set Between 84 ft. and 90 Stagc Water Level 20 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 60 ft after hrs. pumping 15 g.p.m. 12t08/1975 Well Head Completion Pitlees adapter manufacturer Model []Casing Protection [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No Nts Nearesl Known Source of Contaminalion _feet _direction _type Well disinfected upon completion'? 0 ve [] Yes 0 [] No EAE ET EE Pump [] Not Installed Dale Installed Manufacturer's name STA-RITE Model number GP1002 HP g 75 Volts 22,_,0.0 Length of drop Pipe 60 ft. Capacity 15 g.pm Type Submersible Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification [] No [] No License Business Name 111122773322 Lic Or Reg. No. Name of Driller Printed 9/10/2008 Printed 9/10/2008 HE 01205 07 he. tA 720aFDP 2050S ric ae han Wel 0g20Rep2r052001 2752 1027208 103247 AM) t~e:///J~..pt/Appendi~%2~D%20Muni%2~FD%2~ite%2~St~m~rie~/Lake%2(~J~hmma/We~%2~L~g%20Rep~rP/~2~-%2~0~ 12732.htm[10/27/2008 10:32:17 AM] 2233.0449 STATE02827261 2233.0449 STATE_02827261 WolLogReport 01207 Wcll Log Rcport - 00142007 n142r007 Minnesota Unique Well No. wJmECounty Quad Quad ID Ramsay New Brighton 119C WEPLL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~i~[} I}ONI]~G ~O~ Minnesota Statules Chapter 1031 Well Name JAMES KAVANAUGH 5 own oc woes -ownahip Range Dir Section Subsections Elevation 30 23 W 11 BBBCAB Elevation Method =prmmomenseis| LE YL 895 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 87 fl = Depth Completed 87 ft. mpain Entry Date Update Da:e Received Date 08114f1991 08/23~1991 mT Date Well Completed 12/2211977 = Drilling Fluid -Use Domestic I Well Htdrofractured? ~ Yes ~ No I From :t ~o Ft CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/Below0 ft. Casing Diameter Weight Hole Diameter 4 in. to 84 &. Ibs./ft. oss wn Geological Material SAND FILL P EAT CLAY SAN D gu, Color BROWN B LAC K GRAY BROWN men Hardness gonFrom 0 3 20 78 Open Hole from it. to ft Screen YES Cum Diameter |3.5 To Sl0oane LT oh SaT fer a Make JOHNSON Type stainless steel SlotlGauze 12 Length 3 Set Between 84 ft. and 87 3 20 78 87 Stagc Water Level 26 fl from Land surface Date Measured 12t22/1977 PUMPING LEVEL (below land surface) 26 ft afler hrs. pumping 30 g.p.m. To NO REMARKS Well Head Completion Pitlees adapter manufacturer Model []Casing Protection [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No ce ppt Located Minnesota Geological Survey ts as Unique Number Verification Address verification System UTM - Ned83, Zone15, Meters Op Method Digitized Table) 24 scale 1:24,000 or larger(Digitizing dts ssn Date N/A X: 488448 Y: 4994842 First Bedrock isi soso my Last Slral Sand-brown Aquifer Quat. BuriedArtes. Aquifer r)epfhtn Redrock ff County Well Index Online Report County Well Index Online Report ecto ve Nearesl Known Source of Contaminalion 75.~_feet W direction Septic tank/drain field Well disinfected upon completion'? [] Yes BD 0 type [] No ATEAEE R Pump [] Not Installed Manufacturer'sname TAft Length of drop Pipe 36 ft. Date Installed Modal number Capacity 10 g.pm TEwEie HP 1 7airs 22._.0.0 Type Submersible Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No sormtarmstone Well Contractor Certification License Business Name 114422000077 Eom Lic Or Reg. No. hewaom Name of Driller PPrrintteed 9//11001/2008 HE 01205 07 he. tA 720aFDP2050S ric ae han Wel 0g20Repr 2052001200 1027208 103247 AM) 22223333..00445500 STATE02827262 STATE_02827262 WeLoglRolr mt sss Wcll Log Rcport - 00153235 115533228355 | zwim. Minnesota Unique Well No. County Quad Quad ID Ramsay New Brighton 119C MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~TELL ~i~]~[} ]~ORI]~G RECORD ~O~ Minnesota Statules Chapter 1031 5 nnn ses owen Well Name THOMAS ONEIL -ownahip Range Dir Section Subsections Elevation 30 23 W 11 BBBACC Elevation Method J2smeweewenes] 895 ft 7 5 minute topographic map (+/- 5 feet) ee1r Well Depih 106 fl = Depth Completed 106 ft. man Entry Date Update Da:e ft Received Date 08114f1991 08/23~1991 hod Date Well Completed 09/0511978 Ee Drilling Fluid -Use Domestic I Wall Htdrofractured? ~ Yes ~ No I From :t ~o Ft CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/Below0 ft. Casing Diameter Weight Hole Diameter 4 in. to 101 ft. Ibs.lft. acon nn Geological Material CLAY GRAVEL WATER SAND com aon Color Hardness ponFrom To 0 83 83 94 94 106 -- NO REMARKS ce ppt Located Minnesota Geological Survey st ts Unique Number Verification Address verification System UTM - Ned83, Zone15, Meters Op Method Digitized Table) 24 scale 1:24,000 or larger(Digitizing tt ct Date N/A )~: 488512 Y: 4994877 First Bedrock Aquifer Quat. BuriedArtes. Aquifer `County Well Index Online Report Last Slral Sand Depthfo Bedrock ft County Well Index Online Report Open Hole from it. to ft pr Screen YES Diameter 2 gp Make JOHNSON Slot/Gauze 10 Type Length 5 a Set Between 101 ft. and 108 ft. Stagc Water Level 21 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 80 ft after hrs. pumping 20 g.p.m. 09t05/1978 Well Head Completion Pitlees adapter manufacturer Model []Casing Protection [] 12 in. above grade Bruntner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No ect Nearesl Known Source of Contaminalion 55.~_feet N direction _type Well disinfected upon completion'? 0 ve [] Yes 0 [] No ae be EE Pump [] Not Installed Dale Installed Manufaciurer's name GOULD Model number 10EXD7412 HP 0 75 Volts 23._0.0 Length of drop Pipe 54 ft. Capacity 12 g.pm Type Submersible Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification [] No [] No License Business Name 115633223355 Lic Or Reg. No. Name of Driller Printed 9/10/2008 Printed 9/10/2008 HE 01205 07 1. App O05 hha lg Regt253001 S55 1027208 103218 AM) tile:///J~..pt/Appendi~%2~D%20Muni%2~FD%2~ite%2~St~m~rie~/Lake%2(~J~hmma/We~%2~L~g%20Rep~rP/~2~-%2~0~ 53235.htm[10/27/2008 10:32:18 AM] 2233.0451 STATE 02827263 2233.0451 STATE_02827263 WaoglReplort 02670 Wcll Log Rcport - 00206709 220066770099 | wzzm. Minnesota Unique Well No. Caunty Quad Quad ID Ramsay New Brighton 119C MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~7~z~LL ~I~]~[} ]}ORI]~G RECORD ~J~C O~J~ Minnesota Statules Chapter 1031 Well Name TURTLE LAKE ELM. SCH. 3-ownship 30 pu Range Dir 23 W Section 3 ows Subsections DDDACB ween Elevation Elevation Method Well Depih Lr lemme 905 ft 7 5 minute topographic map (+/- 5 feet) 429 ft Depth Completed 429 ft. man Entry Data Update Da:e fbi Received Date 08114/1991 05/06/2005 Date Well Completed 1210211958 arate Well Address newsman NEW BRIGHTON MN Drilling Fluid -- ret Use Abandoned ~ Well Htdrofractured? J From :t to Ft Status Sealed [] Yes [] No Casing Type Steel(black or bwcarbon) Joint Welded Drive Shoe? EE No Above/Below it [] Yes [] Geological Material ESarean. SAN D SAN DY CLAY CLAY & STONE SAN DY CLAY Se Lure SAN D SAND & GRAVEL GRAVEL & DOLOMITE MIX 8HALE SAN DSTON E ar BROKEN SHAKOPEE & SANDSTONE DOLOMITE & SHAKOPEE SHALE JORDAN SANDSTONE JORDAN & SANDROCK ST. LAWRENCE SHALE ST. LAWRENCE SHALE ST. LAWRENCE SHALE Erie ST. LAWRENCE SHALE SAN DROCK SHALE Color Hardness From To Casing Diameter Weight Hole Diameter sE om E 8 5 BROWN BROWN BROWN BROWN 0 14 14 21 21 53 53 71 10 in. to 167 ft. Ibs.rft. 6 in. to 429 ft. EE] 6 in. to 301 ft. Open Hole from301 fl. to 429 fl. Ibs.rft. THiow TAN TAN YELLOW WHITE 5 Bor Sete 71 83 Screen NO Make 83 107 107 126 Diameter 126 127 Type Slot/Gauze ton Length sates Set Between YELLOW 127 131 > PINK YELLOW GRAY GRAY YELLOW YELLOW DK. GRY 2 131 166 228 231 166 228 231 232 232 255 255 290 290 301 301 343 Static Water Level ?,5 fl from I and surface Data Meas~Jred PUMPING LEVEL (below land surface) 30 ft after hrs. pumping 130 g.p.m. 1710711958 EY DK. GRY GRAY GREEN 3 BBareBiewaw n 343 364 364 425 Well Head Completion 425 ~29 Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) REMARKS GAMMA LOGGED 8 24 2001. LOGGED INTERVAL FROM 0 231 FT. IS QUESTIONABLE HAVE TO RELY ON DRILL LOG. WELL SEALED 08 28 2001 BY 71015 ORIGINAL USE PS -PUBLIC SUPPLYtNON-COMMUNITY Sts raasta Located Minnesota Geological Survey pErTaromigre Unique Number Verification Information from owner --eysoos rn248, Method Digitization (Screen) - Map (1:24,0(10) Date 08/24/2001 System UTM- Mad83, Zone15, Meters X: 488307 Y: 4995089 Grouting Information WelIGrouted? [] Yes [] No Grout Material: Neat Cement |r ae Nearest Known Source of Corntamination _feet __direction __type Well disinfected upon completion? [] Yes from [] No to ft. Pump [] Not Installed Date Installed -- eCeonttWeellner Gri pEery Borehole Geophysics Yes Fimf Radr~k Prairie Du Chien Group Last Strat Franconia Aquifer St.Lawrence-Franconia Depth to Bedrock 131 ft. County Well Index Online Report Manufacturer's name Model number__ HP_ Volts Length of drop Pipe_ft. Capaci~y_g.p.m Type Material AbandonedWells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contrador Certification Panner EH. Well 22i 00667700y 99 License Business Name 71015 Sh. SRE Lic Or Reg. No. PENNER. E. Name of Driller FeSO Printed 9/10/2008 HE-01205-07 el. Aen 0aOF205.05 Leb Wl20 Ree 204002060902 208103215 AN) state 02827264 233.0452 STATE_02827264 2233.0452 WolLogReport 042557 Wcll Log Rcport - 00428527 p4r28527 wm WEPLL ALND BEORING mpain Minnesota Unique Well No. Caunty Quad Quad ID Ramsay New Brighton 119C MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Entry Data Update Da:e Received Date 0512011991 08/23/1991 Well Name BLANCHETTE, ROBERT RET -ownehip Range Dir Section Subsections Elevation ows =Beamer] LE t " we 30 23 W 2 CDCCBB Elevation Method gO0 ft 7 5 minute topographic map (+/- 5 feet) Well Depih Depth Completed Date Well Completed 88 ft 88 ft. 05/0611987 ~=~'!!~!~ ~!~ =::.............................................................................................................................................. = Drilling Fluid -Use Domestic I Well Htdrofractured? [] Yes [] No I From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/BelowO ft. Oasing Diameter 4 in. to 84 &. Weight Ibs./ft. Mole Diameter cies ers Geological Material CLAY GRAVEL WATE R SAN D + G RAVE L Goo wns Color Hardness Open Hole from it. l0 ft pom To nT Hew Screen YES Make JOHNSON Type stainless steel From To Diameter 2.5 SlotlGauze 18 Length 6 Set Between 82 ft. and 88 0 65 65 80 80 88 Stagc Water Level 25 fl from Land surface Date Measured 05t06/1987 PUMPING LEVEL (below land surface) 50 ft after hrs. pumping 20 g.p.m. To NO REMARKS Well Head Completion Pitlees adapter manufacturer Model []Casing Protection [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No Lote es tpt. tos gti. 340 Ot Located Minnesota Geological Survey Method Digitized scale 1:24,000 or larger (Digitizing Table) Unique Number Verilication N/A Date NIA System UTM- Mad83, Zone15, Meters X 488797 Y 4995071 First Bedrcck ussre sno ay Last Slral Sand Aquifer Quah BuriedUnconf. Aquife Depthfn Redreck fl County Well Index Online Report County Well Index Online Report Net eB vB 0 Nearesl Known Source of Contaminalion 150 feet S direction __type Well disinfected upon completion'? [] Yes [] No AEA EEE, eT Pump [] Not Installed Date Installed Manufeciurer's name RED JACKET Model number 50CN1 HP 0 5 VoHs 11._.0.0 Length of drop Pipe 50 ft. Capacity 15 g.pm Type Submersible Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No [lespremre Well Contractor Certification Mccullouoh 8, Sons License Business Name 442288552277 Some 82054 Lic Qr Reg. No. tema Name of Driller PPrrintteed 9/10//220008 HE 01205 07 le. tA 720aFDP2050S ric ae han Wel 0g20Rep2r0520002852 hn 1027208 103219 AM) 22223333..00445533 STATE02827265 STATE_02827265 * LLaanneessbboorroo 22223333..00445544 STSATATTEE0_202882277226666 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY LLaanneessbboorroo LPLaaOnnBeeossbbxoor2roo10FFiirree DDeeppaarrttmmeenntt Lanesboro, IN PO Box 210 Lanesboro, MN 5s5s9o4d9e AA5s0ss7ts..t.4FF6i7ir~.e2CC2h2ih5eieffAAnnddrreeww DDrraakkee. 507-467-2225 TTrraaiinniinngg LLooccaatitioonn:: CCiittyy bbaalll fkfield ppaarrkkiinngg loott,, CCoouunnttyy RRooaadd 88 TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 556822118877..0044,, 44884411551188.4444 TTyyppee ooff ffooaamm uusedsiinnttearianinidinngg:: AAAFRFFAFFFF:F: FAA.qquuaaHisEEtccooorsistcituiccskke, unsure of brand Class A: AquaEco AR-AFFF: Historic Class A: Aqua Eco stick use, unsure stick of brand FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: BBai-nannunaulalllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: GGrroouunndg AAnnnnuuaall ffooaamm uussee:: AACFlFFaFsFFs::ALLoeLssosssttshhaatnhna5n gg5aalglllaoolnnlsos.ns. Class A: Less than 5 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: S`Soouutthh BBrraanncchh oofftthhee RRoooottRRiviveerr llooccaatteedd lfeessss tthhaann 11!88 mmiilee eeaasstt NNeeaarreesstt wweettllaanndd:: LLoessss tthhaann 11//88 mmiilee nnoorrtthh aanndd ceaasstt Karst Area: Karst Area: Sites located in an acive karst area. Site is located in an active karst area. Nearest water well: Nearest water well: 110 1/3 mie north-northeast 1t4 to 1/3 mile north-northeast Nearest Wellhead Protection Area: More than 1 mic. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: LLeessss tthhaann 11/84 mmiillee SITE RANKING: 1 SITE RANKING: 18 22223333..00445555 STATE02827267 STATE_02827267 A ME a LLAANNEESSBBOORROO CCWWII W Weellll M Maapp Le ER EARN A F dsa l Are e enTEEN Lbihe UREA RS Gain i UE a Se S D0r E GSHE REEL SNHD SEV0 Tcaab7o 74 ES | SERINE ENE Ji RY RE Lo iseo i HAs USeeosoeye RE e JSR E TEED froma Tae Pl Ney i ee ET Ne SlheBcih|e sl{1 ole emS a e ad PJ CAL A aE =) gi donot Pl ee LS Afio mE anse ) 2 TER th Emr bai y : Soe roan Nay fof SU i TE [ESTE 4PiAina SaALT pehne JoeShuadf%a -- RENIENN WW i SyN Xd hob Tala] rdn gHEnFah ioa Ne e Voz 3 OOVWILNAEhAlCS3 amiELTEUERIN TR sBerld 7A Wesstl pela, i/ | H WE ET E EN STR Low saSm v depete eran sn ere foeae roe 2233.0456 Jp-- STATE_02827268 dL | mld1 & " 5,B1 ERFiI:E3RSE HiA H18,H83 3i Vv fG3iifigtsig hab 5,88s5: a oa en eo me : 43-44-0 N 43-43-30 N 43-43-0 N 43-42-30 N HN at . 3 gl |OeYi : EY [J id I PA "3 2 [ No en i g \wGNaEfiria=e m B2o |g Ma,IN |i.B 5d TE) t2 i ik 2 fir, A o 2O de. | i 2 Fv i iz HE V7 sl . Wik ~ g ie 3 i ij a Ln br Hl 22223333..00445577 sare cases STATE_02827269 |" Lanesboro What's InMyNeighborhoodMap | | / iii |i i 8 1 TM~ | \ | NS | | ICE SITE Nf } | TMnN / ! {L~s~ " iN / vil || 7 =f ) =Be. ; 1 hs een |T reervmrasmirmaanie--rs Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion imc tet sid deme,Th limon sed Unpsrmiasd of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided | EER | pe subject to the express condition that the user knowingly waives any and all claims for clamages against ||| ]VIPCA tha! may arise from lhe use of this data. vayAupvriund coro Foam Speriuna || @Winnesota Pollution Control Agency | P iTacn . PSraeneapmisutsoasn Sean 22223333..00445588 soare casero STATE_0282 7270 Wcll Log Rcport - 00147039 11 47039 Minnesota Unique Well No. Joi w County Quad Quad ID F Ilmore Lanesboro 4B Well Name FORSTRUM, ELMER -ownehip Range Dir Section Subsections Elevation 103 9 W 18 CCBBDA Elevation Method WELaLcANoDrBOnRING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~]~[} BO]~I]~C~ ~CO~ Minnesota Statules Chapter 1031 f=mn Entry Date Update Da:e Received Date 12120/1991 11/21/1994 Well Depih 831 ft 7 5 minute topographic map (+/- 5 105 ft feet) prDrilling Fluid -Use Domestic Depth Completed 105 ft. Date Well Completed 04/2111978 ~ Wall Htdrofractured? J From :t to Ft [] Yes ---- [] No Casing Type Steel(black or lawcarbon) Joint W'elded Drive Shoe? No Above/Below 1 ft [] Yes [] Casing Diameter Weight Hole Diameter 8 in. to 44 ft. Ibs./ft. Well Address aeseonom LAN ESBORO MN poses Geological Material ie DRIFT SAN DSTON E gmColor ElVARIED RED mre pen Hardness ER SOFT From To 0 42 SOFT 42 105 4 in. to 59 ft. Open Hole from 59 ft. to 105 ft. Screen NO Make ameter Diameter Type `Sovauze. Slot/Gauze Ibe./ft. Length Length SetBetween Set Between oe NO REMARKS Located Minnesota Geological Survey Tt er Unique Number Verification Information from owner gystem UTM Ned83, Zone15, Meters Method D igitized - scale 1:24,000 or larger (D igifizing siTable) Date N/A X 583085 : 4841269 Fimt Redr~k ,Jordan rr Ee Last Strat Jordan Aquifer Jordan Depth to Bedrock 42 ft. Gounty Well index Oine Report County Well Index Online Report Static Water Level 74 fl from I end surface Date Msas~Jred 0417"1197 PUMPING LEVEL (below land surface) 24 ft after hrs. pumping 20 g.p.m. nr Well Head Completion Pitless adapter manufacturer Modal ri Shre []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) EE Grouting Information WelIGrouted? [] Yes [] No [OT Grout Material: Neat Cement from O to 59 ft. 2 yrds. Shah Se Nearest Known Source of Contamination 75 lbct __direction Sc#tic tanlddrain ficld type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufacturer'sname Length of drop Pipe_ft. Model number Capaci~y_g.p.m HP 0 Type Volts Material AbandenedWells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification Rowland Well Co. 11S447700l3399 e License Business Name 23124 ROWLAND N LEE. mE Lic Or Reg. No. Name of Driller Pre S008 Printed 9/24/2OO8 HE-01205-07 22223333..00445599 smeaaserzrs STATE_02827271 Wcll Log Rcport - 0071384l 7T13e84e1 Minnesota Unique Well No. oJEr,County Quad Quad ID E m F Ilmore Lanesboro 4B Well NameAMDAHL ORVIL -ownehip Range Dir Section Subsections Elevation 103 10 W 13 ACCAAB Elevation Method WEMLLaAcNoD BORING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL Ai~ID BOR~NG ~O~ Minnesota Statutes Chapter 1031 1095 ft 7 5 minute topographic map (+/- 5 feet) Well Depth 580 ft Depth Completed 580 ft. jBo EA Entry Date Update Da:e Received Dote -- mm 0 06/05f2008 11t0912004 Date Well Completed 09/1412004 , Drilling Fluid Foam Use Domestic ~ Wall Hfdrofractured? ~ Yes ~ No J From :t to Ft Casing Type Steel(black or lawcarbon) Joint Welded Drive Shoe? No Above/Below # ~ Yes ~ Well Address RR 2 BOX 133 LANESBORO MN 55949 ie Geological Material DRIFT Gib LIMESTONE SAN DSTON E LIMESTONE uy LIMESTONE SANDSTONE LIMESTONE LIMESTONE SHALE/SANDSTONE SHALE co Color BROWN Er TAN BROWN BLUE BrTAN BROWN BLUE GREEN ee Hardness SOFT Bn MEDIUM SOFT MEDIUM We MEDIUM SOFT MEDIUM MEDIUM = NO REMARKS Casing Diameter Weight Hole Diameter pen From Te 0 50 5 ff seme 50 72 8 in. to 50 ~. 4 in. to 512 ft. Open Hole from 512 fh to 580 ft. Screen NO Make Type Diameter Slot/Gauze 72 182 Ibs./ft. Ibs./ft. 12 in to 50 ft. 8 in. to 512 ft. tron sateen Length Set Between 182 252 22 252 320 420 452 320 420 452 492 492 512 512 580 Static Water Level 310 ft from I and ei]rface Dafe Meaeured PUMPING LEVEL (below land surface) reeee so 320 ft. after 2 hrs. pumping 15 g.p.m. Well Head Completion Pitless adapter manufacturer Modal C,911417004 REE []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No LLooccaatteedMMiinenessotaDDeeppaodrmtenetooff HHeeaatllhh Unique Number Verification N/A System UTM - Ned83, Zone15, Meters todGPSSAO area) Method GPS SAC[f (averaged) Dale X: 582353 Y: 4841921 --First Redr~k Last Slrat Fos Aqu Jfer Depth to Bedrock ft. `CCoouunnttyy WWeellll IInnddeexx OOnnlliinnee RReeppoorrtt Grout Material: Pearock GGrroouutt MMataetreiraila:l: NNeeaatt CCoemmeentt Grout Material: Neat Cement Nearest Known Source of Contamination 50_~Ibct __direction __type Well disinfected upon completion? from 182 to 320 ft. ffroomm 15to55008f.t. from to 512 ft. [] Yes [] No 8.25 yrds. 00.2255 yyrodns.. 10.75 yrds. Pump [] Not Installed Date Installed Manufaclurer'sname Model number__ Length 01drop Pipe_ft. Capacity_g.p.m HP_ Type Volta Material AbandenedWells Does property have any not in use and not sealed well(s)1 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No oo, Well Contractor Certification Thein Well Co. License Business Name 771133884411 SB. 55079 Lic Or Reg. No. fem SANDERS. T Name of Driller PPrrintteed 9//2244//22O0O08 HE-01205-07 22223333..00446600 stare 02827272 STATE_0282 7272 * LLuuvveerrnnee 22223333..00446611 SSTTAATTEE0_208282277227733 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY LLuuvveermnee LPLuuOvveBemomxee 8FF5iirr9ee DDeeppaarrttmmeenntt Luveme, MN PO Box 659 Luverne, MN 5566115556 D5D0ao7nn.2DD8ee3uui.ts9sc1ch4h,1, FF(iiwroeerCkC)hhiieeff 507-283-9141 (wor~ TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (X.Y); Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: Karst Area: Karst Area: Nearest water well: Nearest water well: NNeeaarreesstt WWeellllhheeaadd PPrrootteeccttiioonn AArreeaa:: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: TTofrreereeoaddduummpp,, 11//22 mmiillee sSoouutthhooff tthhee ictityy oonn HHuweyy 7755,, oonn tthhee eeaasstt ssiiddee of road. 240970.28, 4835779.61 240970.28, 4835779.61 AAClRRaA-sAFsFFAFF:F.N: oNNtoosltussruuerreofoobffrccauunrr.rreenntt brand; brand; used used 1o to use use 3M brand 3M-brand. Class A: Not sure of brand. QQuuaatrteerrlyy 55 ggaatlloonnss dGGirrtooiuugnrndad.v.elAAfwetehrretrtraeaiinntihinnegg,f, otthaheem cwGiatyysuususeseessd.aafoppdaaiyysllopaoodasedarelttoroatppiticchkke uuippytthhee ump. dirt/gravel dump. where the foam was used, for disposal at the city ACAlRRa--sAAsFFF&F:FF:2: 0551gg0aal3lll0oonngssallons Class A: 20 to 30 gallons AA ppoonndd ssttrreeaamm lleossss tthhaann 11//44 mimile ssoouuthh Less than 1/4 mie cast Less than 1/4 mile east Stes not located in a karst area Site is not located in a karst area Less than 1/8 mil o the north Less than 1/4 mile to the north TTrraaiinniinngg ssiitee llooccaatteedd wwiitthhiinn WWPPAA More than 1 mie More than 1 mile =28 22223333..00446622 STATE02827274 STATE_0282 7274 LLUVUERV NECE CWWIR IWWeN lelll MMEaapp S AAT mp wIl T iy amr EL 1TT TTrTeT at mes SPE BRT CELE x wie AR Gh emer OE alr hd! NogAre lV mg NITE A a efriely hoo 3 ro EIN i egg flied =ui ee AEE Sm IN NERT Teae or i" [SLi Wellhneek ad [5 SEEC TEN TAT sioy nt + SSEE Ap Te [3p rotectiont: & JEcs 4= dad FEE) Ged 47 oa ma) F Esi e s FREE ET( To e r 4 HT Fe No IP rsp " TE = SE EN ERSITR En Y fos fo Fagen 1ST ii aifa vem teBER PL a aE Be] Ven baaBeet EE poe HE J Sidi pe eB et R RE Susman oe LPT nso BEE EE P pa sm a el @[o-Nu JToe l CCC apEfeY n) pee LAST F eEErTS a J eas en 22223333..00446633 staveozszrrs STATE_02827275 : i al 3: ; Vv 3,5iG, ilg5, ii3i: fih lhin aiaine b nts iil3 :i a smu 43-39 N sun 43-38 N j|i Sl sa ) san 43-37 N ! 5: g :! is Jf -Mme of At lrgLAnl 4ED LR vg "OF . : -i gH . B51 : g3| ; a=Sf wmgim ? ii TT : fi 2 8 i g 3 \ 3 i it 2 ) ; iol i i pe iol w= = ee Hl N N L~-~b 22223333..00446644 soe caserzre STATE_02827276 | I LLuuvveerrnneeWWhFahotae't'e ss IEInnEMMr yyPrNNeeimiggre hhsbboorrhhooooddMMaapp my | ! in | 1) = | |. || Lyihn i JRE pas -- | - Ta &Pa Fos | | | -- SITE | / ifar] fe a I : oni Ses. |[[IBRmE I IAT || ) Disclaimer: Map and site information is believed to be accurate but accuracy is not guaranteed. No portion of the information should be considered to be, or used as, a legal document. The information is provided emnemes: PBee rnlRiSao ottteaNitupoeordiudnd subject to the express condition that the user knowingly wai,,-es any and all claims for damages against MPCA that may arise from the use of this data. |||| @Minnesota Pollution Control Agency | SiteSuperiund + Sn Fodveni Suportund C--. Vouanmason | | 4L RESRATmSE DFaeciliors agv 22223333..00446655 STATE_02827277 WallogReport 0227 Wcll Log Rcport - 00222779 Minnesota Unique Well No. 22202777799 zz,County Quad Quad ID om Rock A~h Creek x21C Well Name LUVERNE 9 2b -ownship Range 102 45 wzDir Section W 22 wwe Subsections ADDDAB een Elevation ElevatJonMethod MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING WELL AND BORING RECORD RECORD Minnesota Statutes Chapter 1031 mn Entry Date Update Da:e fbi Received Date 04117/1988 0510612005 Lr 1424 ft 7 5 minute topographic map (+/- 5 feet) Well Depih Depth Completed Date Well Completed me55 fl 55 ft. 00/0011962 ~[!!l!9~g_M!P~ = :2............................................................................................................................................. Drilling Fluid -- I Wall Htdrofractured? [] Yes [] No ] From :t to Ft ag Re ee BB Use Abandoned Status Sealed Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below 1 ft Casing Diameter Weight Hole Diameter 12 in. to 38 E. Ibs./ft. Well Address LUVERNE MN Open Hole from it. to ft Screen YES Make Type brass Geological Material TOPSOIL Ly GRAVEL SAN DY CLAY SAND & GRAVEL Color Hardness From To 0 7 Cr 7 21 21 30 30 55 Diameter 12 SlotlGauze Length 17 Set Between 38 ft. and 55 Static Water Level 9 ft. from Landsurface Da:eMeasured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 00/00/1962 rT REMARKS WELL SEALED 05-29-1992 BY 91353 ORIGINAL USE MU - MUNICIPAL et esr Located Minnesota Geological Survey oe tos Bt bs Unique Nu'~ber ~/erification Information from owner System UTM - Ned83, Zone15, Meters 8 ner Method D igitized - scale 1:24,000 or larger (D igitizing Table) 2670 Date N/A X 240728 : 4835176 Foetus A IN First Bedrock ti Seam Last Slral Sand & larger Aquifer Quat. Water Table Aquifer Depth to Bedrock ft. County Well Index Online Report County Well Index Online Report Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade Brenan seangtoun [] At-grade (Environmental Wells and Borings ONLY) Cr Grouting Information WelIGrouted? [] Yes [] No Gna ons . Grout Material: from 0 to 28 ft. i Nearesl Known Source of Conlaminalion __feet __d~rcction __type Well disinfected upon completion? Be [] Yes Be [] No EE se Pump [] Not Installed Date Installed Manufacturer's name Length of drop Pipe _ft. Model number__ HP_ Volts Capacity225 g.p.m Type Submersible Material Abandoned Wells Does property have any not in use and not sealed well(s)'~ [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification na son United States Geolooical Survey 222222e7777t99 e License Business Name Pe.USGS om wc Lic. Or Reg. No Name ol Driller Prirted 7102008 Printed 9/10/2008 HE 01205 07 lap Ape 0m S51 Sms vere WlLg Report 050227 M03730 03532) state 02827278 223.0466 STATE_0282 7278 2233.0466 Wall Lg Ror 022780 Wcll Log Rcport - 00222780 22 22780 Minnesota Unique Well No. w JE. m County Quad Quad ID Rock A~h Creek 21C Well Name LUVERNE 10 Wn own Gemes -ownship Range Dir Section Subsections Elevation 102 45 W 22 DAADDB Elevation Method WEBLLL IATNDRBOONRNING MINNESOTA DEPARTMENT OF HEALTH V~TF~LL flI~ND BORII~G R~C ORD Minnesota Statutes Chapter 1031 CCImOMUSGSTIM 1423 ft Calc from DEM (USGS 75 m n er equi~ ; Well Depth 42 fl Depth Completed 42 ft. mn Entry Data Update Da:e Received Date 04117f1988 05/06/2095 Date Well Completed 00/g011962 Well Address LUVERNE MN Bo. 6eological Material TOPSOIL frSAND & GRAVEL CLAY SAN D o--oColor BLU E REMARKS WELL #10 WELL SEALED 04-11-2003 BY 91686 ORIGINAL USE PC - COMMUNITY SUPPLY - cts enacts Located Minnesota Geological Survey Unique Nu"nber Verification Information from owner System UTM - Nad83, Zone15, Meters ween Hardness Drilling Fluid -Use Abandoned I Well Htdrofractured? I From :t to Ft Statue Sealed [] Yes [] No Casing Type Steel(black or Iowcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below 1 ft Casing Diameter Weight Hole Diameter 12 in. to 17 ft. Ibs./ft. 10 in. to 34 ft. Ibs./ft. Open Hole from it. to ft gop fo From 0 Los 7 Screen YES To Diameter 7 12 25 12 soe Make Type stainless sleel SlotlGauze Length 125 8 70 8 EEE. Set Between 17 ft. and 25 ft 34 ft. and 42 ft 25 28 28 42 Static Water Level 9 ft. from Landsurface Da:eMeasured 00/00/1962 PUMPING LEVEL (below land surface) ft. after hre pumping 225 g.p.m Well Head Completion Nossa ndtv. ott Pitlesa adapter manufacturer Modal Dr Bin gn []Casing Protection [] 12 in above grade Bp Ferritearea) [] At-grade (Fnvirenmantel Wells and garings ONI Y) Grouting Information WelIGrouted? [] Yes [] No we ossaxon Method GPS SA On (averaged) Date NIA X: 240726 Y: 4834941 Tr sit Comptes Neares1 Known Source of Contamination _fc,t __direction __type Wcll disinfcctcd upon complction? Ev [] Yes B50 [] No Pump [] Not Installed Date Installed Arope. Cue5t7 y TLo ie wr Manufaclurer'sname Length of drop Pipe _ft Model number__ HP_ Volts Capacgy_g p m Type Submersible Ma:erial AbandonedWells Does property have any nol in use and not sealed well(s)? [] Yes [] No First Bedrock io ms prog Last SIrN Sand Aquifer Quat. Water Table Aqui:er Dep~hto Bedrock ft. County Well index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification United States Geoloeical Surve'~ 222222o7788m00ens License Business Name USGS Otte eso Lic. Or Reg. No Name of Driller Proieq 9702008 Printed 9/10/2008 HE-01205-07 le 0p Ad201 XN R05 aver Weer 22223333..00446677 A537 02730081035.32 AM) sare 02827279 STATE_0282 7279 WeLoglRolr sass Wcll Log Rcport - 00560385 Sos Minnesota Unique Well 560385 No. F55a,County Quad Quad ID Rock Luverne 2tB oo ts ome Well Name CITY OF LUVERNE -ownehip Range Dir Section Subsections Elevation 102 45 W 23 BBACAB Elevation Method WERLL AiND BaORING MINNESOTA DEPARTMENT OF HEALTH ~7ELL/~]~[} BORI]~G ~CO~ Minnesota Statutes Chapter 1031 SekuSTS00 1425 ft Calc from DEM (USGS 7 5 m n or equiv } Well Depth 13 fl Depth Completed 12 ft. mmnn Entry Data Update Da:e Received Date ogm07110f2001 08/20/2008 05t0911996 Date Well Completed 10/0311995 Ee Drilling Fluid -Use Monitor well I Well Htdrofractured? [] Yes [] No I From :t to Ft Casing Type Plastic Joint Ko Information Drive Shoe? []Yes [] No AbovelBelow ft. Casing Diameter 2 in. to 9.5 ft. Weight Ibs./ff. Hole Diameter 6 in. to 13 ft. S-- Geological Material CLAY CLAY W/SAND MUDDY SAND MUDDY COARSE GRAVEL W/CLAY LAYERS Open Hole from it. to ft cn, smn gp Cum Screen YES Diameter 2 Stone LuTgo IStTSeen ws Make JOHNSON Type plastic Slot/Gauze 10 Length 3 Set Between 9.5 ft. and 12.5 ft. Color Hardness From To BLACK 0 5 GRAY GRAY GRY/BRN 5 7 7 8 8 13 Stagc Water Level 45 ft. from Land surface Date Measured 10t0311995 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. TT REMARKS WELL HEAD COMPLETION -7' LONG, 3' ABOVE GRADE AWIROTMRVRORINE Located Minnesota Depariment of Health Method Digitization (Screen) - Map (1:24,000) Unique Number Notification N/A Date N/A System U1-M - Mad83, Zone15, Meters X: 2410,~5 Y: 4835801 First Bedrock m ses xEas + Last Slral Aqu ifer Depth tn Redrock ft `County Well Index Online Report County Well Index Online Report Well Head Completion Pitlees adapter manufacturer Model []Casing Protection Y [] 12 in. ab3ve grade Beri tre ot ok an [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No |.ierioimpsol Grout Material: Neat Cement Grout Material: Bentonite ar iil from 0 to 3 ft. from 3 to 7 ft. br 2 bags 1 bags ici vB 0 Nearesl Known Source of Contaminalion 20._.Q~feet Ldirection Other .type Well disinfected upon completion'? [] Yes [] No Pump [] Not Installed Date Installed Manufac~urer'sname Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volta Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes sore areas Well Contractor Certification U s Geol Survey License Business Name icOhare M0113 Lic. Or Reg. No =Semon [] No ROSEMORE D Name of Driller 556600338855 Printed 911072008 Printed 9/10/2008 HE 01205 07 1. OR AcXN 202056 er We Lg Report. 0SE8S M2708 1035.35 AM) tile:///J~/~.up%2(lRpt/Appendi%2~D%2(~Muni%20FD%2~Site%2~Smnmaries/Lu~er~e/~Ve~%2~L~g%2~Rep~rt%20-%2~056~385.htm[ 10/27/2008 10:35:33 AM] 2233.0468 STATE 02827280 2233.0468 STATE_02827280  MMaapplleettoon 22223333..00446699 STATE 02827281 STATE_02827281 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatacct:t: SSIITTEE SSUUMMMMAARRYY MMaapplleettoonn MMMaaapppllleeetttooonnn,FFMiirrNee DD5ee5pp0aa6rr5ttmmeenntt Mapleton, MN 55065 C5C0hh7ir-iss52LL4aa-nn3gg3ww4oo1rtd(hhyhy,o,mFFeii)rree CChheietf 507-524-3341 (home) TTrraaiinniinngg LLooccaattiioonn:: Street in frontoffre station, 103 3Ave. NE. Street in front of fire station, 103 3rd Ave. NE TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 442233339911..6622,, 44886844331199.7733 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: AACFlFFaFFsF:s:ACCllCaalssasssBBs fAfooafamomassmttiiscctkkic((kuunn(ussruusrreueoroeffbobrfraabnnrdad)n)d) COtlhaesrs: AP:OCKlaQsusicAkfoSatmfsotiacmk ((uhinsstourriecaolfubsroa)nd) Other: POK Quick Stik foam (historical use) FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: BBai-annnnuuaalllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaalllloonnss ((117/22 sitcickk)) S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Storm sever Storm sewer AAnnnnuuaall ffooaamm uussee:: ClAAaFFsFFsF::ALLeeLssesssttshhaatnhna5n gg5gaaalllloolnnossns((33 (ss3ttiicsctkkissc))ks) Class A: Less than 5 gallons (3 sticks) NNeeaarreesstt ssuurrffaaccee wwaatteerr:: LLaakkee aatt WWaayyssiiddee PPaarrkk,, 11/4 t1o0 117/22 mmiilee nnoorrtthh NNeeaarreesstt wweettllaanndd:: MMoorree tthhaann 11 mmiilee Karst Area: Karst Area: TTrraaiinniinngg stsite iis llooccaatteedd iinn aa ccoovveerreedd kkaarrsstt aarreeaa NNeeaarreessttwwaatteerrwwelelll:: U1/e4ttoo 117/33 mmiilee wweesstt Nearest Wellhead Protection Area: More tha1n mie. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSiitteeiss llooccaatteedd iinn @a SSWWAAAA SITE RANKING: " SITE RANKING: 11 22223333..00447700 STATE02827282 STATE_02827282 M MAAPPLLEETTOONN CCWWII W Weellll M Maapp SCTE oer Lp No a Ihe 5 Fale Fes r CoA elA | a 18 SLSR Ry iA77 p3ag x TST ead Sed Sm |= oe p wT [EPRNCA CF oan Lik AVI 1. Lara be pi AE { 5 Bl . 7 dH CH I 7 LA Te 7L:d fos gE r47)ia o R saCafAmLf BIE eiydemetN E atENL N eN FyL EyT d] .: : #1 cbr RRRTT TT TE oo fare eR Mapleton dt SAE EE i Vp eEFE i iR 4 EE aIRE SED Sef ET Sig WLo oli ahwahe - j Woi o | : t- Foe a & 5 TEN |i | Vemma,Dimtmmit soresn | TTT i Co CoN = Lo Nod FRY TE a SET 01 "~ .... I 0.44:m 22223333..00447711 state 02627283 STATE_02827283 Eg LL A gr iy mtiand ! ;2 5 Gigih,aiillaihLgliFnETEg |g san py wn H 43-57 N 43-56 N 43-55 N : Jl/ g Sd i / i; J od # a 5 SS H|y1: I: :=l HS 3 ; |IiH S| 3 |i = 23 =|: 3 ir iHi ii ri diik wr nr ii 22223333..00447722 STATE_02827284 |__ Mapleton What's In My Neighborhood Map || || | | Fiat m 1 | | 1 { | || | || Pe | a | LI E | EAE a frie po be La || I 4 ' Re T | i moma f | || ' || | a | ne || Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion | REI I T IE AIR O"| of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided rr kybr e srl subject to the express condition that the user knowingly waives any and all claims for clamages against ||| ]VIPCA tha! may arise from lhe use of this data. ||| @#innesota Pollution Control Agency ||| BototoStuoorudns =Pomme sora A UnsemiedDange o caarepnrin Foam period oYomu"anriF;smEsmssetson. 4RRERRAAtTSmsDsFtaicatioens Charap Py y---- 22223333..00447733 state 02827285 STATE_02827285 Well Log Report - 0020990 l Minnesota Unique Well No. 220090990011 wzzm,County Quad Quad ID g=een Blue Earth Mapleton 34B Well Name MAPLETON CREAMERY mw eww canes -ownship Range Dir Section Subsections Elevation 105 26 W 4 BDDBCC Elevation Method WE|LLRAENcoDmByO,RING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I1~]~[} I}OR[]~C~ ~C O~I~ Minnesota Statules Chapter 1031 m[aLno Entry Date Update Da:e Received Date gu 06117/1997 06/20/1997 Well Depih Depth Completed Date Well Completed [Se er men 1031 ft 7 5 minute topographic map (+/- 5 feet) 186 ft 186 ft. 11/3011933 ---- Drilling Fluid -Use Industrial ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or lawcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below 0 ft Casing Diameter Weight Hole Diameter 6 in. to it. Ibe./ft. ---- 6eological Material CLAY CLAY & SAND LIMESTONE LIMESTONE & SANDSTONE BEDS cor, Color YELLOW BLUE PINK -- NO REMARKS en Hardness ponFrom To 0 20 20 140 140 160 160 186 er Open Hole from it. Screen NO Make Diameter sain 1o [t Type Slot/Gauze Static Water Level 58 fl from I end sarfane Date Msas~Jred 1934 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. onLength Well Head Completion Poe vacate ost Pitless adapter manufacturer Modal Bi en []Casincl Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) CEGrouting Information WelIGrouted? [] Yes [] No vase Set Between ene ent Located Minnesota Geological Survey Unique Nu"nber Verification Other, note in remarks System UTM Ned83, Zone15, Meters YO tr Method Digitized - scale 1:24,000 or larger (Digitizing Table) Date H/A X: 422876 Y: 4864381 First Redrrr:k Prairie Dn Chien Gro~Jp Ee Sy Last Strat Prairie Du Chien Group Aquifer Prairie Du Chien Group Depth to Bedrock 140 ft. County Well Index Online Report County Well Index Online Report Nearest Known Source of Contamination _feet __direction __type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufacturer'sname Length 01drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material AbandonedWells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification United States Geoloaical Survey 22009999a 0011 License Business Name Bx USGS Lic. Or Reg. No I BERGGREEN Name ol Driller Preiss Printed 9/24/2008 HE-01205-07 22223333..00447744 state 02827286 STATE_02827286 * NNeeww YYoorrkk MMililllss 22223333..00447755 STATE 02827287 STATE_02827287 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY New York Mis New York Mills NPNeOewwBoYYxoorrk1k7MM2iillss FFiirree DDeeppaarrttmmeenntt New York Mis, PO Box 172 New York Mills, MMNN 5566556677 R2R1ee8ee.dd63JJ8aac.co2ob7bs6so7onn,, Fire Fire Chief Chief 218-639-2787 TTrraaiinniinngg LLooccaatitioonn:: CCCieittnyyteuunttniiliittyaylggrrDara.vveeWll,ppaaarrnkkdiinnHgguyolo.tt,, w1w0e.esstt ssiiddeeooff toowwnn,, Centennial Dr. W. and Hwy. 10. Training Location Coordinates (XY): 316478.52, 515630407 Training Location Coordinates (X,Y): 316478.52, 5155304.07 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: AFF: Ansul AFFF: Ansul FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: `AAbboouutt eevveerryy 33 yyeeaarrss,, 1to0 uussee uupp eexxppiirreedd ffooaamm FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground, storm sewer Ground, storm sewer AAnnnnuuaall ffooaamm uussee:: AAClFFaFFsF:s:A:00 3gg0aallglooannlsls.ons Class A: 30 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: LLeessss tthhaann 11/84 mmiille oto tthhee ssoouutthh aanndd eeaasstt NNeeaarreesstt wweettllaanndd:: LLeessss tthhaann 11//48 mmiillee wweesstt aanndd eeaasstt Karst Area: Karst Area: Sie is not located ian karst area, Site is not located in a karst area. NNeeaarreessttwwaatteerrwwelelll:: LeLsesss tthhaann 11//44 mmiillee nnoorrtthh Nearest Wellhead Protection Area: More tha1n mie. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: LLeessss tthhaann 11 mmiiloe SITE RANKING: Po SITE RANKING: 13 bbeettwweeeenn 22223333..00447766 STATE02827288 STATE_02827288 NNEEWW YYOORRKKMMILILLSLSCCWWII W Weellll MMaapp TT dels Yi i HE EE ARR SLEAT EiE)T HJeemn a APR L Ma Egg GILL [oe | RD Siw pi AA fE>ic PF Ld i on RET . ig ef Fak Tenis a ates PhA TeJW T e Tr Se Es ri ret 8 : sy oI o d wF s h TEf=h"7E1TT drosTTT ; Snorr,ap teor tHmNaES ] TReSe N B iiB nR LL E = Snig r dJ COR Re ' ]85097 h1een FT ee a od a . 5" ld laps 44 i posi a PR TELL tT mG RETRORE FERS SE LE OT udNate es TCI rET adeeTeO i(T APSrem) Calc aReo l el ,y SE IFoR RE aRt AE R e L|ESOCREI Ce AY BT IN at Ty AT Se udegapC <i Shenem LSS Sen A) 2 SEE TD 8 Lh ES Mer Dvds enemasi ohCon rgeoan 7 oes oan 22223333..00447777 stare 282728 STATE_02827289  wl : SW. | H0eeryy [1% | i dp BHH h ath @e oo 1 i ee en sn aan .7 Loodn.y "hEiSERTHg) / 8 3 Ear ACN RAR cdl Ye IN-- Io lehfC JAP mrefy . 52 Loe ") LEY 8 Vals, Niel LA 5 J ti NE 5. ww i FB Cli, ge S| SER A S18 SEE EL v7o SEC KB , | | 1 A ph 0 TIRE 8 I: 1 E| FBaF rn B0 Taern /i 0 1o50v0 aal bf i I fe 4 al fi | |i Bg JE THE ff | =--ree W V7 2 AN = = Wow Ween Towa ly i 22223333..00447788 Jp-- STATE_02827290 New York Mills WhatI'nMsyNeighborhoodMap | t | |le i| || [eng | | hy * ; J| Tye | | m | erry] |1 g I wey Pm - Pee SL : epiFa ph rf X EEL) \ | LLTE AEH BShy LES Ha / ; || Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion | FREI SIS S N | of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided [ET TREE | subject to the express condition that the user knowingly waives any and all claims for clamages against ]VIPCA tha! may arise from lhe use of this data. a | Pollution Control Agency | =pBemoantaissctortSauwpsoarmiauns | vepaorrmiowaDumps. caecuampn rome supnrn vp puss * StatsCoosdLandis 2RrsRoumAowoeresTvteeonnn. Chan 22223333..00447799 sate 2827201 STATE_02827291 WaoglReplort 018505 Wcll Log Rcport - 00185086 118855008866 | Ezz, Minnesota Unique Well No. County Quad Quad ID Bmleew Otter Ta il New York Mills West 236C WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~]~[} ]~ORI]~C~ ~J~C O~J~ Minnesota Statules Chapter 1031 sare Well Name THOM PSON, JACK -ownahip Range Dir Section Subsections Elevation 135 3~ W 7 ABA Elevation Method 1420 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 130 ft wt Depth Completed 111 ft. o =nyu Entry Data Update Da:e Received Date 04117f1988 0T/31/1998 we Date Well Completed 05/1711983 ee Drilling Fluid -Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Plastic Joint iko Information Drive Shoe? []Yes [] No AbovelBelow 1 ft. Casing Diameter Weight Hole Diameter 4 in. to 107 ft. Ibs./ft. 6 in. to 130 ft. mes Geological Material TOPSOIL (DARK) CLAY GRAVEL AND STRIPS OF CLAY =CLAY cu gg ge Color YELLOW mow er, 2| Ee a YELLOW BLU E Hardness SOFT SOFT SOFT SOFT From To 0 1 1 7 7 18 48 Open Hole from it. to ft Screen YES Make JOHNSON Type steel (non-stainless) Diameter 2 Slot/Gauze 12 Length 4 Set Between 107 ft. and 111 ft. = GRAVEL CLAY SAN D BEd GRAY BLUE G RAY SOFT SOFT SOFT 48 49 49 84 84 85 CLAY BLUE SOF, 85 89 Stagc Water Level SAN D CLAY AND STRIPS OF SAND SAND CLAY AND STRIPS OF SAND G RAY GRAY GRAY GRAY SOFT SOFT SOFT SOFT 89 92 98 100 92 98 100 103 28 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 28 ft after hrs. pumping 75 g.p.m. 05117/1983 SAND AND GRAVEL GRAY SOFT 103 130 Well Head Completion -- NO REMARKS Pitlees adapter manufacturer Model []Casing Protection [] 12 in. above grade ren eraig un eon [] At-grade (Environmental Wells and Borings ONLY) Es Tw Be Grouting Information WelIGrouted? [] Yes [] No wt etry Located Minnesota Geological Survey Ts Unique Nu'~ber Verification Information from ewner System UTM - Ned83, Zone15, Meters 18 Method Digitized Table) 50 scale 1:24,000 or larger (Digitizing viDate N/A X 316586 Y: 5155391 Fadel First Bedrock Noro I 8 Last Slral Sand & larger-gray Ate utBurdenRestor Aquifer Quah BuriedArtes Aquifer Depthto Redrnck It `County Well Index Online Report County Well Index Online Report Nearesl Known Source of Coataminalion _feet _direction _type Sodoar 0 10 8 5 Well disinfected upon completion'? [] Yes [] No Punrp [] Not Installed Dale Installed 0510011983 Fr Manufaciurer's name JACUZZI Modal number 754B HP 0 75 eT ne i Length of drop Pipe 63 ft. Capacity20 g.pm Type Submersible Volts 23._.0.0 Material Plastic Abandoned Wells Does property have any eel in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No "e Gunay pw. Well Contractor Certification Cichv R rn Well Co License Business Name 118855008866 alee mm. 56154 Lic Qr Reg. No. QCICoHNY EE Name of Driller PPrrinted 9e1/112//220008 HE 01205 07 el. S051 mi Ne 20 NB WegSpor 0018586 {1027208 10.4162 AN) t~e:///J~/~.endi%2~D%2~Muni%20FD%20Site%2~Summaries/New%2~Y~rk%2~Mi~s/~Ve~%2(lL~g%2(~Rep~rt%20-%2~0 ] 85086.htm[10/27/2008 10:41:02 AM] state 02827292 STATE_02827292 22223333..00448800 Well Log Report - 00185097 Minnesota Unique Well No. | m11188855500009977]E 7 | zSe=rta Well NameWALLACE, RON County Quad Quad ID Otter Ta il New York Mills West 236C WELLRAENCDORBDORING MINNESOTA DEPARTMENT OF HEALTH ~7~z~LL ~I~]~[} ]}ORI]~G ~CO~ Minnesota Statutes Chapter 1031 Well Depth Depth Completed BY a sows one -ownehip Range Dir Section Subsections Elevation 135 3~ W 7 ACAACB Elevation Method Semseensoist 1400 ft 7 5 minute topographic map (+/- 5 feet) Lt 145 ft =135 ft. E2m3e Entry Data Update Da:e Received Date i 04117f1988 09/03/1998 Date Well Completed a. 07/1511983 fe Drilling Fluid -Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or bwcarbon) Joint Threaded Drive Shoe? [] Yes [] No Above/Below 1 ft Geological Material se emocr TOP SOIL, FILL, AND DIRT COARSE GRAVEL CLAY STRIPS OF SAND AND CLAY iCLAY SAN D CLAY SAND CLAY FINE SAND CLAY SAND CLAY SAN D B& e STRIPS OF SAND SAN D CLAY SAN D SAN DY C LAY AND CLAY Casing Diameter Weight Hole Diameter Color Hardness From To 4 in. Lo 130 ft. Ibs./ft. 6 in. to 145 ft. A mek R DARK GRAY BLUE GRAY SOFT SOFT HARD SOFT 0 7 7 20 20 70 70 79 Emme] Open Hole from it. to ft Screen YES Make HOWARD SMITH Type slainless steel ERE BLUE GRAY BLUE GRAY HARD SOFT HARD SOFT BBW 79 104 105 108 104 105 Diameter 106 3.8 109 CW Slot/Gauze 18 TET. Length 5 Set Between 130 ft. and 135 ft. BLUE SOFT 109 110 GRAY SOFT 110 116 BLUE GRAY BLUE SOFT SOFT SOFT 116 117 121 117 121 122 Static Water Level 10 fl from Land surface Date Measured 07115/1983 GRAY SOFT 122 125 PUMPING LEVEL (below land surface) BLUE GRAY BLUE BE Eien a. GRAY BEE EEE BLUE SOFT SOFT SOFT SOFT SOFT oe E pedir Eerhiena) NO REMARKS 125 129 10 ft after hrs. pumping 50 g.p.m. 129 134 134 136 Well Head Completion 136 142 Pitless adapter manufacturer Model 142 145 []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No smears Located Minnesota Geological Survey ct mit crete. Unique Number Verilication Information from te ten reighbor System UTM - Ned83, Zone15, Meters priate Method Digitized scale 1:24,000 or larger(Digitizing oiaeTable) a Date N/A X: 316584 Y: 5155024 ------ Nearesl Known Source of Contaminalion __fcet _direction _type Eiue 31 Be Well disinfected upon completion? [] Yes [] No CEE) Pump [] Not Installed Dale Installed 08100!1983 Coreen SNR Manufacturer's name AERMCTOR Model number SD-12-50 HP 0.5 Volts 23,_~.0 Length 01drop Pipe 59 ft. Capacity15 g.pm Type Submersible Material Plastic Abandoned Wells Does property have any not in use and not sealed well(s)1 [] Yes [] No ksi First Bedrock omy BRENT Last Slral Clay & sand gray ate Aquifer Qu Brut Quat. Buried Arras. Ack Aquifer Depth to Bedrock ft. County Wel Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Sumbesac Well Contractor Certification Cichv Rrn. Well Co. 11S8855e0099m77 E License Business Name ma 56154 gone CICHY. E. LM. JER Lic Or Reg. No. Name of Driller Printed 9712/2008 Printed 9/12/2008 HE 01205 07 srare casera t~e:///J~/~..endi%2~D%2~Muni%20FD%20Site%2~lSummaries/New%2~Y~rk%2~Mi~s/~Ve~%2(lL~g%2~Rep~rt%20-%2~0 ] 85097.htm[10/27/2008 10:41:02 AM] STATE_02827293 22223333..00448811 WeLoglRolr 78 Wcll Log Rcport - 00185878 w185e87r8 e]5, Ehew WEBLLALNDABOMRING Minnesota UniqueWell No. County Quad Quad ID Otter Ta il New York Mills West 236C MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL filliP[} ]~ORI]~C~ ~ C O~:~I~ Minnesota Statutes Chapter 1031 Well Name CICHY, RAYMOND mTN mcvs -ownehip Range Dir Section Subsections Elevation opener 135 3T W 7 ADDBDD Elevation Method 1405 fl 7 5 minute topographic map (+/- 5 feet) Well Depth 160 ft Depth Completed 115 ft. rrEntry Date Update Da:e Received Date AE 04/17f1988 09/04/1998 Date Well Completed 198204 Well Address foNEWYORK MILLS MN Geological Material opsmet TOP SOIL CLAY Sao mowien SAND AND WATER CLAY CLAY CLAY AN D ROCKS CLAY SAND AND WATER CLAY AND SAND SAND AND WATER CLAY Color or al DAR K YELLOW wGieen o2gm YELLOW GRAY Hardness SOFT SOFT SOFT SOFT BLU E SOFT BLU E HAR D BLU E SOFT GRAY SOFT GRAY SOFT GRAY SOFT BLUE SOFT Ee Drilling Fluid -Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Plastic Joint iXo Information Drive Shoe? []Yes [] No AbovelBelow -0.5 ft. Casing Diameter 4 in. to 110 ft. Weight Ibs./ft. Hole Diameter 4 in. to 115 ft. b on fnw[oom se%rous nT on Sue gano vs From To 0 1 1 8 8 18 18 23 Open Hole from it. to ft Screen YES Make HOWARD SMITH Type stainless steel Diameter 3.8 Slot/Gauze 20 Length 5 Set Between 110 ft. and 115 ft. 23 40 40 85 85 11 1 111 114 Stagc Water Level 114 117 120 117 120 160 11 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 11 ft after hrs. pumping 60 g.p.m. 06/05/1982 -- NO REMARKS Well Head Completion Pitleas adapter manufacturer Model []Casing Protection [] 12 in. above grade Bruntner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No cs ppt Located Minnesota Geological Survey lO Method Digitized Table) 4 et scale 124000or larger(Digitizing oe 1, tt x 3540 Unique Nuqnber Verification Nameon mailbox System UTM - Ned83, Zone/5, Meters Date N/A X: 316956 Y: 5154778 Nearesl Known Source of Coataminalion _feet _direction _type Nts 0 ve 0 Well disinfected upon completion'? [] Yes [] No Pump [] Not Installed Dale Installed C1610511982 [F EAfRrEir , oeeNEe Manufaciurer's name AERMCTOR Model number 8A-75-M HP 0 75 Volts 23._.0.0 Length of drop Pipe 63 ft. Capacity32 g.pm Type Submersible Material Plastic | Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No First Bedrock is con rn Last Slral Clay-gray Aquifer Quat BuriedArtes. Aquifer Depthfe Redreck fi `County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No sombre Well Contractor Certification Cichv R m Well Co License Business Name 11 8855887788 Tr 56154 Lic Or Reg. No. CICHY R Name of Driller Printed 9112/2008 Printed 9/12/2008 HE 01205 07 He. O08 20S N20 We 20g Reps203001587 {1037 208104103 ANI t~e:///J~/~..endi%2~D%2~Muni%20FD%20Site%2~Summaries/New%2~Y~rk%2~Mi~s/~Ve~%2(~L~g%2(~Rep~rt%20-%2~0 ] 85878.htm[10/27/2008 10:41:03 AM] 2233.0482 STATE 02827294 2233.0482 STATE_02827294 * NNeewwffoollddeenn 22223333..00448833 STSATATTEE0_022882277229955 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY NNeewwlfooklddeenn NPNeOewwBlfooolxlddee1nn88FFiirree DDeeppaarrttmmeenntt Newloiden, UN PO Box 188 Newfolden, MN 5566337788 2KKe1ei8itt.hh8R7Ru4ud.d,7, 1FF3ii5rree Chief Chief kaud@widel com 218-874-7135 krud@wiktel.com TTrraaiinniinngg LLooccaatitioonn:: Fie hal, 1 Sreet Fire hall, 1st Street Training Location Coordinates (XY): 25352742, 53612522 Training Location Coordinates (X,Y): 253527.42, 5361252.2 TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: OOtthheer:r: OOxxffoorrds 222290 WWetetttiinngg AAggeentn,t, uusseedd iinn rtraaiinniinngg nnoott ssppoecciiffieedd FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaalllloonnss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground Ground AAnnnnuuaall ffooaamm uussee:: ClOOtathhseers:r:&S5gg5aa1tl0loonn1s0s gallons Class A: 5 to 10 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: MMiiddddlleeRRiviveerraappprporxoixmimataetleyly 11//44 mmiilee ssoouutthhwweesstt NNeeaarreesstt wweettllaanndd:: LLeessss tthhaann 11 mmiillee ttoo tthhee ssoouutthhwweesstt KKaarrsstt AArreeaa:: SStitee iiss nnott llooccaatteedd iinn aa kkaarrsstt aarreeaa.. NNeeaarreessttwwaatteerrwwelelll:: 11/221to011 mmiille eeaasstt Nearest Wellhead Protection Area: More than 1 mie. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSiittee llooccaatteedd wwiitthhiinn aa SSWWAAAA SITE RANKING: 12 SITE RANKING: 12 22223333..00448844 STATE02827296 STATE_02827296 is a Room fp " NEE *"NNEEWWFFOOLLDDEENN CCWWII W Weellll MMaapp [0 od Ln i\ ' ny Frases CR [I Foi dbs : \, ; A Fro RaI | \. | he SLdy EENS VEWo Nl A LG oN| wlee fe (1 ; Jfoeo LNT T E @ ENAL TT E LA Ni | 1 az i Sa N1 oo i) aCodn, 7h| JR H1eS G E NE Ea E s SHOR i Prot Le PHe eo] & HS" |07 Ggee mtmelea NE1NET i Name Ie aSArNn | aa AN h ! i GamIEE \, v LL do i Ea I e WEgN ee CEN AY PySy ramose e n core fy NeeLs 22223333..00448855 stare 0227207 STATE_02827297 Tr Fag i Lp | dthil}1 i Jo t Giidg,2i hHopaih,bps itied a = $ gB.tgF-oBeAeE:81 ann 48-22-30 N wn0N aan anon 7 80300 WBN 3H| & Z| - Eb4 aed N 7B 88 : g2 -2:$} . FREaTlS whi oa | \z ek5 epi | \ iis Lol 8 FEi iI68s 43 3 i :3 i ii;h i =--gii4,aigh w= 5 |i enn 2233.0486 Jp-- STATE_02827298 |__ Newfolden What's In My Neighborhood Map | TeN 3 | ~% ' || 1] ii7 -- || t \\| | | - || oony) RT Hey || ||i | i TaNNe | | | HS 1 | | al ||| A B |PBpoeromnatndSotoDomeStnuinoaosroudns Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion rr kybr e srl A of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided subject to the express condition that the user knowingly waives any and all claims for clamages against | ]VIPCA tha! may arise from lhe use of this data. ||| @winnosota Pollution Control Agency | | | | crteyeAtungie Hy -- YEar, 4 RSRATSGFacilies RORAInssatia&tCoiaorunp A sta Aooreommnt 22223333..00448877 state ozs27299 STATE_02827299 WeLoglRolr sons Wcll Log Rcport - 00683985 Bases Minnesota Unique Well 683985 No. Jwm.County Quad Quad ID Marshall Newfolden 416D Well Name KNUTSON. RANDY -ownehip Range Dir Section Subsections Elevation 156 44 W 9 BAABDB Elevation Method WEBLLL IANMDRBONRCING MINNESOTA DEPARTMENT OF HEALTH V~TELL flI~ND ]~ORIN-C~ R~(~ ORD Minnesota Statutes Chapter 1031 1096 ft Calc from DEN (USGS 7 5 m n or equi~ ', Well Depth 85 fl Depth Completed 83 ft. mmonn Entry Date Update Da:e Received Date Eoms 04106/2005 05/09/2006 0113112005 Date Well Completed 01/1112005 Well Address 12615 330TH ST NW asus es NEWFOLDEN MN 56738 Geological Material TOP SOIL CLAY - STONES SAN D cor Color BLACK GRAY GRAY pen Hardness SOFT MEDIUM SOFT ronFrom 0 1 75 = Drilling Fluid Bentonite Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Plastic Joint Ko Information Drive Shoe? []Yes [] No AbovelBelow ft. Casing Diameter 4 in. to 78 ft. Weight 1.5 Ibs./ft. Hole Diameter 8 in. to 30 ft. 6.25 in. to 85 ft. Open Hole from it. 1o ft 10 | Cum Screen YES Diameter To 3 So* ne LT g StBT tn Make JOHNSON Type SlotlGauze 12 Length 5 Set Between 78 ft. and 83 ft 1 75 85 Static Water Level 12 ft from Land surface Date Measured 01t03/2005 PUMPING LEVEL (below land surface) 75 ft after 2 hrs. pumping 7 g.p.m. To NO REMARKS Well Head Completion Pitlees adapter manufacturer MONITOR Model BULLDOG []Casing Protection [] 12 in. above grade Brun tner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No oct ere Located Minnesota Depadment of Heallh Unique Number Merilication N/A System UTM - Ned83, Zone15, Meters ts co kre Melhod GPS SAO1f(averaged) Date 12/22/2005 X: 254434 Y: 5361240 First Bedrock [i ts + Last Slral Aqu ifar Depth tn Redrock ft County Well Index Online Report County Well Index Online Report Grout Material: High solids bentonite from to 40 ft. 1 bags Net pes ve BD 0 Nearesl Known Source of Coataminalion 100 feet S direction Sentictankidrainfield t}pe Well disinfected upon completion'? [] Yes [] No F Ae A er i Pump [] Not Installed Date Installed 01/03/2005 Manufacturer's name STA-RITE Model number 10SP40C2J HP 0 5 Volts 23._.0.0 Length of drop Pipe 75 ft. Capacity 10 g.pm Type Submersible Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No sormbarmriure Well Contractor Certification Davidson Well License Business Name 668833998855 wom45664 Lic Qr Reg. No. ewan DAVlDSON J Name of Driller PPrriinntteedd 661/2288//22000088 HE 01205 07 e150 App 20020 Sc Sis een Wel LgReprs2040006 {1037 208 10-423 ANI tile:///J]/.../;_0Rpt/Appendix ,o20D o20Muni ,o20FD ,o20Site/;_0Summarie~ Newfblden/Well 420Log/;2(?Report o20-~o2000683985.htm[lO/_7/_OO8 10:42:23 AM] 2233.0488 STATE 02827300 2233.0488 STATE_02827300 Wall Repo asst Wcll Log Rcport - 0071235 l Ts] Minnesota Unique Well 712351 No. wEm E County Quad Quad ID Marshall Newfolden 416D Well NameANDERSON, ROB -ownship Range Dir Section Subsections Elevation 156 44 W 8 BBBBDC Elevation Method WEELL ANoD BORING MINNESOTA DEPARTMENT OF HEALTH V~TF~LL ilioNI) BOR~i~G R~(~ ORD Minnesota Statutes Chapter 1031 1093 ft Calc from DEN (USGS 7 5 m n or equi~ : Well Depth 112 ft Depth Completed 110 ft. mon Entry Date Update Da:e Received Dote 08/02/2006 04t14/2005 Date Well Completed 03/0112005 E-- e------------ Drilling Fluid Bentonite Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Plastic Joint No Information Drive Shoe? []Yes [] No AbovelBelow ft. Casing Diameter Weight Hole Diameter 4 in. to 100 ft. 1.5 Ibs./ft. Well Address 330TH ST NW esses wr NEWFOLDEN MN 56738 Geological Material TOPSOIL CLAY-STONES SAND-FINE con Color BLACK GRAY GRAY me Hardness SOFT MEDIUM SOFT pomFrom 0 1 95 Open Hole from it. to ft 70 |Cum Screen YES Diameter To 3 Stuone Make JOHNSON Slot/Gauze 10 1 95 112 LuTgo EStTBern Type Length 10 Set Between 100 ft. and Stagc Water Level 10 fl from No Information Date Measured 03~0112005 PUMPING LEVEL (below land surface) 30 ft after 2 hrs. pumping 35 g.p.m on 110 ft. To NO REMARKS Well Head Completion Pitleas adapter manufacturer MONITOR Model BULLDOG []Casing Protedion [] 12 in. above grade Brun tner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No cts Urns Located Minnesota Depadment of Heallh Unique Number Merilication N/A System UTM - Ned83, Zone15, Meters ts co kre Melhod GPS SA 0If(averaged) Date 12/22/2005 X: 252198 Y: 5361266 First Bedrock ses Eas + Last Slral Aqu ifar Depth tn Redrock ft `County Well Index Online Report County Well Index Online Report Grout Material: High solids bentonite from 8 to 60 ft. 2 bags Nhe eps Bt Nearesl Known Source of Colf[aminalion 100 feet N directian Sentie lank,/drain field type Well disinfected upon completion'? [] Yes [] No e At A ere EE i Pump [] Not Installed [,ale Installed 03/01!2005 Manufacturer's name STA-RITE Model number IOSP4OCJ2 HP 0 5 Volts 23._.0.0 Length of drop Pipe 40 ft. Capacity 10 g.pm Type Submersible Material Abandoned Wells Does property have any nol in use and not sealed well(s)') [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No sormbarmriure Well Contractor Certification Davidson Well License Business Name 771122335511 Eom45664 Lic Or Reg. No. mwa Name of Driller FPirinteed 6t/28i/20n08 HE 01205 07 e150 App 20020 Sc Sis een Wel LgReprs204007 235 {1037 208 10-6234 ANI tile:///JI/.../o_ORpt/Appendix ,o20D o20Muni ,o20FD ,o20Site/;_0Summarie~ New~blden/Well/o20Log/;2flReport 020-,o2000712351.htm[10/_7/_00g 10:42:24 AM] 2233.0489 STATE 02827301 2233.0489 STATE_02827301  NNoorrtthhffiieelldd 22223333..00449900 STSATATTEE0_202682277330022 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY NNoortrthhffiieelldd N3No0orr0thtWfh.iefl5di" eFiSlritredeeeDDleeppaarrttmmeenntt Northfield, 300 W. 5th Northfield, MN 55057 Street MN 55057 M5Mi0ic7tch-he2el7ll1l -DD4ee5ww6ara6,r, CCaappttaaiinn/TTrraaiinniinngg OOffffiicceerr dewar@e norhfeld 507-271-4566 md ewa r@ci.no rt h field .mmn.n.uuss. TTrraaiinniinngg LLooccaatitioonn:: Cilityy ssttrreeeett sshhoopp,, 11771100RRiviveerrvviieeww DDirvivee,, NNoortrthhffiieelldd Training Location Coordinates (XY): 48512154, 4920059.49 Training Location Coordinates (X,Y): 485121.54, 4920959.49 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: AFF: 3 ATO 3%-6% AFFF: 3M ATC 3%-6% FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAgpppyrreooarxriismmaattealyy eevverryy 5 yyeeaarss;; aver haven't trraaiinneedd wwiitnh ffooaamm iinn 11001to0 15 years FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ssttoormm sseewveerr AAnnnnuuaall ffooaamm uussee:: AAClFFaFFsF:s:4-220030gg0aallglloaolnnlssonoosvveeorrvetthhrethllaeasstlt a33t00 1yy0eeyaaerrssars Class A: 300 gallons over the last 10 years NNeeaarreesstt ssuurrffaaccee wwaatteerr:: CGaannnnoonn RRiivveerr llooccaatteedd lleessss thhaann 11//48mmiilee wweesstt Nearest wetland: Nearest wetland: Less than 18 mil west Less than 1/4 mile west Karst Area: Karst Area: Site is located n an active karst area Site is located in an active karst area Nearest water well: Nearest water well: Approximately 174 mie south Approximately 1/4 mile south Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: AApppprrooxxiimmaatteelyl1y1 mmiilce NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilee SITE RANKING: 2 SITE RANKING: 25 22223333..00449911 STATE02827303 STATE_02827303 AT eR NNOORRTTHHFI?IIEELLDD CCWWII WWelelll MMaapp Ny hd sr I re EH Sel] SRM en CAR pal PoE TT Fp EA i = =n Ae T JDEWaga N"mlail pJtageotba id nT Agta] Sool aE CIEATT =| a rs hl TEA - ups 4 rR ERG Titeol fiadhledAi ,IASeBosgTmN2A F d hed l e aE eSeo W adiheereactdiion d SE nLiNILg ef et ee a A UNSCALTIR E pr nse peAT orE alee e ENN LJSA E Gl | 47Laearde Bl r P y Ef TL awit SA] lee ML R a ENE EET oree Gem E CeRsE ar fem relee S< wErRyyED iE dy &| RE d AeS E iT A ee e es Vogl selene STEERS CR eS SE CAEn2) Se tn te EeirLaNEY || A E EfRi e E Y NR eT|S Sr ArRR Ei SEdiRA eeAnJ y PiaASES hedNA ALT EREOEA RTf E i Ng Fld dy Sn ES R EITE oxy ETRE SMOeroen ayers.d Oud TesR as CopA gtommT ~HA tae Las 22530852 2233.0492 stareo28z7304 STATE_02827304 ff Vv won 44-27-0 N NG33 A\N\ NF] 3 be 6 ~ : i : TE 3 5&.s3ing, 3Ei:in iriEkHi jsiisit3 2i Gigi habs a mer wwe awe ume amen 44-26-40 N 44-26-20 N 44-26-0 N 44-25-40 N 44-25-20 N -- 7- -|- --- : ] { i | :3 I || ;: ~ ..... 16 J] c8e)\% E5ogoNt C: li: E ........... 5 .....................~..... a ~.~ ....... { .......................~........................... ............. cls f \VExEL AEN N | i[kHH z|}3 NNaE N TN :i [i|i ~~,, $o :, NNBE \LN ii Z EB: &g \\ S2OAR \NGEsli 8 W \ viel |B ee Det Eg v NB i N 0-LS-~ N 0~-9~-~ N 0S-9~-~ N @9~-~ N 0~-gS-~ N 22223333..00449933 sare cases STATE_02827305 | NEE [Northfield What's InMyNeighborMahpood| | tne i sn bee phim Ag Tm jd ena = TT i | ; / 32a 5 eea EAaTE i re wl ns |He| --fye 4 Lr/iP aNN {i 1 Jud FTEs fr Ph || o Lf ZF Pna liLt Elt 5h. | A trig Is - | | SFr nih #7. 1 0f / Ee1 || li il 7 ide iE [A y A || PBormoiaetaissctotSurpsoeriauns Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion ||A BS SS EEE| | ypeemeandDenno of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided subject to the express condition that the user knowingly waives any and all claims for clamages against ]VIPCA tha! may arise from lhe use of this data. | | @Minnosota Polution Control Agency | | caonerinund rome supnrn ere. P"e ESatoyr R+sRnAMmeaesronasOban 22223333..00449944 state 02827306 STATE_02827306 log Rn 21629 Wcll Log Rcport - 00218299 Minnesota Unique Well No. 221188229999 FaCounty Quad zz.Quad ID Rice North field Well Name COLLEGE CITY BEVERAGE -ownship 111 Bw Range Dir 20 W Section 11 we Subsections ACCAAC een Elevation Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~7~z~LL ~I~]~[} BO~]~G RECORD ~O~ Minnesota Statutes Chapter 1031 Sr em 931 ft 7 5 minute topographic map (+/- 5 feet) Well Depth 73 fl Depth Completed 73 ft. mn Entry Date Update Da:e fbi Received Date 04117f1988 04/23~1992 Date Well Completed 09/2511971 ee Drilling Fluid -Use Domestic I Wall Htdrofractured? ~ Yes ~ No I From :t ~o Ft CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/Below0 ft. Geeing Diameter Weight Mole Diameter 4 in. to &. Ibs./ft. Well Address sorrow NORTHFIELD MN ets is Geological Material DRIFT LIMESTONE co en Color Hardness gon 10 From To 0 5 5 73 -- NO REMARKS ct norte Located Minnesota Geological Survey Uo Bt Unique Number Merification Nameon mailbox System UTM Ned83, Zone15, Meters Oe 0 ot Method Digitized -scale 124000or larger(Digitizing Table) 00450 Date N/A X: 484942 Y: 4920392 rs momo yo prion First Bedrcck Prairie Du Chien Group ee renee Ena? Last Slrat Prairie Du Chien Group Aquifer Prairie Du Chien Group Depth ~o Bedrock 5 ft. County Wall Index Onin Report County Well Index Online Report Open Hole from Cr Screen Make Diameter it. to Type fl Saas Slot/Gauze ag Length SuBan Set Between Static Water Level ft. from Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade ae [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Nearest Known Source of CoNamination __feet _direetion _type Vor siren_@ v8 xe Well disinfected upon complehon? [] Yes [] No Pump [] Not Installed Date Installed Ee or tr Tuy Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0.5 Volts Type Submersible Ma:erial Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification [] No TE212I 188229999 comePrinted eSTTeG2n008 License Business Name Lic Or Reg. No. Name of Driller Printed 9/16/2008 HE-01205-07 el. pend 0a OFSXS Nor Wel 5g Report 25 OCI bn 12 208 1.4478 AN) ti~e:///J~.~%2~Rpt/Appendix%2~D%2~Muni%2~FD%2~ite%2~Sumtnaries/N~rthtield/We~l%2~L~g%2~Rep~rt%2~-%2~218299.htm[10;27;2008 10:44:08 AM] 2233.0495 state 02827307 2233.0495 STATE_02827307 Well Lg Ror 23835 Wcll Log Rcport - 00236835 mois Minnesota Unique Well 236835 No. FJEa.County Quad Quad ID ERice Northfield 71B Well Name BARFAS, LUKES -ownehip Range Dir Section Subsections Elevation 111 20 W 12 BBCACB Elevation Method WEBLLL IATNDRBOONRNING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 954 ft 7 5 minute topegraphic map (+/- 5 feet) Well Depih 48 ft Depth Completed 48 ft. mn Entry Data Update Da:e Received Date 0411711988 1012Y/1992 Date Well Completed 06/2111966 Em -- Drilling Fluid -Use Domestic ~ Well Htdrofractured? J From :t to Ft [] 'Yes [] No Casing Type Steel(black or Iowcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below 0 ft Casing Diameter Weight Hole Diameter 4 in. to 21 ft. Ibs./ft. Well Address H~VY3 S rNOoRRTHmFRIELEDoMwN actos ein Geological Material MOSTLY CLAY forte LIMESTON E cor nes Color Hardness pom To From To 0 17 $8 17 48 Open Hole from21 ft. to 48 ft. Screen NO Make Type Oiameter Diameter `Slouauze. Slot/Gauze Length SetBetween Length Set Between oeAsS50 NORTEL SOHUNG. REMARKS HOUSE ACROSS FROM NORTHFIELD BOWLING. Static Water Level 1,5 fl from I and surface Date Mees~Jred PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 0617"/1966 oso ons Well Head Completion Pitless adapter manufacturer otModel []Casing Protecfien [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Com: Grouting Information Vem WelIGrouted? Ge [] Yes aw[] No [ evans-- ean--an ne ooos tse 0) Located Minnesota Geological Survey Method DLcitization (Screen) Unique Number Verification Information from neighbor Date 0612912004 Map (1:24,000) System UTM - Ned83, Zone15, Meters X 485730 Y 4920776 Nearest Known Source of CoNamination _feet __dkection __type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volta Materiel AbandonedWells Does property have any not in use and not sealed well(s)? [] Yes [] No First Redr~k Prairie D~] Chien Gro~Jp ri preva Le Last Strat Prairie Du Chien Group Aquifer Prairie Du Chien Group Depth to Bedrock 17 ft. County Well Index Orlin Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Harlmann Well Co 232R3668o833r5 y License Business Name 40174 cE eon Lic Or Reg. No. Name of Driller Pred 9752008 Printed 9/16/2008 HE-01205-07 lp Agen Sa20D Noh Wel 22223333..00449966 Sort 20,OSES 027008 10489AN] STATE 02627308 STATE_02827308 + NNoorrwwooood Yoouunngg AAmmeerriicca 22223333..00449977 STATE 02827309 STATE_02827309 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonnttaacctt:: SSIITTEE SSUUMMMMAARRYY NNoowrwwoooodd NPNoOomrBwwoooxoodd8--SYYoouunngg AAmmeerriiccaa FFriree DDeeppaarrttmmeenntt 33NP22oO77twBWWe,oo.xdEE,8ll5mmMNSSttrr5ee5eet3t 58 Norwood, MN 55388 9BBr5ree2nn.t4t 6AA7rre.et2tzz7,6FF7iirr(eehCoChmhieie)eff 952-467-2797 (home) TTrraaiinniinngg LLooccaatitioonn:: VBVaracucasanhnttSltootet too,wwnnNeeoddwbboyyothdhee cciittyy,, iinntteerrsseeccttiioonn ooff SSoouutthh SSttreeeett aanndd Brush Street, Norwood TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 44228~557723.0.088,, 44995577444400.5522 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: AAFFFF:F: AAnngguussHHii-CCoommbbaatt FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: GGrroouunndg Annual foam use: Annual foam use: AAFFFFF:: 55 ggaallloonnss, NNeeaarreesstt ssuurrffaaccee wwaatteerr:: BBrraannddyy LLaakkee,, l1f46 t1o0 117/33 mmiilee ssoouutthh NNeeaarreesstt wweettllaanndd:: `AApppprrooxxiimmaatteellyy 11//44 mmlilee ssoouutthh Karst Area: Karst Area: TTrraaiinniinngg ssiitee iis llooccaatteedd iinn oorr nneeaarr aa ccoovveerreedd kkaarrsstt aarreeaa NNeeaarreessttwwaatteerrwwelelll:: LeLsesss tthhaann 11/84 mmiillee ssoouutthh Nearest Wellhead Protection Area: More tha1n mie. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: TTrraaiinniinngg ssittee llooccaatteedd iinn aa SSWWAAAA SITE RANKING: 1s SITE RANKING: 16 22223333..00449988 STATE02827310 STATE_02827310 NNOORRWWOOOODD CCWWII WWelelll MMaapp. Lr ae IR =SISTeET U al l a Cas de Ee RTl I ER i FRAESOTeWNE i en I OVC bEE HN hee T E SEE aEem LE Lie UhmA TS bp fiemrss: Shanet SE PE almd SRiS r TSRE PLES RL LOalm JA C mEoTTLe EBal odnyLI TT 0) 1 KLod re bp ER TRG em fe AS ESretgheP a SU HRER T TYHLEPagTRG YY ie 1 eiSe IB mLsESiCpea Ea e Be dm ET gh =r VERE er Ne Pepealrg hg nh Le NL ST [I ag ET 1 INYO / ole AERA Jorn CYT 4 ~ Sol Jw neh fpr AT] Mer Detdes vdxs rhCrue {7 UE 22223333..00449999 sare cas STATE_02827311 Jer a ! % 1 f{oior>x [31% | E s4ind,dH idiiil]d h i Li oHaeE. 3: reE e em wen EeenE ee 0 ash en Byi Ce i1i :: $y Cedar 8 5) i/ 3 f : 3\ [EY 2p) 23 fl] eit NpCalAlA EA he ARNE 2| 4 i Lo id TR]m} R x ls | Hs| E |, 1 2 3 Egi : Ld 2 Jur, Z2o , : a : i i : |i A 3 Tul 5 = A1pl TT | =. ; = TR SRR C3 s3 i Hl 22223333..00550000 -- STATE_02827312 NorwoodWhat'Isn MyNeighborMahpood J: EE Ny: | Cenl pA | iPe ; il: | Treen = | | LEE) 1 I | a PietPyr | [Ef # i 1 BI m et| Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided subject to the express condition that the user knowingly waives any and all claims for clamages against ]VIPCA tha! may arise from lhe use of this data. = roereasr ovttvoen gemma oowmaps ramen @Minnesota Pollution Control Agency 0 *+ SanPaEmsLtsonorSean 22223333..00550011 stare ozs27313 STATE_02827313 WeLoglRolr 2368 Wcll Log Rcport - 00247268 arms Minnesota Unique Well 247268 No. JE.County Quad Quad ID = iCarver No.cod 106C om een Well Name NORWOOD TEST WELL -ownship Range Dir Section Subsections Elevation 115 26 W 14 CBCCAC Elevation Method WEPLL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota S~atutes Chapter 1031 pmoin Entry Date Update Da:e Received Date ome 06123/1992 02/1912008 Bon) 1008 ft 7 5 minute topegraphic map (+/- 5 feet) Well Depih 620 ft Depth Completed 620 ft. Date Well Completed 00/0011988 Well Address NORV~OOD MN 55368 crogommane Geological Material CLAY CLAY CLAY CLAY WITH SAN D SAND & GRAVEL ROCKY CLAY SAND & GRAVEL CLAY ROCKY CLAY CLAY ROCKY GRAVEL CLAY ROCKY SAND & GRAVEL CLAY SAND & GRAVEL CLAY SAND & GRAVEL CLAY WITH ROCKS SHALE ROCK ROCK SHALE SAN DROCK SANDSTONE OFFWHITE SANDSTONE SHALE OFF WHITE SANDSTONE SHALE SANDSTONE & SHALE BLUE RED PINK SANDSTONE & SHALE SANDSTONE &SHALE SANDSTONE & SHALE H =m= SANDSTONE & SHALE GREEN CREVICED SANDSTONE LOST CIRCULATION REMARKS RED TAN MG.S. NO. 2865. Drilling Fluid I Wall Htdrofractured? [] Yes [] No coeColor anes gem go [CETTE TS Dr vege Reet Hardness From To -Use Test well I From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/BelowO ft. BLACK TAN 0 3 Casing Diameter 3 30 Weight Hole Diameter GRAY 30 50 GRAY 50 110 GRAY 110 115 GRAY 115 158 Open Hole from it. to ft GRAY SOFT 158 165 Screen Make Type GRAY HARD 165 170 GRAY 170 210 Diameter Slot/Gauze Length Set Between GRAY 210 220 GRAY 220 223 GRAY 223 237 GRAY 237 240 GRAY 240 250 TAN TAN TAN ORANGE WHITE 250 257 305 315 320 257 305 315 320 335 Static Water Level ft. from Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. BROWN GREEN GREEN BROWN HARD SFT-HRD SOFT HARD 335 345 350 365 345 350 365 373 Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade HARD 373 440 440 450 [] At-grade (Environmental Wells and Borings ONLY) BLU/WHT HARD 450 460 460 505 GREEN HARD 505 520 GRN;PNK HARD 520 530 GREEN 530 575 5 VARIED GREEN SOFT 575 600 605 = ome Ts Ee 600 605 620 Grouting Information WelIGrouted? [] Yes [] No cts wena Located Minnesota Geological Survey as Unique Number Verification Information from owner System UTM- Nad83. Zone15. Meters es icsscoseen Method Public Land Survey - QQQQQQ Section Date N/A ws X: 426531 Y: 457263 mp Neares1 Known Source of Contamination fr_f~,t __dk,ctien __typ Well disinfected upon completion? [] Yes [] No ctor rm roa Cuttings Yes First Bedrock Crefeceous.Undiff. Last SIrN Franconia Iron,on Galesvill Sos m1 Aqu iler Depthto Bedrock 320 ft. CCoouunnttyy WWeellll IInnddeexx OOnnlliinnee RReeppoorrtt Pump [] Not Installed Date Installed Manufacturer'sname Model number Length of drop Pipe_ft. Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any not in use and net sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No mer Well Contractor Certification Prauaht M. Well Co. License Business Name 224477226688 OR86576 Lic Or Reg. No. teats Name of Driller Prienitesds S9/r24a/a20n0y8 HE-01205-07 1.720SOF20 Nord0 Yom ga Regn ONT He 027308 1045 0AM) 22223333..00550022 STATE02827314 STATE_02827314 Well Report 043131 Wcll Log Rcport - 0046313 l w4631i31 g, Minnesota Unique Well No. County Quad Quad ID = Carver No~ood 106C Well NameARETZ BRENT -ownehip Range Dir Section Subsections Elevation 115 26 W 15 DBDCAD Elevation Method WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 1001 fl CALC FROM 2-FOOT COUNTY DEN Well Depih 168 ft Depth Completed 168 ft. mn Entry Date Update Da:e Received Date ew 0810111991 06/15/2007 Date Well Completed 03/2111991 E-- e------------ Drilling Fluid Bentonite Use Domestic ~ Well Htdrofractured? [] 'Yes [] No J From :t to Ft Casing Type Plastic Joint iko Information Drive Shoe? []Yes [] No AbovelBelow 1 ft. Casing Diameter 4 in. to 163 ft. Weight Ibs./ft. Hole Diameter 8 in. to 168 ft. Well Address 815 ELM ST NORV~OOD MN 55368 F- Geological TOPSOIL CLAY CLAY Material SAND BF Color BLACK YELLOW BLUE Hardness SOFT SOFT SOFT Open Hole from it. to ft Screen YES Make JOHNSON Type stainless steel From 0 3 15 160 To 3 15 160 168 Diameter 2 Slot/Gauze 18 Length 5 Set Between 163 ft. and 168 ft. Stagc Water Level 90 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 168 ft. after 0.5 hrs. pumping 40 g.p.m. 03t2'/1991 -- NO REMARKS Well Head Completion Pitlees adapter manufacturer MONITOR Model []Casing Protection [] 12 in. above grade Brun tner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No ected ti Located MinnesotaGeologicalSurvey Method Digitization (Screen) Map(124,000) Grout Material: Grout Material: rk Neat Cement Bentonite from from RIE 0 to 30 ft. 30 to 163 ft. on0.25 0.5 yayrds. yrds. Unique Number Merilication Address verification Date 02/2T/2037 System UTM- Nad83, Zone15, Meters X: 425919 Y 4957268 Nearesl Known Source of Contaminalion 60._.Q~feet Ldirection Sentie lank/drain field icieptet Bv BD 0 Well disinfected upon completion'? [] Yes type [] No Pump [] Not Installed [,ale hlstallad 03/21!1991 ar heetous van Manufaciurer's name FLINT 8, WALLING Model number HP 0 75 Vails 22._0.0 a SE Length of drop Pipe 108 ft. Capacity 11 g.pm Type Submersible Material Galvanized Abandoned Wells Does property have any hal in use and not sealed well(s)? [] Yes [] No First Bedrock Aquifer Quat. BuriedArtes. Aquifer `County Well Index Online Report Last Slral Sand Depthfo Bedrock ft County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Braunwarth Well Co 10068 BRAUNWARTH M License Business Name 446633113311 Lic. Or Reg. No Name of Driller Priinmtead t9/24a/20n08 HE 01205 07 1.720SOF20 Nor0 d g 0Am WlP og Reg2G 31 Hed 0273008 104531 AM) state 02827315 22223333..00550033 STATE_02827315 log Ron 030 Well Log Report - 00700300 [770000330000 Minnesota Unique Well No. 700300 5Jz,.County Quad Quad ID Carver No.cod 106C WELRLEACNODRBDORING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} BOPPING 1~1~ I~ O1:~) E HSB OW 1e 5 AMO Eeatoaesod Well Name CITY OF NORWOOD -ownship Range Dir Section Subsections Elevation 115 26 W 15 DAC,aAD Elevation Method Minnesota Statutes Chapter 1031 Well Depth Eh ew [ws vperarennir] 989 ft 7 5 minute topegraphic map (+/- 5 feet) ot 300 ft Depth Completed ua 300 ft. mRonaoe un Entry Date Update Da:e Received Date 04119/2006 081061200T 01t2612006 Date Well Completed od 11/0412003 tes Well Address BALL FIELD ALAS NORV~:)OD MN 55368 Geological Material TOP SOIL SAND SAN DY CLAY & SAN D M IX Esra SAND CLAY SAND & GRAVEL & CLAY LAYERS SAN DY CLAY SAN DY CLAY SAN DY CLAY, COAL SAN DY CLAY BE ne SANDY CLAY & COAL & PEBBLES SAND SAN DY CLAY fered GRAVEL SANDY CLAY & LIMESTONE & SAND LAYE SANDY CLAY & LIMESTONE & SAND LAY SANDY CLAY & SAND LAYERS SAND ROCK CLAY & SAND LAYERS SAN DSTON E ii-- - REMARKS USE: ENVIRON BCRE HOLE EEDrilling Fluid -Use Abandoned I Wall Htdrofractured? I From :t to Ft Status Sealed [] Yes [] No rT CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below ft. Casing Diameter Weight Hole Diameter Color Hardness BLACK GRY/BRN GRAY SNGRAY GRAY GRAY SOFT GRAY GRAY GRAY Bm GRAY VARIED GRAY SeVARIED GRAY SOFT SOFT HARD GREEN BROWN GRAY GRAY WHITE - From To 0 4 6.25 in. to 300 ft. 4 9 9 17 Open Hole from it. to ft 17 44 Screen 44 49 Make Type EE [ow women suse 49 82 82 87 Diameter Slot/Gauze 87 102 102 107 BE 107 116 116 119 119 123 Static Water Level BREE 123 130 ft. from Date Measured 130 201 Length Set Between 201 232 232 247 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 247 276 292 276 292 300 Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade C Ee oet. y [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No ne enor Located Minnesota Geological Survey Unique Number Merilication Information from owner ee -- System UTM- Ned83, Zone15, Meters tes eter) Method Digitization (Screen) Dale 07/16/200~ a X: 426247 Y: 4957361 30 Map(l:24,000) Grout Material: High solids bentonite from to 300 ft. RT Nearest Known Source of Cortamination _feet _direction _type Na tant Well disinfected upon completion'? 181 [] Yes [] No 20 bags Pump [] Not Inetalled Date Installed Manufacturer's name Length of drop Pipe_ft. Model number_ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Fran Cont. TM First Bedrcck Cretacaous,Undiff ee ee ps Last Strat Cretaceous,Undiff. Aquifer Depth to Bedrock 292 ft. CountyWell Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification isSor: L.te. Entererises Ins. 77f0000r3300r00 e License Business Name Py cma 91686 Tr Lic Or Reg. No. GRIMM. G. Name of Driller Printed 5124/2008 Printed 9/24/2008 HE-01205-07 FaOF 205 Sms oro Ye0m Lg Tear 3004S 22223333..00550044 1037008 10.4531 AM state 02827316 STATE_02827316 WallogReport 75st Wcll Log Rcport - 00752454 7T52o454s]. Minnesota Unique Well No. County Quad Quad ID = iCarver No.cod 106C on soe Gemens Well Name MW-1 -ownehip Range Dir Section Subsections Elevation 115 26 W 14 BCCADB Elevation Method WEBLLLIANMDRBONRGING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Sam usm 987 ft Calc from DEM (USGS 7 5 m n or equi~ } Well Depih 20 ft Depth Completed 14.5 ft. mmnn Entry Data Update Da:e Receivod Date Gum E12113/2007 08/1512008 08t08/2007 Date Well Completed 06/0412007 Ee Drilling Fluid -Use Monitor well ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Plastic Joint Threaded Drive Shoe? [] Yes []No Above/Below ft. Casing Diameter 2 in. to 4.5 ft. Weight Ibs./ft. Hole Diameter 8.25 in. to 20 ft. Well Address NORV~OOD MN 55368 Tep n Geological Material CONCRETE FILL BROWN SANDY CLAY oom Color GRAY Hardness HARD BROWN MEDIUM ptr From To 0 2 2 20 Open Hole from it. to ft pe Screen YES Diameter 2 Make JOHNSON Type plastic sper "ur Slot/Gauze coor 10 Length 10 Ee Set Between mr4.5 ft. and we14.5 ft. Static Water Level 7 ft. from Land surface Da:e Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 06/04/2007 VEL COCA SCF VERSEST 441 RALSCASDT HORWGC0, Wh5 REMARKS WELL LOCATION: SW OF N. MORSE ST. &W. RAILRCAD ST., NORWOOD, MN 55368 cts enaraomemttan Located Minnesota Depariment of Health Unique Number Verilication N/A System UTM - Mad83, Zone15, Meters wos rs arin Method GPS SAOrf(averaged) Date 08/23/2007 X: 426615 Y: 4957718 First Bedrock Aqu ifer `County Well Index Online Report Last Slral Depth to Redrock ff County Well Index Online Report Well Head Completion Pitleas adapter manufacturer Model Bron rerun []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information aad WelIGrouted? ad [] Yes [] No Grout Material: CONCRETE from to 4 ft. 1.5 bags tie ophtt_ 3 1 Nearesl Known Source of Contaminalion 0_.~feet _direction _type Well disinfected upon completion'? [] Yes 50 [] No Pump [] Not Installed Dale Installad Manufeciurer'sname Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Beraerson Caswell Inc 176~7 LENZMEIER D License Business Name 775522445544 Lic. Qr Reg. No. Name of Driller Priinmtead te/24a/20n08 HE 01205 07 1.720SOF20 Nord0 Yom ga Reg 22223333..00,550055 NT S21 Hed 0273008 104531 AM) state 02827317 STATE_02827317 WeLoglRolr 752155 Wcll Log Rcport - 00752455 Toss Minnesota Unique Well 752455 No. JE.County Quad Quad ID = iCarver No.cod 106C on so Gemans Well Name MW-2 -ownehip Range Dir Section Subsections Elevation 115 26 W 14 BCCADC Elevation Method WEHLLOANDNBOGRING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Sam wns 990 ft Calc from DEM (USGS 7 5 m n or equiv ', Well Depih 15 ft Depth Completed 14 ft. mmnT Entry Date Update Da:e Received Date Eum E12113/2007 08/1512008 08t06/2007 Date Well Completed 06/0412007 ---- Drilling Fluid -Use Monitor well ~ Well Htdrofractured? J From :t to Ft [] Yes [] No Casing Type Plastic Joint Threaded Drive Shoe? [] Yes []No Above/Below ft. Casing Diameter 2 in. to 4 ft. Weight Ibs.fft. Hole Diameter 8.25 in. to 15 ft. JrWell Address NOR~AKBOD MN 55368 iy Geological Material SAN DY CLAY uh.Color BROWN WER Hardness MEDIUM IR From To 0 15 Open Hole from it. to ft ogScreen YES Diameter Sages legen Make JOHNSON Type plastic SlotlGauze Length 2 10 10 San Set Between 4 ft. and 14 ft. Static Water Level 7 ft. from Land surface Da:e Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 06/04/2007 Ha REMARKS MW-2 WELL LOCATION: SW OF N. MORSE ST. &W. RAILRCAD ST., NORWOOEh MN 55368 ct erent Located Minnesota Department ef Health RES Unique Number Notification N/A System UTM - Nad83, Zone15, Meters hr skates Method GPS SAOff(averaged) Date 08/23/2007 X: 426607 Y: 4957710 mx First Bedrock Last Slral Aqu ifar Depth to Redrock ff `CCoouunnttyy WWeellll IInnddeexx OOnnlliinnee RReeppoorrtt Well Head Completion Pitleas adapter manufacturer Model []Casing Protection [] 12 in. above grade Bruntner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No Grout Material: CONCRETE from to 4 ft. 1.5 bags ite ees Nearesl Known Source of Contaminalion 0_.~feet _direction _type Well disinfected upon completion'? B vB [] Yes [] No Pump [] Not Installed Dale Installad Manufeciurer'sname Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Beraerson Caswell Inc 176~7 LENZMEIER D License Business Name 775522445555 Lic. Qr Reg. No. Name of Driller PPrrinted 9e//224//220008 HE 01205 07 1.720SOF20 Nord0 Yogm aWIP og Reg 22223333..00550066 NT SSS Hed 0273008 1045 3AM) STATE02827318 STATE_02827318 Wallog Report 755156. Wcll Log Rcport - 00752456 Tos Minnesota Unique Well 752456 No. JE.County Quad Quad ID = iCarver Norwood 106C on son Gemens Well Name MW-3 -ownehip Range Dir Section Subsections Elevation 115 26 W 14 BCCACA Elevation Method WEBLLL IANMDRBONRGING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Sam ws 15m 987 ft Calc from DEM (USGS 7 5 m n or equiv ', Well Depih 16 ft Depth Completed 18 ft. mmnn Entry Date Update Da:e Received Date Gum E12113/2007 08/1512008 08t08/2007 Date Well Completed 06/C,412007 Ee Drilling Fluid -Use Monitor well ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Plastic Joint Threaded Drive Shoe? [] Yes []No Above/Below ft. Casing Diameter 2 in. to 5 ft. Weight Ibs./ft. Hole Diameter 8.25 in. to 16 ft. Well Address NORV~OOD MN 55368 NORWOOD wi sess Geological Material rm CONCRETE FILL CLAY mmr Color GRAY Hardness HARD From To 0 4 GRAY MEDIUM 4 16 Open Hale from it. to ft Screen YES Spmetr Diameter 2 Make JOHNSON Type plastic 'Sefonzs SlotlGauze 10 `Lngn Length 10 or SBeeen Set Between 5 ft. and 15 ft. Static Water Level 8 ft. from Land surface Da:e Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 06/04/2007 ---------- REMARKS WELL LOCATION: SW OF N. MORSE ST. &W. RAILRCAD ST., NORWOOD, MN 55368 MW-3 cts Urns Located Minnesota Depsdment ef Health RES Unique Number Merification N/A System UTM - Mad83, Zone15, Meters as cosacree Method GPS SAC[f (averaged) Date 08/23/2007 X: 426600 Y: 4957725 First Bedrock Aqu ifar County Well Index Online Report Last Slral Depth tn Redrock ft County Well Index Online Report Well Head Completion Pitleas adapter manufacturer Model Bron rerun []Casing Protedion [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information aad WelIGrouted? ad [] Yes [] No Grout Material: CONCRETE from to 4 ft. 1.5 bags tie ophtt_ 3 1 Nearesl Known Source of Contaminalion 0_.~feet _direction _type Well disinfected upon completion'? [] Yes 50 [] No Pump [] Not Installed Dale Installad Manufeciurer'sname Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Beraerson Caswell Inc 176~7 LENZMEIER D License Business Name 775522445566 Lic. Qr Reg. No. Name of Driller PPrrintteed 9/24//220008 HE 01205 07 le 0SDP 0815SNor 0Ameo n Lg064p SSO56 037 208104532 A STATE 02827319 STATE_02827319 22223333..00550077 Well Log Ror 752557 Wcll Log Rcport - 00752457 Tos Minnesota Unique Well 752457 No. JE.County Quad Quad ID = iCarver Norwood 106C on so Gemans Well Name MW-4 -ownship Range Dir Section Subsections Elevation 115 26 W 14 BCCADC Elevation Method WEBLLLIANMDRBONRGING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Sam wns 990 ft Calc from DEM (USGS 7 5 m n or equi~ } Well Depih 15 ft Depth Completed 14 ft. mmnn Entry Data Update Da:e Received Date Gum E12113/2007 08/1512008 08t08/2007 Date Well Completed 06/1112007 Ee Drilling Fluid -Use Monitor well I Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Plastic Joint Threaded Drive Shoe? [] Yes []No Above/Below ft. Casing Diameter 2 in. to 4 ft. Weight Ibs./ft. Hole Diameter 8.25 in. to 15 ft. Well Address vanes NNOORRVW~OOOODD wMiN s5e53s6s8 Geological Material SILT SILTY CLAY pw Color BLACK Hardness MEDIUM GRY/BRN MEDIUM Open Hole from it. to ft fF From 0 2 Screen YES Spmetr Diameter 2 Make JOHNSON Type plastic 'Sefonzs SlotlGauze 10 corm Legh Se Bete . Length Set Between 10 4 ft. and 14 ft. 2 15 Static Water Level 8 ft. trom Landsurface Da:eMeasured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 06/11/2007 ---------- REMARKS WELL LOCATION: SW OF N. MORSE ST. &W. RAILRCAD ST., NORWOOD, MN 55368 MW-4 cts Urns Located Minnesota Depsdment of Health Res Unique Number Merification N/A System UTM - Mad83, Zone15, Meters as cosacree Method GPS SAC[f (averaged) Date 08/23/2007 X: 426613 Y: 4957708 First Bedrock ses Eas + Last Slral Aqu ifer Depth tn Redrock ft County Well Index Online Report County Well Index Online Report Well Head Completion Beritre ot ok an Pitleas adapter manufacturer Model []Casing Protection Y [] 12 in. ab3ve grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information aad WelIGrouted? ad [] Yes [] No Grout Material: CONCRETE from to 4 ft. 1.5 bags tie ophtt_ 3 1 Nearesl Known Source of Contaminalion 0_.~feet _direction _type Well disinfected upon completion'? [] Yes 50 [] No Pump [] Not Installed Dale Installed Manufeciurer'sname Length of drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Smear Well Contractor Certification Berc~erson Caswell Inc License Business Name 775522445577 som17ET Lic Or Reg. No. een HOLMEN G Name of Driller PPrrintteed 9/24//220008 HE 01205 07 le 0SDP 0815SNor 0Ameo n Lg prs64S707 208104A53 state 02827320 STATE_02827320 22223333..00550088 * PPeerrhhaamm 22223333..00550099 STATE02827321 STATE_02827321 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY Perham Perham P5P2ee5rrhhWaaemmsFtFiiMreaiDDneeppaarrttmmeenntt Perham, MN 56573 525 West Main Perham, MN 56573 TT2r1raa8cc-yy3S4S6cc-h4m4h0id2tm,FFiirireeCtChhi,iee!f 2f1r8e-@3c4i6y-o4t4p0e2rham.com fire@cityofperham.com TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusedsiinntetrraaiinndiinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: Nearest surface water: Nearest surface water: Nearest wetland: Nearest wetland: Karst Area: Karst Area: NNeeaarreesstt wwaatteerr wweellll:: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: 4NN8ee0aarrCoppanarerkkyiinSngtgreeennetttrr,aannPcceeerohofafPmPrraaiiriiee W Wiinnddss MMiiddddllee SScchhooooll 4813 Coney Street, Perham 30264 55, 162411.87 30264.55, 5162411.87 GCClllaaassssss ABBAAFvFFaFFrF:io: usvvaabrrriioaounusdssbbararnddss. Other: POK system wih Class A: various brands Other: POK system with ffooaamm ssttiicckkss SSeemmbi-aannnnuuaalllyy LLeessss tthhaann 55 ggaatlloonnss. Ground, storm sewer Ground, storm sewer GCClllaaassssss BAB"AAFF1FF0FF1:0: 211000g1tao0l2l2o00nsggaalllloonnss. ther: ~ Class A: Other: ~ acase of sticks (1 10 to 20 gallons a case of sticks (1 sstticikc=k= ~~55 ggaalllloonnss)) UUnnnnaammeedd ppoonnddss llooccaatteedd 11//44 ttoo 111/22mimlilee ssoouuthwweesstt Approximately 1110 172 mil southwest Approximately 1/4 to 1/2 mile southwest Sieis not located ian karst area. Site is not located in a karst area. Less than 1/4 mike 0thesou, southeast and northeast Less than 1/4 mile to the south, southeast and northeast Site s located ina WPA Site is located in a WPA MMoorree tthhaann 11 mmiilee 222 22223333..00551100 STATE02827322 STATE_02827322 ETEor | PPERE HAMRCCWWH IIWWeAlelllMMMaapp PEL eae ha bie HN TT em ERPSSEECR e ey iNT my 00 | IEE esTEN C0 fo i B; o TSyI. E es 18 of] "L sev Ne N 4 JTT pe toa ne Ei A ST Cae NE Soe T SeY wie Pa ln a LC e i be EN EE MT CEa EE Te i Er Ll ER TE oped Araki TIRE PY ds ohee NR he foo mE a 3 i RpeoT bEE sEE EnE Ee aN STT ITARaFee Moprp ndeve eresr encor. gromy feign 22223333..00551111 soe caseraes STATE_0282 7323 f GdI i1 ; 3 ol'. : |2g 5HE & 7 l2e sHHiiillod i i 22: I 8 i | iEh ofsib i aEARI EHMBRHEi .& = o46-w36nN q[| 3 i | a46w-35nN , B46-U34NN 73| jJE ET 1H4 | 58 8 f ; / .1 fe -- { i UX f ~ 2Hh~: ~ ~ ......~.....................- ......................... ............. : li / / / CE /, x oe N 9~-9~ i &2 o :2 3 S 5| : N ~-9~ HH 4] lidHl Ii5iH]t i] Ii = |i Bool i|B N ~-9~ 22223333..00551122 stare_oasarszs STATE_02827324 [mm | TY\ PerhamWgSeWhat's In My Neig]h7 borhoo7T d Map J f{iil N \ br--R4E NY i i |i |{ | \, EL au | [ho oN Bemisia |1 |. a 3Y FfRT ay R || _ SKE 0 Na Ll , | Le le i wl iIi l I il Sl | Th F Ss | % i li FlTe r. #1 ||lA y es 1 | || =rBeemltsauooerastSwupaaeasrsidund Disclaimer: Map aud site itffo~lnation is believed to bc accurate but accmacy is uot guaranteed. No portion |RELI TE SRI S I"| weseniraunpe of the informntion should be considered to be, or used as, ~ legal document The information is pro~:ided | wae subject to the express condition that the user knowingly waives any and all claims fbr clamages against ||| ocFoaetsacitaeuppsortind MPC,\ that may arise from the use of this data. Sites. | @Minnesota Pollution Control Agency eTe E n | 4sReEmRrAosMsmoestit Cshtuaorunp 22223333..00551133 STATE 02827325 STATE_0282 7325 WolLogReport 021637 Wcll Log Rcport - 00214327 aes Minnesota Unique Well 214327 No. F EEE County Quad Quad ID Otter Tail Perham 237D Well Name MANTHE, ELWYN 5 5 a1 oc oven -ownship Range Dir Section Subsections Elevation 136 39 W 15 CACCCC Elevation Method WEPLL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~i~[} ]~ORI]~G ~O~ Minnesota Statules Chapter 1031 J7prmwomensiis] 1367 ft 7 5 minute topographic map (+/- 5 feet) eeorWell Depih 102 fl > Depth Completed 102 ft. mpain Entry Date Update Da:e Received Date 04117/1988 10/0~f1998 hid Date Well Completed 01/1711969 = Drilling Fluid -Use Irrigation I Wall Htdrofractured? ~ Yes ~ No I From :t to Ft CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/Below ft. Casing Diameter Weight Hole Diameter 12 in. to 56 ~. Ibs./ft. asso Geological Material SAN D CLAY CLAY COARSE SAN D FINE SAND guColor BROWN ween Hardness SOFT HARD omFrom 0 25 35 45 70 Open Hole from it. lo ft 1 |Chm Screen YES Diameter To 12 SuW ze Egin Make Typa Slot/Gauze 100 Length 46 25 35 45 SaEBTenen Set Between 56 ft. and 70 102 Stagc Water Level 24 fl from Land surface Date Measured 01t17/1969 PUMPING LEVEL (below land surface) 44 ft after hrs. pumping 1200 g.p.m. we 102 To NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No te eet Located Minnesota Geological Survey Eemt eras Unique Nu"nbsr Merilication Other, note in ramarks System UTM - Nad83, Zone15, Meters Ov 120 i Method Digitized scale 1:24,000 or larger (Digitizing 0 ToTable) Date N/A X: 301553 Y: 5162783 First Bedrock Aquifer Quat. BuriedArtes. Aquifer LastSlral Sand Depthto Bedrock ft `CCoouunnttyy WWeellll IInnddeexx OOnnlliinnee RReeppoorrtt Nts Nearesl Known Source of Coataminalion _feet _direclion _lype Well disinfected upon completion'? 0 ve [] Yes 0 [] No ASR Se Pump [] Not Installed Date Installed Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m Bh Bh HP 0 Type Volts Material Abandoned Wells Does property have any eel in use and not sealed well(s)? [] Yes Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Wall Contractor Certification [] No [] No License Business Name 221144332277 Lic Or Reg. No. Name of Driller Priinetedd S9ta2/02000s8 HE 01205 07 he 1. OR A NOO 0003143R 7 {1027 2081048.32AN 22223333..00551144 STATE02827326 STATE_02827326 WllogReport -0245% Wcll Log Rcport - 00244983 2m4a4s98s3 F JEE Minnesota Unique Well No. Caunty Quad Quad ID Otter Ta il Perham 237D Well Name R.D. OFFUTT COMPANY Er -------- -ownship Range Dir Section Subsections Elevation Bown cee 166 39 W 15 Elevation Method WEBLLLIATNDRBOONRNING MINNESOTA DEPARTMENT OF HEALTH V~/F~I~L flI~NID BO~]~IG R~(~ ORD Minnesota Statules Chapter 1031 Well Depih Symsfw 1366 ft ft. Calc from DEM (USGS 7 5 m n or equiv ', Depth Completed ft. mn Entry Date Update Da:e Received Dote 0110211992 03/1112005 Date Well Completed a-- Drilling Fluid -Use Irrigation I Well Htdrofractured? I From :t to Ft [] Yes [] No CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below ft. Casing Diameter Weight Hole Diameter (S-- Geological Material or ines Color Hardness Open Hole from Cum Screen Make Diameter it. 1o Type fl Swoas Slot/Gauze Pom To From To Static Water Level ft. from Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. Lan SutBtwen Length Set Between NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No ets rt, Located Minnesota Department of Health Unique Number Verification N/A System UTM - Nod83, Zone15, Meters eS fei ee Method GP~ Differentially Corrected Dale N/A X: 301545 Y: 5162789 First Bedrcck Aqu ifer County Last Strat County WWeellll IInnddeexx Online Report Depth to Bedrock ft. Online Report Vor siren_@ v8 Nearest Known Source of Contamination _feet _direction _type Well disinfected upon completion'? [] Yes xe [] No Pump [] Not Inatalled Date Installed Manufacturer's name Length of drop Pipe_ft. Model number_ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification [] No 244983 License Business 244983 Name Lic Or Reg. No. PPiriinntleeddNa59me/t2o2f//D2r2il0le0r0088 HE-01205-07 le 100 Ape 201 Nm R050mePbAVI SL Spr 3048S W077 208 10455 tile:///Jl,'...upo/.2ORpt/Appendix'o/o20Do~;20Munie/,o, 20FDo/,o20Siteoy~20gmnmaries/Perham/~[ello~.20Logozo20Reporto/~20-o,,~"_3 0009_44983.htm[10i27/2008 10:48:33 AM] sare 02827327 STATE_02827327 22223333..00551155 Wallog epor-4477 Wcll Log Rcport - 00445787 waster] Minnesota Unique Well 445787 No. EFEE County Quad Quad ID Otter Tail Perham 237D Well Name LEIN, DAME -ownship Range Dir Section Subsections Elevation 136 39 W 22 ABBACB Elevation Method WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} BORI]~[C~ ~CO~J~ Minnesota Statules Chapter 1031 1369 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 118 ft Depth Completed 99 ft. man Entry Data Update Da:e Received Date 0111711991 10/08/1998 Date Well Completed 09/1311988 Well Address PERHAM MN 56573 Fr Drilling Fluid Revert Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or bwcarbon) Joint Threaded No Above/Below 1 ft Drive Shoe? [] Yes [] Casing Diameter Weight Hole Diameter 4 in. to 94 ft. Ibs./ft. 6 in. te 118 ft. Geological Material Sos io Graves SAND AND GRAVEL CLAY EN somostars CLAY & SAND STRIPS )SAND CLAY SAN [] CLAY SAN D SAN [] SAN [] CLAY SAN [] Color Row ME rr EEmeT-------------------------- YELLOW BLU E aie, Bg 2 [om ore YELLOW ESE 2 flare wee ovr. YELLOW Hardness SOFT SOFT SOFT SOFT From To 0 30 30 38 36 43 43 65 Open Hole from it. to ft Screen YES Make JOHNSON Type stainlesssleel Diameter SlotlGauze Length Set Between BLU E SOFT 65 68 3.8 12 5 94 ft. and 99 GRAY SOFT 68 81 BLU E SOFT 81 88 GRAY SOFT 86 9~ GRAY GRAY BLUE G RAY SOFT SOFT SOFT SO FT 93 98 99 105 98 99 105 118 Static Water Level 27 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 50 ft after hrs. pumping 100 g.p.m. 09113/1988 -- NO REMARKS Well Head Completion Pitless adapter manufacturer MONITOR Model 6FT BURY []Casing Protection [] 12 in. above grade Bren rerio yen [] At-grade (Environmental Wells and Borings ONLY) Ce ms rsa Gre Grouting Information WelIGrouted? [] Yes [] No J Located Minnesota Geological Survey Method Digitized scale 1:24000or larger(Digitizing Table) poUnique Number Veritication Naereon mailbox ,System UTM - Ned83, Zone15, Meters Date X: 302065 -- Y: 51622#0 Grout Material: Cuttings from to ft. Nearesl Known Source of Conlaminalion 75.~fct Nort~ East direction S*ntic tank/drain field ~pe he Well disinfcctod upon completion? [] Yos [] No Pump [] Not Installed Dale Installed 09100!1988 [ErEiR ae T eti Manufacturer's name AERMCTOR Model number SD-12-75 HP 0.75 Volts 23._0 on Length 01drop Pipe 72 ft. Capacity30 g.pm Type Submersible Material Galvanized | Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No First pd Bedrock iss soso any Last Slral Sand gray ate Aquifer Qt Quat Baws ie BuriedArtes. AAcqtuiefesr Depth to Bedrock ft. County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Lucho Cichv Rrn. Well Ce. 44445577p8877es License Business Name ms 56154 Se EEL Lic Or Reg. No. frou CICHY. R. Name of Driller Printed 9/2/2008 Printed 9t2/2008 HE 01205 67 le 100 Ape 201 NmR050mePbAVISL Spr 3040085757 N07208 10455) sare 02627328 STATE_02827328 22223333..00551166 WaoglReplort 0465720 Well Log Report - 00483720 Minnesota Unique Well No. 448833772200 FE County Quad Jez im Quad ID Otter Tail Perham 237D Well Name R.D. OFFERT CO. mow -ownship Range 136 39 Dir W hon Section Subsections 15 BDDD seme Elevation Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~7~z~LL ~I~]~[} ]~ORIN-C~ RECORD ~CO~ Minnesota Statules Chapter 1031 SLES 1367 ft Calc from DEM (USGS 75 m n or equi~ ', Well Depih 34 fl Depth Completed 33 ft. man Entry Date Update Da:e fbi Received Date gow 09105/1997 10/26/200T Date Well Completed 06/2811994 Drilling Fluid -- ------ Use Monitor well I Well Htdrofractured? [] Yes [] No I From :t to Ft Casing Type Steel(black or bwcarbon) Joint Threaded Drive Shoe? EE No Above/Below it [] Yes [] Casing Diameter Weight Hole Diameter 2 in. to 28 ft. Ibs./ft. 6 in. to 34 ft. cies win Geological Material TOPSOIL Simi FINE GRAINED SAND SAN D W/ GRAVEL FINE GRAINED SAND SAN D & GRAVEL GRAVEL FINE SAND chorColor = BROWN BROWN BROWN BROWN GRAY GRY/BRN bmn Hardness Open Hole from it. to ft Fon To From To foun Screen YES Diameter Some yon Make Type stainless sleel SlotlGauze Length Sqpen Set Between 0 2 2 10 5 28 ft. and 33 i2 8 8 16 16 20 20 31 31 33 Static Water Level 33 34 22 ft from Land surface Date Measured 0612811994 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. -- NO REMARKS is mtn Located Minnesota Depadment of Health Unique Nu'~ber k/erilication N/A System UTM - Ned83, Zone15, Meters os ots Method GPS Differentially Corrected Date N/A X: 301937 Y: 5163187 iooe First Bedrock iS" u Aquifer County Well Index Online Report Last Slral Depth to Bedrock ft. County Well Index Online Report Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade Bren rerio yen [] At-grade (Environmental Wells and Borings ONLY) Ce ms rsa Gre Grouting Information WelIGrouted? [] Yes [] No Ga ts ne Grout Material: Bentonite | Got concREre Grout Material: CONCRETE nem from 21 to 26 ft. om B38 from to 21 ft os0.5 bags 5 bags i Nearesl Known Source of Contaminalion __feet _direction _type Well disinfected upon completion? Be [] Yes Be [] No Pump [] Not Installed Dale Installed Manufaclurer'sname Length oldrop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)1 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Well Contractor Certification Si U.s. Geol Survey M0113 4488r3377e22e00r wim License Business Name Lic. Or Reg. No. Yes [] No ma ROSEMORE D eo Name of Driller Printed 5/2/2008 Printed 912/2008 HE 01205 67 le 100 Ape 201 NmR050mePbAVISL Spr 30400537 07 208 10.4534 A stare 02827329 22223333..00551177 STATE_02827329 Wiley pornos Well Log Report - 0050147 l Minnesota Unique Well No. 5S0o14r7t1 F zi E im County Quad Quad ID Otter Ta il Perham 237D Well Name TOBKINS, NElL -ownahip Range Dir Section Subsections Elevation 136 39 W 22 BBADCD Elevation Method WE|LLRAENcDomByO,RING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 1348 ft Calc from DEM (USGS 75 m n or equi~ ', Well Depih 73 ft Depth Completed 73 ft. m[Lno Entry Data Update Da:e Received Date 01102/1992 12/29/2004 Date Well Completed 04/1011989 ee Drilling Fluid Bentonite Use Irrigation ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below 1 ft Casing Diameter Weight Hole Diameter 10 in. to 63 ft. Ibs./ft. 10 in. to 72 ft. Geological Material SAN D Lp SAN D SAN D Color TAN Z BROWN BROWN Hardness SOFT wr SOFT SOFT From To 0 10 Ii 10 55 55 73 os NO REMARKS -- Located Minnesota Geological Survey Unique Nu'~ber Verilication Other, note in remarks System UTM - Ned83, Zone15, Meters ssn Method GP$ Differentially Corrected Date X: 301298 Y: 5162156 rss rate ot wre First Bedrock tse gars Last Slral Sand brown Aquifer Quat. Water Table Aquifer Depth to Bedrock ft County Well Index Online Report County Well Index Online Report Open Hole from it. to ft Screen YES Make JOHNSON Type stainless sleel Diameter 10 SlotlGauze 100 Length 10 Set Between 63 ft. and 73 Static Water Level 10 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 45 ft after hrs. pumping 300 g.p.m. 04110/1989 Well Head Completion C i E or Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Grout Material: Bentonite from 0 to 55 ft. Te Eno Nearesl Known Source of Conlaminalion __feet _d~rection __type Well disinfected upon completion? 1 [] Yes G8[] No Pump [] Not Installed Date Installed Manufaciurer'sname Length 01drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification TT ain, Inaleaide Enor. 55e0011e447711 License Business Name a eno 27355 DEHN. D oT un Lic Or Reg. No. Name of Driller Printed ST2008 Printed 9t2/2008 HE 01205 07 el. Ape 20935005 Pe Ne20 Rr S017 12208 1353 sate 02827330 STATE_02827330 22223333..00551188 WeLoglRolr ms55373 Wcll Log Rcport - 00555375 sos Minnesota Unique Well 555375 No. F JE. E County Quad Quad ID Otter Tail Perham 237D Well Name -ownehip 136 en Range Dir Section 39 W 22 Subsections ACAABA een Elevation Elevation Method WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH V~/EI~L flI~NID BORI]~C~ R~(~ ORD Minnesota Statules Chapter 1031 man Entry Date Update Da:e Received Date 07112/1995 10/08/1998 Bo) 1362 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 165 ft Depth Completed 159 fh Date Well Completed 05/2511995 Ee Drilling Fluid Bentonite Use Domestic ~ Well Htdrofractured? [] 'Yes [] No I From :t lo Ft Casing Type Plastic Joint Glued Drive Shoe? []Yes El No Above/Below ft. Well Address RR 3 BOX 27H tog wn PERHAM MN 56573 Geological Material SAND AND CLAY STIPS SAND gE SAN D CLAY SAND SAND SAND CLAY Ge ren pom 1 Color Hardness From To YELLOW SOFT 0 58 YELLOW SOFT 58 88 EEE G RAY BLUE YELLOW YELLOW SOFT MEDIUM SOFT SOFT 88 121 132 138 121 132 138 148 GRAY SOFT 148 161 BLUE HARD 161 165 Casing Diameter Weight Hole Diameter 4 in. to 155 ft. Ibm/ft. 7 in. to 30 ft. [COOpen Hole Screen YES TT from it. to ft Make JOHNSON Tr Type stainless steel 6 in. to 165 ft. Diameter 3.8 Slot/Gauze 10 Length 4 Set Between 155 ft. and 159 ft. Stagc Water Level 22 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 45 ft after hrs. pumping 100 g.p.m. 05t25/1995 -- NO REMARKS Well Head Completion Pitlees adapter manufacturer MAASS Model 1.25 []Casing Protection [] 12 in. above grade Brun tner rt ao [] At-grade (Environmental Wells and 3orings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No cts Meer tt Sey Gt 40 ap Ta Located Minnesota Geological Survey Melhod Digitized scale ~:24,000or larger(DigitizingTable) Grout Material: Bentonite from 0 to 30 ft. Unique Number Merilication Tag on well Date N/A System UTM-Ned83, Zone15, Meters X: 302281 Y: 5161941 Nearesl Known Source of Coataminalion 70._.Q~feet S direction Sentic tank/drain field terectoste Bs 50 Well disinfected upon completion'? [] Yes type [] No Pump [] Not Installed Dale Installed 05/30/1995 [ e ARE Er , f a a r eni| Manufacturer's name AERMCTOR Model number 5T-12-50 HP 0 5 Volts 23._.0.0 Length of drop Pipe 60 ft. Capacity 15 g.pm Type Submersible Material Plastic Abandoned Wells Does property have any hal in use and not sealed well(s)? [] Yes [] No First Bedrock is con my Last Slral Clay-gray Aquifer Quat BuriedArtes. Aquifer Depthfn Redrnck fl `County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No sombre Well Contractor Certification Cichv R rn Well Co License Business Name 555555337755 rT 56154 Lic Qr Reg. No. CICHY R Name of Driller Printed 97212008 Printed 9t2/2008 HE 01205 07 he 1. OR A NOO 0008S O W107 2081048.35 AN tile://IJl,'...upo,~2ORpt/Appendi'o/o20Dov;20Muni c/,o, 20FDo/,o20Siteoy~20Smnmaries/Perham/~[ello~,20Logozo20Reporto/~20-o,,~_000555375.htm[10i27/2008 10:48:35 AM] 2233.0519 STATE 02827331 2233.0519 STATE_02827331 ---- Well Log Report - 00609559 [Co6o0s95s6s9o_|] zii,. Minnesota Unique Well No. 609559 County Quad Quad ID i5Otter Tail Perham 237D Well Name CITY OF PERHAM -ownship 136 ww Range Dir 39 W Section 22 ms Subsections ABABBB seme Elevation Elevation Method WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH V~/F~I~L flI~N]D BORIN]~ R~(~ ORD Minnesota Statutes Chapter 1031 SLES 1370 ft Calc from DEM (USGS 75 m n or equi~ ', Well Depth 100 ft Depth Completed 100 ft. =fnm. Entry Date Update Da:e Received Date om 07113f1999 OTI1212004 Date Well Completed 08/1211998 Ses Well Address CONEY RD S PERHAM MN 56573 MoErDotSahtie,WOuEMeDEDNSE 6eologioal Material FINE SAND- MEDIUM DENSE MEDIUM SAND- MEDIUM DENSE SAND WITH GRAVEL- MEDIUM DENSE FINE SAND - MEDIUM DENSE SILTY SAND - VERY LOOSE TO DENSE SAND W/ SILT - DENSE TO VERY DENSE -- RE ---------- Drilling Fluid -Use Monitor well I Well Htdrofractured? [] Yes [] No I From :t to Ft Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below it Casing Diameter Weight Hole Diameter ga een Color BROWN Brent BROWN Hardness BROWN GRAY GRAY GRAY Eon From To 0 9 suf 9 24 24 29 29 34 34 44 44 96 2 in. to 97 ft. Ibs./fl. 4 in. to 95 ft. Emer Open Hole from it. to ft Screen YES Make Type steel (non-stainless) Ge tn Sy Diameter 3 TST we 2 Slot/Gauze 10 Length 3 Set Between 97 ft. and 100 Static Water Level 24 ft from Land surface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 08112/1998 a NO REMARKS LocaMirmessa Dportmrt of oath Located Minnesota Depadment of Health Unique Number Verification N/A System UTM - Ned83, Zone15, Meters Ub: Digiaton (Sree) Map (124000) Method Digitization (Screen) Map(l:24,000) Date 07f09/2004 X: 302159 Y 5162346 rss TE First Bedrock i ety Em Last Slral Sand & silt gray Aquifer Quab Water Table Aquifer Depth to Bedrock ft. County Well Index Online Report County Well Index Online Report Well Head Completion C Brrenan seangtoun Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Gt es com Grout Material: Neat Cement wn on wn from 0 to 93 ft. GGrroouutt M Mataetreiraila:l: BBaernttoonnittee tfroomm B9334to 8958,ft. i ir J ts Neared Known Source of Contaminalion __fcet _direction _type Well disinfected upon completion? [] Yes 15[] No Pump [] Not Installed Date Installed Manufadurer'sname Length oldrop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification atin Gme Consultants 66e 009955559e 9 License Business Name owSa, M0101 Lic Or Reg. No. jar E ALDRICH. T. Name of Driller Printed S208 Printed 9t2/2008 HE 01205 07 el. Ape 20935005 Pe Ne20 Rr 0 SOS 12208 1385 AN tile:///JI/...up/oo2ORpt/Appendix'o/o20Do;~;20Muni e/,o, 20FDo/,o20Siteoy~2OSummaries/Perhan~/&~Telloro20Logozo20Reporto/dO-,ovo_ooo609559.htm[lOi22/2008 10:48:3_5 AIM] state 02827332 STATE_02827332 22223333..00552200 Wallog Report tr: Well Log Report - 00609562 6w09e562e]F , E Minnesota Unique Well No. County Quad Quad ID Otter Tail Perham 237D Well Name PERHAM, CITY OF -ownship Range Dir Section Subsections Elevation 136 39 W 15 CDDDCC Elevation Method WEHLLiANvD IBORNING MINNESOTA DEPARTMENT OF HEALTH V~/F~I~L flI~NID BORIN{~ R~(~ ORD Minnesota Statules Chapter 1031 1366 ft Calcfrom DEM(USGS75mn or equi~ ', Well Depih 101 ft Depth Completed 65 ft. mEnR Entry Date Update Da:e Received Date 05125f1999 03/1112005 Date Well Completed 08/1411998 Geological Material or SAND W/SILT - MEDIUM DENSE SAND, TRACE SILT - DENSE TO LOOSE S hh C Gel Tee SILTY CLAYEY SAND - LOOSE TO DENSE FINE SAND - MEDIUM DENSE FINE SAND - DENSE FINE SAND - DENSE SILTY CLAY - STIFF FINE TO COARSE SAND - DENSE FINE TO COARSE SAND - MEDIUM DENSE SILTY CLAY - STIFF TO VERY DENSE ------------ Drilling Fluid -Use Monitor well I Well Htdrofractured? [] Yes [] No I From :t to Ft Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below it Casing Diameter Weight Hole Diameter SoColor BROWN BROWN nar GRAY BROWN BROWN GRY/BRN GRAY BROWN GRAY GRAY pg Hardness From To 2 in. to 62 ft. Ibs./ft. 4 in. to 65 ft. E fe re Open Hole from it. to [t Screen YES Make Type stainless sleel Erm 0 19 19 30 30 44 Diameter 2 SlotlGauze 10 hale Length 3 rR Set Between 62 ft. and 65 44 49 49 59 59 64 64 79 Static Water Level 79 84 18 fl from Land surface Date Measured 08114/1998 84 89 PUMPING LEVEL (below land surface) 89 101 ft. after hrs pumping g.p.m. -- NO REMARKS LocaMirmessa Dportmrt of oath Located Minnesota Depadment of Health Unique Nu'~ber Verilication N/A System UTM - Ned83, Zone15, Meters Ub: Digiaton (Sree) Map (124000) Method Digigzation (Screen) Map(l:24,000) Date 0710912004 X: 301858 Y 5162360 ksi First Bedrock isn srs Somer Last Slral Silt & clay gray pate Aquifer QQuuaalt Baw Nw, BuriedANes. Ale Aqur[er Depth to Bedrock ft. County Well Index Online Report County Well Index Online Report Well Head Completion Pitless adapter manufacturer Model []Casing Protection Y [] 12 in. above grade Bren oreo i [] At-grade (Environmental Wells and Borings ONLY) Ce ms rsa Gre Grouting Information WelIGrouted? [] Yes [] No Go tn et Comer Grout Material: Neat Cement GGrroouutt MMataetreiraila:l: BBaernttoonnittee mown from 0 to 58 ft. tfroomn B5845to 6030,ft. Se obiet Nearesl Known Source of Contaminalion __fcet _direction _type Well disinfected upon completion? [ts [] Yes 30 [] No Pump [] Not Installed Date Installed Manufaclurer'sname Length oldrop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Coslanatis Well Contractor Certification Gme Consultants 66s0099t5566a22re License Business Name wa M0101 Se en Lic Or Reg. No. aomout ALDRICH. T. Name of Driller Printed 9/2/2008 Printed 9t2/2008 HE 01205 67 le 100 Ap201 e Nm R050 mmo PbAVI SL Spr 3040046 W107 20810453 tile:///JI/...up/oo2ORpt/Appendix'o/o20Do;~;20Muni e/,o, 20FDo/,o20Siteoy~2OSmnmaries/Perhan~/&~Telloro20Logozo20Reporto/~20-,ovo_ooo609562.htm[lOi2%'2008 10:48:36 AIM] sare 02627333 STATE_02827333 22223333..00552211 log Ron 0trcs Well Log Report - 00609565 Minnesota Unique Well No. 660099556655 | =o x. mi County Quad Quad ID Otter Tail Perham 237D Well Name HEART C,F THE LAKE ELEM. mw -ownship Range 136 39 Wb Dir Section W 15 ow Subsections CDADAD seme Elevation Elevation Method WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH V~/F~I~L flI~NID BORIN{~ R~(~ ORD Minnesota Statutes Chapter 1031 SLES 1369 ft Calc from DEM (USGS 7 5 m n or equi~ ', Well Depth 100 ft Depth Completed 100 ft. nfeb,i Entry Date Update Da:e Received Date a 07113f1999 OTI1212004 Date Well Completed 03/1811998 Well Address 810 2ND AV SW PERHAM MN 56573 Geological Material FINE TO MED SAND LOOSE TO DENSE SAND WITH SILT MEDIUM DENSE SILTY CLAYEY SAND MEDIUM DENSE FINE TO MEDIUM SAND MEDIUM DENSE Re a SAND WITH SILT DENSE FINE TO MED SAND DENSE FINE SAND DENSE CLAYEY SAND DENSE SAND WITH SILT VERY DENSE Golor BROWN BROWN BROWN BROWN Ee GRAY GRAY GRAY GRAY GRAY Hardness Em -- Drilling Fluid -Use Domestic I Well Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below ft Casing Diameter Weight Hole Diameter From 0 24 29 31 i49 59 74 91 94 2 in. to 97 ft. Ibs./ft. 4 in. te 100 ft. Ere Open Hole from it. to ft To Screen YES 24 Make Type steel (non-stainless) 29 Diameter 31 2 49 Slot/Gauze 10 Length 3 Set Between 97 ft. and 100 fr 59 74 91 94 Static Water Level 95 23 fl from Land PUMPING LEVEL surface Date Measured (below land surface) 03118/1998 es ft. after hrs pumping g.p.m. -- NO REMARKS LocaMirmessa Dportmrt of oath Located Minnesota Depadment of Health Unique Number Verification N/A System UTM - Ned83, Zone15, Meters Ub: Digiaton (Sree) Map (124000) Method Digigzation (Screen) Map(l:24,000) Date 07f09/2D04 X: 301950 Y 5162631 sae re First Bedrock erp Es Last Slral Sand & silt gray Aquifer Depthto Bedrock ft. County Well Index Online Report County Well Index Online Report Well Head Completion Pitless adapter manufacturer Model []Casing Protection Y [] 12 in. above grade Bren oreo i [] At-grade (Environmental Wells and Borings ONLY) Ce ms rsa Gre Grouting Information WelIGrouted? [] Yes [] No Gt es com Grout Material: Neat Cement GGrroouutt MM ataerteiraila:l: BBaernttoonnittee manus from 0 to 93 ft. tfroomm B9334to 8958,ft. i Nearesl Known Source of Contaminalion __feet _direction _type Well disinfected upon completion? Be [] Yes Be [] No Pump [] Not Installed Date Installed Manufaclurer'sname Length oldrop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification a war waar Gme Consultants M0101 -- SR. SE License Business Name Lic Or Reg. No. [] No ALDRICH. T. Name of Driller 609565 Printed 9/2/2008 Printed 9t2/2008 609565 HE 01205 67 hl. Ape 0 S051Sms Pr Wl 20 Ree20500956 029 208104856 ANY tile:///JI/...up/oo2ORpt/Appendix'o/o20Do;~;20Muni e/,o, 20FDo/,o20Siteoy~2OSmnmaries/Perhan~/&~Telloro20Logozo20Reporto/~20-,ovo_ooo609565.htm[lOi2%'2008 10:48:36 AIM] sraTe 02627334 STATE_02827334 22223333..00552222 WallogReport tr Well Log Report - 00609569 [C6o09o5s69a]| zix,. Minnesota Unique Well No. 609569 Caunty Quad Quad ID i5Otter Ta il Perham 237D Well Name HEART C,F THE LAKES ELEM. mw -ownship Range 136 39 wb Dir Section W 15 om Subsections DCDABC seme Elevation Elevation Method WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 SLOSS 1368 ft Calc from DEM (USGS 7 5 m n cr equi~ } Well Depih 100 ft Depth Completed 100 ft. ffbmi Entry Data Update Da:e Received Date om 07113/1999 OTI1212004 Date Well Completed 08/1111998 Well Address 810 2ND AV SW FEM rs PERHAM MN 56573 (---- Geological Material MED SAND LOOSE TO MED DENSE SAND WITH GRAVEL LOOSE Ean SAN [] SAND WITH GRAVEL DENSE SAND WITH SILT DENSE SAND WITH GRAVEL VERY DENSE aorColor BROWN BROWN BROWN BROWN BROWN BROWN mn Hardness MEDIUM Drilling Fluid -- Em -- Use Domestic ~ Well Htdrofractured? [] J From :t to Ft Casing Type Steel(black or bwcarbon) Joint Threaded FA No Above/Below ft Yes Drive [] No Shoe? [] Yes [] Casing Diameter Weight Hole Diameter emo From To 0 29 29 34 i 34 64 64 74 74 93 93 95 2 in. to 97 ft. Eee Open Hole from it. to ft lo e Screen YES Make Type Ibs./ft. 8 in. to 4 in. to 29 ft. 100 ft. Diameter Slot/Gauze Length Set Between 2 10 3 97 ft. and 100 ft. Static Water Level 24 ft from Land surface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 08110/1998 -- NO REMARKS ts rer tn Located Minnesota Depadment of Health hs Dron Gv) tc) Method Digitization (Screen) Map (1:24,000) AR Unique Nu'~ber Merification N/A System UTM - Ned83, Zone15, Meters Date 07f09/2004 X: 302253 Y 5162501 fn - First Bedrock erp Es Last Slral Sand & larger brown Aquifer Depth to Bedrock ft County Well Index Online Report County Well Index Online Report Well Head Completion Pitless adapter manufacturer Model []Casing Protection Y [] 12 in. above grade Bren oreo i [] At-grade (Environmental Wells and Borings ONLY) Ce ms rsa Gre Grouting Information WelIGrouted? [] Yes [] No Go tn et Comer Grout Material: Neat Cement | Gt i: anne Grout Material: Bentonite wn owen from on moe from 0 to 90 ft. 90 to 95 ft. Vi i Nearesl Known Source of Contaminalion __feet _d~rection __type Well disinfected upon completion? 0 v0 [] Yes 1 3 [] No Pump [] Not Installed Date Installed Manufaclurer'sname Length oldrop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification a war sas Gme Consultants M0101 stare Se en License Business Name Lic Or Reg. No. [] No ALDRICH. T. Name of Driller 609569 Printed 9/2/2008 Printed 9t2/2008 609569 HE 01205 67 le 100 Ape 201 Nm R05m0moPbAVI Lp 304300496107 20810453 tile:///JI/...up/oo2ORpt/Appendix'o/o20Do;~;20Muni e/,o, 20FDo/,o20Siteoy~2OSmnlnaries/Perhan~A~Tellor.2OLogozo20Reporto/~20-,ovo_ooo609569.htm[lO/2%'2008 10:48:36 AIM] 233.0523 state02627335 2233.0523 STATE_02827335  PPllyymmoouutth o CCoouunnttyy RRooaadd 66 o DDuunnkkiirrkk LLaannee OOlldd RRoocckkffoorrdd RRooaadd 22223333..00552244 STATE 02827336 STATE_02827336 Site Name: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY PPllyymmoouutht-h- CGoouurnltyy RRooaadd &6 P3Pl4lyy0mm0ooPuultthyhmFFoiiureelnDDBeeippvaa.rrttmmeenntt Plymouth, MN 3400 Plymouth Plymouth, MN 55447 Blvd. 55447 R7Ri6icc3kk.5KK0lli8inn.ee,5,1FF2i1irree Chief Chief 763-509-5121 TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusedsiinnttearianinidinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water wall: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: FFiirree SSttaattioonn 11,, 1133225500 CCoouunnttyy RRooaadd 86,, PPllyymmoouutthh 446644869999..0044,, 44996822776666..1144 AFFF: Ansul AFFF: Ansul SSeemmai-nannnuuaalllyy LLeessss tthhaann 55 ggaaollonnss. Storm sewer Storm sewer AAGFlFFaFFsF:s:Alleesslssosttshhaahnnan22005gg0aaglllaloolnnlssons Class A: less than 50 gallons UUnnnnaammeedd ppoonnddss 11//44t0o 117/22 ssoouutthh 21/210to11 mmiilee eeaasstt SStitoeiiss llooccaatteedd inn aa ccoovveerreedd kkaarrsstt aarreeaa 14 to 12 mie east 1/4 to 1/2 mile east Trang sie i located in a WPA Training site is located in a WPA More than 1 mic More than 1 mile 1122 22223333..00552255 STATE02827337 STATE_02827337 PPLLYYMMOOUUTTHH -- CCOOUUNNTTYY RROOAADD 66 CCWWII WWeellll MMaapp. LwEr H ioR t5 e en EFA co Rem Bitte NNER fest Eos rl Ne ~4 gD 1) ihe ph peer Phemaad O10 =!3 TR Si | c aa edprteEeE eS a Eo ee iz Anmgstenaied ski Dro a mean ee pe LiRES ek a NY f= 5 22223333..00552266 STATE_02827338 wtih Tge s hinl }i i{ feBiy [1% ,RINTORLEBil 1 ag1 i . JEeqlegi iid SEE -B |Lon 4~1-0 N couniooy n asaon 45-0-30 N 45-0-0 N 44-59-30 N wmon 44-59-0 N Z| B Td x a ] Ip ges =m E ! Avis + FT be wa 747 JN ag \. a il 0 A Bay a sk. EE = Vai Z| f- 7/7 .... I Rl z +" . i es rd EE nl \ ..... i S l 5 lr t ge EL a 8| TET g /f .[ :s 2 a| d . fo |iits i HL i -- i /VJi -- N 0-~-9~ N 0~-0-~ H i e ! N 0-0-9~ 3 N 0~-69-~ i 1i5 J |i N 22223333..00552277 STATE_02827339 Na! UR a "PlymCotuytRdh6W JThaIntMcy'oNhes ighborahmoodMap_ SE tt EET Sy JY pe ny| a on j \ {igs see i Aili i{ = fNiefe | Sf ena Kr EE, TLde. y | = --1 {\J Ne fee, oR \ fmm i i: mngey 4 fy o JINN --_-- As li 3 pe Abii eh 0i 7 et ofe | 4e17} omarion Disclaimer: Map and site information is believed to be accurate but accuracy is not guaranteed. No portion st oe of the information should be considered to be, or used as, a legal document. The information is provided ET || subject to the express condition that the user knowingly wai,,-es any and all claims for damages against pamansr MPCA that may arise from the use of this data. BelRao te Ntupeoriudnd @Minnosota Pollution Control Agency * ng PFettam-- reot.ons Coan 22223333..00552288 stare oomr300 STATE_02827340 WollogReport 0108267 Wcll Log Rcport - 00104247 oar] Minnesota Unique Well 104247 No. GEm Epen County Quad Quad ID Hennepin Hopkins 104B Well NameAL RANISATE -ownehip Range Dir Section Subsections ows Elevation 118 22 W 28 CBCACA Elevation Method WEPLL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 pmoin Entry Date Update Da:e Received Date ones 08124f1991 09/1111991 954 ft aren] 9 " wn 7 5 minute topographic map (+/- 5 = ee feet) Well Depih Depth Completed Date Well Completed 90 ft 9D ft. 06/1211976 ~=:!!~!~ ~!~ =::.............................................................................................................................................. = Drilling Fluid -Use Domestic I Wall Htdrofractured? [] Yes [] No ] From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 4 in. to 84 ft. Weight Ibs.fft. Hole Diameter Well Address 1640 OAKVIEW LA POUT PLYMOUTH MN comes rn Geological Material SOIL SAN D & GRAVEL cl Color BROWN BROWN mes Hardness SOFT SOFT peFrom 0 3 Open Hale from it. to ft Screen YES Make HOWARD SMITH Type stainless steel Cum Sour rah Sen Diameter 2 wo To SlotlGauze 12 Length 6 Set Between 82 ft. and 88 3 Static Water Level 55 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 56 ft after hrs. pumping 15 g.p.m. 06t12/1976 CoN 0 5 a AGRESS VACATE AN BE. RCH E07 REMARKS LOCATED BOTH BYADRESS VERIFICATION AND BY INFO. FROM NEIGHBOR Well Head Completion Pitlees adapter manufacturer Model yan mvo t gs) []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) (Srivrssmess Grouting Information Wmst WelIGrouted? |Fio [] Yes giio[] No J Located Minnesota Geological Survey Unique Number Merification Address verification System UTM - Ned83, Zene15, Meters Method Digitized - scale ad 1:24,000 or larger (Digitizing Table) Dale N/A 465352 Y: 4982814 First Bedrock utsre sooo potions Last Slral Sand-brown Aquifer Quat. Water Table Aquifer D~.pfhtoRedrock ff County Well Index Online Report County Well Index Online Report Nts Nearesl Known Source of Contaminalion _feet _direction _type Well disinfected upon completion'? 0 ve [] Yes 0 [] No STEER Jo TY Pump [] Not Installed E,ate Installed Manufacturer's name FAIRBANKS Model number 4C-5008 HP 0 5 Veils 22._.0.0 Length of drop Pipe 63 ft. Capacity 10 g.pm Type Submersible Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No orm amor Well Contractor Certification Maher Well Co License Business Name 110044224477 Some 19301 Lic Qr Reg. No. tema Name of Driller FPirinteed t9/1i0t/2a00n8 HE 01205 07 le. 208 0a28SAE Snes Poth Cy OR 206 Lg Reg 20820104247 Wf 1027 008 10150 A tile:///Jl,'...dix%20D%20Muni%20FD%20Site%20Summarieg/PlymoutlgCly%20Rd%206/Well%20Log%20Report%20-%2000104247.htm[ 10/27/2008 11:01:50 AM] 2233.0529 STATE02827341 2233.0529 STATE_02827341 WollogRp 0116312 Wcll Log Rcport - 00114312 Tas] Minnesota Unique Well 114312 No. GEm Epen County Quad Quad ID Hennepin Hopkins 104B -- Ri Well Name JEFF CANFIELD -ownahip Range Dir Section Subsections ves Elevation 118 22 W 26 CBBCAD Elevation Method WELPL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~]~[} I}OI~.I]~G ~CO~ Minnesota Statules Chapter 1031 949 ft Joremenins] vt 7 5 minute topographic map (+/- 5 = LE feet) Well Depih 97 fl Depth otCompleted 97 ft. pmoin Entry Date Update Da:e Received Date ones 08124/1991 09/1111991 nin Date Well Completed 05/2011975 = Drilling Fluid -Use Domestic I Well Htdrofractured? [] Yes [] No I From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 4 in. to 92 ft. Weight Ibs./ft. Hole Diameter Well Address arson e"s 1745 OAKFIELD LA PLYMOUTH MN Geological Material CLAY CLAY GRAVEL or Color BLACK BROWN VARIED ws Hardness Open Hole from it. to ft ono| Cum From Screen YES Diameter To 4 Sl0oane LToh ESTafer Make JOHNSON Type stainless steel SlotlGauze 18 Length 4 Set Between 92 ft. and 97 0 2 2 8 8 97 Stagc Water Level 67 fl from Land surface Date Measured 05t20/1975 PUMPING LEVEL (below land surface) 0 ft. after hrs. pumping 20 g.p.m. To NO REMARKS Well Head Completion Pitlees adapter manufacturer Model []Casing Protection [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No ce respi Located Minnesota Geological Survey ts as Unique Number Verification Address verification System UTM - Ned83, Zone15, Meters EE Method Digitized Table) 60 r scale 1:24,000 or larger(Digitizing tv ta Date N/A )~: 465304 Y: 4982923 Nts Nearesl Known Source of Cootaminalion _feet _direction _type Well disinfected upon completion'? 0 ve [] Yes 0 [] No AE Pump [] Not Installed Date Installed Manufacturer's name MEYER Model number Length of drop Pipe 75 ft. Capacity 12 g.pm TE HP 0 75 Molts 23._.0.0 Type Submersible Material Abandoned Wells Does property have any hal in use and not sealed well(s)? [] Yes [] No ursosrtessno First Bedrock LastSlral Sand srate tct tna Aquifer Quat. Water Table Aqui:er Deplhto Radrnck f1 CCoouunnttyy WWeellll IInnddeexx OOnnlliinnee RReeppoorrtt Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification [re a Rennet E H & Sons 27015 orm batons Some License Business Name Lic Or Reg. No. [] No tema Name of Driller 111144331122 PPrrintteed 9//1100//22O0O08 HE 01205 07 le. 208 0a28SAE Snes Poth Cy OR 206 Lg Reg 20820014312 Wf 1027 2008 10150 A ti~e:///J~.~dix%2~D%2~Muni%2~FD%2~ite%2~Sumtnarie~/P~ym~ut~C~y%2~Rd%2~6/We~%2~L~g%2~Rep~rt%2~-%2~ 14312htrn[10/27/2008 11:01:50 AM] 2233.0530 STATE02827342 2233.0530 STATE_02827342 Wallog Report i. Wcll Log Rcport - 00204614 2p04o614 Minnesota Unique Well No. FE County Hannepin Quad CaseD Quad ID 120C Well Name PETER KUIPER ve mow ou com cmos -ownehip Range Dir Section Subsections Elevation 118 22 W 2T ABCDBB Elevation Method WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} ]}ORING ~O~ Minnesota Statules Chapter 1031 [opraermenseis| 941 ft 7 5 minute topographic map (+/- 5 feat) Well Depih 236 fl Depth Completed 236 ft. mn Entry Date Update Da:e Received Dote ew 08124/1991 09/11~1991 Date Well Completed 10/0211961 atotmn Well Addiesa 7908 HWY 55 HY PLYMOUTH MN sos ow Geological Material CLAY aCLAY SAN DY CLAY DI RTY SAND-STON ES CLAY CLAY-STONES a CEMENTED SAND MUSH CEMENTED SAND CEMENTED GRAVEL ST. PETER, DIRTY SHALE SHALE ST. PETER cou, Color BROWN boyBLUE BROWN BROWN TAN BLUE ~ BROWN BROWN BROWN DARK BROWN WHITE RED WHITE we Hardness -- NO REMARKS Ee -- Drilling Fluid -Use Domestic I Wall Htdrofractured? I From :t ~o Ft ~ Yes ~ No CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/Below0 ft. fmFrom To 0 10 PE 10 40 40 46 46 65 65 70 70 81 f J 81 85 85 101 101 111 111 135 135 177 177 185 185 11 191 236 Casing Diameter 5 in. to 191 ft. Weight Ibs./ft. Hole Diameter Em Open Hole from 191 fl. to 236 ft. Screen NO Make Type Diameter Slot/Gauze Length Set Between Static Water Level 80 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 0 ft. after hrs. pumping 42 g.p.m. 10t02/1961 Well Head Completion Pitless adapter manufacturer Modal []Casing Protection [] 12 in. above grade a Gr [] At-grade (Environmental Wells and Boringa ONLY) Grouting Information WelIGrouted? [] Yes [] No ert eS. Stn HE CT Located Minnesota Geological Survey Method Digitized - scale 1:24,000 or large[ (Digitizing Table) A Unique Number Verification N/A Date NtA System UTM- Ned83, Zone15, Meters X 464709 Y 4983523 [---- re First Bedrcck St Peter uss sr Seri vw Last Slrat St.Peter Aquifer St Peter Depth to Bedrock 135 ft. County Well Index Online Report County Well Index Online Report Vor siren_@ v8 Nearest Known Source of Contamination _feet _direction _type Well disinfected upon complehon? [] Yes xe [] No Pont Bb son VehSECVeAa Pump [] Not Inatalled Date Installed Manufacturer's name RED JACKET Model number 15C K1 -gCA Length of drop Pipe 108 ft. Capacity 20 g.pm Type Submersible HP 1.5 Material Molts Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification To i Rennet E.H & Sons 27015 msn Foe erm License Business Name Lic Or Reg. No. [] No Name of Driller 220044661144 PPrriinntteedd 99//1100/22000088 HE-01205-07 Hl 207 NA F700 PC 200 2233.0531 LagReon YE 102700 110151 AN STAT 02627343 WolLogReport 0204615 Wcll Log Rcport - 00204615 2i0e4t6s1]5 GEm Epen WELPL ALND BEORING pmoin ones Minnesota Unique Well No. County Quad Quad ID Hennepin Hopkins 104B Well Name O. V. BUSBY m Ve 7 on 7 covens -ownehip Range Dir Section Subsections Elevation mts p=rmmemenseis| ee7 = -- 118 22 W 2T CCAABA Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Entry Data Update Da:e Received Date 0812411991 09/1111991 950 ft 7 5 minute topegraphic map (+/- 5 feet) Well Depih Depth Completed Date Well Completed 72 fl 72 ft. 10/0111968 ~[!!I!9~g_M!P~ = :2............................................................................................................................................. = Drilling Fluid -Use Domestic I Well Htdrofractured? [] Yes [] No I From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 4 in. to 66 ft. Weight Ibs./ft. Mole Diameter Well Address 13919 CO RD 6 CR MN Sti Geological Material DIRT AND SAND CLAY, HARDPAN SAN D frees Color BLACK Hardness YELLOW BROWN fomFrom 0 27 56 Open Hole Screen YES Cum Diameter To 2 2S 27 56 72 from it. Make to ft 948 Type stainlessstee Suis Legh SetBen SIoUGauze * wooememon 12 Length Set Between 5.6 0 ft. and ft. Stagc Water Level 30 fl from Land surface Date Measured 10t0'/1968 PUMPING LEVEL (below land surface) 0 ft. after hrs. pumping 25 g.p.m. rrREMARKS WELL WAS DESTROYED Lt gtSrey Ws 340 Oe Located Minnesota Geological Survey Method Digitized - scale 1:24,000 or larger (Digitizing Table) Unique Number Merilication N/A Date NtA System UTM- Mad83, Zone15, Meters X: 463948 Y: 4982664 First Bedrock isi soso my Last Slral Sand-brown Aquifer Quat. BuriedArtes. Aquifer r)epfhtn Redrock ff County Well Index Online Report County Well Index Online Report Well Head Completion Pitless adapter manufacturer Model []Casing Protedion [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No Nts Nearesl Known Source of Cootaminalion _feet _direction _type Well disinfected upon completion'? 0 ve [] Yes 0 [] No AE Se TE Pump [] Not Installed Dale Installed Manufaciurer's name GOULD Model number NP 1 5 Molts Length of drop Pipe 55 ft. Capacity_gp.m -ype Submersible Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No sombre Well Contractor Certification Mork Well Co License Business Name 220044661155 Ome 02133 Lic Or Reg. No. twat Name of Driller PPrrintteed 9//1100//22O0O08 HE 01205 07 le. 2080a208 SAE Suns Poth Cy OR 206 Lg Reg 2020004615 Wf 1027 2008 10151 AM) STATE02827344 2233.0532 WallogReport 026510 Wcll Log Rcport - 00224310 Minnesota Unique Well No. 222244331100 GmCounty Quad |i.Quad ID wmHennepin Hopkins 104B Well Name PARKERS LAKE SUB. STAT. 1s-ownehip 118 Bw Range Dir 22 W Section 2T on Subsections CDCCBC een Elevation Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING WELL AND BORING RECORD ~ C O~:~I~ Minneseta Statutes Chapter 1031 Lr 939 ft 7 5 minute topographic map (+/- 5 feet) Well Depth mmm243 ft Depth Completed 243 ft. man Entry Date Update Da:e fbi Received Date 03131/1994 10/11/1995 Date Well Cempleted 02/2511969 Well Address aoctoss cs PLYMOUTH MN Geological Material CLAY GRAVEL-CLAY MIXED WATER SAND GRAVEL-HARD-DIRTY FINE GRAVEL SHALE SHALEY SANDROCK SANDROCK SHALE SHALE SANDROCK-HARD, SOFT STREAKS eTREMARKS MG.S. NO.507. a Color YELLOW GREEN GREEN REEl ames Hardness SOFT Drilling Fluid -- {ee Use Cornmercial I Well Htdrofractured? [] Yes [] No I From :t to Ft Casing Type Steel(black or lawcarbon) Joint No Information Drive Shoe? [] Yes [] A EE No Above/Below 0 ft Casing Diameter Weight Hole Diameter omg From To 0 15 15 32 32 46 46 67 67 76 76 82 82 108 108 189 189 196 196 208 208 243 8 in. to 67 ft. 4 in. to 208 ft. Open Hola from 208 fl. to 246 fl. Screen NO Make Type Ibs./ft. Ibe./ft. 8 in. to 4 in. to 107 ft. 246 ft. Diameter BlotlGauze Length Set Between Static Water Level 5,5 fl from I and surface Date Msas~Jred PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 6,~1751196,9 oGsoommones Bsowtomen Well Head Completion Pitless adapter manufacturer Modal []Casincl Pretecfien [] 12 in. above grade EE a []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No ts versity Located Minnesota Geological Survey Unique Number Verification Information from owner System UTM- Ned83, Zone15, Meters ns Oto Gv) Method Digitization (Screen) Date 08/30/2004 X: 464048 Y: 4982328 456 Map(l:24,000) Nearest Known Source of Contamination __fcct __direction __type Well disinfected upon completion? [] Yes [] No - Cuttings Yes First Redrrr:k Plafle\,ille ee Ett Last Slrat St.Peter Aquifer St.Peter Depth to Bedrock 67 ft. County Wal index Ge Repor County Well Index Online Report Pump [] Not Installed Date Installed Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material AbandonedWells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification Beraerson Caswell 22f2244o3311r00e License Business Name 27058 ER eon Lic Or Reg. No. Name of Driller Fried 702008 Printed 9/10/2008 HE-01205-07 ll. OH CM2a0 0S 0m PC ORB WaPo eqn3 AES10 M1 272508 1012 AN tile:///JlL.,dix%20D%20Muni%20FD%20gite%20Sumtnaries/Plymoutl~Cly%20Rd%206/Well%20Log%20Report%20-%2000224310.htrn[10/27/2008 11:01:52 AM] 2233.0533 state 02827345 2233.0533 STATE_02827345 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY PPllyymmoouuthth-- DDuunnkkiirrkk LLaannee P3Pl4lyy0mm0ooPuultthyhmFFoiiureelnDDBeeippvaa.rrttmmeenntt Plymouth, MN 3400 Plymouth Plymouth, MN 55447 Blvd. 55447 R7Ri6icc3kk.5KK0lli8inn.ee,5,1FF2i1irree Chief Chief 763-509-5121 TTrraaiinniinngg LLooccaatitioonn:: FFiirree SSttaattioonn 33,, 33330000 DDuunnkkiirrkk LLaannee,, PPllyymmoouutthh TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): 446611330086.4411,,44998844998933..6699 TTyyppee ooff ffooaamm uusedsiinnttearianinidinngg:: AFFF: Ansul AFFF: Ansul FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: SSeemmai-nannnuuaalllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaaollonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Storm sewer Storm sewer AAnnnnuuaall ffooaamm uussee:: AAGFlFFaFFsF:s:Alleesslssosttshhaahnnan22005gg0aaglllaloolnnlssons Class A: less than 50 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: LLeessss tthhaann 11//88 mmiilee eeaasstt NNeeaarreesstt wweettllaanndd:: LLeessss tthhaann 117/88 mmiille eeaasstt KKaarrsstt AArreeaa:: SStitoeiiss llooccaatteedd inn aa ccoovveerreedd kkaarrsstt aarreeaa Nearest water wall: Nearest water well: Less than 1/4 mil west Less than 1/4 mile west Nearest Wellhead Protection Area: Trang sie i located in a WPA Nearest Wellhead Protection Area: Training site is located in a WPA NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: Less than 1 mio Less than 1 mile SSIITTEE RRAANNKKIINNGG:: 1188 22223333..00553344 STATE02827346 STATE_02827346 PPLLYYMMOOUUTTHH -- DDUUNNKKIIRRKK LLAANNEE CCWWII WWelelll MMaapp cpr ed lin Rated : Nand Ep Be) ) EP CJ vane WEEE EEL ree fans Ue Ge \! Te BLYMouTREND HH ChE aE Se x aA TNR oes== =Nor& sFe OR i SAlpS yEke iis J it A EEN AE ib alibi ANS NC LRN Spl gbe bs Br fri eTe:o ILh i hrS s)NN7L roA sanl u Bre) fiat foNSrRe TH a L~Sarma Bahl Loaaha dSIT T o E lR e TRL Qa = NH Bre a Ee Sema Ewa Bay | pb aoe eT EL yi, a pt ha pid Eye Car isis eel |REE LeINiEY la ea 22223333..00553355 sre czs277 STATE_02827347 gr ls gailll ig K . i i 3 R IP yn, t T L iahighaiilailaati vo we whl?emHi fanet e ie we weit, ] 45-1-0N 45-0-40 N 45-0-20 FET Fd i 2g Wd . Yi | wl Ay yb)i L 4 C ARIEVE 7 23 i: Lal fo ANCES: AS Se I B5l l~52. JVaBl RD SUR 2SF ii | frags P 1H ; |B 3ER ] i aaor y oT oTfaa l i+g] 5 Jd 5 fs stl zi 7 Vora 3 7 AGS HAY { B.S g colnoxaoibean [81 {hss |: Ta In |8 lg : ii Bd ers or TET ora Tew Tew Hl 22223333..00553366 sre czs2rs STATE_02827348 [PPllyymmoouutthh DDuunnkkiirrKkLLnn WWhahtat''ss IInn MMyy NNeeiigghhbboorrhhoooodd MMaapp] || = i I~ I A | |TM 17 J| il Pr TT ig FEi | bh Do Ay | en /; |3 || M i e x 2X | |i |4 Nf i | ax | me4 ni SelSenld j| ee | || alii : cin - agli| l1Hls Hf h { i |i I Ee wb a i i red e NG E: jhe { - BiG |I| TTPeorvtissntodSamnttasvSuigsassriiasund Disclaimer: M~p and site information is believed to be accurate but accuracy is not guaranteed. No portion [mms mamas of the information should be considered to be, or used as, a legal document. The information is provided EE te KT subject to the express condition that the user knowingly wai,~-es any and all claims for damages against | Sete Suporiund MPCA thai may arise from lhe use of this data. ||| | @winnosatspotuton Conte agency *pcCoCma ReOSLmEo-- saLauins Yop men || 4 RSRATA Facies RSRAmt4ACohanp L AStatofoossomont 22223333..00553377 STATE 02827349 STATE_02827349 Wallog Report 302% Wcll Log Rcport - 00204296 2w04i296 Minnesota Unique Well No. JF E E E Caunty Quad Quad ID Hennepin Osseo 120C Well Name JOHN GULLICKSON np -ownehip Range Dir Section 118 22 W 20 wes Subsections BDBBBD owen Elevation Elevation Method WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} BORI]~G ~0~ Minnesota Statules Chapter 1031 mn Entry Date Update Da:e Received Date ge 08124/1991 05/22~2002 Well Depih Depth Completed Date Well Completed Smee] 1012 ft 7 5 minute topographic map (+/- 5 feat) 280 fl 280 ft. 11/1511968 Ee -- Drilling Fluid -Use Domestic I Well Htdrofractured? I From :t b Ft ~ Yes ~ No CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/Below ft. Geeing Diameter Weight Hole Diameter Well Address 17005 24 CR PLYMOUTH MN Geological Material CLAY GRAVEL BL CLAY Ne SAND GRAVEL BLUE CLAY SAND ROCK SHAKOPEE SAND ROCK Color Hardness WHITE PINK WHITE 4 in. to 270 ft. Ibs.lft. From To 0 23 23 44 44 81 rs 81 160 241 160 241 262 262 278 278 280 Open Hole from 270 ft. to 280 ft. Screen NO Make Type Diameter Slot/Gauze Length Static Water Level 112 ft. from Land surface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping 20 g.p.m. 11/15t1968 Set Between -- NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade a Gr [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No ert eS. Stn HE CT Located Minnesota Geological Survey Method Digitized - scale 1:24,000 or large[ (Digitizing Table) Unique Number Verification N/A Date NtA System UTM- Nad83, Zone15, Meters X 460888 Y 4985047 rs sna sae Parada ring First Bedrcck St Peter or rreircmons Sry Last Strat Prairie Du Chien Group Aquifer Prairie Du Chien Group Depth ~o Bedrock 241 fh County Well Index Online Report County Well Index Online Report Vor sir ompen_@ v8 Nearest Known Source of Contamination _feet _direction _type Well disinfected upon complehon? [] Yes x0 [] No Ten Se on i Lag ees Pump [] Not Installed Date Installed 11114!1968 Manufacturer's name FAIRBANKS MORSE Model nurrber K2ND Length of drop Pipe 126 ft. Capacity 12 g.pm Type Submersible HP 1 Material Volts Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification ata Rennet E.H & Sons 22s0044m22s996 License Business Name Po27015 Foe erm Lic Or Reg. No. Name of Driller Printed 9/102008 Printed 9/10/2008 HE-01205-07 le 1 PM 053mPy 20 WAL Reon 330208 103700 1105.43 AN tile:///JlL..ndi%20D%20Muni%20FD%20Site%20Summaries/Plymou~l'dDunkirk%20Ln/Well%20Log%20Report%20-%2000204296.htm[ 10/27/2008 11:03:42 AM] STATE 02827350 STATE_02827350 22223333..00553388 WaoglReplort 02097 Wcll Log Rcport - 00204297 Minnesota Unique Well No. 220044229977 FE County Quad zi. = Quad ID Hennepin Osseo 120C WelINameGREG REDPATH 18-ownship 118 wn Range DirSection 22 W 20 we Subsections BDBBCB een Elevation Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING WELL AND BORING RECORD RECORD Minnesota Statutes Chapter 1031 mn Entry Data Update Da:e fbi Received Date ew 0812411991 09/11/1991 Sr 1010 ft 7 5 minute topographic map (+/- 5 feet) Well Depih Depth Completed Date Well Completed me235 ft 235 ft. 09/2211971 ~[!!I!9~g_M!P~ = :2............................................................................................................................................. ee Drilling Fluid -Use Domestic I Well Htdrofractured? [] Yes [] No ] From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 4 in. to 231 ft. Weight Ibs./ft. Hole Diameter Well Address 17015 CO. RD. 24 CR Hs PLYMOUTH MN ots is Geological Material CLAY SAN D coo rs Color Hardness Open Hole from it. to ft rm To Cu Swans From To Screen YES Diameter Make Typa stainless steel Slot/Gauze 0 229 229 235 aon Length Static Water Level 108 ft. from Land surface Date Measured PUMPING LEVEL (below land surface) 0 ft. after hrs. pumping 20 g.p.m. 09/22t1971 SuBaen Set Between -- NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade ae [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No es es tS. Stn i 4 Gi Located Minnesota Geological Survey Method Digitized - scale 1:24,000 or large[ (Digitizing Table) A Unique Number Verification N/A Date NtA System UTM- Had83, Zone15, Meters X 460847 Y 4985022 prema fe 0 Bech see First Bedrcck we NGS LastStrat Sand Aquifer Quat. BuriedArtes. Aquiler Depthto Bedrock ft. County Wall ndex Online Report County Well Index Online Report Nearest Known Source of Cor~amination _feet _direction _type Natant 181 Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Inatallad CEE ee Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0.75 Vots Type Submersible Ma:erial Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification "awea Stodola Don Well Co. 22e 00442299y 77 License Business Name P=271 ?'2 cf erm Lic Or Reg. No. Name of Driller Printed SO008 Printed 9/10/2008 HE-01205-07 207 NaF295 XSi yTAo WaPo 0egr3t 7 1272508 110542 AN tile:///JlL..ndi%20D%20Muni%20FD%20Site%20Summaries/Plymou~h!Dunkirk%20Ln/Well%20Log%20Report%20-%2000204297.htm[ 10/27/2008 11:03:42 AM] 2233.0539 sate 02827351 2233.0539 STATE_02827351 Wallog Report 309% Wcll Log Rcport - 00204298 2w04e298 Minnesota Unique Well No. JF E E E Caunty Quad Quad ID Hennepin Osseo 120C Well Name JOHN GULLICKSON np -ownship Range Dir Section 118 22 W 20 we Subsections BDBCCB owen Elevation Elevation Method WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} I}ORI]~G ~O~ Minnesota Statules Chapter 1031 mn Entry Date Update Da:e Received Date ge 08124/1991 05/22~2002 Well Depih Depth Completed Date Well Completed Sr me] 1010 ft 7 5 minute topographic map (+/- 5 feet) 299 fl 299 ft. 09/2711968 Ee -- Drilling Fluid -Use Domestic I Wall Htdrofractured? I From :t ~o Ft ~ Yes ~ No CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/Below ft. Geeing Diameter Weight Hole Diameter Well Address 17040 32ND AV N PLYMOUTH MN Geological Material SAN DY CLAY GRAVE L CLAY = CLAY GRAVEL CLAY CLAY DOLOMITE 4 in. to 299 ft. Ibs./ft. Oolor Hardness From To BROWN 0 30 DAR K 30 43 BROWN 43 81 EI GRAY DARK GRAY 81 92 100 92 100 225 GRAY 225 255 PINK 255 299 Open Hole from 299 fl. ta 299 ft. Screen NO Make Type Diameter Slot/Gauze Length Static Water Level 110 ft. from Land surface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping 20 g.p.m. 0912711966 Set Between -- NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade a Gr [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No ert eS. Stn HE CT Located Minnesota Geological Survey Method Digitized - scale 1:24,000 or large[ (Digitizing Table) Unique Number Verification N/A Date NtA System UTM- Mad83, Zone15, Meters X 460854 Y 4984927 tus nt em First Bedrcck Prairie Du Chien Group or reine Sart Last Strat Prairie Du Chien Group Aquifer Prairie Du Chien Group Depth ~o Bedrock 255 ft. County Well Index Online Report County Well Index Online Report Vor sir ompen_@ v8 Nearest Known Source of Cor~amination _feet _direction _type Well disinfected upon complehon? [] Yes x0 [] No Tene son 0 Le Hawa Pump [] Not Installed Date Installed 10115!1968 Manufacturer'snameAERMCTOR Modelnumber_ HP0.75 Volts Length of drop Pipe 126 ft. Capacity 12 g.pm Type Submersible Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification Tie iy Rennet E.H & Sons 27015 sms Te License Business Name Lic Or Reg. No. [] No Name of Driller 220044229988 PPrriinntteedd 99//1100/22O0O088 HE-01205-07 le PM 053mPy 20 WAL Reon YS 103700 1105.45 AN tile:///Jl,'...ndi%20D%20Muni%20FD%20 Site%20Summarie s/Plymou~l~Dunkirk%20Ln/Well%20Log%20Report%20-%2000204298.htm[ 10/27/2008 11:03:43 AM] sare 02827352 STATE_02827352 22223333..00554400 WaoglReplort 0269 Wcll Log Rcport - 00204299 Minnesota Unique Well No. 22004422999 GmCounty Quad |i.Quad ID en Hennepin Osseo =1200 Well Name J. GULLICKSON 18-ownehip 118 2p Range Dir Section 22 W 20 we Subsections BDBDDC een Elevation Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING WELL AND BORING RECORD RECORD Minnesota Statutes Chapter 1031 Sr 1015 ft 7 5 minute topographic map (+/- 5 feet) Well Depih me208 ft Depth Completed 208 ft. mon Entry Date Update Da:e fbi Received Date ones 0812411991 09/1111991 Date Well Completed 10/2511967 ee Drilling Fluid -Use Domestic I Wall Htdrofractured? [] Yes [] No ] From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 4 in. to 204 ft. Weight Ibs./ft. Hole Diameter Well Address 16925 CO. IRD. 24 CR WRWAYZATA MN ots is Geological Material CLAY SAN D coo rs Color Hardness Open Hole from it. to ft rm To Cu Swans From To Screen YES Diameter Make Type stainless steel Slot/Gauze 0 204 204 208 aon Length Static Water Level 108 ft. from Land surface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 10125t1967 SuBaen Set Between -- NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade ae [] At-grade (Environmental Wells and 3cringe ONLY) Grouting Information WelIGrouted? [] Yes [] No es es tS. Stn i 4 Gi Located Minnesota Geological Survey Method Digitized - scale 1:24,009 or large[ (Digitizing Table) A Unique Number Verilication N/A Date NtA System UTM- Ned83, Zone15, Meters X 460991 Y 4984898 prema fe 0 Bech see First Bedrcck we NGS LastStrat Sand Aquifer Quat. BuriedArtes. Aquiler Depthto Bedrock ft. County Wall ndex Online Report County Well Index Online Report Nearest Known Source of Cor~amination _feet _direction _type Natant 181 Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Ee mei Manufacturer'snameAERMCTOR Modelnumber_ HP0.75 Volts Length of drop Pipe_ft. Capacity_g.p.m Type Submersible Ma:erial Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification "awea Stodola Don Well Co. 22e 00442299s 99 License Business Name P=271 ?'2 cf erm Lic Or Reg. No. Name of Driller Printed SO008 Printed 9/10/2008 HE-01205-07 207 Na OF 2350S yTAo WaPo 0egr2t 9 1272508 10545 AN tile:///JlL..ndi%20D%20Muni%20FD%20Site%20Summaries/Plymou~h!Dunkirk%20Ln/Well%20Log%20Report%20-%2000204299.htm[ 10/27/2008 11:03:43 AM] 2233.0541 state 02827353 2233.0541 STATE_02827353 WolLogReport 0206501 Wcll Log Rcport - 0020430 l [220043001 1 Minnesota Unique Well No. Je,County Quad oe Quad ID = Hennepin Osseo WW120C Well Name BILL CAVANAUGH Ve 7 nn on woes -ownehip Range Dir Section Subsections Elevation 118 22 W 20 DBBBBA Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~TELL ~i~]~[} BORII~G RECORD ~O~ Minnesota Statates Chapter 1031 J=mrmwomensiis] 1009 ft 7 5 minute topographic map (+/- 5 feet) Well Depih ee105 fl Depth Completed =105 ft. fe Entry Date Update Da:e fer Received Dote 08124/1991 09/11~1991 Date Well Completed mT 10/2511970 = Drilling Fluid -Use Domestic I Well Htdrofractured? ~ Yes ~ No I From :t ~o Ft CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/Below0 ft. Casing Diameter Weight Hole Diameter Well Address 2951 COMSTOCK LA PLYMOUTH MN 4 in. to 99 &. Open Hole from it. to ft Screen YES Make 960 Type Ibs./ft. Geological Material CLAY CLAY Ee SAND + GRAVEL SAND GRAVEL HARDPAN SAN D, G RAVEL Color Hardness From To Diameter SIoUGauze Length Set Between YELLOW 0 16 4 6 0 ft. and ft. BLUE 16 32 gE BLUE BROWN BROWN HARD 32 61 61 72 72 98 98 105 Static Water Level 75 fl from Land surface Date Measured 10t25/1970 PUMPING LEVEL (below land surface) 0 ft. after hrs. pumping 30 g.p.m. Tro NO REMARKS Well Head Completion Pitleas adapter manufacturer Model []Casing Protection [] 12 in. above grade yan mtvo gs) [] At-grade (Environmental Wells and Borings ONLY) ET Grouting Information WelIGrouted? [] Yes [] No ce Wr Located Minnesota Geological Survey Unique Number Verilication N/A System UTM-Nad83, Zone15, Meters Vos etn. | HIG GrTk) Method Digitized scale 1:24,000 or larger (Digitizing Table) Date NIA X 461279 Y 4984647 Sion Nearesl Known Source of Contamination _feet _direction _type Well disinfected upon completion'? 3 va [] Yes BN [] No RT ey tr Pump [] Not Installed Date Inatalled Manufaclurer'sname STA-RITE Model number Length of drop Pipe 84 ft. Capacity,_gp.m -ype ba HP 1 8 Vol~s Material Abandoned Wells Does property have any nat in use and not sealed well(s)? [] Yes [] No rots fate 0 Bes sok First Bedrock ussre sno prot Last Slral Sand Aquifer Quat. BuriedArtes. Aquifer Depthto Bedrock ft County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification eoMork Well Co ormtamer License Business Name P02133 wom Lic Qr Reg. No. wewass Name of Driller 220044330011 PPrrintteed 9//1100//22O0O08 HE 01205 07 le. 07 ON FD 20506 Suri PohDk 20 Lg Reg 208200304300 Wf 1027 2008 165.84 AM) tile:///JlL..ndi%20D%20Muni%20FD%20Site%20Summaries/Plymou~l'dDunkirk%20Ln/Well%20Log%20Report%20-%2000204301 .htrn[10/27/2008 11:03:44 AM] 2233.0542 STATE02827354 2233.0542 STATE_02827354 Well Log Ror sn Wcll Log Rcport - 00204302 2w04z302 Minnesota Unique Well No. JF E E E County Quad Quad ID Hennepin Osseo 1200 Well Name GREG RED PATH 5 Zn owwo Comes -ownehip Range Dir Section Subsections Elevation 118 22 W 20 DBBCDD Elevation Method WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 mon Entry Date Update Da:e Received Date ones 0812411991 09/1111991 t[h Serene 1010 ft 7 5 minute topographic map (+/- 5 feet) Well Depih Depth Completed Date Well Completed eetrt en ne 138 ft 138 ft. 10/2411968 ~[!!I!9~g_M!P~ = :2............................................................................................................................................. Ee Drilling Fluid -Use Domestic I Wall Htdrofractured? [] Yes [] No ] From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 4 in. to 134 ft. Weight Ibs./ft. Hole Diameter Well Address 2920 COMSTOCK LA PLYMOUTH MN FewouT Geological Material ErCLAY AND SAND SAND vorColor ce Hardnesa yoFrom 0 126 Open Hole from it. to ft Screen YES | DiDaiammeteeterr 4 To 126 Make Type stainless steel SSloott/GGauuzee tom LLeenggthh 4 SSewt BBewtwneenn 134 ft. and 138 ft. 138 Stagc Water Level 85 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 85 ft after hrs. pumping 20 g.p.m. 10t24/1968 -- NO REMARKS Well Head Completion Pitleas adapter manufacturer Model []Casing Protection [] 12 in. above grade Brun tner rt ao [] At-grade (Environmental Wells and Borings ONLY) on rs sas Bre EI Grouting Information WelIGrouted? [] Yes [] No oct Me Gp Whos ttc 3 Oc Located Minnesota Geological Survey Method Digitized scale 1:24,000, or larger (Digitizing Table) Unique Number Verification N/A Date NIA System UTM-Nad83, Zone15, Meters X 461327 Y 4984476 rites ate ct pest ste First Bedrock is sos a Last Slral Sand Aquifer Quat. BuriedArtes. Aquifer Depthto Bedrock ft County Well Index Online Report County Well Index Online Report Nt sient Nearesl Known Source of Contaminalion _feet _direclion _lype Well disinfected upon completion'? 0 vB 50 [] Yes [] No ASE ST Pump [] Not Installed Date Installed Manufacturer's name Length of drop Pipe_ft. Model number Capacity_g.p.m TEER we HP 0 75 Vote Type Submersible Ma:erial Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification f wa Stodola Don Well Co 271 T2 sms rT License Business Name Lic Qr Reg. No. [] No Name of Driller 220044330022 PPrrintteed 9/10//220008 HE 01205 07 1. Ns 20204 rh Dr LW SLRen2?040300 1027 2008 1105.48 A tile:///JlL..ndi%20D%20Muni%20FD%20Site%20Summaries/Plymou~hJDunkirk%20Ln/Well%20Log%20Report%20-%2000204302.htm[ 10/27/2008 11:03:44 AM] STATE 02827355 STATE_02827355 22223333..00554433 WolLogReport 020830 Wcll Log Rcport - 00204303 is] Minnesota Unique Well 204303 No. EFEE County Quad Quad ID Hennepin Osseo 120C Well Name ROBERT RODERICK Ve 7 an on mies -ownship Range Dir Section Subsections Elevation 118 22 W 20 DBBDCD Elevation Method WEPLL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 pmoin Entry Data Update Da:e Received Date ones 08124/1991 09/1111991 J=mrmwomensiis] 1015 ft 7 5 minute topographic map (+/- 5 feet) ee = " Well Depih Depth Completed Date Well Completed 169 ft 169 ft. 04/1711969 ~[!!I!9~g_M!P~ = :2............................................................................................................................................. = Drilling Fluid -Use Domestic I Well Htdrofractured? [] Yes [] No ] From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 4 in. to 165 ft. Weight Ibs./ft. Hole Diameter Well Address 16520 29TH AV N PbO PLYMOUTH MN cies rn Geological Material CLAY SAND [ Color Hardness From To 0 162 162 169 Open Hole from it. to ft om Screen YES Diameter Seow Lon Make Type stainless steel SIoUGauze Length 4 4 Son Set Between L 0 ft. and ft. Stagc Water Level 103 ft. from Land surface Date Measured PUMPING LEVEL (below land surface) 103 ft. after hrs. pumping 20 g.p.m. 04/17t1969 To NO REMARKS Well Head Completion Pitlees adapter manufacturer Model []Casing Protection [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No Lote es tpt. tos gti. 340 Ot Located Minnesota Geological Survey Method Digitized scala 1:24,000 or larger(Digitizing Table) Unique Number Verilication N/A Date NIA System UTM- Ned83, Zone15, Meters X 461360 Y 4984504 rots fate 0 Bes sok First Bedrock ussre sno prot Last Slral Sand Aquifer Quat. BuriedArtes. Aquifer Depthto Bedrock ft County Well Index Online Report County Well Index Online Report Nts Nearesl Known Source of Contaminalion _feet _direction _type Well disinfected upon completion'? 0 ve [] Yes 0 [] No A er EE wa Pump [] Not Installed Date Installad Manufacturer's name Model number HP 0 75 Vote Length of drop Pipe 25 ft. Capacity_gp.m -ype Submersible Platerial Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification Sania wz Stodola Don Well Co 271 T2 [repre Soe License Business Name Lic Or Reg. No. [] No tema Name of Driller 220044330033 Pre SHO Printed 9/10/2OO8 HE 01205 07 le. 07 ON FD 20506 Suri PohDk 20 Lg Reg 2020304308 Wf 1027 2008 16545 AM) tile:///JlL..ndi%20D%20Muni%20FD%20Site%20Summaries/Plymou~hJDunkirk%20Ln/Well%20Log%20Report%20-%2000204303 .htrn[10/27/2008 11:03:45 AM] 2233.0544 STATE02827356 2233.0544 STATE_02827356 SSiittee NNaammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY PPllyymmoouuthth-- OOlldd RRoocckklfoorrdd RRooaadd P3Pl4lyy0mm0ooPuultthyhmFFoiiureelnDDBeeippvaa.rrttmmeenntt Plymouth, MN 3400 Plymouth Plymouth, MN 55447 Blvd. 55447 R7Ri6icc3kk.5KK0lli8inn.ee,5,1FF2i1irree Chief Chief 763-509-5121 TTrraaiinniinngg LLooccaatitioonn:: TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y):): TTyyppee ooff ffooaamm uusedsiinnttearianinidinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: KKaarrsstt AArreeaa:: Nearest water wall: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SSIITTEE RRAANNKKIINNGG:: FFiirree SSttaattioonn 22,, 1122000000 OOlldd RRoocckkffoorrdd RRooaadd,, 446655093322..5533,, 44998866334444.7766 AFFF: Ansul AFFF: Ansul SSeemmai-nannnuuaalllyy LLeessss tthhaann 55 ggaaollonnss. Storm sewer Storm sewer AAGFlFFaFFsF:s:Alleesslssosttshhaahnnan22005gg0aaglllaloolnnlssons Class A: less than 50 gallons LLeessss tthhaann 11/38mmikilee nnoortthh aanndd wweesstt LLeessss tthhaann 117/88 mmiillee nnoorrtthh SStitoeiiss llooccaatteedd inn aa ccoovveerreedd kkaarrsstt aarreeaa Less than 178 mie north Less than 1/8 mile north Trang sie i located in a WPA Training site is located in a WPA More than 1 mic More than 1 mile 1188 PPllyymmoouutthh 22223333..00554455 STATE02827357 STATE_02827357 [PlymoPulymtouhth OOllddRRoocckkffoorrdd WWhhaatt''ss IInn MMyy NNeeiigghhbboorrhhoooodd MMaapp ob a IB La i} Jk c gd d |} I oi rT Ee J. SITE-- f= rs Er ey Hy ; y[fic oEy --e HE Foray fa X ig =e engl) i |gily gd m ea/N gi A ath) { t Vd Mec Th ke sl ELiLg hi Si ho i Pe fl eo hl) \ =PSeumtatnoanosvSautsae Disclaimer: Map and site information is believed to be accurate but accuracy is not guaranteed. No portion Rmee| ipemasatunge of the info~rnation should be considered to be, or used as, a legal document. The information is provided Lr TSR SE er | wv subject to the express condition that the user knowingly waives any and all claims for damages against o rc[ oomnm-- son 1VIPCA th~l m~y arise from lhe use of this d~tz. Sites. @winnesota Pollution Control Agency : mp PFRiAmcsmoantCan +cin eorsomons 22223333..00554466 sare 2827358 STATE_02827358 *gir ls iwll i !4 |i hed Hhte [Igy: td; HHAEal 1 . niid To [09 0, `3 : sion san eon CE ot TOF, : gBFlo oteklE e|GS NE =Fl BLT f 7) 8 Ei ty cai = 3gly om iL TE ET No |B eit = 7 iH 3 | 8) gli ggli h Las oe | 3 HH ll 3) BLays bf3 |ijE srl ed e m1i 22223333..00554477 STATE_02827359 a : BE CE, Ss PPLLYYMMOOUUTTHH -- OOLLDD RROOCCKKFFOORRDD RROOAADD CCWWII W Weellll MMaapp a > ih id es S0 Ld Fi ks A Ro Ee SL aa 75 le Re ha i0che Suid Lg eeee AGEr LSIcRe OaR WO en ee BEE FL REA EE Sri is! eta Noe AST TE: oe Flamin CartonTSE blal aga FAL ns Sai i Clee Bae HR Er a ms 5 - 7 ETA vH ii A T i,T T aE E he aae Ta nd BA Ra Rion te 5 3 eelti NEMisAsion NFaYrms Sion | Bt 0 TJleyLen,a Mmmpepreisen pumseemmeen,corgrenn [11 SEI oe EECA 22223333..00554488 sare cans STATE_02827360 Wallog Report 3027 Well Log Report - 00204273 2w04i273 Minnesota Unique Well No. F JE E E County Quad Quad ID Hannepin Osseo 120C Well Name TOM FORSTER rm -ownship Range Dir 118 22 W Section 14 es Subsections ADBBBD vies Elevation Elevation Method Well Address 11510 ROCKFORD RD Eee PLYMOUTH MN Geological Material A Sou amaveL +cua CLAY, SOME BOULDER HARDPAN SAND, SOME GRAVEL CLAY BOULDERS GRAVEL, SOME CLAY CLAY, SOME GRAVEL RR. SAND CLAY, SOME GRAVEL ST. PETER SANDSTONE SHALEY SANDSTONE SANDSTONE onOolor WEBLLLANDABOMRING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} I}OI{I]~G ~O~ Minnesota Statu~es Chapter 1031 man Entry Date Update Da:e Received Dote 08124/1991 05/21f2002 Well Depth Depth Completed Date Well Completed SFme] 970 ft 7 5 minute topngraphic map (+/- 5 feat) 211 fl 211 ft. 07/2911959 Ee -- Drilling Fluid -Use Domestic I Well Htdrofractured? I From :t ~o Ft ~ Yes ~ No CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/Below ft. Geeing Diameter Weight Hole Diameter soon Hardness gon 3 From To TD 0 72 72 79 79 139 139 141 141 147 147 160 [i160 164 164 167 167 194 194 204 204 211 4 in. to 169 ft. Ibs./ft. Open Hole from169 fl. to 211 ft. omer Screen NO Make Diameter Souza Type Slot/Gauze Laogh Length Static Water Level 88 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 96 fl after hrs. pumping 20 g.p.m. 07t29/1959 Su Been Set Between -- NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade a Gr [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No ert eS. Stn HE CT Located Minnesota Geological Survey Method Digitized - scale 1:24,000 or large[ (Digitizing Table) Unique Number Verification N/A Date NtA System UTM- Nad83, Zone15, Meters X 466487 Y 4986613 Vor siren_@ v8 Nearest Known Source of Cor~amination _feet _direction _type Well disinfected upon completion'? [] Yes xe [] No frp ro ox PlyryMid Pump [] Not Inetalled Date Installed Manufacturer's name JACUZZI Model number 15S4 H HP 1.5 Volts 220 Length of drop Pipe 105 ft. Capacity_g.p.m Type Submersible Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No reams ino por First Bedrcck St Peter uss sr Si oa Last Strat St.Peter Aquifer St Peter Depth to Bedrock 167 ft. County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Wall Contractor Certification "Lamas Tri state Well Co. 2200m4422b7733ar License Business Name Pe27118 mere BENEKE R cle em Lic Or Reg. No. Name of Driller Printed 9/102008 Printed 9/10/2008 HE-01205-07 lM TY SmtPm OeReg 0epent 30S00357 am 1027008 10535 AM) STAT 02827361 STATE_02827361 22223333..00554499 log Rn 030274 Wcll Log Rcport - 00204274 Minnesota Unique Well No. 20044221744 GmCounty Quad zi.Quad ID en Hennepin Osseo =120C Well Name JEROME BEGIN 1s-ownship 118 Bw Range Dir 22 W Section 14 vn Subsections BCCCCA een Elevation Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~7~z~LL ~I~]~[} ]~ORII~G RECORD ~O~ Minnesota Statules Chapter 1031 mon Entry Date Update Da:e fbi Received Date onew 08124/1991 05/21~2002 Sr 910 ft 7 5 minute topngraphic map (+/- 5 feet) Well Depih Depth Completed Date Well Completed me160 fl 160 ft. 11/0611959 ~~]I~9~g_M~P~ =:2............................................................................................................................................. ee Drilling Fluid -Use Domestic I Wall Htdrofractured? ~ Yes ~ No I From :t to Ft CasingType Joint Nolnfo~ation DriveShoe? ~Yes ~No Above/Below ft. Casing Diameter Weight Hole Diameter 5 in. to 143 ft. Ibs./ft. Well Address 12710 ROCKFORD RD PLYMOUTH MN acetos ioens Geological Material GLACIAL DRIFT Hin PLATTVILLE LIMESTONE ST. PETER SANDSTONE cn ma Color Hardness gon 7 From To 0 169 B2 109 145 145 160 Open Hole from 143 fl. to 160 ft. Cur Screen NO Make Diameter Saas Type SlotlGauze lah Length Static Water Level 67 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 78 ft after hrs. pumping 15 g.p.m. 11t06/1959 SuBaen Set Between i -- REMARKS HARDNESS 21 GRAINS FE 1 7 PPM os erst. Located Minnesota Geological Survey Stn 4 Method Digitized scale 1:24,000 or larger(Digitizing Table) Unique Number Verilication N/A Date NIA System UT'vl- Nad83, Zone15, Meters X 465302 Y }4986297 te ren om ere turns First Bedrcck Prairie Du Chien Group ee renee Snamrer Last Strat Prairie Du Chien Group Aquifer Prairie Du Chien Group Depth ~o Bedrock 109 ft. County Wall Index Onin Report County Well Index Online Report Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade a Gr [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Na tant Nearest Known Source of Cortamination _feet _direction _type Well disinfected upon completion'? 181 [] Yes [] No frrpo ooPy Pump [] Not Installed Date Installad Manufacturer's name JACUZZI Model number 1L4 HP 1 Volts 22._.~0 Length of drop Pipe 120 ft. Capacity_g.p.m Type Submersible Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification wy Pn Tri state Well Co. 27118 ty cf erm License Business Name Lic Or Reg. No. [] No Name of Driller 220044227744 PPrriinntteedd S9/1O00/200088 HE-01205-07 el. E050 smh ON ck ORI0La prt 30 20K 10273008110536AM state 02827362 22223333..00555500 STATE_02827362 Well Lg Ror 2813 Wcll Log Rcport - 00426803 an] Minnesota Unique Well 426803 No. EFEE County Quad Quad ID Hannepin Osseo 120C Well Name PLYMOUTH (P-3) -ownehip Range Dir Section Subsections Elevation 118 22 W 14 AACBCB Elevation Method WEBLLL IATNDRBOONRNING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 966 ft 7 5 minute topographic map (+/- 5 feat) Well Depih 328 ft Depth Completed 328 ft. mn Entry Date Update Da:e Received Date 03106f1993 03/11/2005 Date Well Completed 08/1211986 Well Address 11510 9 CR ( ha o--w-- PLYMOUTH MN 55447 Geological Material CLAY (FILL) CLAY CLAY SILTY SANDY CLAY SANDY CLAY & GRAVEL SANDY CLAY & GRAVEL Es GRAVEL GRAVEL, CLAY, SAND SILTY SANDY GRAVEL SHALEY SANDSTONE SANDSTONE (ST PETER) LIMESTONE (SHAKOPEE) SANDSTONE (JORDAN) cBoomr Color BROWN BLACK BLUE RED RED RED VARIED RED RED GRN/GRY GRAY BRN/ORN WHITE B Mares T Eom To Hardness SOFT From To 0 3 SOFT 3 5 MEDIUM 5 35 MEDIUM 35 45 MEDIUM 45 55 SOFT 55 60 oo = SOFT 60 68 MEDIUM 66 75 MEDIUM 75 149 HARD 149 155 HARD 155 165 HARD 165 322 V.SOFT 322 328 eTREMARKS MG.S. N0.2542. ct Ment Located Minnesota Geological Survey Unique Number Verification Information from owner System UTM-Nad83, Zone15, Meters Ms Opt. Method Digitization (Screen) Date 07/19/2004 X: 466462 Y: 4986811 1400 Map (1:24,000) PrDrilling Fluid -Use Test well ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or Iowcarbon) Joint Welded Drive Shoe? No Above/Below 2 ft [] Yes [] Casing Diameter Weight Hole Diameter 4 in. to _155 ft. Open Hole from 155 ft. to 10.79 328 ft. Screen NO Make Type Iba./ft. 8 in. to Ane 4 in. to 155 ft. mn 328 ft. Diameter Slot/Gauze Length Set Between Static Water Level 91 fl from I end sarfane Date Meas~Jred PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. (~6106/1986 oso ons Well Head Completion Pitless adapter manufacturer otModal []Casing Pretecfien [] 12 in. above grade Com re ear Gre []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No Got om Grout Material: Neat Cement ROTO from 0 to 155 ft. 1s en 1.5 yrds. Rt stemgpt Nearest Known Source of Contamination _feet __direction __type Well disinfected upon completion? BV [] Yes Ne [] No _ Cuttings Yes First Redr~k St P~ter Nog SST Last Strat Jordan Aquifer Prairie D u Chien-Jordan Depth to Bedrock 149 ft. County Wal index Onis Report County Well Index Online Report Pump [] Not Installed Date Installed Manufacturer's name Model number__ Length of drop Pipe_ft. Capacfly_g.p.m HP_ Type Volts Material AbandonedWells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Beraerson Caswell 42P22r65m88r00r33 License Business Name 27058 Sa oe Lic Or Reg. No. Name of Driller Fired 02008 Printed 9/10/2OO8 HE-01205-07 lMTY01S Pm Oie Reg 0ep3eSn00t380 22223333..00555511 1027008 10535 AM) STATE 02627363 STATE_02827363 WallogReport Well Log Report - 00462963 dome] Minnesota Unique Well 462963 No. EFEE County Quad Quad ID Hennepin Osseo 120C Well Name PLYMOUTH MW MARION PARK -ownehip Range Dir Section Subsections Elevation 118 22 W 14 DAADDC Elevation Method WEBLLLIATNDRBOONRNING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING I~COP~ Minnesota Statules Chapter 1031 932 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 320 ft Depth Completed 320 ft. mn Entry Data Update Da:e Received Date 0310611993 05/06/2005 Date Well Completed 01/1811991 gates Well Address 3950 ZACHARY LA N PLYMOUTH MN 55447 Geological Material TOP SOIL Ero SAN DY CLAY CLAY GRAVEL CLAY GRAVEL CLAY GRAVEL CLAY - GRAVEL & ROCKS 8AND & GRAVEL ST. PETER SANDSTONE GHAKOPEE DOLOMITE ST PETER SANDSTONE DOLOMITE DOLOMITE Ro, DOLOMITE DOLOMITE SANDSTONE Color Hardness BLACK & GRAY BROWN SOFT ll SOFT DARK SOFT BROWN GRAY SOFT RED BROWN SOFT RED So BROWN BROWN WHITE 8OFT TAN HARD TAN TANfYEL TAN Jig TAN/YEL TANIWHT WHTIPNK From To 0 2 2 15 15 25 25 45 45 50 50 78 78 98 98 105 105 115 115 135 135 160 160 177 177 187 187 230 230 247 247 256 BO 256 278 295 278 295 320 REMARKS MG.$. NO. 3190. WELL SEALED 04 19 1993 BY 27010 ORIGINAL USE MW MONITORWELL -- oS ts versity E ns Dt av) 456 Located Minnesota Geological Survey Unique Number Verification Information from owner System UTM - Ned83, Zone15, Meters Method Digitization (Screen) - Map (1:24,0(10) Date 0711912004 X: 466808 Y: 4986080 Frm Drilling Fluid Bentonite Use Abandoned I Well Htdrofractured? I From :t to Ft Statue Sealed [] Yes [] No Casing Type Steel(black or lawcarbon) Joint W'elded Drive Shoe? No Above/Below 2 ft [] Yes [] Casing Diameter Weight Hole Diameter 4 in. to 187 ft. 10.79 Ibs./ft. 4 in. to 320 ft. Open Hole from 18T [1. to 320 ft. Screen NO Make Type Diameter Slot/Gauze Length Set Between Static Water Level 79 fl from I and surface Date Meas~Jred (~1117/1991 PUMPING LEVEL (below land surface) 100 ft. after 3 hrs. pumping 40 g.p.m. ee Well Head Completion Pitless adapter manufacturer Modal Done Bee reson []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No Grout Material: Neat Cement _ from 0 to 187 ft. et thicone Bi be No Nearest Known Source of Contamination 90__.~lbct __direction Semic tanlddrain field type Well disinfected upon completion? [] Yes [] No 40 bags Pump [] Not Installed Date Installed Manufaclurer'sname Model number__ HP_ Volta Length of drop Pipe_ft. Capacity_g.p.m Type Material AbandonedWells Does property have any not in use and not sealed well(s)1 [] Yes [] No First Redr~k St P~ter ogy fatty Last Strat Jordan Aquifer Prairie D u Chien-Jordan Depth to Bedrock 160 ft. County Wal nde Onlin Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Penner EH. Well 44o6522r9966o33 License Business Name 71015 Sh. Sem Lic Or Reg. No. PRAUGHT V. Name of Driller Pred 97192008 Printed 9/10/2OO8 HE-01205-07 lMTYSmt Pm Oie Reg 22223333..00555522 een 3000565 1027008 1057 AM) sTaTe 02827364 STATE_02827364 Wcll Log Rcport - 00749386 7H49s386 Minnesota Unique Well No. GEm,County Quad Quad ID en Hannepin Osseo 120C WELLeAND eBORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 mponn Entry Data Update Da:e Received Date ooommm05122/2007 02/1512008 07t05/2007 Well Name PLYMOUTH TW-16 Well Depih Depth Completed Date Well Completed -ownship Range Dir Section Subsections Elevation 118 22 W 14 BDDBCA Elevation Method 933 ft 7 5 minute topographic map (+/- 5 feet) 408 ft 408 ft. 04/2712007 Well Address Eee 12000 OLD ROCKFORD RD PLYMOUTH MN 55441 ssi, Geological Material Ea ROCKY SANDY CLAY SAN D BrColor BROWN BROWN a Drilling Fluid Bentonite Use Test well ~ Well Htdrofractured? [] 'Yes [] No J From :t to Ft werer nt Tw T ON Hardness SOFT 8 eter SOFT From To 0 38 38 42 Casing Type Steel(black or Iowcarbon) Joint Threaded No Above/Below ft Drive Shoe? [] Yes [] Casing Diameter Weight Hole Diameter 4 in. to 152 ft. 1079 Ibs./ft. 8.75 in. to 150 ft. 4 in. to 408 ft. Open Hole from 153 fh to 408 ft. CLAY ROCK Brame - SAN D TOOK WATER CLAY ROCKS SAND GRAVEL BROWN Cum BROWN BROWN BROWN SOFT 42 coum SOFT MEDIUM 2753 97 SOFT 98 53 Screen NO Make 599678,| otameter Diameter 116 Type `Slouauze. Slot/Gauze Length Length SetBetween Set Between CLAY GRAVEL ime SANDSTONE SANDSTONE SANDSTONE SANDSTONE SHALE SHALE SHALE SHALE GRY GRY WHT WHT ORG ORG SANDSTONE TAN GRN ORG SANDSTONE SANDSTONE SANDSTONE BROWN GRYNVHT GRYNVHT VARIED VARIED VARIED BRN/TAN WHITE WHITE MEDIUM 116 123 LEE HARD HARD HARD HARD 123 125 148 150 125 148 150 154 HARD 154 213 HARD 213 292 SOFT 292 308 SOFT 308 398 Static Water Level 6) fl fram Top afcasing exle.nsion Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. 0417712807 SANDSTONE SHALE BRN TAN GRY HARD oso ons 398 408 Well Head Completion Pitless adapter manufacturer otModel ree REMARKS GAMMA LOGGED 5 16 2007. M.GS. NO. 4606. LOGGED BY JIM TRAEN. oem wis Be []Casing Protecfien [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No [---- Located Minnesota Geological Survey os coor Wo 1000 Method Digitization (gcreen) Map(l:24,000) FRIRRE Pore Unique Nu'~ber Verification Info/GPS from data aource System UTM - Mad83, Zone15, Meters Date 05/22/2007 X: 465886 Y: 4986405 rs nencat Grout Material: Neat Cement Grout Material: Neat Cement om B BR from 20 to 153 ft. from to 20 ft. Th SLTpetg Nearest Known Source of Contamination 50__.~lbct South East direction Scntic tanlc/drain ficld ~pc Well disinfected upon completion? [] Yes [] No 1a45 bags 10 bags ee Cuttings Yes ee Borehole Geophysics Yes First Redr~k St Peter Aquifer Prairie Du Chien-Jordan County Well Last Slrat St.Lawrence County Well IInnddeexx OOrniliinnee Report Depth to Bedrock Report 125 ft. Pump [] Not Installed Date Installed Manufacturer's name Model number__ HP_ Volts Length of drop Pipe_ft. Capacity_g.p.m Type Material AbandonedWells Does property have any not in use and not sealed well(s)'~ [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification EH Penner and Sons Inc. 143~1 PRAUGHT L. 749386 License Business 749386 Name Printed S192008 Lic. Or Rag No. Name of Driller Printed 9/ 0/20 HE-01205-07 22223333..00555533 stave ozs273s STATE_02827365 * RRaannddaallll 22223333..00555544 STATE02827366 STATE_02827366 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY Randal Randall R1Ra0an5nddaMalallpl lFFieirrweeoDDoedeppaDarirttvmmeeenntt Randall, MN 58475 105 Maplewood Drive Randall, MN 56475 Pa3P2at0t-BB3o6oo0n-e5o,2F4Fin0ireeCeChih,eieff Patick boone @us amy. 320-360-5240 Patrick.j.boone@us.army. mmiil TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: Nearest wetland: Nearest wetland: Karst Area: Karst Area: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: LLoott aaccrroossss ffrroomm tthhee fefire ssttaattiioonn 383015.77, 5105488.16 383015.77, 5105488.16 CCllaassss AA/BB PPyyrrooccoomm sliticckkss. AAnnnnuuaallllyy LLeessss tthhaann 55 ggaatlloonnss. Ground Ground CGalnlaaass2ss AsAt/BiBckPPsyyCrrlooaccsoosmmA)ssiticckkss:: lleessss hthaann 55 ggaalllloonnss ((11 Class and 2 Class A Ansuil Siv-ex: sticks Class A) A Ansul Silv-ex: 3300 ggaalllloonnss MMoorree tthhaann 11 mmiilee `AApppprrooxxiimmaatteellyy 111/44 mmiiloe wwoesstt aanndd ssoouulthhwweesstt Sieis nt located ian karst area. Site is not located in a karst area. Less than 1/8 mile northeast Less than 1/4 mile northeast More than 1 mic. More than 1 mile LLeessss tthhaann 11/84 mmiillee 12 12 ssttiicckk CCllassss BB 22223333..00555555 STATE02827367 STATE_02827367 RRAANNDDAALLLL CCWWII W Weellll MMaapp JET ee ON \ \ oo | ON N Po ee ONG TE dRe eninfi! = Xo) od \ Ng, \ f |: T DARLLIPNeGLg,A2DA i FNa,n, - Dip FTE NE ---- HE EN I brat] Sn an, Le i AOE [en Ne Wi. Lies Xi , : =~ 7 J 14 wd wl ft 224470 De fra! Ny NOeYl a EFNN J Fon iAryie L Tis AT vw Fy bl Af am RAt R. E| ) iNTE Se al i WE Rendall RR 0 Ng A mim Sal cod | ; C \ 2 Sita $0 if Ep ING MoretonSven Coron -- fr peta 22223333..00555566 stare ozs27368 STATE_02827368 Tn ii 5 iHi 5 pl, 5 HBEaEth ELo ngd 3 Ww ial lilfillaribdiini &. 46-6-20 N 46-5-0 N 46-5-40 N 46-5-20 N 4~-5-0 N oY| = PLE .... ~ ..... Teva] .~ 7%. ~.. ] L 4 ANkWw ii |i 35 Eg, i~ I~ & y4Z|| q8i: 5 12 Pygl ct ..... )| }x 4 I Gi 1 EH2 lE 7a S |,m9 T"U~ a a. s La0g,kis :L;; ~ .................................................................................................. ................ ........... rnb Ob uN il N 0Z-9-9t N 0-9-9t N 0t-9-9t N 0Z-9-9t N 0-9-9~ srsnoser 2233.0557 J STATE_02827369 [Pr------------ | Randall What's In My Neighborhood Map | 5 2 T | : ( | : : | Xo [ |1 Si | No jy | | NL --- | SETTING A : | FAL ial || Eh | } mR | i Vefr hlTET Ee WHE by : a hhh | Sites. |i *F-- mdsows. Disclaimer: Map and site in f~)~naLion is believed to be a~:curate but ac~:uracy is nl)L guaranteed. N~ porfi~n | BREIE| unsemanaunge oI the i~'ormation should be considered to be~ or used as, a legal document. The information is provided aySo em i oe | m WAP subject to the express condition that the user knowingly wai~,es any and all claims for damages against ||||| @Minnesota Pollution Control Agency 42RRtfVcFoSoniuueRRadss"AotAfCsEraTaM ooSrmiSopoagsDmpsrseFsaooraoLnmitcs aueiinrmaedats6onn Hana MPCAthat may arise from the use ofthis data. 22223333..00555588 STATE 02827370 STATE_02827370 log hn Well Log Report - 00224470 22244447700 | ozim. Minnesota Unique Well No. County Quad Quad ID izMorrison Randall West 195D WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} I}ORI]~G 1~1~ C O~]~ Minnesota Statules Chapter 1031 m=nn. Entry Date Update Da:e Received Date 04113/1988 05/24/2004 Well Name SCHMIDT, EUGENE -ownehip 130 uw Range Dir 31 W Section 1 osSubsections DCCAB een Elevation Elevation Method Well Depih Depth Completed Date Well Completed Lrlemme 1181 ft 7 5 minute topographic map (+/- 5 feet) 46 ft 46 ft. 00100/1948 Drilling Fluid -- ree Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? [] Yes [] [fr eea e m eeae E | No Above/Below ft Casing Diameter Weight Hole Diameter 6 in. to 42 ft. Ibs./ft. Well Address RANDALL MN 56475 Geological Material CLAY SAND or Color Hardness From To IE 0 41 41 46 rrREMARKS WELL FLOWS. J aa Located Minnesota Geological Survey Method Digitized - scale 1:24000 or larger(Digitizing Table) Unique Number Veritica[ion Nsmeon "mailboz System UTM - Ned83, -Zone15, Meters wsvo Date X: 382222 Y: 5105690 reas fae 0s Brn ste First Bedrock Emam Last Slral Sand Aquifer Quat. BuriedArtes. Aquiler Depthto Bedrock ft. County Well Index Online Report County Well Index Online Report Open Hole from it. to ft Screen YES Make Type Diameter 6 SlotlGauze Length 4 Set Between 42 ft. and 46 Static Water Level -1 ft. from Land surface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping 1.5 g.pm. 00!00/1948 Well Head Completion C Brrenan seangtoun Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No i Nearesl Known Source of Conlaminalion __fcet _direction _type Well disinfected upon completion? Be [] Yes Be[] No Pump [] Not Installed Date Installed Manufaclurer'sname Length 01drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification -- United States Geoloeical Survey 2222p444477T00 License Business Name we come USGS LE, Lic. Or Reg. No. OOTHOUDT E. Name of Driller Printed 911512008 Printed 9/15/2008 HE 01205 07 hl. Ape 0 S051 Sms Ea Wel 0 ORs 30 C2450 22223333..00585599 27208 1065 AN) sate 02827371 STATE_02827371 log hn 023047 Wcll Log Rcport - 00224477 Minnesota Unique Well No. 22244447777 zoim.County Quad Quad ID uzMorrison Randall West 195D WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota S~atutes Chapter 1031 =mnn. Entry Date Update Da:e Received Date yo 04113/1988 06/2Y/2006 Well Name RANDALL TEST WELL -ownehip 130 Range 30 Dir W Section 6 i Subsections Elevation CCACCD Elevation Method A 1 1175 ft 7 5 minute topographic map (+/- 5 feet) Well Depih Depth Completed Date Well Completed -------- 114 ft 111 ft. ~[!!I!9~g_M!P~ = :2............................................................................................................................................. Well Address apes RANDALL MN 56475 Geological Material CLAY QU IC KSAN D FINE SAND FINE SAND i FINE SAND GRAVEL GRAVEL CLAY SAN D IRON ORE --Color -- Hardness BLUE Drilling Fluid -- ---------- Use Test well I Well Htdrofractured? [] Yes [] No ] From :t to Ft Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? [] Yes [] [fr eea e m eeae E | No Above/Below ft Casing Diameter Weight Hole Diameter in. to 96 ft. Iba./ft. From O 18 40 45 50 55 60 72 94 113 To 18 40 45 50 i55 60 72 94 11 3 114 Open Hole from it. to ft Screen YES Make Type Diameter Slot/Gauze Length 15 Set Between 96 ft. and 111 Static Water Level ft. from Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. REMARKS FIRSTWELL BEAME TOO HIGH IN MN & FE. ct eet Located Minnesota Geological Survey Unique Number Merification Information from owner I System UTM-Nad83, Zone15, Meters ns te Go e308 Method Digitization (Screen) - Map (1:24,000) Date 06/27/2008 X: 383133 Y: 5105728 rts rtm cu are sa First Bedrock Precambrian Crystalline Roc eo fo Sn Last Slral Precambrian Crystalline Roc Aquifer Quab BuriedArles. Aquifer Depth to Bedrock 113 ft. County Well Index Online Report County Well Index Online Report Well Head Completion Brenan seangtoun Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No TT Nearesl Known Source of Conlaminalion __feet __d~rcction __type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufacturer's name Length 01drop Pipe_ft. Model number__ Capacity_g.p.m HP_ Type Volta Material Abandoned Wells Does property have any not in use and not sealed well(s)'~ [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification ji United States GeoloGical Survey 2202e 44447777s License Business Name ws ese USGS LE, Lic. Or Reg. No. OOTHOUDT E. Name of Driller Printed 911512008 Printed 9/15/2008 HE 01205 07 hl. Ape 0 S051 Sms Ea Wel 0g ORs 30 C247 223.0560 2233.0560 272081065 AN) state 02827372 STATE_02827372  RRiicchhffiieelldd 22223333..00556611 STSATATTEE0_208228277337733 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY Richfield Richfield 6RRi7icc0hh0ffiieePlloddrtFFiiiarrenedDDAeevppeaarrttmmeenntt Richfield, MN 55423 6700 Portland Ave, Richfield, MN 55423 6BB1rr2aa.dd2SS0v3vee.uu4mm5,0,2FFiirree Chief Chief 612-243-4502 TTrraaiinniinngg LLooccaatitioonn:: Richfieid ie arena, 636 E. 66" Street Richfield ice arena, 636 E. 66th Street TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XX,,YY):): 447789008889..1133,, 44967700114433.55 TTyyppee ooff ffooaamm uusedsiinnttearianinidinngg:: AATFrFaFFiFnF:i:n3gMF-obborrraa:nnddNahhtiiisstotoonrariilccaatllrllyayinuuissneegddfoo Training Foam: National training foam FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AApppprrooxxiimmaatteellyy bbri-aannnnuuaalllyy FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: 33001to0 4400 ggaalllloonnss ttoo ccoovveer aalll ddeeppaarrttmmeenntt sshhiiltlss S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground. sion sewer Ground, storm sewer AAnnnnuuaall ffooaamm uussee:: ClAAaFFsFFsF:A: :UUn5ncc0eergrtataaliilnnons Class A: 50 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: LLeeggiioonn LLaakkee lleessss tthhaann 111/88 mmiilee eeaasstt NNeeaarreesstt wweettllaanndd:: LLeessss tthhaann 117/88 mmiilee eeaasstt KKaarrsstt AArreeaa:: SSitteesis llooccaatteedd nin aa ccoovveerreedd kkaarrsstt aarreeaa NNeeaarreessttwwaatteerrwwelelll:: LLeessss tthhaann 11//48 mmiille ttoo tthhee wweesstt Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: TTrraaiinniinngg sisite llooccaatteedd wwiitthhiinn aa W WPPAA NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilce SITE RANKING: 2 SITE RANKING: 3O 22223333..00556622 STATE02827374 STATE_02827374 RRIICCHHFFIIEELLDD CCWWII WWelelll MMaapp hE Ci eas ameanmees ashiEaRS gE5E E "Ae % fs =] Sept mh OProtertibn:SE CEoliaitasts C 10s aE aodb Ts ZR sil AN Fenner ZN BS ONEc ERRAt eNe SE ielitt A i de Se wr ea ii Ty etal Ril Bra Eh iD Pet: ; 2 Sn a Ce el In orSE er Tad0 lem ay AEe AR ape mites HAIN (W <=SL TREET feo HL ann a ITN CoRR EEER ES ge RICHFIELD!NNESOTA, UNITED STATES Nebol DotA gs Th ising msDnDa imdet ms a inCr: eo FAERIE 3 oe BOHA I1 pn 22223333..00556633 stare ozs2737s STATE_02827375 Lt det 3 gBye |, | TE1 # iwtil ii i: Ww PSoiaiiiintneeig iii] A IT Ea " :3 NE oo 3 BL. sg eBr eE ee FL. w 2] F 5es Omm e itH {|B 2[1 AVBNE a wide LACx aE i JF 2 vdeo el 3Ai; a3 ia 3 Tt Eso 5 |] E3| BD A/ J B| [otal7) 3 Fal A 3 - sath rim" @& 38Bh aTfR Is NNy E: or1:10 |iB % Crear B EY " me| .2m fr |} Hi Jz 13 iin ] 3i & B-.. a+ 2 |iif re rfT ]i 22223333..00556644 stare_oomarans STATE_02827376 [RichfieldWhat'sIn MyNeighborhoMoadp | | ITT LTT | = jhi=dl i [ind| n7g =A i << [EEI nr TT \ 5 1S ii reregr pHi i| P{aFbiraaaiiti Jormne f|eeeee ] | SITE 1B aI | :I aapibi grate so dite hig | |1 ject Fis fh bia dhe do ie H Ifi ait i setaei Apeunda pug an i& | j|||em pa SEE Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion | FREI SIS S N | of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided |I EER | subject to the express condition that the user knowingly waives any and all claims for clamages against || ]VIPCA tha! may arise from lhe use of this data. | @innesota polution Control Agency | HEL i Sis =pBemoantaissctortSauwpsoarmiauns eepoyrmiowaDumps. tcaecluampan L ft m Tr En RsRuAowoeresvteonnn Chan 22223333..00556655 sate 02827977 STATE_02827377 WolLogReport 0206274 Wcll Log Rcport - 00206274 woz] Minnesota Unique Well 206274 No. Eft Caunty Quad Hennepin Minneapolis South Quad ID 104A WEPLL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota S~atutes Chapter 1031 A pi Entry Date Update Da:e Received Date 08124/1991 09/11/1991 Well NameOKERMAN AND -ownship Range Dir Section ows HUNTSTEAD Subsections Elevation 28 24 W 26 BBCCCC Elevation Method 845 ft emer] 7 5 minute topographic map (+/- 5 =feet) Well Depih Depth Completed Date Well Completed 8 " ro 49 fl 49 ft. 11/3011960 ee ~[!!I!9~g_M!P~ = :2............................................................................................................................................. = Drilling Fluid -Use Cornmercial I Well Htdrofractured? [] 'Yes [] No I From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 2 in. to 46 &. Weight Ibs./ft. Hole Diameter Well Address 6339 PORTLAND AV S asso es RICHFIELD MN Geological Material SAND HARDPACKED SAND SAND AND GRAVEL cor wns Color Hardness pomFrom 0 10 18 Open Hole from it. 10 | Cum Screen YES Make Diameter To 1.3 10 18 49 Stagc Water Level to fl Siv tus JOHNSON Type SIoUGauze 8 30 fl from Land aurface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. Lg Length 4 11t30/1960 SetOBRenE. Set Between 0 ft. and ft. To NO REMARKS Wall Head Completion Pitlees adapter manufacturer Model []Casing Protection [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No Lote es tpt. tos gti. 340 Ot Located Minnesota Geological Survey Method Digitized scale 1:24,000 or larger (Digitizing Table) Unique Number Verification N/A Date NIA System UTM- Ned83, Zone15, Meters X 478873 Y 4970493 rots sate ct tna First Bedrock ussre sno rt Last Slral Sand Aquifer Quat. Water Table Aqui:er D~plhte Redrnck fl County Well Index Online Report County Well Index Online Report Nts Nearesl Known Source of Contaminalion _feet _direclion _lype Well disinfected upon completion'? 0 ve [] Yes 0 [] No ASR Se Pump [] Not Installed Date Installed Manufaciurer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m Bh Bh HP 0 Type Volts Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Wall Contractor Certification pe wz Aamot Well Co 27062 orm bam tors Some License Business Name Lic Or Reg. No. [] No tema Name of Driller 220066227744 PPrriinntteedd 99//1100//22000088 HE 01205 07 e.g Ag 200 MDP202K ric Re NP Lg Reg 20200306274 Wf 10272008 10834 AM) tile://iJlL..up%20Rpt/Appendix%20D%20Muni%20FD%20Site%20Smnmaries/Riehfield/Well%20Log%20Report%20-%2000206274.htm[ 10/27/2008 l 1:08:24 AM] 2233.0566 STATE02827378 2233.0566 STATE_02827378 Wcll Log Rcport - 00206278 20066227878]S,r Minnesota Unique Well No. County Quad Quad ID fe. Hannepin Minneapolis South 104A WEMLLaAcNoD BORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 fBr h Entry Data Update Da:e Received Date AE 0812411991 09/1111991 Well Name LEGION POST 435 nn we ee -ownship Range Dir Section Subsections Elevation 26 24 W 26 BCCBBA Elevation Method Well Depih Depth Completed Date Well Completed presenti 848 ft 7 5 minute topographic map (+/- 5 feet) 168 ft 168 ft. 06/1611971 ~[!!I!9~g_M!P~ = :2............................................................................................................................................. Em, Drilling Fluid -Use Cornmercial I Well Htdrofractured? [] Yes [] No ] From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 4 in. to 108 ft. Weight Ibs./ft. Hole Diameter Well Address 6501 PORTLAND AV S RICHFIELD MN vm, Geological Material SAND, CLAY, ROCK SAN D, GRAVEL CLAY, GRAVEL LIMEROCK aColor - Hardness mFrom To or Open Hole from Screen Make Diameter it. to Type ww ft Slot/Gauze Length 0 72 72 89 89 104 104 168 Static Water Level 74 ft from Land surface Date Measured 06t16/1971 PUMPING LEVEL (below land surface) 0 ft. after hrs. pumping 50 g.p.m. too Set Between ms NO REMARKS Well Head Completion Pitless adapter manufacturer Model EET []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No anLocated Minnesota Geological Survey ATA Method Digitized - scale 1:24,000 or large[ (Digitizing Table) Unique Number Verilication N/A Date NtA System UTM-Nad83, Zone15, Meters X 478910 Y 4970239 i Nearest Known Source of Cor~amination _feet _direction _type Well disinfected upon completion? oun[] Yes [] No Er Pump [] Not Installed Date Inatallad Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Fonts umes Joke pase First Bedrcck Platte,~ille os Bi Last Slrat Platteville Aquifer Platteville Depth ~o Bedrock 104 ft. `County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification te Aamot Well Co. 22e 00662277n 88 License Business Name 2227062 Hn sie Lic Or Reg. No. Name of Driller Printed 97102008 Printed 9/10/2OO8 HE-01205-07 stare 02827379 tile:///Jl,'...up%20Rpt/Appendix%20D%20Muni%20FD%20 Site%20S mnma ries/Riehfield/Well%20Log%20Report%20-%2000206278.htm[ 10/27/2008 11:08:25 AM] STATE_02827379 22223333..00556677 Wcll Log Rcport - 0020628 l 200662881 1]S,r Minnesota Unique Well No. County Quad Quad ID fe. Hennepin Minneapolis South 104A WEMLLaAcNoD BORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 Ene., Entry Date Update Da:e Received Date Gm 0812411991 06/03/2004 Well Name SKELLY OIL CO nn cw ee -ownship Range Dir Section Subsections Elevation 28 24 W 26 CAAAAA Elevation Method Well Depih Depth Completed Date Well Completed preempt 840 ft 7 5 minute topographic map (+/- 5 243 ft 243 ft. 10/2011960 feet) ~=~'!!~!~ ~!~ =::.............................................................................................................................................. Em, Drilling Fluid -Use Cornmercial I Wall Htdrofractured? [] Yes [] No I From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Well Address 0 ines RICHFIELD MN Geological Material SAN D GRAVEL CLAY, STONES GRAVEL SANDY CLAY SANDY SHALE STICKY CLAY, STONES CLAY SAND + ROCK HEAVY GRAVEL HARD SANE) SHAKOPEE go,0 Color BROWN GRAY BROWN GRAY BROWN LIGHT GRAY BLUE LIGHT LIGHT GRAY mem Hardness HARD opep From To 0 60 60 70 70 90 90 91 91 128 128 150 150 165 165 190 10 200 200 210 216 212 212 243 Casing Diameter 5 in. to 205 ft. EEE Open Hole from it. to ft Screen Make Type Weight Ibs./ft. Hole Diameter Diameter Slot/Gauze Length Set Between Static Water Level 73 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 77 ft after hrs. pumping 30 g.p.m. 10t20/1960 ms NO REMARKS Well Head Completion Pitless adapter manufacturer Model EET []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No fe Located Minnesota Geological Survey nom Method Digitized - scale 1:24,000 or large[ (Digitizing Table) Unique Number Verification N/A Date NtA System UTM-Nad83, Zone15, Meters X 479616 Y 4970032 rts ram mn mm First Bedrcck Prairie Du Chien Group Hp oe. Last Strat Prairie Du Chien Group Aquifer Multiple Depfhto Bedroc4 212 ft. `County Well Index Online Report County Well Index Online Report i Nearest Known Source of Cor~amination _feet _direction _type Well disinfected upon completion'? oun[] Yes [] No CnTaresaEE Pump [] Not Installed Date Installed Manufacturer'sname FAIRBANKS-MORSE Length of drop Pipe_ft. Capacilyl_.~_g p.m trope Model number HP 1 Volts -ype Submersible Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification tes " Rennet E.H & Sons 27015 Kor vin Ze ww License Business Name Lic Or Reg. No. [] No Name of Driller 220066228811 PPrriinntteedd 997/1100/22000088 HE-01205-07 stare 02827380 tile:///Jl,'...up%20Rpt/Appendix%20D%20Muni%20FD%20 Site%20S mnma ries/Riehfield/Well%20Log%20Report%20-%2000206281 .htrn[10/27/2008 11:08:25 AM] STATE_02827380 22223333..00556688 WollogRepo 20252 Wcll Log Rcport - 00206282 2w06o282e]E , ft Minnesota Unique Well No. County Quad Quad ID Hennepin Minneapolis South 104A WEPLL ALND BEORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota S~atutes Chapter 1031 A pi Entry Date Update Da:e Received Date 08124/1991 09/11/1991 ows Well NameOAKERMAN AND HUNSTEAD -ownehip Range Dir Section Subsections Elevation 28 24 W 26 CBADDA Elevation Method 835 ft Beamer] 7 5 minute topographic map (+/- 5 =feet) Well Depih Depth Completed Date Well Completed " we 50 fl 50 ft. 06/2911960 LE~[!!I!9~g_M!P~ = :2............................................................................................................................................. = Drilling Fluid -Use Domestic I Wall Htdrofractured? [] 'Yes [] No I From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 2 in. to 47 ft. Weight Ibs.fft. Hole Diameter Well Address 6638 CHICAGO AV S asso RICHFIELD MN Geological Material SAND FINE SAND SAND AND GRAVEL comColor GRAY wes Hardness ponFrom 0 21 42 Open Hole from it. to fl 10 | Cum Screen YES Diameter To 1.3 Suis Make Type Slot]Gauze 21 42 50 Stagc Water Level 22 fl from Land surface Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. LTon OSetNBeEn. Length Set Between 3 0 ft. and ft. 06t29/1960 To NO REMARKS Well Head Completion Pitlees adapter manufacturer Model []Casing Protection [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No Lote es tpt. tos gti. 340 Ot Located Minnesota Geological Survey Method Digitized scale 1:24,000 or larger (Digitizing Table) Unique Number Verification N/A Date NIA System UTM- Ned83, Zone15, Meters X 479206 Y 4969902 rots sate ct tna First Bedrock ussre sno rt Last Slral Sand Aquifer Quat. Water Table Aqui:er D~plhte Redrnck fl County Well Index Online Report County Well Index Online Report Nts Nearesl Known Source of Contaminalion _feet _direclion _lype Well disinfected upon completion'? 0 ve [] Yes 0 [] No ASR Se Pump [] Not Installed Date Installed Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m Bh Bh HP 0 Type Volts Material Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification pe wz Aamot Well Co 27062 orm bam tors Some License Business Name Lic Or Reg. No. [] No tema Name of Driller 220066228822 PPrriinntteedd 99//1100//22000088 HE 01205 07 e.g Ag 200 MDP202K ric Re NP Lg Reg 2006282 Wf 10272008 10835 AM) tile://iJl/...up%20Rpt/Appendix%20D%20Muni%20FD%20Site%20Smnmaries/Riehfield/Well%20Log%20Report%20-%2000206282.htm[ 10/27/2008 11:08:25 AM] 2233.0569 STATE02827381 2233.0569 STATE_02827381 Wcll Log Rcport - 00206283 20066228833 Minnesota Unique Well No. S|r,County Quad Quad ID fe. Hannepin Minneapolis South 104A WEMLLAaNDcBOoRING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 fBr h Entry Data Update Da:e Received Date AE 08124f1991 09/1111991 Well NameWEEGMAN nn own ee -ownship Range Dir Section Subsections Elevation 26 24 W 26 CBBBCC Elevation Method preemies 852 ft 7 5 minute topographic map (+/- 5 feet) Well Depih Depth Completed Date Well Completed orn50 fl 50 ft. 08/2911960 ~[!!I!9~g_M!P~ = :2............................................................................................................................................. EE , Drilling Fluid -Use Domestic I Well Htdrofractured? [] Yes [] No ] From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 2 in. to 47 ft. Weight Ibs.fft. Hole Diameter Well Address 6621 PORTLAND hRoICwHiFIEE.LDonMyN es ow Geological Material SAND SAN D Bon SAND AND GRAVEL JUColor BROWN EnBROWN Hardness Open Hole from it. to ft Screen Make Type Diameter Diameter --From To 0 21 21 42 242 50 `StotGauze Slot/Gauze Length Length Static Water Level 38 ft from Land surface Date Measured PUMPING LEVEL (below land surface) 0 ft. after hrs. pumping 10 g.p.m. 08t29/1960 Set Between Set Between ms NO REMARKS Well Head Completion Pitless adapter manufacturer Model EET []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No anLocated Minnesota Geological Survey ATA Method Digitized - scale 1:24,000 or large[ (Digitizing Table) Unique Nu'~ber Verification N/A Date NtA System UTM- Mad83, Zone15, Meters X 478864 Y 4969956 i Nearest Known Source of Cor~amination _feet _direction _type Well disinfected upon completion? oun[] Yes [] No Er Pump [] Not Installed Date Inatallad Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No FFiersat oBuemdcrcec.k ize Sa LastSlrat Sand-brown Aan Cut esr Tate ser Aquifer Quat. Water Table Aquifer Depth to Bedrock ft `County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No "Well "panics Contractor Certification Aamot Well Co. 22e 00662288n 33 License Business Name am 27062 Hn sie Lic Or Reg. No. Name of Driller Printed 97102008 Printed 9/10/2008 HE-01205-07 [-- tile:///Jl,'...up%20Rpt/Appendix%20D%20Muni%20FD%20 Site%20S mnma ries/Riehfield/Well%20Log%20Report%20-%2000206283 .htrn[10/27/2008 11:08:26 AM] STATE_02827382 22223333..00557700 Wcll Log Rcport - 00206289 20066228899 Minnesota Unique Well No. S|r,County Quad Quad ID fe. Hennepin Minneapolis South 104A WEMLLAaNDcBOoRING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota S~atutes Chapter 1031 fBr h Entry Date Update Da:e Received Date AE 08124/1991 09/1111991 Well Name FOLEY P_G nn seo ee -ownehip Range Dir Section Subsections Elevation 26 24 W 26 BAACCA Elevation Method preemies 825 ft 7 5 minute topographic map (+/- 5 feet) Well Depih Depth Completed Date Well Completed orn50 fl 50 ft. 09/2111960 ~[!!I!9~g_M!P~ = :2............................................................................................................................................. EE , Drilling Fluid -Use Domestic I Wall Htdrofractured? [] Yes [] No I From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter 2 in. to 47 &. Weight Ibs./ft. Hole Diameter Well Address 6232 11TH AVe owieong RICHFIELD MN es ow Geological Material SAND SAND Bown SAND AND GRAVEL J-- Color BROWN GRAY Tho 2 BROWN Hardness F[om To 0 21 21 42 42 50 Open Hole from it. to ft Screen YES Make Type Diameter Diameter `StotGauze Slot/Gauze Length Length Static Water Level 36 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 0 ft. after hrs. pumping 10 g.p.m. 09t2~/1960 Set Between Set Between ms NO REMARKS Well Head Completion Pitless adapter manufacturer Model EET []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and 3cringe ONLY) Grouting Information WelIGrouted? [] Yes [] No anLocated Minnesota Geological Survey ATA Method Digitized - scale 1:24,000 or large[ (Digitizing Table) A Unique Nu~ber Verification N/A Date N/A System UTM- Mad83, Zone15, Meters X 479499 Y 4970700 i Nearest Known Source of Cor~amination _feet _direction _type Well disinfected upon completion? oun[] Yes [] No Er Pump [] Not Inatalled Date Installed Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No FFiersat oBuemdcrcec.k ize Sa LastSlrat Sand-brown Aan Cut esr Tate ser Aquifer Quat. Water Table Aquifer Depth to Bedrock ft `County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No "Well "panics Contractor Certification Aamot Well Co. 2200662288t99 n License Business Name am 27062 Hn sie Lic Or Reg. No. Name of Driller Printed 97102008 Printed 9/10/2008 HE-01205-07 [-- tile:///Jl,'.., up%20Rpt/Appendix%20D%20Muni %20FD%20 S ite%20S mnma ri e s/Richfield/Well%20Log%20Report%20-%2000206289 .htm[ 10/27/2008 11:08:26 AM] STATE_02827383 22223333..00557711 * RRiicchhmmoonndd 22223333..00557722 STSATATTEE0_202882277338844 Site Nome: Site Name: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY Richmond Richmond 4RR5iiccHhhamlmloonnAddveFFniirureeeDDeeppaarrttmmeenntt Richmond, IN 45 Hall Avenue Richmond, MN 5566336688 CC32hh0uu-cc5kk97MMe-er2tr2tee1nn4., Fire Fire Chief Chief 320-597-2214 TTrraaiinniinngg LLooccaatitioonn:: Training Location Coordinates (XY): Training Location Coordinates (X,Y): TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: AAnnnnuuaall ffooaamm uussee:: NNeeaarreesstt ssuurrffaaccee wwaatteerr:: NNeeaarreesstt wweettllaanndd:: Karst Area: Karst Area: Nearest water well: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: SITE RANKING: SITE RANKING: `IInAnddvuuessntterrii,aaloolnot,tt, h33leolonttosstwwheesssittdeooffottfhhMeaiiInnn.tteerrsseeccttiioonnooff Man Main & & 19st 191st Avenue, on the north side of Main. 362469.71, 503454188. 382469.71,5034541.88 AFF: Ansuife AFFF: Ansulite AAnnnnuuaallllyy LLeessss tthhaann 55 ggaatlloonnss. GGrroouunndd,, tthheenn oto ccaattcchhmmeenntt ppoonndd AAClFFaFsFFs:A6600S1itb0o-e99x00: gg5aa0llll1oo0nnss90 gallons Other Class Other: Just started A Silv-ex: 60 Just started using to 90 using HCT F500 gallons HCT F-500 AA-B ffooaamm AApppprrooxxiimmaatteellyy 111/44 mmiilee eeaasstt--nnoorrtthheeaasstt `AApppprrooxxiimmaatteellyy 111/48 mmiilee eeaasstt--nnoorrtthheeaasstt Sieis nt located ian karst area Site is not located in a karst area `Approximately 118 me south and soulheast Approximately 1/4 mile south and southeast Loss than 1/4 mile northwest Less than 1/4 mile northwest MMoorree tthhaann 11 mmiilee 1s 15 22223333..00557733 STATE02827385 STATE_02827385 RRIICCHHMMOONNDD CCWWII WWeellll M Maapp el ub : Sod Cen RTT a A "LL ! FAN i A y 7tr Re a Pie Ry Er tot] Se . fi T idEiRE ae] Pspe ERCR LATPE adie ie ce pn eT] TN CT sisdinasbiseenad LNT TA Ew L EE e me lp<r. |RrSRENRSl we ay are hi Lod SITE,C2NY0 f frm NCRLGgLLiaTi a p eoid nl oyNL =g=eeE TcTee lT l e 3 S eiiE e en LT ade, Mo ed S FS 2 J a Sheud yPosal She l SRGYFT, ih, here Kamei 3 fw] ak hed na giants THESE ieee Jbhow o Te n Ht T Sg bipn TeRdAaDT Vaa =r ;of a VEee Tg 0 a TE OO ah Eat eySET MaSp indEia mer S: TOEY| op AS ad ebeatiostp 22223333..00557744 stare oz27386 STATE_02827386 * gir |, hiial ii :: M0Try ||gRi , INEHh HL e egtif i chi Rul i en I een w" erm, wma T eee ewer ay } ] 20 EY Pl) ' "ih b. / 3 ii ( ob 4 re | gay, lYeovldFSlnd ge @ Jeg TF EA a 2 Cig |I late fF ILS i$F" i &NERA Hih 2 bo [ | 3 JA { i Ef A HF cl 2| 5 LS i en aa | 7 i | / i5 ) W\ N 1i4 N O~-L~-gI~ 22223333..00557755 sre czs277 STATE_02827387 RRiicchhmmoonndd WWhahta't'ssIInnMMyyNNeeiighgbohrhbooodrMMhaappood| Jad | | || | E en r| a= pre i Lo] ee | [Ry EE[Re|H)srdaipsidg 3 e | 2TM~ye =m|{ ,|i ier T{Ei o} || rth & \\ / aN --=T Sites. SS m A EEEET || Disclaimer: Map and site information is believed to be accurate but accuracy is not guaranteed. No portion of the information should be considered to be, or used as, a legal document. The information is provided subject to the express condition that the user knowingly wai,,-es any and all claims for damages against MPCA that may arise from the use of this data. [D ogme eml aRniao toeuNt nuipsossriudnd ocaointnt rato @Minnesota Pollution Control Agency o fvreoSorr vareryi FPraym m Cram 22223333..00557766 state oases STATE_02827388 Wcll Log Rcport - 00020049 02000499 Minnesota Unique Well No. o|ir,County Quad Quad ID aoF , Stearns Cold Spnng 140B WEMLLaAcNoD BORING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 VVell Name CS-1 -ownehip Range Dir Section Subsections Elevation 123 30 W 19 ACBBBA Elevation Method 1111 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 112 ft Depth Completed 112 ft. tBneh, Entry Data Update Da:e Received Date 2% 0513011991 12/23/2003 Date Well Completed 06/2211988 TE Drilling Fluid -Use Exploration ~ Well Htdrofractured? [] Yes [] No J From :t to Ft CasingType Joint Nolnformation DriveShoe? []Yes []No Above/Below0 ft. Casing Diameter Weight Hole Diameter 6 in. to 60 ft. 3 in. to 112 ft. Geological Material Ly SAN D OUTWASH Wie. SAPROLITH GNEISSIC GRANITE Color gn BROWN =BLU E Hardness UgSOFT 2 M EDIUM HARD From Te gm0 53 23 53 98 98 112 or Open Hole from Screen Make Diameter it. to Type ww fl Slot/Gauze Length Static Water Level ft. from Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. too Set Between repREMARKS GAMMA LOGGED 6 21 88. MG.S. NO. 2830. oem Located Minnesota Geological Survey Method Digitized scale 1:24,000 or larger (Digitizing Table) eminem Unique Number Merilication Information from owner ,System UTM - Ned83, Zone15, Metera Data N/A X 383030 Y: 5034293 ee eine Cuttings Yes Borehole Geophysics Yes First Bedrcck Cretaceous Regolith Hemp] Cem Last Strat RICHMOND GRANITE Aquifer Depthto Bedrock 53 ft. County Well Index Online Report County Well Index Online Report Well Head Completion Pitless adapter manufacturer Model EET []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No yas Nearest Known Source of Cor~amination 750 feet N direction Bamvard Well disinfected upon complehon? type [] Yes [] No Er Pump [] Not Installed Date Installed Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Bevies Bros.drillins 22a 00004499 License Business Name Eg053 on mse Lic Or Reg. No. Name of Driller Printed 9/7212008 Printed 9/12/2008 HE-01205-07 22223333..00557777 stare 02827389 STATE_02827389 Wale Rn 0197 Wcll Log Rcport - 00115997 Minnesota Unique Well No. 11185999977 wJemz,County Quad Quad ID exe Stearns I~chrnond 141A Well Name HART, GARY -ownehip 123 3Range 30 wo Dir Section W 19 ve Subsections BCADDC een Elevation Elevation Method WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING RECORD Minnesota Statutes Chapter 1031 fmabni Entry Data Update Da:e Received Date 0411711988 08/02/1993 Well Depih Depth Completed Date Well Completed Lr mm 1115 ft 7 5 minute topographic map (+/- 5 52 ft 52 ft. 07/1511976 feet) ~:~!!~!~ ~!~: ~!~. ~o~!........................................................................................................................... Drilling Fluid -- {ee Use Cornmercial I Well Htdrofractured? [] Yes [] No ] From :t to Ft Casing Type Steel(black or lawcarbon A No Above/Below 1 ft Joint Threaded Drive Shoe? [] Yes [] Casing Diameter Weight Hole Diameter 4 in. to 52 ft. Ibe./ft. Well Address RICHMOND MN 56368 Geological Material B= GRAVEL WATERSAN D FINE MARL Color Hardness BT YELLOW YELLOW BLU/GRN MEDIUM 8OFT REMARKS SCREEN 6 IN. HOLE 4 IN SLOTTED PIPE GRAVEL PACK. From 0 37 40 Open Hole from it. to [t Gums Sweet Screen YES Diameter Make Type slatled pipe Slot/Gauze Length To - 37 40 52 Static Water Level 30 fl from I and surface Date Maa~Jred (~7115/1976 PUMPING LEVEL (below land surface) 33 fl after hrs. pumping 10 g.p.m. oGsoommones Bsowtomen Well Head Completion Pitless adapter manufacturer Modal []Casing Protecfien [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No SuBeen Set Between Located Minnesota Geological Survey ee Unique Number Merilication Information from owner i ah System UTM - Ned83, Zone15, Meters Method Digitized scale 1:24,000 or larger (Digitizing Table) Data N/A X 382656 Y: 503411T First Redr~k Cr~.far:a.OlJS Regnlith ee ee Sena Last Strat CretaceousRegolith Aquifer Depth to Bedrock 40 ft. oars hos edex Bo pert County Well Index Online Report Nearest Known Source of Contamination _feet __direction __type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufacturer'sname Length 01drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material AbandonedWells Does property have any not in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification JenninasWell Co. T1f11o55r99977 License Business Name 73321 PPrrinetedd EE9/12e/2EOO8 Lic Or Reg. No. JENNING S Name of Driller HE-01205-07 el. pend 0a OFSXSi han WelLog Report56014597 220811000 AN) t~e:///JlL..p%2~)Rpt/Appendix%2~D%2~Muni%2~FD%2~Site%2~Summaries/Riehm~nd/We~%2~L~g%2~Rep~rr?/~2~-%2~ 15997.htm[10~2%2008 1 ] :10:00 AM] 2233.0578 sate 0282739 2233.0578 STATE_02827390 WeLoglRolr i220 Wcll Log Rcport - 00124229 Minnesota Unique Well No. 11224422299 wmCaunty Quad zz, Quad ID geStearns Richmond um141A Well Name TORBERG, MELVIN nn ower tea -ownship Range Dir Section Subsections Elevation 123 30 W 18 CBAACA Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~TELL ~i~]~[} ]~OR[]~C~ RECORD ~J~C O~J~ Minnesota Statules Chapter 1031 [7smemeswenee nsl re TY 1108 ft 7 5 minute topographic map (+/- 5 feat) Well Depih 37 ft = Depth Completed 35 ft. man Entry Date Update Da:e ft Received Date 02113/1989 08/02/1993 hod Date Well Completed 06/2911976 Drilling Fluid -Use Abandoned ~ Well Htdrofractured? J From :t to Ft Status Sealed [] Yes [] No Casing Type Joint Welded Drive Shoe? []Yes [] No Above/Below 2 ft. Casing Diameter Weight Hole Diameter 12 in. to 31 ft. Ibs./ft. Well Address RR1 iit ww RICHMOND MN 56368 Geological Material DRY SAND & CLAY FAIR FINE SAND FAIR GRAVEL coColor BROWN GRAY GRAY ies Hardness romFrom 0 6 17 Open Hole from it. to ft Screen YES Make JOHNSON Type stainless steel To|Diameter To 12 6 17 37 wSlotlGauze 100 TT Length 4 Set Between 31 ft. and Static Water Level 88 ft. from Land surface Date Measured 06t2911976 PUMPING LEVEL (below land surface) 21.8 ft. after hrs pumping 357 gp.m wa 35 -- NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade Brun tner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No rity Located Minnesota Geological Survey m oe a,n rt Unique Nu'~ber Verification Information from owner System UTM - Mad83, Zone15, Meters Sl Method Digitized Table) 20 ey scale 1:24,000 or larger (Digitizing 36 0 Date N/A X 382634 : 5035440 First Bedrock utr orice NAY Last Slral Gravel (+larger)-gray Aquifer Quat. Water Table Aquifer Depth to Redrock ft `County Well Index Online Report County Well Index Online Report Nts Nearesl Known Source of Contaminalion _feet _direclion _lype Well disinfected upon completion'? 0 ve [] Yes 0 [] No Pump [] Not Installed Date Installed Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any eel in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No som eresiuns Well Contractor Certification In(]elside Ena License Business Name 112244222299 ohn 712T8 Lic. Qr Reg. No. umber PRAUGHT J W Name of Driller Priinmtead t9/i12e/n20a0n8 HE 01205 07 e.g DP EOFS M Sms Ren Wel Lg20Ror32O01262391027 208 1:10.06 AN) STATE 02827391 22223333..00557799 STATE_02827391 WaLoglRolr E070 Wcll Log Rcport - 00131070 113311007700 J wzzm, Minnesota Unique Well No. County Quad Quad ID ee Stearns Richmond 141A Well Name NEU, LARRY -ownship Range Dir Section Subsections Elevation 123 30 W 19 BCDADD Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~7~L~LL iJll]~[} ]}ORIN-C~ RECORD I~J~C O~a~ Minnesota Statules Chapter 1C,31 1118 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 56 ft Depth Completed 56 ft. man Entry Data Update Da:e ft Received Date 04117/1988 08/02/1993 Date Well Completed 09/241197~ Em -- Drilling Fluid -Use Domestic ~ Well Htdrofractured? J From :t to Ft [] Yes [] No Casing Type Steel(black or bwcarbon) Joint Welded Drive Shoe? No Above/Below 1 ft [] Yes [] Casing Diameter Weight Hole Diameter 6 in. La 22 ft. Ibs./ft. Well Address RR1 RICHMOND MN 56368 Geological Material NO RECORD Ea Color Hardness oo -- NO REMARKS From To 0 56 oE Open Hole from it. to ft Screen YES Make JET STREAM Type plastic Diameter 5 SlotlGauze 30 Length 34 Set Between 22 ft. and 56 Static Water Level 20 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 50 ft after hrs. pumping 10 g.p.m. 09124/1976 Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade Bren rerio yen [] At-grade (Environmental Wells and Borings ONLY) Ce ms rsa Gre Grouting Information WelIGrouted? [] Yes [] No J Located Minnesota Geological Survey Method Digitized scale 1:24000or larger(Digitizing Table) oe res Unique Number Meritication Nameon mailbo System UTM - Ned83, Zone15, Meters Data X: 382657 Y: 5034029 iorne ors First Bedrock E-fe s Aquifer County Well Index Online Report Last Slral No Record Depthto Bedrock ft County Well Index Online Report Grout Material: Cuttings from 0 to ft. Nearesl Known Source of Conlaminalion 135 feet S direction Septic tanlddrain field t)p A i eit Be Be Well disinfected upon completion? [] Y~s [] No Pump [] Not Installed Date Installed 09127!1976 [Eelse EEeN, h Manufacturer's name AERMCTOR Model number SD12X50 HP 0.5 Volts 23._D.0 Length 01drop Pipe 34 ft. Capacity12 g.pm Type Submersible Material Galvanized | Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification TE = Traut Well 73157 ore rT License Business Name Lic Or Reg. No. [] No CLAUDE. J. Name of Driller 113311007700 PPrriinntteedd S9//17221122000088 HE 01208 g7 lp Agen S20Da im We Se2e 0,OSrI 1027008 111601 AN] t~e:///J~..p%2~)Rpt/Appendix%2~D%2~Muni%2~FD%2~Site%2~Summaries/Riehm~nd/We~%2~L~g%2~Rep~rr?/~2~-%2~31070.htm[10~2%2008 1 ] :10:01 AM] sare 02627392 STATE_02827392 22223333..00558800 WallogReport 150705 Well Log Report - 00150705 115500770055 | w=zm, Minnesota Unique Well No. County Quad Quad ID ee Stearns Richmond 141A VVell Name HEMMESCH, LESTER -ownehip Range Dir Section Subsections Elevation 123 30 W 19 BCDADD Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~7~L~LL iJll]~[} ]}ORIN-C~ RECORD I~J~C O~a~ Minnesota Statutes Chapter 1031 1112 ft 7 5 minute topographic map (+/- 5 feet) Well Depth 52 ft Depth Completed 52 ft. man Entry Date Update Da:e ft Received Date 04117f1988 08/02/1993 Date Well Completed 05/1711978 Em -- Drilling Fluid -Use Domestic ~ Wall Htdrofractured? J From :t to Ft [] 'Yes [] No Casing Type Steel(black or bwcarbon) Joint Threaded No Above/Below 1 ft Drive Shoe? [] Yes [] Casing Diameter Weight Hole Diameter 4 in. to 33 ft. Ibs./ft. 7 in. to 52 ft. Well Address RICHMOND MN 56368 F= Geological Material GRAVEL COARSE MARL MARL E= Color YELLOW RED GREEN Hardness HARD HARD NO REMARKS TFFrom 0 35 47 Open Hole from it. to [t Screen YES Make Type plastic Diameter To 4 35 47 52 SlotlGauze Length 0 Set Between 33 ft. and 52 Static Water Level ft. from Date Measured PUMPING LEVEL (below land surface) 30 ft after hrs. pumping 10 g.p.m. Well Head Completion Bren rerio yen Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Located Minnesota Geological Survey oes resem. Unique Number Verification Information from owner System UTM - Ned83, Zone15, Meters = Method Digitized Table) scale 1:24,000 or larger (Digitizing ot w9T Data N/A X 382414 Y: 5033950 rioanmbiaormmamnt First Bedrock Cretaceous Regolith a Sn. Aquifer Multiple County Well Index Last Slral Cretaceous Regolith County Well Index OOnnlliinnee ReportDepth 1o Report Bedrock 35 ft. Se obiet Nearesl Known Source of Conlaminalion __feet _direction _type Well disinfected upon completion? [ts [] Yes 30 [] No nn denGhn Pump [] Not Installed Date Installed Manufacturer'sname Length 01drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification Rr = mmm JenninoaWell Co. 73321 eae Sm. Ses License Business Name Lic Or Reg. No. [] No JENNINGS S Name of Driller 151500770055 Prinnteedd 9/1122/200008 HE 01205 07 lp Agen S20Da im We Se2e 0,00r 508027008 111601 AN] tile:///J~..p%20Rpt/Appendix%2~D%2~Muni%20FD%2~Site%2~Summaries/Riehm~nd/We~%2~L~g%2~Rep~rr?/~2~-%2~ 50705.htm[10~2%2008 1 ] :10:01 AM] sraTe 02627393 STATE_02827393 22223333..00558811 WeLoglRolr mens Wcll Log Rcport - 00180862 118800886622 | wzzm, Minnesota Unique Well No. County Quad Quad ID geStearns Richmond 141A Tre Well Name RICHMOND BASEBALL ASSC. -ownahip Range Dir Section Subsections Elevation 123 31 W 24 ACAABC Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~TELL iJll]~[} BORIN-C~ RECORD I~J~C O~a~ mn Entry Date Update Da:e ft Received Date 04117f1988 05/29f2002 Fede 1115 ft 7 5 minute topographic map (+/- 5 feat) Minnesota Statules Chapter 1031 Well Depih 163 ft == Depth Completed 163 ft. Date Well Completed 05/2911981 Ee Drilling Fluid -Use Domestic ~ Wall Hcdrofractured? [] Yes [] No J From :t to Ft Casing Type Plastic Joint No Information Drive Shoe? []Yes [] No AbovelBelow 1 ft. Casing Diameter 4 in. to 83 ft. Weight Ibs./ft. Hole Diameter 8 in. to 163 ft. Well Address RICHMOND MN ones Geological Material SAND SHALE MARL & DECOMPOSED GRANITE GRANITE BrColor YELLOW GRAY GREEN GREEN PEHardness MEDIUM MEDIUM SFT-HRD SFT-HRD &From 0 20 24 To 20 24 150 150 163 Open Hole from it. to ft Screen YES Make JET STREAM Type plastic Diameter 4 Slot/Gauze 40 Length 80 So! Between 83 ft. and 163 Stagc Water Level 22 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 150 ft. after hrs. pumping 5 gpm 05t30/1981 REMARKS 23-31-24 ACAABC ELEV 1115-+5 '41-A F oo e Located Minnesota Geological Survey Unique Nu'~ber Merification Name on Echmailbox Method Table) Date DigC[ized - scale 124000 or larger(Digitizing System UTM- Ned83, Zone15, Meters X: 381803 Y: 5034298 First Bedrock Cretaceous,Undiff. ---- REA Last Slral Precambrian Crystalline Roc Aquifer Multiple Deplh to Bedrock ?0 ff `County Well Index Online Report County Well Index Online Report Well Head Completion Brun tner rt ao Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No Grout Material: Neat Cement from 3 to 30 ft. rte eps Bt 0 Nearesl Known Source of Coataminalion 150 feet F, direction Sentic tank"drain field type Well disinfected upon completion'? [] Yes [] No Pump [] Not Installed Date Installed Manufaciurer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any nol in use and not sealed well(s)') [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No sortase Wall Contractor Certification JenninasWell Co License Business Name 118800886622 wom73321 Lic Qr Reg. No. hewaow JENNINGS S Name of Driller Pima tienan Printed 9/12/2008 HE 01205 07 e. DPM EOg FS Sms sen Wel Lg20320i1207 21081:10.02 AN) t~e:///J~..p%2~)Rpt/Appendix%2~D%2~Muni%2~FD%2~Site%2~Summaries/Riehm~nd/We~%2~L~g%2~Rep~rr?/~2~-%2~ 80862.htm[10~2%2008 11:10:02 AM] 2233.0582 STATE 02827394 2233.0582 STATE_02827394 WeogRelport 045685 Wcll Log Rcport - 00436849 wns] Minnesota Unique Well 436849 No. w=m,County Quad Quad ID geStearns I~chmond 141A Tre ey Well Name RICHMOND APARTMENTS -ownahip Range Dir Section Subsections Elevation 123 31 W 24 ABDADC Elevation Method WELHLiANvD IBORNING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~]~[} I}OR[]~C~ ~J~C O~J~ EmoRn Entry Data Update Da:e Received Date 0510711991 0T/22/1993 feed] 1119 ft 7 5 minute topographic map (+/- 5 feet) Minnesota Statules Chapter 1031 Well Depih 42 ft Depth Completed 4C, ft. Date Well Completed 07/1511988 = Drilling Fluid Bentonite Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Plastic Joint iko Information Drive Shoe? []Yes [] No AbovelBelow 1 ft. Well Address 466 1ST ST SE Basie RICHMOND MN 56368 cies rn Geological Material SAN D MARL cor Color YELLOW LT. CRY mes Hardness SOFT ponFrom 0 30 Casing Diameter Weight Hole Diameter 4 in. to 25 ft. Ibs.fft. 4 in. to 40 ft. Ibe./ft. Open Hole from it. to fl Screen YES og Diameter 4 ono| ]o Make CERTAINTEED Type plastic Soom Lom Sys SlotlGauze 23 Length 5 Set Between 25 ft. and 30 ft 30 42 Stagc Water Level 22 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 25 ft after hrs. pumping 15 g.p.m. 07t15/1988 To NO REMARKS Well Head Completion Pitlees adapter manufacturer Model []Casing Protection [] 12 in. above grade yan mvo t gs) [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No cs ppt Located Minnesota Geological Survey t,t as Unique Nu'~ber Verification Nameon mailbox System UTM - Nad83, Zone15, Meters lO Method Digitized Table) 4 et scale 124000or larger(Digitizing x 18 Date NIA X: 381840 Y: 5034418 mutsva cumanto First Bedrock Cretaceous Regolith aaamae Aquifer Quat. Water Table Aquifer County Well Index Online Report Last Slral Cretaceous Regolith Depth m Redreck 3D ft County Well Index Online Report Grout Material: Neat Cement from 0 to 22 ft. Nts Nearesl Known Source of Coataminalion _feet _direclion _lype Well disinfected upon completion'? 0 ve [] Yes 0 [] No Pump [] Not Installed Date Installed Manufacturer'sname Length of drop Pipe_ft. Model number Capacity_g.p.m HP 0 Type Volts Material Abandoned Wells Does property have any eel in use and not sealed well(s)? [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No [rey Well Contractor Certification Jennin~]s Well Co License Business Name 443366884499 cokers T3321 Lic. Or Re_c. i/o. owas NORDMANN M Name of Driller PPrrinted 91/12//220008 HE 01205 07 le. App 207 20a FDP SXSemis Risen Wel 2 gh20Regrt 0 OOH {1272008 1:10:02 AN) STATE02827305 2233.0583 STATE_02827395 2233.0583 + RRoosseemmoouunntt 22223333..00558844 STATE 0282739 STATE_02827396 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SiStitee CCoontnatcatc:t: SSIITTEE SSUUMMMMAARRYY RRoosseemmoouunntt 2RR8oo7ss5eme1mo45uo"nutSFFntiierrteeelDDeWepepasarttrtmmenetn.t Rosemount MN 2875 145th Street Rosemount, MN 55068 West 55068 6SS5cc1oo-tt3t2AA2kk.ee2r,r0,8F6Fi.ireeCChiheieff 651-322-2066 TTrraaiinniinngg LLooccaatitioonn:: 1144770000 SShhaannnnoonn PPaarrkkwwaayy,, RRoosseemmoouunntt Training Location Coordinates (XY): 488446.7, 495365120 Training Location Coordinates (X,Y): 488448.7, 4953651.29 TTyyppee ooff ffooaamm uusedsiinnttreraaiinnidinngg:: fAAoFrFFtF:rFa: iuunnngssuufrroecmoofFf bbirrtaannHddi.,lsnnooRellfooinnnggeeerrryuuissneedtd.h.eRRpoeacscateiivvneeoddtsoeuxxrppeiirceofdd bffoaonaadmm. TfLLoriikrakeeitlrnlayyiintnthghinaaftgtosasfmoroo:mmmeeunFttsiilmiunmreeteHiinonifllbttshhreeRaneppdafais,nstetnrffoyooalainmomnthgbbeeyyr past, not sure 3uMsewdas used. 3M was used. of brand. Training foam: unsure of brand, no longer used FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: AAnnnnuuaallllyy FFooaamm uusseeppeerrttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground, storm sewer, santary sewer Ground, storm sewer, sanitary sewer AAnnnnuuaall ffooaamm uussee:: AATrFFaFFinFFin((gnhiisfsttoooarrimicc(uuussese)i:)o: rnnioottussseuu):rreenot sure Other (HCT F-500 A478 Training foam (historic Other (HCT F-500 A/B foam): 5 use): not foam): 5 st(ou01r1e55ggaalllloonnss NNeeaarreesstt ssuurrffaaccee wwaatteerr:: SUUonnunntaahmemaeesddt ppoonnddss 11//44t0o 11 mmililee1t0o tthhee wweests,t, ssoouutthhwweesstt aanndd southeast Nearest wetland: Nearest wetland: 1d 101 mile northwest 1/4 to 1 mile northwest Karst Area: Karst Area: Sieis located in a covered karst area. Site is located in a covered karst area. NNeeaarreesstt wwaatteerr wweellll:: LLeessss tthhaann 11/84 mmiille wweesstt Nearest Wellhead Protection Area: 1/4 10 1/3 mle southeast Nearest Wellhead Protection Area: 1/4 to 1/3 mile southeast NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilee SSIITTEE RRAANNKKIINNGG:: 119 22223333..00558855 STATE02827397 STATE_02827397 Is er Sh RROOSSEEMMOOUUNNTT CCWWII WWeellll MMaapp TSE | Es SSS 4, SR ART CAT 7SLeimoe]li SeaetH s o oonon ie ils) Son arth ee =Siema]RE R o Re T TE TTF wn abr lA sn ER Cla TR 11 fA A ErelTRRE Se eda he Soli ss Salli A ET enE18 8 NT Sa SA ml Dts Un a ee |Bon Belt Ertan nt atoll Dib l TERE SE ee ye RS TR Ci ota a Ssaewnnded aE BZzaaeiaa sin Hc essotd ee eHEtE aoo 0S0eSembeitaonur.MEaRe lL a h =i e E UhG doE aRBl feed NwOaVEepLeesnff IoNG odFL ahead A EEN Mesemsugspsmensgemenssvonn. coaro n BULER | apr fan 22223333..00558866 -- STATE_02827398 %gr sid al i: Bec1 H%S 3i : | I i e ii i "isa hffA uidiiiitaiih aliiniifIg jee530 :son ped gio [35: Ch prove 40m 4330n 3 3 Ea IN PERS R "son 3| b H7H PL |t i5 3.7 Edlh.a8 Fl ETeRs 2 BE UE 2 3 3| LEos 1| iHE3 d &8 | S| } [/ 9b :% x : Losift f . a i: li i He HHIH se3 |i| e HI i Iz # Hl 22223333..00558877 stare_oasar3e0 STATE_02827399 Rosemount What'sIn My NeighborMhaopod WoL | io pe |- I y iz \" Jily: Fa iy | Ly lis +! Erie EAL fe sma hWdEE1E ey Teili EN a a j= EN 3i FEiwlto 570 mE e1rril eiFt= ] [Butt pPrristine: fFheesrf |fi]1 E liaE d aE || | m Sf lCeea [Lo a] -- / EEE rT gid || Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion |pmme | of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided Loa hHee o mo ons | subject to the express condition that the user knowingly waives any and all claims for clamages against ]VIPCA tha! may arise from lhe use of this data. e Lor PBiooirtntisscoitmraatSuenpsoraiauns WAR so rons | @Minnesota Pollution Control Agenc,y -- -- nn Vr otaemostoston 22223333..00558888 ovecaer STATE_02827400 Wall Repo 027601 Well Log Report - 0020760 l 2w076e01 Minnesota Unique Well No. FJEE.County Quad Quad ID Dakota Farmington 88B WEBLLL IATNDRBOONRNING MINNESOTA DEPARTMENT OF HEALTH V~TF~[~L gleNI) ]}ORI]~C~ R~(~ ORD Minnesota Statules Chapter 1031 Well Name OSTERTAG, BARNEY sn oom cme -ownship Range Dir Section Subsections Elevation 115 19 W 30 CCDDBB Elevation Method [Spraermensis| 965 ft 7 5 minute topegraphic map (+/- 5 feet) Well Depih 214 ft Depth Completed 214 ft. man Entry Date Update Da:e Received Bate 09115f1988 03/24/2006 Date Well Completed 10/1611973 Em -- Drilling Fluid -Use Domestic I Wall Htdrofractured? I From :t to Ft [] Yes [] No Casing Type Steel(black or Iowcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below 0 ft Casing Diameter Weight Hole Diameter 4 in. [o 191 ft. Ibs./ft. 4 in. to 214 ft. Well Address 14888 DODD BL ROSEMOUNT MN 55068 Geological Material GRAVEL Lo SAN DSTON E LIMESTONE Open Hole from 191 fl. to 214 fl. Cum Screen NO Make Diameter Sues Type Slot/Gauze Color Hardness From To 0 130 "FB 130 190 190 214 - Static Water Level 75 fl from I end surface Date Meas~Jred PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. Legh Length 10117/1973 Sa etven Set Between re REMARKS DRILLED BY GENZ RYAN oso ons Well Head Completion Pitless adapter manufacturer otModal Cr []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No ct MentSsre Wa tt AO Ot Located Minnesota Geological Survey Method Digitized scale 1:24,000 or larger (Digitizing Table) Unique Nu'~ber Verification N/A Date N/A System UTM- Ned83, Zone15, Meters X ~.87938 Y 4953265 Nearest Known Source of Contamination _feet __direction __type SE AL VnaJen Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed 10117!19~3 Manufacturer'sname MCDONALD Model number Length of drop Pipe 105 ft. Capacity_g.p.m Type HP 0.75 Material Volts AbandonedWells Does property have any not in use and not sealed well(s)~ [] Yes [] No County Well Index Orlin Report First Redr~k St Peter Last Strat Prairie Du Chien Group Aquifer Prairie Du Chien Group Depth ~o Bedrock 130 ft. County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification 207601 License Business 207601 Name HELGESON. J Pred 91672008 Lic. Or Reg. No. Name of Driller Printed 911612008 HE-01205-07 lp App SP 305 Smt Rv lL Sgt 204 O00 i107 3081119 AM) tile:///Jl,'.../;_0Rpt/Appendix ,o20D o20Muni ,o20FD ,o20Site/;_0Summerie~ Rogetnount, Well %~0Log ,o_0Report %20- ;~000~07601 .htm[l 0/27/2008 1 l: 11:29 AM] STATE 02827401 STATE_02827401 22223333..00558899 WallogReport 022277 Wcll Log Rcport - 00212277 C2o 1217r &Jz,, Minnesota Unique Well No. 212277 County Quad Quad ID =x = Dakota Farmington 88B WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH V~TF~]~]~ titaN']) I}ORI]~C~ R~(~ ORD Minnesota Statules Chapter 1031 Well Name ROSEMC, UNT 5 bo -ownship Range Dir Section 115 19 W 30 om Subsections DDBDDC een Elevation Elevation Method Well Depih Lr emmee 958 ft 7 5 minutetopegraphic map (+/- 5 feet) 490 ft Depth Completed 490 ft. f=nn,. Entry Date Update Da:e Received Date Wm 07110/1989 03/2~/2006 Date Well Completed Drilling Fluid -- {ee Use Commercial ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or lawcarbon) Joint No Information Drive Shoe? [] Yes [] [frea e m eeae E | No Above/Below 0 fl Casing Diameter Weight Hole Diameter Well Address ROSEMOUNT MN 55068 eps ss Geological Material DRIFT imap oor ST. PETER LIMESTONE & SANDSTONE SHAKOPEE DOLOMITE Sioa Savosrone SAN DSTON E DOLOMITE JORDAN SANDSTONE corns Color Hardness goFrom To 0 206 BE 206 217 217 295 Er295 314 314 384 384 ,490 10 in. to ft. 8 in. to ft. Lr mote Open Hole from 399 ft. to 490 ft. Screen NO Make Type Diameter Slot/Gauze Static Water Level fl from Dale Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. Ibe.lft. Ibe./ft. ra Length stn Set Between EL S------------------------ REMARKS FORMERLY ROSEMOUNT TOWNSHIP NO.2 WELL ABANDONED. 50 TO 75 FT. SOUTH NO.4. oso ons Well Head Completion Pitless adapter manufacturer otModel []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No Located Minnesota Geological Survey Unique Number Verilication Information from owner ,System UPM - Ned83, Zone15, Meters Method Digitized scale 1:24,000 or larger (Digitizing Table) Date N/A X 488980 Y: 4953367 First Redrrr:,k St P~ter sis ee Seen wen Last Strat Jordan Aquifer Jordan Depth to Bedrock 206 ft. County Wal nde Orin Report County Well Index Online Report Nearest Known Source of Contamination _feet __direction __type Well disinfected upon completion? [] Yes [] No SE Se hee Pump [] Not Installed Date Installed Manufacturer'sname Length of drop Pipe _ft. Model number HP 0 Volts Capacity130 g.p.m Type Submersible Material AbandonedWells Does property have any not in use and not sealed well(s)1 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification Minnesota Deoartmert of Healfl" T2i1o2e27e7 e License Business Name MDH a Lic. Or Reg. No Pred Printed 9752008 Name ol Driller 9/16/2008 HE-01205-07 el. pp 200 Na P5 20S 0 Res el Lg Reet 20400327 bn 025 00 141:9AM) tile:///JlL../;_0Rpt/Appendix ,o20D o20Muni ,o20FD ,o20Site/;_0Summeries Rosemount, Well %-0Log ,o_0Report %20- ;~000_12277.htm[l 0/27/2008 1 l: 11:29 AM] 2233.0590 state 02827402 2233.0590 STATE_02827402 WallogReport 0227 Wcll Log Rcport - 00212278 [C21o221i8 e 5zz,, Minnesota Unique Well No. 212278 Caunty Quad Quad ID =ix = Dakola Farmington 89B WELLRAENCDOBRODRING MINNESOTA DEPARTMENT OF HEALTH V~TF~L]~ flliN]) ]}ORI]~C~ RECORD Minnesota Statules Chapter 1031 n =n. Entry Data Update Da:e Received Date Em 12127/1989 03/2T/2006 Well Name ROSEMC, UNT 6 -ownehip 115 Range 19 Dir Section W 30 et Subsections Elevation CADCBA Elevation Method Well Depih Depth Completed Date Well Completed A 1-- 7.5.1) ---- 962 ft 7 5 minute topcgraphic map (+/- 5 feat) 482 ft 482 ft. Well Address cies mess ROSEMOUNT MN 55068 Geological Material DRIFT SAND & GRAVEL Ey SHAKOPEE DOLOMITE JORDAN SANDSTONE SHALE REMARKS FORMERLY ROSEMOUNT TOWNSHIP NO.3. WELL SEALED 11 18 1997 BY 71701. ORIGINAL USE MU MUNICIPAL. a Located Minnesota Geological Survey Unique Nu'~ber Verification Address verification System UTM - Ned83, Zone15, Meters Coo vans Color Hardness pono From To 0 179 2 179 383 383 477 477 482 ---- Method Digitization (Screen) - Map (1 24,000) Date 03/27/2036 X: 488237 Y 4953670 Drilling Fluid ~ Well Htdrofractured? [] Yes [] No -- J From :t to Ft A EE Use Abandoned Statue Sealed Casing Type Steel(black or Iowcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below 0 ft Casing Diameter Weight Hole Diameter 24 in. to 162 ft. 16 in. to 398 ft. Open Hole from 398 ft. to 482 ft. [OE Screen NO Diameter Make Sos Type Slot/Gauze Ibs./ft. Ibs./ft. Lown Length susan Set Between Static Water Level fl from Bale Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. oso ons Well Head Completion Pitless adapter manufacturer otModal []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No _ Nearest Known Source of CoNamination _feet __dkection __type Well disinfected upon completion? [] Yes [] No Sn ST Pump [] Not Installed Date Installed Manufac~urer'sname Length of drop Pipe _ft. Model number Capacity_g.p.m ee HP 60 Molts Type Turbine Material AbandonedWells Does property have any not in use and not sealed well(s)'~ [] Yes [] No iCotsytoVirlel ndor Gri orSE First Redrrr:,k Prairie Du Chien GroiJp Last Strat St.Lawrence Aquifer Jordan Depth to Bedroc4 179 ft. County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification Minnesota Deoartmert of Health F21P227]8 a License Business Name MDH om sar Lic. Or Reg. No Name ot Driller FTI Printed 911612008 HE-01205-07 ll. pp 200 Na OP 5020RSes el Lg Ree 2040028025 00 14130AM) tile:///JI/.., ag_ORpt/Appendix ,o20D o20Muni ,o20FD ,o20Site/;_0Summaries Rosetnount, Well %-0Log ,o_0Report %20- ;~000_1227g.htm[l 0/27/2008 11:11:30 AM] 22330891 state 02827403 2233.0591 STATE_02827403 * SSaarrtteellll LLeeSSaauukk 22223333..00559922 STATE 02827404 STATE_02827404 SSIITTEE SSUUMMMMAARRYY Site Name: Site Name: SSaarrtteellI--LLeoSSaauukk Fire Fire Dopartment: Department: ~~ 2SSa0arr4tte"ollI--LALeovSSeaasuukk FFiirree DDeeppaarrttmmeennt 2Sa2r0te4ltnl MNAve. $S6.377 Sartell, MN 56377 Site Contact: Site Contact: K3K2ee0nn.2HH6ee0iim.m8,F0Fi1ri7reeCChiheieff 332200-2.6805-660.1174a07x 320-656-1407 fax TrainingLocation Training Location: Likely a re ha, 2240 Ave. 5. Likely at fire hall, 220 4th Ave. S. Training Location Coordinates (XY): Training Location Coordinates (X,Y): Type of foam usin eairidng: Type of foam used in training: FoFoaamm ttraaiinniinngg ffrreeqquueennccyy:: FFooaamm uussee ppeerrttraaiinniinngg eevveenntt: 40575766, 505152366 405757.66, 5051923.66 AAQnRReA-rAF:FFFEDF:a: wAAnnngdgueussh soap. Other: Dawn dish soap Annto utianall Annually to bi-annually Less than 5 gatos Less than 5 gallons SSppeenntt ffooaamm ddeessttiinnaattiioonn:: Annualfoam use: Annual foam use: Ground Ground AAHRERXA-:AFFFFE40F::ga""lnnoootntmsmuucchh"" HiEx: 40 gallons Nearest surface water: Nearest surface water: Nearost wetiand: Nearest wetland: MMiissssiissssiipppii RRiivveerr aapppprrooxxiimmaatteellyy 141/4 miemile eeaasstt Loss than 118 mi to he wast and to the southeast Less than 1/4 mile to the west and to the southeast Karst Area: Karst Area: Nearest water wet: Nearest water well: Nearest Wellhead Protection Area: Nearest Wellhead Protection Area: NANesaesraereessssttmSSeoonuutrrcAcereeWW aa:taeterr Assessment Area: SITE RANKING: SITE RANKING: Steisnotlocated in a kart area. Site is not located in a karst area. Loss than 14 ie northeast Less than 1/4 mile northeast Loss than 1/4 mie noth Less than 1/4 mile north More than 1 mie More than 1 mile 1s 15 22223333..00559933 STATE 02827405 STATE_02827405 AREER Rae iL SSAARRTTEELLLL--LLEESSAAUUKK CCWWII WWeellll MMaapp w<lC bl L URE mAe AB eXl E SeS g H {NoLai Wrelelaheeandd "T||e n ETE othCeAlT laEBlgeeeEdT S ER ER E sa TRE fe ThAiiTi do edEee 1 TT odoso bfooangatbe B e OL NEe S (A Ts ETLES hg) Arn | [ll Nye Re NN 2 WB e? r b --~ "1 TE AY rah F al Ll ey ale a Ben e hoe SIER| n ae IN h NE STCRREeE SBAOTF aNlIuTRO CiEy N W CL e ale Co INIESSY CUE fay dP A CLT NR 135955 fAinS d VeIe ISL ESEgS R[a\(hye Fae pel CC n o VE y TREEAN he Ea PI R RE ETESe TTeSmE LO|OUNR Aa NEpas JNTOA Lot Bhee ccl ob lCAINNE S E spate UH Le NC m84 omenos m" S|cam + 22 pe > 1, C(h ANEE 22223333..00559944 sre czs27406 STATE_02827406 Nawl : ! Vv IsdfGaiidlg,aiH Hid h FaEb I pEs hd i a oe p= p= : F we gr 2| : Sod : i : 79 8 Cade Fr Bis g ii zi 3 z3 |i 4g oe B2d 3 1 4: oR ik Bim 22 im0 Ei Er { h5E kL | =~ 3 iH iis 18 iB 4: i Bh ee i re h4e i er nee fiil 22223333..00559955 soe casero STATE_02827407 _Sartell-LeSauk What'sIn My NeighborhoodMap Le Etl ==8!! / nny - e fii re y NVy! | | fms i i | | 1 a gl Eff pean, (E 1 he NST | | Eateriesi I > DT pe wa e EvE] | |b[ od hS ed I e e TeE e \ 13 \ w/e. | 3Ha mmm.)RWR n fo F | NEL Em | | WU XN Ne 43 i rlYn = ro[teottaoraSaootvroaNStuvpeSoeNrniundZeA Disclaimer: Map and site information is believed to bc accurate but accuracy is not guaranteed. No portion EET | eee of th~ iufonnatit~n sbt~uld b~ ~nsid~~d t~ b~, or used as, a l~gal document. The information is provided subject to ~e exwess condition that ~e us~ ~owingly waiv~ any and all claims for clamages aga~st ~ ~CA thai may arise from the use of this data. oravtnyaRnumgvirisunudn @Minnesota Pollution Control Agency | vr one meson 2+rBoanm Temeto.ns Gras 22223333..00559966 stare ozs27a0s STATE_02827408 WallogReport 13955 Wcll Log Rcport - 00135955 113356998555 | aFzA, Minnesota Unique Well No. County Quad Quad ID izStearns St Cloud 156C YVell Name NEUMANN, DR. MYREL Bn -ownehip Range 125 28 nvDir Section W 27 ee Subsections BCBCCD oes Elevation Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~7~z~LL ~I~]~[} ]}ORI]~G RECORD ~O~ Minnesota Statules Chapter 1031 Well Depih SF mre 1054 ft 7 5 minute topographic map (+/- 5 feet) 76 fl Depth Completed 76 ft. man Entry Date Update Da:e fbi Received Date fu04117/1988 0~/30~1993 Date Well Completed 05/2511977 Drilling Fluid -- ree Use Domestic I Wall Htdrofractured? ~ Yes ~ No I From :t to Ft Casing Type Steel(black or bwcarbon) Joint Welded Drive Shoe? 3 RT BE No Above/Below 1 fl ~ Yes ~ Casing Diameter Weight Hole Diameter 6 in. to 76 ~. Ibs./ft. 6 in. to 76 ft. Well Address ets} is RIVER RD N ST CLOUD MN Geological Material SAND HARDPAN GRAVEL + WATER GoColor YELLOW YELLOW te Hardness SOFT HARD NO REMARKS omFrom 0 8 62 Open Hole from 62 ft. to 76 ft. Cums Swans Screen NO Make Type Diameter To Slot/Gauze 8 62 76 leh Length Static Water Level fi from F)ele Me~eured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. oGsoommones Bsowtomen Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No SuBeen Set Between Located Minnesota Geological Survey meron Unique Nu"nber Verification Information from owner gystem UTM Ned83, Zone15, Meters Method D igitized - scale 1:24,000 or larger (D igifizing on sn Table) Date N/A X 406359 Y: 5051384 Fimt Redr~k Note faa Last glrat Gravel (larger) Aquifer Quaternary Undi'f. Depth to Bedrock ft. may Woh dex Bois Reon County Well Index Online Report Nearest Known Source of Contamination _feet __direction __type D SE a AS Ewe t Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed 0010011977 Man ufaclurer's name GOULD Model number 25EL15412 HP0.5 Volts Length 01drop Pipe 13 ft. Capacity_gp.m ype Submersible Material Galvanized AbandonedWells Does property have any not in use and not sealed well(s)'~ [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell7 [] Yes [] No Well Contractor Certification Donabauer Well Co. 11C3355e9955e55 , License Business Name 73061 LIB, PPrrineteddoG9/1e9/2EOO8 Lic Or Reg. No DONABAUER G Name of Driller HE-01205-07 lp20n 0 Mm D1 5 SotsSrl 201 5a Nel0g 20.200 SSS M1027 308 11516 AM tile:///J~..t/Appendi~%2~D%2~Muni%2(~FD%2~Site%2~S~nnmaries/Sarte~%2~LeSauk/We~%2~L~g%2~Rep~rt%2~-%2~ 135955.htm[10/27/2008 11:13:16 AM] 2233.0507 state 02827408 2233.0597 STATE_02827409 log on 21533 Wcll Log Rcport - 00215302 221155330022 | wzim. Minnesota Unique Well No. County Quad Quad ID izStearns St Cloud 1560 Well Name SARTELL 1 BB -ownehip Range Dir 125 28 W Section 21 ome Subsections DDBABB een Elevation Elevation Method Well Address MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING WELL AND BORING RECORD RECORD Minnesota Statutes Chapter 1031 man Entry Date Update Da:e fbi Received Date 04117/1988 02/25/2008 Well Depih Depth Completed Date Well Completed Serr me 1017 ft 7 5 minute topographic map (+/- 5 66 ft 64 ft. 00/0011958 feet) ~=~'!!~!~ ~!~ =::.............................................................................................................................................. Drilling Fluid -- I Wall Htdrofractured? [] Yes [] No ] From :t to Ft A EE Use Abandoned Status Sealed Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below ft Casing Diameter Weight Hole Diameter 12 in. to 49 ft. Ibs./ft. eins SARTELL MN 56377 Geological Material BSEY image FINE SAND CLAY, ROCKS, AND WATER CLAY DIRTYGRAVEL & FINE SAND SAND AND GRAVEL MARL cor wn gon Color Hardness From Hews 3:0 GRAY 5 BROWN HARD 22 35 39 64 REMARKS NURE NO.602176. WELL DRILLED BY MEAD WELL CO. FROM GRAND RAPIDS WELL IS LOCATED IN THE ENTRANCE TO THE CITY PARK, IN THE PUMPHOUSE WELL SEALED 10-17-2003 BY 73646 = ORIGINAL USE PC - COMMUNITY SUPPLY Located Minnesota Geological Survey Unique Nu'~ber Merification Information from owner System UTM - Ned83, Zone15, Meters Method GPS SA On (averaged) Date NIA X: 406030 Y: 5052399 Open Hole from Screen Make plore To Diameter 5 22 35 3339 it. 1o Type sms ft Slot/Gauze 54 56 Static Water Level )) fl from I end surface Date Msas~Jred 1958 PUMPING LEVEL (below land surface) 32 ft after hrs. pumping 415 g.p.m. tr Length oso ons Well Head Completion Pitless adapter manufacturer otModel []Casing Protection [] 12 in. above grade []At-grade (Environmental Wells and 3orings ONLY) Grouting Information WelIGrouted? [] Yes [] No satore Set Between Nearest Known Source of Contamination _feet __direction __type Well disinfected upon completion? [] Yes [] No Pump [] Not Installed Date Installed Manufacturer's name Model number__ Length of drop Pipe_ft. Capacfly_g.p.m HP_ Type Volts Material AbandonedWells Does property have any not in use and not sealed well(s)? [] Yes [] No First Redr~k CmfaceolJS Regelith ee ee ar Last Strat CretaceousRegolith Aquifer Quat. BuriadA~tes. Aquifer Depth ta Bedrock 64 ft. oars hos eden Bos Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contrador Certification United States Geolooical Survey 721155e330022e License Business Name USGS a ar Lic. Or Reg. No Name o1 Driller Pre SE Printed 9/19/2OO8 HE-01205-07 lp20n 0 Mm D1 5 Sots orl 201 5a Nel0g 20215 M1027 308 11517 AM t~e:///Jl/~..t/Appendi~/;2~D%2~Muni%2(~FD%2~Site%2~nnmaries/Sarte~%2~LeSau~UWe~%2~L~g%2~Rep~rt%2~-%2~(l215302.htm[10/27/2008 l 1:13:17 AM] 2233.0598 sate 02827410 2233.0598 STATE_02827410 log Ron Well Log Report - 00236198 Minnesota Unique Well No. 22366119988 wmCounty Quad |.Quad ID i=Stearns St Cloud 156C Well Name SARTELL 2 BB -ownehip Range Dir 125 28 W Section 21 om Subsections DDBBAA een Elevation Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING WELL AND BORING RECORD RECORD Minnesota Statutes Chapter 1031 mn Entry Data Update Da:e fbi Received Date 0910811992 02/25/2008 Lr 1016 ft 7 5 minute topographic map (+/- 5 feet) Well Depih Depth Completed Date Well Completed mee64 fl 64 ft. 00/0011959 ~[!!l!9~g_M!P~ = :2............................................................................................................................................. Drilling Fluid -- I Well Htdrofractured? [] Yes [] No ] From :t to Ft FA Use Abandoned Status Sealed Casing Type Steel(black or bwcarbon) Joint No Information Drive Shoe? [] Yes [] No Above/Below 0 ft Casing Diameter Weight Hole Diameter Well Address ante err SARTELL MN 56377 cscs nw Geological Material FINE SAND CLAY, ROCKS, AND WATER Rea CLAY DIRTYGRAVEL & FINE SAND SAND AND GRAVEL MARL --Color GRAY haBROWN -- Hardness HARD From To 0 5 5 22 so 22 35 35 39 39 84 64 84 12 in. to 39 ft. Ibs./ft. Emer Open Hole from it. to ft ea Screen YES Make Type Diameter SlotlGauze Length Set Between 0 25 39 ft. and 64 Static Water Level ft. from Date Measured PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. REMARKS USED WELL LOG FROM WELL NO.1 WHICH IS 25 FT. TO THE EAST. WI-LL ShALl-L) 12-23-1999 BY/1536 ORIGINAL USE PC - COMMUNITY SUPPLY E ts ts ues asrs anes Located Minnesota Geological Survey Unique Nu'~ber ~/erification Information from owner "ER= E wan System UTM - Ned83, Zone15, Meters Method GPS SA On (averaged) Date N/A X: 406000 Y: 5052402 riaetesavneset First Bedrock Cretaceous Regolith Last Slral Cretaceous Regolith pSyhgaut ess te Aquifer Quat. BuriedArtes. Aquifer Depth to Bedrock 64 ft. CCoouunnttyy WWeellll IInnddeexx OOnnlliinnee RReeppoorrtt Well Head Completion Brenan seangtoun Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade [] At-grade (Environmental Wells and Borings ONLY) Grouting Information WelIGrouted? [] Yes [] No i Nearesl Known Source of Conlaminalion __feet __d~rcction __type Well disinfected upon completion? Be [] Yes Be [] No Er Lr Pump [] Not Installed Date Installed Manufacturer'sname LengtholdropPipe_ft. Model number HP 0 Volts Capacity400 g.p.m Type Subnqersible uneMaterial Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes baneaien Well Contractor Certification Minnesota Geolooical Survey License Business Name edw=n MG~S Lic. Or Reg. No. [] No win Name of Driller 223366119988 PPrriinted 99//1199//22000088 HE 01205 07 lpn 200 Mm D15 SotsSrl 201 5a Nel0g 20 OSES M1027 308 11517 A sate 02827411 2233.0599 STATE_02827411 2233.0599 Wall Lg Ror 461850 Well Log Report - 00461830 we] Minnesota Unique Well 461830 No. Ewm E Caunty Quad Quad ID Stearns St Cloud 156C Well Name GALLIPO, WILLIAM -ownship Range Dir Section Subsections Elevation 125 28 W 21 CACCBC Elevation Method EN Well Address 808 1ST ST N SARTELL MN 56377 WEBLLLIATNDRBOONRNING MINNESOTA DEPARTMENT OF HEALTH ~7~L~LL iJll]~[} ]]ORIi~G I~J~C O~a~ Minnesota Statules Chapter 1031 1040 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 60 ft Depth Completed 60 ft. mon Entry Date Update Da:e Received Date gam 0712011992 0T/30/1993 Date Well Completed 05/1011990 -- Drilling Fluid Bentonite Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Steel(black or bwcarbon) Joint Threaded No Above/Below 0 ft Drive Shoe? [] Yes [] Casing Diameter Weight Hole Diameter 4 in. to 56 ft. Ibs./ft. Erm Open Hole from it. to ft Screen YES Make JOHNSON Type stainlesssleel Geological Material CLAY SAN [] = CLAY SAND Color Hardness BROWN HARD BROWN SOFT BF GRAY BROWN HARD SOFT From To 0 27 27 32 ii 32 53 53 60 Diameter 4 SlotlGauze 20 Length 4 Set Between 56 ft. and 60 Static Water Level 27 fl from Land surface Date Measured PUMPING LEVEL (below land surface) 0 ft. after hrs. pumping 30 g.p.m. 05110/1990 -- NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade Bren rerio yen [] At-grade (Environmental Wells and Borings ONLY) Ce ms rsa Gre Grouting Information WelIGrouted? [] Yes [] No J Located Minnesota Geological Survey Method Digitized scale 1:24,000 or larger (Digitizing Table) Toe reso. Unique Number Verilication Information from cwner ,System UTM - Ned83, Zone15, Meters Date N/A X 405108 Y: 5052505 ot rate ot emt sie First Bedrock ion ue Shey Last Slral Sand brown Aquifer Quab BuriedArtes. Aquifer Depthto Bedrock ft. County Well Index Online Report County Well Index Online Report Nearesl Known Source of Conlaminalion 50_.9._feet Ldircction Seutic lank/drain field i AR Well disinfected upon completion? [] Yes type [] No Pump [] Not Installed Dale Installed 05/11!1990 Ee iii Manufacturer's name GRUNDFOS Model number 10S05-9 HP 0.5 Volts 23._.0.0 Length 01drop Pipe 42 ft. Capacity10 g.pm Type Submersible Material Galvanized Abandoned Wells Does property have any not in use and not sealed well(s)9 [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes Well Contractor Certification T in Pm wanis G & M Drillin(~ 73542 rr LSE. ER License Business Name Lic Or Reg. No. [] No MAJERUS. S. Name of Driller 446511883300 PPrriinntteedd S9//1799/122000088 HE 01205 07 le pe 0 Mi DY 30Smts Sarl So Nel0 Regn 20ZOOM 1037208 11315AN SsTaArTeE0_208282277441122 22223333..00660000 WeogRelport 8631 Wcll Log Rcport - 00486424 o4864i24 ],FE Minnesota Unique Well No. Caunty Quad Quad ID Stearns St Cloud 1560 man om een Well Name BOECKMAN, RALPH -ownahip Range Dir Section Subsections Elevation 125 28 W 21 DDCCCC Elevation Method WERLiL iANmDaBOnReING MINNESOTA DEPARTMENT OF HEALTH ~TELL ~i~]~[} ]]OR[i~C~ ~J~C O~J~ Minnesota Statules Chapter 1031 moime Entry Date Update Da:e Received Dote 12115f1991 0T/30/1993 Bo) 1032 ft 7 5 minute topographic map (+/- 5 feat) Well Depih 76 ft Depth Completed 75 ft. Date Well Completed 0510311991 ------------------------ Drilling Fluid Additive (+ Bentonite) Use Domestic ~ Well Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Plastic Joint Glued Drive Shoe? []Yes [7]No Above/Below 2 ft. Well Address 5 RIVERSIDE S SARTELL MN aars ress Geological Material CLAY CLAY CLAY SAN [] SI LTY CLAY SAND + GRAVEL CLAY sfgyn Color BROWN GRAY BROWN BROWN BROWN BROWN BROWN tn Hardness Casing Diameter 4 in. to 57 ft. Weight Ibs.fft. Hole Diameter Open Hole from it. 1o ft a 0m kfo From 0 19 Screen YES To 19 Diameter 33 4 w0 s gT a SuT p Make JOHNSON Type plastic SlotlGauze 12 Length 4 Set Between 71 ft. and 75 33 36 36 39 39 57 57 76 Stagc Water Level 76 76 ft. from Dale Measured PUMPING LEVEL (below land surface) 70 ft after hrs. pumping 20 g.p.m. To NO REMARKS Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade Bruntner rt ao [] At-grade (Environmental Wells and Borings ONLY) ns mies Wasa Ba Grouting Information WelIGrouted? [] Yes [] No i ety Located Minnesota Geological Survey Method Digitized Table) 503| Goa scale 1:24,000 or larger (Digilizing Grout Material: Grout Material: Neat Cement Bentonite wmween o from 7 to 37 ft. 0 from 37 to 60 ft. 0 oe rt st Unique Number Verification Information from c,wner System UTM - Ned83, Zone15, Meters Date N/A X 406086 Y: 5052206 Nearesl Known Source of Coataminalion _feet _direction _type Nts 0 ve 0 Well disinfected upon completion'? [] Yes [] No Pump [] Not Installed Dale Installed 0711011991 creGATE Won OL V2 Manufaclurer's name GRUNDFOS Model number NP 0 33 HFaRA 1 Length of drop Pipe 40 ft. Capacity_gp.m -ype Submersible Volts 23._0.0 Platerial Plastic Abandoned Wells Does property have any nol in use and not sealed well(s)? [] Yes [] No First Bedrcck ise cao prin Last Slral Clay-brmNn Aquifer Quat. Buried Aries. Aquifer Deplhtr~Redreck ft `County Well Index Online Report County Well Index Online Report Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No rrr Wall Contractor Certification Traut M i WellCo License Business Name 448866442244 womgr 71536 Lic. Or Reg. No. urmiber BRUCE/ROBBIE Name el Driller Fie tigan Printed 9119/2008 HE 01205 07 1. pdOHT 0M 4S rcSal 201 Ss Nel2g Regr 204 0613 Hl1027 2008 11313 AM) state 02827413 223.0601 STATE_0 2827413 2233.0601 + WWoollvveerrttoonn 22223333..00660022 STATE 02827414 STATE_02827414 SSiittee NNoammee:: FFiirree DDeeppaarrttmmeenntt:: SSiittee CCoonntatactc:t: SSIITTEE SSUUMMMMAARRYY W Wooilvveerrttoonn WWPoOolBlvveoerrxttoo7nn FFriree DDeeppaarrttmmeenntt `WPWOoollvvBeerortxtoon7n,, MMNN 5566559944 M2Mi1ikk8ee.9TT9rr5aa.ccy2y,5,2FF5iirree CChhiieef 218-995-2525 TTrraaiinniinngg LLooccaatitioonn:: GGrraavveell rroaadd iinn ffroonntt ooff fiirree hhaallll aatt 330011 HHiigghhwwaayy 7755,, WWolovlveertrtoonn.. TTrraaiinniinngg LLooccaattiioonn CCoooorrddiinnaatteess ((XXY,Y);): 221133882255..9988,, 55116633444400.6611 TTyyppee ooff ffooaamm uusseedd iinn ttrraaiinniinngg:: CCClllaaassssss BAB' AAFSFiFFvF:o: xAAnnssuulliftee 33%% Class A: Silv-ex FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: SSeemmkia-annnnuuaall FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: LLeessss tthhaann 55 ggaatlloonnss. S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: Ground Ground AAnnnnuuaall ffooaamm uussee:: ClCGallaassssss ABB AAFLFFeFFsF:s: tLLheaenssss1 thghaaalnnlo11n gallon gallon Class A: Less than 1 gallon NNeeaarreesstt sSuLrirffaaccee wwaatteerr:: IRInnettdeermRrimitveteenrnttlosscttrareteaeadmml1el/es4ss1s0tth1ha/a3nn m11i//44e sswooeuusttthhwwesets,t, which which drains drains 0to the. the Red River located 1/4 to 1/3 mile west Nearest wetland: Nearest wetland: 11416173 mie 1 the noth and south 1/4 to 1/3 mile to the north and south Karst Area: Karst Area: Sie is not located ian karst area. Site is not located in a karst area. Nearest water well: Nearest water well: 1721601 mile northwest 1/2 to 1 mile northwest Nearest Wellhead Protection Area: More than 1 mic. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeW aW:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilee SITE RANKING: 7 SITE RANKING: 22223333..00660033 STSATATTEE0_208282277441155 W WOOLLVVEERRTTOONN CCWWII W Weellll MMaapp duobd }i = ! 1 i: Tita. AE Bmo dEPY EA | eLodh a mbes csnomadtnenf__[] EN J ey, Es) || vo ) YT | jl A #r Said B ! EAL SS mf rl re AA 17 3 7 LR abe oN r CSTE ESE SSE NU Wl Fath Nhe CCoora bid odo th so val gNaah iin WF ee Nar iin w=gE he -YSN \ LE 4 i . Do Vin ra i Lp 8 Y SUCE T IT enppreannGsoneon corey {5 JLo] opti i. 2233.00660044 Jp-- STATE_02827416 2t sHiiHil ii i 1 :i ] ow Tin HHL hf hth i. TE a - p= 3 i i 2 ` g ve2 : ; 3 --~ | le :i 84 =i i || N|l| > MA i : i oo sl i 22 N72 \ | i 5 Ji i i & ii ew rol iil puiaial ew 22232333..00660055 STSATTAET_E0_202882277441177 | WolvertonWhat's In My Neighborhood Map ||| . | || |Wm AEE | ETT \i | ------ | Os || J SITEa S| | | { | Sn EH Lo TTT ---------- || i1 |{ || i: || A 1i E | l ||[[ menE e T eTeREE || Disclaimer: Map and site infonuation is believed to be accurate but accuracy is not guaranteed. No portion of the it~onnation should be consid~-ed to be, or used as, a legal document. The infoxmation is pxovided subject to the express condition that the user knowingly waives any and all claims for clamages against ]VIPCA tha! may arise from lhe use of this data. | | @#innesota Pollution Control Agency | | upBa eomtnisn act stSuopsomriauns | var srcoecoumns rome supnrn ee Vy a, +RsRRouRAAoTw oSrBervaeo nmns Cn han 22223333..00660066 sare ozs27ans STATE_02827418 WallogReport 017573 Wcll Log Rcport - 00175735 Minnesota Unique Well No. 117755773355 wmCounty Quad |i.Quad ID ae Wilkin Wolverton 241C en we crs Well Name PETERSON, VICTOR -ownahip Range Dir Section Subsections Elevation 136 48 W 2T BCABAB Elevation Method MINNESOTA DEPARTMENT OF HEALTH WELL AND BORING ~TELL ~i~]~[} I}OR[]~C~ RECORD ~J~C O~J~ Minnesota Statules Chapter 1031 mn Entry Date Update Da:e fbi Received Date 04117/1988 02/04/2004 remem TT 930 ft 7 5 minute topographic map (+/- 5 feet) Well Depih 60 ft Depth Completed 60 ft. Date Well Completed 06/1711983 ee Drilling Fluid -Use Domestic ~ Wall Htdrofractured? [] Yes [] No J From :t to Ft Casing Type Plastic Joint iko Information Drive Shoe? []Yes [] No AbovelBelow 1 ft. Casing Diameter 4 in. to 54 ft. Weight Ibs./ft. Hole Diameter 6.25 in. to ft. Well Address RR1 WOLVERTON MN Geological Material TOP SOIL CLAY CLAY SAND LENS Color BLACK. YELLOW BLU E WHITE Hardness SOFT SOFT M EDI U M MEDIUM From 0 1 18 54 Open Hole from it. to ft Screen YES Make JOHNSON Type stainless steel Diameter To 3 1 SlotlGauze 12 18 54 60 Stagc Water Level Length 6 Set Between 54 ft. and 60 12 fl from Land surface Date Measured 06t17/1983 PUMPING LEVEL (below land surface) ft. after hrs pumping g.p.m. rerREMARKS PLASTIC CASING vt empty Located Minnesota Geological Survey Unique Number Verification Plat Book System UTM-Nad83, Zone15, Meters it Sr te A Method Digitized - scale 1:24,000 or larger (Digitizing Table) Date NtA X: 215293 Y: 5163989 First Bedrcck ire son Samy Last Slral Sand-white Aquifer Quat. Buried Aries. Aquifer Deplhtr~Redreck fl Gounty Well Index Online Report County Well Index Online Report Well Head Completion Pitless adapter manufacturer Model []Casing Protection [] 12 in. above grade ren eruaneiogn [] At-grade (Environmental Wells and Borings ONLY) Es Tw Be Grouting Information WelIGrouted? [] Yes [] No Grout Material: Bentonite from to ft. 1 yrds. Nearesl Known Source of Coataminalion _feet _direction _type Sodoar 0 10 8 5 Well disinfected upon completion'? [] Yes [] No Pump [] Not Installed Dale Installed 0611911983 er eee wnze Manufaciurer's name GOULDS Model number 7EH05412 HP 0 5 Volts 23._.0.0 Ce err i Length of drop Pipe 40 ft. CapacityT__,g p.m Type Submersible Material Plastic Abandoned Wells Does property have any hal in use and not sealed well(s)') [] Yes [] No Variance WasavariancegrantedfromtheMDHforthiswell? [] Yes [] No Well Contractor Certification Folk eros Well Co 11s77m5577b33a55mre License Business Name site 91204 Lic Qr Reg. No. rie FALK J Name of Driller Sa Printed 10/23/2008 HE 01205 07 ll. Ap2p00eOnad 90520S Wel 0g ea30230158 1037 X08 11.15.04) SstTaAtTeE0_202882277441199 22223333..00680077 AAppppeennddiixx EE SScchhooooll TTrraaiinniinngg SSiittee PPrrooffiillee ffoorr SSiittee RRaannkkeedd PPoosstt--JJuunnee 3300t"h RReeppoorrtt NoNrotrhthllaanndd CCoolllleeggee,, EEaasstt GGrraanndd FFoorrkkss 22223333..00660088 STSATATTEE0_208282277442200 SSiittee NNaammee:: SSiittee CCoonnttaacctt:: SSIITTEE SSUUMMMMAARRYY 2NN0oot2rtt2hhilCaaennnddtaCColollAlleevggeee--nEEaaNsstEt GGrraanndd FFoorrkkss 2Ea0s2t2GCreanntdraFl oArkvse.nuMeNNE58721 East Grand Forks, MN 56721 D2D1aa8vv.ee73HH2oo.ee2ffe5er5r0 218-793-250 Training Location: Training Location: TTfihhrrrieeieeghlloionccgaattbiiouonlndssinoognn, ccaaammgprpuausss:s:yaaarggerraaaasssstyytaahrroeenaaonrnotorhrttwhheosoftfctthoheemerof firefighting building, a grassy area at the northwest corner of bcuaimlpduisng, and a parking lot on the south side ofthe firefighting campus, and a parking lot on the south side of the firefighting building. Training Location Coordinates (XY): Training Location Coordinates (X,Y): 221090090191727080..80.8666,,,555333111888131080242..888115 2109091952281.90,6,55331188309645.4865 200152.19,5318065.46 TTyyppee ooff ffooaamm uusedsiinn tetrraaiinndiinngg:: CGClllaaassssss BBBAAPFrFFotFFeF:in:: 33%n%olCChshueermmeggbuuraaarnrddd, historic use. Class Class Class &: Chemguard B Protein: not sure A: Chemguard brand, historic use FFooaamm ttrraaiinniinngg ffrreeqquueennccyy:: OOnncceeppeerrsseemmesetseter,r, ssppriinngg aanndd ffaalll FFooaamm uussee ppeerr ttrraaiinniinngg eevveenntt: 22001to02255 ggaatltloonnss: S`Sppeenntt ffooaamm ddeessttiinnaattiioonn:: TTpaoortkthhieenggglorroouutnnrddainiIninnttghheseigeg.rraassssyy aarreeaass,, ftootthhee ssttoormmsseewweerr nintthhee parking lot training site. AAnnnnuuaall ffooaamm uussee:: CCGlllaaassssss B8BAAPFrFFtFFeFi:n:: 4400unggkaalnlllooonwnsns Glass Class Class AAB:: 10 gallons. Protein: unknown 10 gallons NNeeaarreesstt ssuurrffaaccee wwaatteerr:: RReedd RRiivveerr,, 33//44 11 memile ssoouutthtwweesstt Nearest wetland: Nearest wetland: 17210 36 mil northwest 1/2 to 3/4 mile northwest Karst Area: Karst Area: Siois nt located ian karst area. Site is not located in a karst area. NNeeaarreesstt wwaatteerr wweellll:: MMoorree tthhaann 11 mmiilee Nearest Wellhead Protection Area: More than 1 mie. Nearest Wellhead Protection Area: More than 1 mile NANeseasarereessssttmSSeoonuutrrAccreeeaW W:aatteerr Assessment Area: MMoorree tthhaann 11 mmiilee SSIITTEE RRAANNKKIINNGG:: 5 22223333..00660099 STSATATTEE0_208282277442211 NNOORRTTHHLLAANNDD CCOOLLLLEEGGEE,, EEAASSTT GGRRAANNDD FFOORRKKSS CCWWII WWelelll MMaapp i ts i: "Loup Li[aRnVR] nly reo Fes ANC - I Toon Rem to { CEi ee : a aAlni ERC od --- on IH Hoa i aoa TET ered LL sie I NEon i TH r of | Vy fo fe Toobg ys id Ly BARR op ) of Lt Bik EpEoE SEaELL a LT Aam= NL og imenrtly SLCL fo iy BORO fy er Coif os S S SaoA T Ae yRIE e e )eyafi[Fai LT , oe i of ad } [sl MwoNSSVSee (pT ee0 as, dhwel wn) LH oo #W ee !Ii JolslR )I T Ea A i. E E mT el: RE | i SShLa [T Clade or Tp EL m =y ENi Ei S EE an ia eH RBAyL \ SEERaA lOFS AGA H RAD| vos W i EiEe. BANG OA ne a RELg mE AMommomnsiiion Sader onsoem | ps 22223333..00661100 state oas2r422 STATE_02827422 il } : i Hh 0 2 EERE] 5,1 FE3RE 2 3 ] Vv Gsinidpg, dii haHNbhs il a mn 47-58 N aN 47-57 N [ PH A47r-s56onN . . . . . . . . . . . . | 3 0 LY 5 i l- 27 15 2| $3 Bl5l|g et3 i i3| {i IF g 43 -- AVV.APEy y[#8 8 + HOTS i | Len) 5HE o Z i ad ~~ 2 SVlE i SE i be : ww i oa| Hil 22223333..00661111 soe caserazs STATE_02827423 NorthlandCollege East Grand ForksWhat's InMyNeighborhood E1| e Eng | pl |Jessep i 1|{Ei {| { || [EEE ---- e| |l=igtiie er, || abr eaad ihigizhich : { | pdVi ed pistl Co se pi 4 JL dee Sl) = -- | Ean | : NeyylThy Ld iil | | aCaTaEh oH A NGF Ahi Ll: i || -- Disclaimer: M~p and site information is believed to be accurate but accuracy is not guaranteed. No portion me OU of the information should bc considered to be, or used as, a legal document. The information is provided [EERE IEEE | subject to the express condition that the user knowingly waives any and all claims tbr damages agahast MPCA that may arise from the use of this data. | @Minnensoostoata PollutionPolution ControlControlAgenAgency | L Sec"StSlUimnSupru = Ponsa G~i~ ~L~at~ ~UlP~rfu r~l | vumpaomanaDangs ofcreirca r~Ln~ s oS[emrSheonplanetils 2EecSRRaTmSoDcFtartoomnes Chany ASumroosomont 22223333..00661122 state oas27424 STATE_02827424