Document 4B4bMj3bMxpEJ48OgMmgKKYe

FILE NAME: Abex (ABX) DATE: 1947 DOC#: ABX082 DOCUMENT DESCRIPTION: Industry Recommended Practices - American Brakeblok Ready Reference Brake Service Guide ) ) H P A K T | fM iN n CLlJTf !! rACK-if-S TAN BELTS "ADIATOR HOSE S C F - ABEX-0400 rm/w ni'i AMERICAN BRAKE SHOE COMPANY AMERICAN BRAKEBLOK DIVISION D E T R O IT 9, M IC H IG A N c o m mom <94/ no ami ihcah iiiiaki ^nor co I'niN i r o in u.9 a , jom 4 i;w 1- - - .............................. ..... TABLE OF CONTENTS \ ir\\i>ul ( * m i .i! lnMt iu imns 1 m kltt i ti \ lyiSi.nilii iW.tki's 1 m il 1I w l .......In I t i . i k i 1') I'J. I'M / t m kin i! S H- \il|usnni> Hi ik* \ til HiltS 1C\all .Ittill .11V < >|M t ill (1 Hi ,k< * tl( Hilts '1 uft.Mint*, A i h Iiui Hi.tkr ( M m 1i. i (Mr ,iliy ( )ju i,i|r (1) H n u t i s I u i h S I h h , t)tmlil< A m hoi Hi.tkc* ( M u lunti ti) t`iiiil Ht.iki s -- f * i\,}- \ \ ` i 1 ( M f i li.mii ,il) I n n ! I t i.i k is -- I ' H ' i - V i ( M n li.tnii ,il) I m i l lli.iki 1737-38 (M et li.mii <il) 1Ini k Hi ,iki*s-* Mc i.Krtl 111ii k Hi .iki s-- Its ilt ,t HIn .ill v ( ) j h nit <1 1 Mi t ii il '1 \ |ir Ikind lli.iki". W.ll'lll 1 1II* 1(Ilk lil.tkcs ' 1nnki'ii "111'" (Hn.il I ' m i u i y III,ikcs) , V. if mini I'i . u m tiiitki* !,(|i(ijnnrm An Hi.ike 1 ifinpuirnt S id| i|iiim' t >m ini< ( Jhnri ludi s i if Hi,ikes U srd cm (kits 3 . 3 7 1 1 12 Id 18 r> 21 22 23 23 2d 28 111 33 3(i 37 32 33 ) .1 s Ready Reference Brake Service Guide FOREWORD I HU Jil.ikc .Si rvu<* (hlldc ll.lt 111 I 11 pii p.ucd feu (hr assonante ,iml infoi muuoo of brake sri vn e stations .mil other o ik.hu z.ttions .imi individuals inteirstrcl m dir relming .I'd inaintcnaorr of nutmuoiivt brake's No ademp li.it tim i made lo go into compii lr details of the full malmenante of llic Vfinom types of htakrs `I hr iminirlimit nml tfcomiuciui.Kioiu li.ivr been confined m utely (o fin non r<coiunirn* dntieint, adjustin' nit, ami invio* lufps In ptrpaiing (Ins guide ,in eiloti !ta\ lim i in.idr (n to mr.mgt ilir t ontents lli.it infoi in.Hum it easily available and is not complicated All 1 if (In prim 1p.1l lypt 1 ol brake Yftiipmt tu have hern lo w tt I hose found only on a few m a k ito r models of ears or i .u t produced lomr yeais ago have hern omitted Adjustment instrutiont and irroinuirmiatiunt for (lute can he supplied im applnalim All imuhanical teemmnciHlaiinnt such as clr.u an<*<s, c* , an hated on (hr prac- (ue of tin A inm can Ilinkrblok Sri vice Kugimets and will lie found to hr piac- tirally liir same at dime irnm unrndrd hy tin hiake innntif,ii H u m I( it dir hope eif (lie oiauufai turrit of Atnr in .in Hiakehlnk that dut (huele will hr found helpful ami ute fof to all (hotr <iiguipd ni htakt sm ite uoik Atutman Htakt Shut Ctt .Unworn Htnkthhik Dinntun GENERAL INSTRUCTIONS ttrake C on tro l System --It is impor tant that (hr brake cnm inl system of a motor vehicle operates prnptrly at all tunes A freely operating brake control systrin allows its return to ilir stop pievldcd I hit m ay he the toe-hoard, a set screw nt the foot pedal, or tomr tmt of lever ic d iin rest at a point on the chassis W hen a brake control system returns to its m axim um relented position n longer period o f operation can In e x p te k d be fore adjustm ent ignect stai y O n m echani cal hiake systems, it is ve y m iporiani to obtain the entree t angle htlw ecn the various mis nml levees heir the best h iake operation, the angle Im tween a reel and leve r should he <)o degl re t when the brake it applied O n met haemal brakes 3 (Ill I) II kl is|| HI p! IS sIlHIlM III1 pfl rill ll ill! Ill lk pi l| tl HI <| dll <>| II | I)Iu* ll M t i )h ll* iH11\ In n sin( In iki s, m ill' link mm 111i i i i i m i ' h n kl inIi tin ......Ii inn ituisi In sin lli i| hi 11ii s m| r s p u iil iln sltnis hu m tin u n h u i puts I In i un slim iM |t|s| ih m ii in i util n l u n i* (In i nils h | llu I ii ii k<' \| nn*s I In hsili min In iki s) sh thru should In tin mi 1, " In i* ]l is in llu 'lu .ik i pi il tl 1 hue ll it* pi s(i ii j m d ir IlM sIlT i sl- iiuli i In i'.iiis (u m in i iln I ii mk *np 11iik ii*i nn I m llin ti t Ii m - ii.il m il hsili min iita k r s\s| nix should in < iitlttllv <*s. imnth 11 Soini Itnti's llu* In iki Ii si is }i u` hum* lli m inn* lml<* in s%Im 111h r i |i m s pm tn a \ In* pl.u r d , I In sr ih lh iM ti pustturns p io d m e a suthr ni h nifi i luakt p u lt l, isdesurd / uln h tttioii-- !< mil ir lu liiii .Hum o f llu* iMMissity pulls o f a Inulie system is iiiipni (.m l, in o id r i in gi { free opi ration nl III- s \s |(|l| ,Sill It p u itt .IS till* (TOSS .ii ill lii .ii imts, < Ii s is <hum <turns, cnhie .mil t nuiluil i uiittois, nr .my titlirr moving p u t must ho h ih rn iled O v e r -lu b r im imn of the ft i hi ( u h r r l hearings, outer h ,u axle I k m ints, .uul <hih rcntinl must In* t*i11r<l<11 mt.mist to insure against i*i 1 m s n ik fil hi ike luting. W h en doing i In iki* pit, IFif im i It,iiu< should inspi rt iln i i .iso i< t m u ts and replace th< m if 111 I ( SN u s l lv t i n u V/j# /mgt-- T o lin s im the ie - 1 i*.1.u turn ul .t lu da* t untrui system thru In s M in iu Intu* m i u i *. iln* uninform ed iik i 11, 1111< si ii in 11 u ti s soil nisi ill .i<trli * iiu im I k n u ll .spurn's .it s.uiHtts ptiiuls in llu* III iki ( Hill M<1 XVsll HI t Ills ts <l< iri* iik i ii 11 In s iti\| m ihi s lii ike |H i fm m iiu c, n u n im s tin pi t l d pussuti and is tin in 11 s<>ii v It iiv im I I s u ill Iu (uiiiifl lh.il ( m i n i In I it ii 11j. hi , uni pinpf r ,iti p ist 111<u l, w ill pi nilm i s ni'1 it m iy oprrufintt of tin In iku ii iii im l vssh iu A ll leturu spimgs should I k i l n i k t d .nul ssc ik in hoik* " on* M i | i l m <1 Cttm sy -- b ra k in g trutihlc xwll I m* avoids d if die lu b iu a tm n nf llu* m ir isle .tin I fi out is Ik f 1 Im .trings is In li| to ih m i f i d sudi hi! hi mi m , heavy pult l pi i sstu I Ol possible St n Hist hi iki .llllilll si ill i<stilt m<l llu' mils i tin is 11 pt t<11ti* lli* In.tkt Ilium* il muidi'l iiituut hi* iHiiifs not nwf|\ s urn ,tii*d u'dli (Ik Inluit .ml it nt iv Ik* |H>ssihl<* (n n move die liihru.uit from llu* lining with high lest gust time lU / r k e D u n n s m u / 97m * c-- When In .tiers me srrvu ed, the drums should be <.ik hillyt x.in un* <1lor sun mg, In att h<< k* m* or pitting of the snrf.ii e hi .nliliium, (lie di inus should Im*hispei ted loi signs of chsloi imn mi {tiding sv.upmg, hell-mmitling, h u 11 hsli.ipiug .uni out-ufooitimIu< ss Ih.ikedtuinst ,m Fir ret until honed, pro siding die smte m.iiks .im not loo deep .uul the <111niis .ire nut too ninth out of .sli.qn. ('me should lu t.ikni nut (o remrivc ioo ninth niet.il Imaiise hums whit It .ire tot) thin he.tl up i.ipulJy mid distort omit r In.iking pu ssmii s It ts extremely iiu|kk i im m olil.tm the smoothest (ulisti jmissiIiIi on 11 <unihliimed brake dittms, Whtntv tr possible, (hey should he gimmd in .i xmouih (imsli. before repl.u nig die hums, .ill abrasivr and ms tai p.iriults should he re* moved During die first fi sv hundred ntilejs of driving, die hr.iki s should not Ik* nppln d .`my harder th.m nurss.iry fo r a rci ondiniHK d hr,ike dt uni is similar to a rrhotrd engine and niiist lx* " broken in" i-i-mi)' brake drums should he ret ondidoned equally in p m s , so tli.K llie two fiont dt urns are si nut n ami the two it ar di inns tie die same ( )(Iim wise, (he In.iking <It ( I on one si<l<* ul tin <,ir may not lie <i|u.d hi dial mi (lit min i snh W Ik ii lit.ike (hums haw In* n turned uul, h Is ntMissiiy (o use hiake lining wliu ii is n u i si/e in dm km ss or ( ise place slum Mm k Ik iiu <n die lining and shoes. If sin in situ k is list <1, (me should he taken 4 ) to i ImiiM ,) sfiuti sliu k with h is not t m il- (tit ssiI lit aud v%ill Mol sold u limit i lu.ikf i< mpi i .iitit<s 'flu* la aid shots should 1 lliujnm 'lilv ( It .uk tl and .t lit.iki lining t lam p slmiiltl lit* list (I (it buhl flu* lining lightly ilu* situ* itr the dultm g and iivttio* n|M r tlimi D ull (Ik* lining so lli.il iivc ( heads may In* pi i<<tl down in the iii.ilu i il .is ilt*<ply .is tl is sale In go without <ltnt*< t of (lit* lining polling nil ili<* siitk s. By following tins pun t dine, \\< l<a\e as mm h usable ilitt kites. .s possible (it wear purposes. I hr depth il win h nvt ts may he safely pf.utcl vanes, tit |Mtiding uptm (hr in.ike .mtl lypr of brake lining Willi some lin ings, it m 5.if<* (n ell ill to <t depth of fimn only ihonl out-half in two-thirds of (hr (ni.il ihuknrss o f (he mnirriii VVtth Aiiirnr.ui llrakrhlok, uhitli lux .i wire doth rnnforting haik, K is Ixst In drill until (lit* wiic <hitii is just h.trt ly vwblr 'ihcu (he head of the rivet will 5 r.1t squarely on the reinforcing back, the riveting job will he light, there will be a mnxhmim o f friction m.iirri.d for wear purposes and lhr braking trains will hr evenly dnm hnitd throughout (he entire id 'll 1(Mil of lining It is espdt.iily important to obtain 1 0 0 % <nm.it t !x*lwccn thr hr.ikr lining surface and the brake drum Whrnrvrr possible, it is helpful to grind the lining on (hr shun to thr roirrrt drum radms Mat limes wh>< h mount on dir axle spin dle anti grind dm lining on thr lines while they me in plate in (hr assembly do an (spec tally hnrjoh, providing a good qual ity mat hmr is ust d ( `hamier the rods o f rarh hrakr lining srgmrni hack past thr trm rilm r of tltr end rows of rivets, I Ins rhimnatrs end t tml.it t wlm h is a fir qtu n( tause of brake squeak All holts and nuts in thr brake, wheel and tliimi assembly should hr sc* iu k ly itghtt tied Vactori AJJvcting Brake Systems-- A motor vehicle. should leave the service st.ilton with thr htake to n im i system hi at uies svi II hdo 11 in tl, 1 u h is le * I l> i>| In ikr (It it* and lie Inni I ! tl > l.d .un ( d I hr* sprilli* 1 lips h n M iie' tie h 1 sis spi mgs to the ash- must In pelli I le w h n l I m i i i i i i 's musi h< m i orali ly .id pisttd to ptevsut Itr ike th .ig , dste U loose healings Braking sooiriimes is unpislly hlamrd when the fault he with (hr steering ap paratus of (hr motor vehicle Front wlirtls art* mountrd with a delmiie amount of castri, camber, and tor-in Afirr considerable mileage or dur (o accidents tlirxe net css.ity adjustments be come distili bed Therefore, when the litakrs are applied the motor vehicle swerves and becomes chlhcult to lontrol C.ister and entnber as well as toe-in of the front wheels should be period ally <becked to insure projier brake perform ance 'lire inflation, tire trend wear, condi tion o f brake drums, one front or rear spring more flexible than the other, im properly adjusted road shock dampeners, e t c , Mfet t brake systems *1 hese items should always he checked. B ra k e L in in g s -- !i is important to use .*1 high quality brake lining on nil jobs ' 1 hts insures that (he final result will he snjt brakes, wlurh after nil, are one of the greatest features which a motor vclu< Ir can have Not only does high quality brake lining produce the maximum degree o f j/ifety bet ause o f its better performance, but It also gives longer life and freedom from muse and storing. Customer xatbifnctiun is greater and there are fewer complaints and requests for no-rharge adjustments For best results it is important to reline all hors of all brake o f a vrlurlr at the same time. F.ven though the old brake lining is not rompletrly worn out, it is (hfht uh toohtam thr correct adjustment ami the prn|>er braking powerdismlmoun un less all shoes are relined at the same time 5 U i mot n ig fin / r / lutiti u h u h fun hvet! ( tutu u tiu i to the \fiov\ ''mm it h< h ' a u tu M i i h i n hn h ti i \ in il * Im iti'' <* mi ntt I lu i 1h In ik> shut s (h it i m u i] i im w !ih li li is in in n iji [i h m ! s<In t |i s ul lim k im l, i M i Miiiii ml 11 d m (In fulllMMOI UM (lim i (U III list'd fui l< IMMS* un1 lili* lit.iki Imine, fiu m ih r sinn Ih r iiim M < ilisf.ii im \ u tv in ir ih 'iU ' liti* lim ili' h " iii (hi slnus in | i\ I m m I ( I llll}( (l)l 'lim ili ,i Sli < ( il ijl il II) ih r i enti r rr iitfiii ( tiu; i li with (In (nr <u<l uf (h r dim* jin m iim i tip A pply heat ev< ilk' un (h r until i nh* ul (he ll.tni;<* .it c.it h tuli uf the n h DeOiihtUe the h i.it .15 r w u l v .it (insMhlr u> ftt.tI (hr spur w ill ItMi W.ll I W i n n lit' 'Imt nul lie Immi* a n M t n h f i t . i u d tlu li iiin1' i* r a n i s p u n t Iniisi w it h M i i n u l i i m hi Ns i n i . i n v n f si im i 11 (uni (hill (ht* Ihm* h Ul VI (hat .ill (i h r u| llu ulti Iu n i e 1, imi u n e ut n m mus 11 Iit ft If .i|i|>ls m e llu tu w lin in g llu une Im ite' tun lit iis M ttl tu ih r shut ut (hr sim e m u n iti .is m (he ]>u5t, Musimi h .is Ihr u s ti hulls me alieatly di ilh ti in musi shui s N Mm ally, in (lise i ist s win ri die shuts are nul (h ille d , it w ill lie netrS M iy In d rill lhe m in u id e r to use i isrts (o a I la th (he Ilium* Many michnnus |ucfrr lo remove hnintc wlm h hns hem crmrnlrd on to Ihi shut s In 1*1 nullin' U nil 0 LOCKHEED Hydraulic Brakes Lockheed internal Type H ydraulic rakes-- 'l hr latrr models o f ihn ty|se of l<ot khrrcl Brake me a Mastrr cylinder which n always in direct fnni.v t wtih the onrrr of supply of ihr brake fluid J `tg. 3, show n typical master ryhndcr of late model car using Ltitkheed lmern.il My th auhe Brakes A cross-sc t denial view of ihr wheel cylinder used to actuate die brake slme is shown In Fig 2 Some ears are equipped wilh straight horc wheel cylimh rs using .1 piston of (lie same ch.uurtcr for operating r.ieh hoc Other cars arc equipped with stepped horr wheel cylinders which have pistons o f different diameters In cases where the manufacturer tun attempted to secure more equal wear on the two shoes, we find (tie larger diameter pistons operating the Reverse Shoes. In cases where the manufacturer has attempted to obtain a softer brake prdal wc find the larger pistons operating (be forward .Shoes. Often die diameters of the front wheel brake cylinders arc larger than those of the rear wheel brake cylinders in order to obtain letter brake distribution Tor the above reasons, it is always hn- ^ a\ltA ROTAr/o ^ .010 IN. ON BACKING PLATE 010 IN. ON BACKING PLATE FORWARD SHOE-USE STANDARD AMERICAN BRAKEBLOK .005 IN : Flyura 2 locMioffd Hydraulic Brake 7 REVERSE SHOE - USE STANDARD AMERICAN BRAKEBLOK IiiHi <t>i hi 111 tIt Min* i ! i ii u !h I <vlm d eit .im * (nil b.n k p i n e p io p fjjy Hi i .im s win i< di*') )l.l\ I 1II I ii 11 tto\ i il i ill' III III l IV IMil I( 11| 11J >| ( SVI11](* ilWIII Mil* i pt.il | in ns*ti * .il n 11 I ii ,i likl' III IIIMIM p l t l p l I b a b Mill (il 11If l l l .l k l t l i ' v\ >,11Mi AitiM 'Ml' Ii fill It IS v. mil* \ II M ill Ml Ml (|< MIJM <>f i IH kI i m i I Ui iki v( ni i*.n*i.il 11h* adpisimt ntv .mi m i'li .is l.illiiws M I N I HC U i j C M M l . N I ) ( Mil ,lH]l|viMI< Ills . l i e JM(lV'|l)l(} oti ( it ii I >i ike siiiie (i i <i nitjM ns.ilr fui lining NM'.M j ill k O p I .11 . 1lift (Ml 11 I IMl 11 (i II1 l ) t n u i w a i d a t I fi f ip, fnnii the <l III l I I if 1! M ,1 vlf , Mill ll tlie Ilium ( IJill.M (t (he ( l ii m i Vfidif U ml)' (o sij> ())e u l i r i l (lo in vpiMIMM" l i n k oi l Ml) ( tin (Hill! i m n it* 1 1* ti s t l n n i t a n d w hi i I just ti n ns f o t i v I h e . ii 1| i M i i m* < i i 11s* . n e In id in podiim i by fin Mon *.piines nil some t . u t . m m | {mi k m i ; iv i)i 1 |i i [i n ii ii A Inf k Hi IC |v mm d o n i il In i i i n " li h h ( In i k m iv/i i i shm li r lot <ni re< l Ilim l | i \ r | I he fluid suppK t mk should In Mi w id m i 1,* m( dn tup M A J O R A D J I 'S I M I.N I 1 'J f e if i n liu MiniMihm; of llie two ,ini Inn p i n s ( ! ( l i e 0 , d i o w s >t i nle nil* o f d i e i it ,ik e vfi'.f s II iln )( . l i e m i m s p i c* n o n !iol< s i n l i e I m .i k e i l m t i i 1! (In y s h o u l d lx 11*iiit>v 1 1 1,t 11i dn shoe. I ive brier gnatp* hi pl.u e .mml (tit n e J ), .i In Hi* and n y again ( `mi et i ,nl|iisi mem is oblaim tl when Hie OHMm h g ingcjust rulers at die tor or ttppi r end nf Iming and (he OiH-iof It al die Jmvrr end Doth slims of rath wheel are adjm ud in this m.h u m r. <1 U epi.ue hmkc drums and piorccd as outlined above fot " M in u k A djust* mi n i * " I f a rim ; gauge is not available a major .afpiMMiem ran iie tn.idr by tnuim g d ir e tte m n r am Imr ftm titm iside d ie li (king pl.Hr O n .some tats K is mil possible to m m (iie e< ( t nine am hots fim n die out side without removing the am hoc (Ins aiul slutting d u m fur a surew driver, in mi tier to do (his it is in estary to gi md off (he t.ise-h.Mih tied mo f a ir niul .slot die rod by using i \h i h.uksaw blades placed side by side io die same handle. 'I lie am Imr pins .u< (lien lepi.ui-d and the .uljKvfnii ot made as follows. t 'Im n amlnvr pms G (frig, 1) and tains Ii (I ig t) (m id slim s ,uc at far as possible .m a y fom i dimns 2. Ad|tiMiti(* one shoe at a time, turn f.iin II m ild a alight that* it obtained I hen m m r<t< nine am hor C tintii this dr at; lias been relievtd 'I bus It is seen that die tnm enieiu o ft ctenlur. nm hor C not only nflet (s (hr position of the heel of die shoe, but also die for o f die shoe near tarn H \ K ep ral these opri.Hums of obtaining a due* by m ining (.m i Ii and relieving die di ag hy (timing am hor O, unid fur* ilu r turning o f am imr C vsill not relieve the drag *1. 'I h r bat k off cam II .md a o d io r C just slightly m ud w|ie< l turns freely, 5 R rp ra t at other wheels. 'I his method prodm i s tie.ram et t <i y close to the rec ommended values of OUS and 010 inch. H ) Interjrd lank Tyjw Mnslor Cylinder CLEARANCE CHECKED LINING ANDRING GAUGE BETWEEN -R IN G GAUGE Figure 4 Ring Cl.juqo ni Plato ojieiin! tun-half In ihrer-cju.irlt r men, Imi nnl (nmpltd ly it'movrd Mlt (dun; is dune Iiy pr< ssuit die br ike ]><(!.d slowly (it half the lumi of its {i .im I afiri nuking sure lha| muso r rylmdtr Ksrrvon (Mr 1) fs full o f Jlmd Jfrts/r\tm filler openuii; plug h hft out dnrm); die hit i dm); die fluid ran be wairlud m see that it does not get lx low die half way [Hunt An automatic reliller for inaslei tyhwleis (F ir 6) prevents (hr mnsler tyhndir from running dry during (hr bleeding oj>cralum With master rylmdcr reservoir full (he brake pedal can be Riven 6 or 1 0 half strokes lit fore K Is necessary lo refill the irscrvmr, 'Jim pumping notion forces die licpifd nml air through (hr system owl out of (hr filet der hose ` 1 hr pro* esshtcnnmmrd until die fluid runs dear wuhout .or imbblts It is best to hired one wheel lylbiflrr at a lime in make sure nil air is <*jx lied. Ilh t dim; tanks ore available whit h pt rtuit die b inding to hr done limit r air pressure in .i mudi shorter tune (ban by pumping widi the firakr pedal S F R V K JF I IF,Id'S If, nfirr bleeding, the pedal still feels spongy, die rondinoti may sometimes l>e A (\ Cheek fluid level m mash r ylmdt i nml add fluid if nenssary IIU XO IN C A lrrn n fir removed fiom (lie brake linei by lilt (din); I Ins is net rssary after lint s have l>een d m o m iM U d or If (he liuul in the ni.istu cylinder has been allow itl in run mo low Hit (d in g ( .m he (loot tin nuidi .1 rubhrr tube, the end immersi d in .i th a n (I-{m il glass hull Ir) rim i.nn rr partially fdh d vvirh brake fluid W hen b in d in g , d ir b in d e r valve A ( li)* S) in die win 1 <yhmh r dit mid be 9 /rJirvrd by hobbug blr<d<i vaKr A (Fig 5) n[irii iiiiti! fluid appears, wtlli the rubhri lube mil screwed in place Hired r valve is (hen closed `lids oper ation should hr /` rformrd with n pedal pressure of only a few pounds W h en rem oving the shoes from a hy d ra u lic brake asst m bly u is best to d a m p the wheel c ylin d er* in order to prevent th r .renient,d blow ing out of the pistons, m aking n bleeding operation necessary <)n all bydtn nhe brake systems only an approved hydr.iolic fluid should be used I f there is any doubt about the purity nr q u a lity of the llunl in the lines, tt is brst to (lush nut the entire hydrnuhr sys tem using a good I8B pi oof alroliol In some cases, it is necessary to remove the iiu s tir and win el cylinders and clean them llin m u g h ly , using alt uhol or brake llunl In fe rio r brake fluids dam age the Htbbei parts u f a hydraulic systtin am i it is often neieM.tr y to replat c the rubber aps I f tin <>lindt rs have been srnrrd nr ___ pittrd, (hey should hr hum <1 to a inurot (midi Sometime* this stmt ter putt of lining is placed so dint the open spate is at the toe, ns shown, and in other caws the open space is at the heel end of the shoe O n some i ars fitted util) Lockheed 1iydrnuhe drakes thrre is only one anchor pm In cat h wheel brake both tlicfoi ward shoe and the reverse shoe m each brake arem uliorrd to this same pin The turn ing of tins eccentrir anchor pm controls the position of dir fieri t rids of both shoe* However, tim e is no brake lining on the Two Forward Shoe broke Used on Front Wheels o| Lola Mrxlel Chrysler Corporalion Core Figure 6 /\utoimih<* Reliller lot hhisfnr Cylinder A ftrr adjusting tin cams always press die b ia k r p rd .d tw o or i l m r times after sjiiniung the whr I bv hand 1 hen check the u I im I tn make sure dial it is sttll free uf di ,u* ( )m Lock hen I Hydraulic Ihakrs, thrre are sometimes < ,im s uf squt aks caused bs binding uf die tups uf d ir H i verse Shoes w hi re die K c \ rrse Shoe lining is die same It iitph as d tr ! ursvatil Shut lining I lus scpitak can be lim in a it d li\ using a ihurter p irc r uf lining oil the |<rvrr<e Shor, ns shoss it in Fig I bed end of thr reverse shots ami the ec centric anchor pins air adjusted to obtain DOS* clear,tnre between die lining and the drum at the heel ends of the forward shoes 'Ihe only adjusting on the reverie short is done by means of the cams in order to obtain 0 1 0 * clearance at the toe ends of these shoes O n late mode! Chrysler Corporation ran die from wheel brakes have two For ward Shoes, O n these car* the recom mended clearances nre 007* at the toes and 006* at the heels on all Forward Shoes, ,md 007* nil around on Reverie Shoes In (deeding these front wheel brakes, bleed the top cylinders first and then bleed thr lower cylinder* Hus In ake assembly is shown in I igurc 6 A American lirakeblok, as well ns most other lining manufacturers, recommend a f.uiiv high friction lining cm hoih for- 10 ) wan! ami reven? neting shoes of dir la kheed Hydraulic Brake Figures ! and 6A show die ret nmmenderi hiakr lining when rail dot k is used. Amincan Urakehlok also furnishes brake lining cgnuuts m boxed <nr sen especially prepared for cars equipped with Lockhted Hydraulic Ihakes FORD Hydraulic Brakes Ford cars me equipped widt hydraulic brakes winch a re very similar to the Lockheld hiakcs just described. A left rear 1939-42 Fore! brake assembly isilluslr.itc<l m Figure 7 and shows the mechanism which operates the sliors through the hand brake hverfor parking nr emer gency purposes. '1 be 1946 Ford brakes have brake shoes which are self centering at the an chor pins and therefore there is no anchor pin adjustment to be made on these brakes SERVICE HELPS ADJUSTING CAM ft 'I he hand brake lever on all recent Ford passenger car and light trmks oper ates the brake shoes tn the two rrarwlirt fs fot parkingorcmrrgency pmposes \Mien making service brake Adjustments, it is advisable to disconnect (be band brake cables In order to adjust the band brake on these vehicles, proceed as follows. -- -- jV AUtfliCAH BIAKUtOK /3 . 1. Release the hand brake lever com pletely and then place it tn the first notch riguro 7 1939 1942 Tord Hydraulic Broke Showing Mochanleol Oporalloti of Rear Whool Brakes for Parking A D JU SIM K N IS 1 tie major and minor adjustments Ford hydraulic brakes through 1942 models are made m die same maimer as on the Lockheed brake described on page 7. 2. Apply a pressure of about 30 pounds to (lie brake pedal and hold at appiuxirnntcly this pressure throughout (lie hand brake adjustment 3 7 nke nil stack out of the baud brake tables and ndpjsl conduits so (hat cables are exactly the right length. on 4 Remove the pressure from the brake pedal and release the hand brake lever completely and check the rear wheels lo make sure they do not drag U I lu I 1 a *(mm I u n i l n i< ks h i w M p . i i .i t t ln.il>' h . u n i s li h u t i l mi 11h h h vs ht ( |s .n u l M f M i . i t u I i f 11 1mli d u h . n u l l u . d u i< \ ( t Int j u i k U h*, o r i n u i i*i ut \ (Mil i him s l i n l u i u ! I u .tk< s n u (lu f > . ( o n (u n k * . IM ,lll|lis|( il ,is lu llo U s I H i leus* li.im 1In ukr 1rs t*i Miiipl H I) ' A ' t | 1lM l n . t k f Mills SM lim i ,m t 11Ml I ili il* is (u mi lut i il .il c Mli t f .il u lit i ( u f i n i li nu l Iit .tkr ts .t]tj ilit il AMIMK Ml Itl.tkt lllllk, .IN Will .IS MI()S( Ml III 1 ll l.lkl 14111111* IM 1lllll.lt (till IS, |t I (lilt* m n ul ilu* mm ul ,t C.mK high Uu uuu Immi' uu iiuili slims of (In* I mmI .uhI Stiii|i {11ki i fi)ilj.uilu In.iki s. In .itlthumi in null iml in 1 oils, A m ti( i mm Hm I.i hluk ,iIso fiitiusliis In.ikc lining Sfg UK Ills Ml h o s t ll ( .If \C (\ fSJH ( l,lll\' prc* Jl.lM tl for (111 M- In .ik< s ! LOCKHEED Hydraulic Brakes tu du* (\ i u In 11i , i m is i mil in 11 Iunk slim mi Inn {tins In v i I m m i i li m il i. m i l (In I. *ssi i mis ci (In sinn s Inil ( .if misi .1 selli I I ill II k II mi l!\ ,i 11.ii lit 11 111 (III I >,ii k* un' i <! Mi I Jim I ll' ii k is m u In in 11 so ll i i ( Us sul f s .i 11 .ilujni il i ,u Inil ts tu {lie .isti K m o i t h d .iIm ii iiim K s mi (in l i m o <mis ut d ir sign's, .illiiw lin situi s tu l i n k l.iii`i.Jl>` un du ult s u f du M i n k s Wh n lin lu i k f is a p p l i e d , lln slims i i i i M r i )h itici Ivrs l>y moving in d i.ills un ni Uu* sinus .tit* lit fI ir 11 (u o p o positions in H`lu m n m ilu ilim n tins sidf-ienu ting fr 11in f 11 rimi it s nu in on iinner M 'l.l - M >|US I IN I. Ill V IC I l lif vr|f..iiI|Ustmi* U c s u i . u it o n u h I nils m i n Iu ns in * fm tin Iimn/T w ea r nml sii to ills m . m u.m is (In m ig in. d p n l . i l host I UitumUiuiil (Ik t n l iif (iff tif llir Im u i ii ' A s Unm n ni 1 iijiin 7A, fin* Urvjf ts lu i.in U nn ih f ( m u m l M in f only .Sin (hi luting mi (In K e s ri * Slmc s. us m Um Is , u is t u ty utuict <ts.u y lu i<Jrttsi (t un n i u Inline ni (Ik I mss .ud Slim is lf<p li I <i i H .isji.ills, (lif ft If* .iil|uslim; t lis n i i uiisjs|s ul ,i tu n t.i<l pim*, t ii if i ml uf vshu h t sicmis dum igh shull m Uu* t i (lift o f t lif vluif usdhuuig 1 he iiilii i in d ul Un pine is tt'iiU .ill) ju n n n l (<> .1 Ics n , ssim liin h im , s pumi d nl its |im t i (n il to (!n In.iki slim flic U|i|ii i ( ml m( (lif It m i (if us ttpnis (lie In .ik i t ( t ( n iiit , s\In u (in In<ik( is in (hr u h .is t U fuim Unit A spimt' .u uniteti su dije is h i m i u il liciUM'si Un pimi miel li \ i i pin mui .i vvtdiji guide f.ish n< d in Uu slim Mu* finn nun ul Un si 11*iul |tis( iu14 d r sit is in i lust Is tin in i.im um si.uti slitte t ii u,int Us .ills, im i mi; ih f siine imv.ird du* tlju iti ns inumi u f.ii M inus I he lu .ikt h t m il it is .iii|usifd u iiu i (he In ikt is tos iUr U, .nul no fui tliu m .iu iu l u1|i)s(uu ii< of (he f t i f i u i K is fittt't.s.iry im h l (hr si it it s m ill it lining \s\nnm uj no ilim n distmium m ex pansion, (In ( uiK.it ( plug nul It ver .i lu . i) t musi du N.Min disi.tnt f fm iii (fir h i.ik r r c i i i i i i i i vsIn n (In slims .ut ,ipp lin l O u ting .i Iji.ik f .ipfdu.itiun, die shn< is f o u n l ng.nnst Uu (hu m hy fluid picssiuc, .ind ( .tin ts Willi (I (fir to iiu in plug w lut ft is lu Ut nt ils o iu tu u l position in rri.id n u lo (he lining viuf.it i hy uu .ins of .1 light holding vpnng ( iguit 7 A ) I*i m (hr p u l p s e uf e x pl an a t io n , wi in n .i s su n i f ( h u dir <*on(nr( n u l o f du plug do r s tug w r u , m.rsinm h as du* ,u noil unni li.is he rn found to h f \ ( ry slight, ,uitl is <omp< ns,ne d fm hv (hr Irvt r I ' ) WHUL CHINO ASSfWJir Figuro 7A Loekhood Seli-AHjuchng H yd raulic Brako. W ith tubstaptcni Iir.tkr apphtadons, imi as limng sveni mcurs, th n m i i i i pini* movcs die adjusdug levri pi rei,itimi lo d ir wcdfjf f*ilitio, .dlowmg ilio adpislmi wcdgr (o .ulv.mcc upsv.iid by spimi; ,i< m m , (iiri< h y (akifi# up (ito rJfataiK.r b< fsveen (ie plug mui levrr pili and die svilire guide f he \v< dgcholds th I<vn in io. ,u linstai posinoti in rrl.iltnn (o (In siine Wltrn dir lii.ikr is rclrnsrd, dir ndjusi. iiiu Irvrr ri sinties eod|.i< | willi dir bi.ikr rtien trii, ibis Ionio siine ri Inni lo tls originai drum ( lem am r 1 1 (1 0 , 1 1 1 1 siine ii.is Ih o .id|us(< d m .m ainoum <rfii.il in (in Itomi; wi'.ir I l i o .k non lohlinues ssdli die wrdgi giadually .ideane im; upw itti lindi die li liuti' li is unni lo die )hinil svili ir dir i otn.it i ititi; has r< ,tt In d itMxiMiitm n .tv fl, ,o svini li dim die pini: (niU .idi die svi Ir tf die siine W HisN IO KK U N Iv HRAKI S Afiei th jilm <nnt.K is dii sveli of dn siine, .tddidun.il hr.ikr appio altons svdl forre flit slioi .nid pini' .ig um ( (In di imi svilii it|ti,d piessnrc musing die (dui; to svt.n ,u die suine iute as du Lmuii|* I he to n i,u t im i of dii dui* ih ui.tdr of .in unli-fnt donai mnlenal wimli pi units tins wtar .uni prrscms dum i suiting lire shoe rJrarancc wdl ilirirAue w crtase with lining wear, ami (he lirakr pedal travel will also lrrf*m to increase When dus m o iri, dir d nvrr is warned dial dir brakes netti rchmng Drum distortion nr expansion has rio e d ili upon (hr self-adjusting device, Min t the niceh ,musiii is a lia tilid in dir shot ,utd tines not allei tls posidun, even sshi n the shoe is fort ed into the distorted nr ( xpandt d camour o f the Jo ake drum I he movement of dir contici plug dr. prods rndirly upon do hmitg wc.ir O vi i .ad|os|fm in is dtrieby pieveoird ru *.M O V IN G H K A K K SIIO I-.S hirst p l.n r a wlirtl tvlutdii d.uiip across du wheel tyhndci bool on t.nh brake, brfoie altruiptuig lo ninovt (hr biakt shoes I 1 ) ) ,f / ront wheet brttkti H im n v c ani hot {('(u h i .pimi and siine i< mi n spum i (I u lu li' 7 A ) Remavi* " ( !" w .n h ris fu m i <diu( n i e l l i n e i.iim 1 1li vlirx is k univi il by pili li mi lite Ih c1 nf (hi slmr .tu ty Itn m th .(( Imi h inik, lifting fieni d ir 11.m kitu' piale im til <Ir.n o f tb r n u nii u e un spintile, unti diri pnllm g uway rum i (he whrel tylindor H Hent tv/ted In aket R n u n v r th r ,nu Imi i c iu m spi mj, ,md shnr ifin # n spimi m ul fm iU d ir p.ukiug le v rr inw .uds t i n i t r of ihc* h i.ih r unti iinlmok ta llir Ri move h tn p m lu ttu s fn in i (i<* siine adptsiiug { ( ( r u ll i* (.un R r im iu ' rat li slmt ut d ir sante iim ih k i .ih fn lim viil fui ihe fu m i w h rrt hinkrs C Dttoucrnh/y j th iclj-tirljustntg tivt tt t R i i n i n r (In lin i piu ut h i . I*m sv du* ( n i i i u i pini im v .n il nnhl ih r pini; im i* i ii fi n< h ni siiia M a i ninni pi ( smii c un rim i u l pimi sellile irtiin v m g w rd g r ten* (ino sptmg .uni u lu le wnhdruw m g adp m m g le v<i R iin m 'i1 u rd g e , svolge U m ili, i m it i t i plm* .uni <untar! plug pfessine sprmg R U .lN t N C UH \ K l . S U O I S A. Uetrjvc th oh/ hn v g l H efnte th short, A n i m i m i Ihnkt* ! iIr ite i .ifvris fui iIn se binivi s ,u r proviti* I w iili ( mi im l pliiq i l< u .un e huli sal ready rn t m die ln .ik ( limm fui ijm un die fui ward s|ines K u r t ih r hnm rs In llie shm* ! f (In Intuiti is lo I m* ground un die dtors di im i t< iskemlile die srff-ndjnstmg m n h.nusiH u n ii! <fier di g im ilm g np rr* iliiin unlrss s p tii.il ninnimi etpiipineut is nrd u lm h p im uh s .i mi ,ms fur lam piog f!ir self iiljiiM ini* mi ( li.misin C HrmsemhJe t>e trlj+sif/jutf/ug t/eviet a i Jotlow t S lip 1 l 'sr a iu u (o n t.n l plug R ad i i.-ir-m of A u iu ii.iii ih .ik(hluk Ihake l.mm g, fni me mi ilu sc In.ikes, <untains loui new t otu.u i plugs lot use m die selfadjusting m<*( lutnsiiis on enr li uf (he foisv.ud shurs. Inset! die pirssmc sjning in iltc (iini.it I pin;:, uml slip tlicum tart pint mm pl.n e making sutr ili.K (he con* l.Kt (tin* is cm die (m in t side of (he shoe blep 2 Replace ihc wedge guide S u p 1 Ware die wedge into position so dial il clc.us (he lever pm hole in (he shoe S u p 4: Hi place die adjusting lever while depressing the cntii.iu plug. Make ue the wedge is flat against die shoe heiwicii ilu* adjusting lever and the wedge guide Step *5 luilly advance the wedge, and irpl.uc die ssedge It nsmn spimg T o avoid d.tmigm g the wedge tendon pnng, use ,t iiouk to M irhh die spring fium wc'dgr to lever. Step 6 Complete the reassembly of die self-adjusting device by tinning die shoe in n and mstailmg (hr h.mpin m ((tn , 1 ) ( `omplcIrly redact the adjusting wedge while pirssmg the em tlatl plug Clam p dir shot In a vise so ih.it (hr jaws of the vise air ducctlv tiemMlh and hearmg against (lie adjusting lever to picvcn( move meu( o( the tout i< t jilug. 'I lien file the contact plug to wiilnn IJflS*' of the lining smf.tce. IN M T .C 1IO N O r S U K -A !)|U S I IN C DI-.VICP, A. Tor (he self-adjusting device ( 0 function pmperly, the end of (hr contact plug must etdtc` 1 In* li \cl with or extend not more than .005' nhove the lining suifacc \\ 'To test die wtdgc actum, pi css (he end of thr rout.tel plug while <omplrtely retracting die wedge Re h a ir the cemlact plug, and thru the wedge Manually push thr contact plug inward, at the same time noting whether the wedge lids aners Re jir.it lest W C Io irsi com .iU pluf; premure leaiid position during .uljuiiment Ad* ipim g, <lt pievi fonia l plug, fully rena t jm t liiuug d caram c by rotating tlic wedge, ami hold it in fully rctrmteil recentn< tarn adjustment away from the position while pie sung ,oul rehaving w bttl cylinder wub die wrriub handle roni,h t plug pomtrd tmiward (lig urr 711) Vtt strrw lindi triti II A O ihould rt veal positive ipnng ardori W orn, or <l< feccivc parts tltuier \j ain reerntne adjustment has lot inttfml of lift type hratl should be eplaccd wliru (litre 11 failure l*o centr.ilire the brake boa, the I of <(her (hr contact plug [irrisore spring <li uiiii mult be rotated forward while or the wedge tension spring to finn Imn adjuitmg the forward lines nod must be pmprrly rotated backwardi while adjusting the B R A M AS.SRMBI.Y A N D IN I! IAl - A D J U b 'IM tiN l* Do not lobi it ate any pnit of the brake, lb fort moulding (be ib o ii upon (be tevene shod. bring rath ihoe info com tael with the drum, noted by n decided drag, (ben hack olf until the drum turns freely hai king jiinie, fully tetr.ut (be adputmg wedge wink ptditng on the ront.ict plot* Then nioiiut the iboti Kiniovr PARKIN G BRAKE A D JU .S I'M EN V wbrrl cylinder (lampi Rotate shoe ad* Hiding rcteiiine cairn to the leleasrd position Appioxtmalrly ttnlialnrr the Itoti. O n all rear wheel lunkn erpuppid with m rilianual linkage to opriatr die brake ihors for parking, the ( ab ln ilumld he mljtnled whenever new oi relhud 'I be Initial adjuuinrnt n made by iboei are untallcd. Mu bydi.udu to ike manually setting lite fotwatd nnd re* adjustment should he made firs! m vene ihoe eccentric rains (Figure 7B) accordance with die mljinliuent prutc* Caution--Parking brake must be in rr- dnre reiom m ended N c v rr attem pt IS ) ) p u k in g fit Ikt nl|iislnn m sm inuii ftxf .iiIjiK tm i! Ini piMpci hi ikt ]ii il.iI ti]ir t I liuti M ake ir ti.u n tli.it ili< pdikm g iit.ikt I iM* \ ft t <Is itisi u ltim i ritt I .ilili t .mil w hi k llir in It it k uni lu tili }\ li ttiil iti I h m im du I utile ts nut liitiihm ; S il I hi It mil in ikt le u I lutti ni ivt nun lit s turnt liti I r le m il | insu un f hi n liMtvr u t in uni un I lit d iir.n h 11ititi ul lite < ihh .il liti i.iiitt ih p .uni tight n (hr M tt ttuf un ni .1 ln .iw li.ut n felt when m i limi* d ir ti ti w h irls hv li imi li r h t r n ih r itim i im i |u iii.tittl mi lite idpivU m nf llrh .tv f fin II,md Iti.iki fully nini m.ikt siiti tini it un lu.tki siine li.ti* , ts tht M.u w lt**t h .n r m i.iti il ( h r h )d td iih t sinn is s m u i i l llic limi' .ts liir si.mil m l I m ktm il Iim I m u I ic s\sti m pit vimmK di'si i i Ih i I BENDIX Hydraulically Operated Brakes M iN O K A i >)i i s i m i ;n r I fm k trji .di sslu r ft Srr* fh.n In .tkis .n r fully rrh'.isnl Peti.il should h.tvo 1 / ji Ki > ? I unsi u lut knut I*. (I ig K) mi n rii ttu .itljiiMtm ut .md pl.irc .i h ilf m th fi <Irr hrlsvt et fini ni .mif d u m i.(( adjitsp mg i rrw im i ni lh.it siine sslui li I h .its dg.unsi n i ( im \ I n n i h in fui u . m i dii ti limi uf v\ In < 1 n a s ci imiti frelrt g mgi pisi (ighutis I uditi il lui k m u un et i u ftu .id |i is im r nl I U r p r 11 .il e. ii h ss hi r ( lu i kt il md id|usii il, if u n r< M iy , liy disi umu i Ime, (In m it the miss d ia li, expanding tin sinus |v iin .iiu uf xlar vlicci A m ini tt is in tjn ism 1tU tu turn (.ir svi r i, and ih n m mhh mg si u k in r.thfe S t ir svhci 1 A should ih rn he h.ti ki d off m iti! ssh n I i< fi re M AJO R A D J U S M H N l 1 Disi (intieri p.uking br.iket ahlrRmid p n ir m l .s m I, ?, md 1 u n d e r`` M inor A n p m mi'n i '* 2 I.u n v ii .un Imi Inrkim f I' (l'ig 8) <mr tin ti .md m ir i d OKI fu In gauge b r t w n n hnmg .md drum ni .un ho reel rnd uf ( i ri UN u ( nnirolled dine O n siitint; durim i (yp< tap .inclior slightly ssiilt Rnft lu m in i t uniti feeler gauge p w tightens Rei h n k eli ai duce al nljusim g si n w i nd of shoe .md if correct (u d ititi lui knut [ with a large wrench K ep id t .il <nh w h n I. S<r m siuiodoni un page f S fur Mendix Ih .ik M u tili rrcen* (tir lype d m h n iv 4 1irn stai w hfl A (log 9) im til a slight drag ir fd i al r.tr whrfl)'JMI'Nl ** n f he h>drauht p.irt uf die synein li IS'H rd (h r Rdiitr ,is ssitli |,ck k lin d Ify * dr.m lu Hr.ikei 16 ) Most of lite late model flendix Hy draulic Brakes do not have (hr* <<et nine niljiisiinrni " Jv*1 how in J'lgurc II On these biake assemblies, ait (hr mechanic has (o do is adjust (hr star whe cl A (I tg 9) and (hr anchor pm !* (Pig 11). I*or .1 major adjustment (lie drum inspection hole 11 phurd oppusitc the center of the Secondary Shoe. A screw driver Is pf.tc ed between the Secondary Shoe and the Inakr ditim in ord< 1 lo force die Primary Shoe tulitty agamM the drum 'the mU View irom Backing Plate Side ol Bendix Hydraulically Operated Brake justing crew m (urned and the Anchor pm moved if necessary in order 1 0 obtain 0 1 5 ' clearance between the drum and each end of the Secondary Shoe. #l he Primary Shoe 1 kept in close roninc t with (hr drum throughout (he ad|us<nicut proceil lire In some cases the anchor pin is eccentric and hi other tascs it 11 movable m an elongated slot (See page !>) O n the type of Briidtx Hydraulic Mialci s turd on some Hudson m n , (here are two Moating nix hors htstrnd of a single <re entrie anchor pm *1 hrsr two floating an* chors are used only to absorb the hrakmg strains and they are not adjustable In place of Che adjustable am bur pm (here are (wo in c m n c rams, one for each hor 'I he <J<araii<.( s at (hr am hor rnrb of the Primary and Sccoudaiy sinus art cm itiolhd by these eccentric canes and the clearances at tin* other ends of the slioes are continfhd tty (hr star wtic el adjustment SERVICE HELPS O n (lendtx 'I wo-Slioc brakes, both hy* drauhralty and inccbaoically controlled types, one shoe Is known as the Primary Shoe and (he other as the SecmidnryMme. Primary and Seronilary brake hoc arc usually maiked with a " P" and **SM respectively (rres(MCtivc o f the position in which the brake Assembly ts mounted on the axle, (tic Primary Shoe is always the onr "ahead'* of (hr am hor in the dinctton of forward rotation of the drill. Figure 9 shows the recommended brake lining when (he material is cut from roil stork American lhakehtok also furnishes brake lining segments m hnxed car sr(s espet ally pre parrel for (hr more popular cars rtpnpprci with benchx Hydraulic /Jr.ikrs If die brakes are uo( effective enough will the rrcninmcmh it inatennl to satisfy HUl5HCAHMAt M>CtHOSLRO 6OTAUrt- itroHOA*WA'<l'C*AH' JMUCAMMAWftCOS _^r******tr^ S 30 aemtwiArtrc " hOLAMt till v>i wmnntstKic HU ( UAKANI | UH eAU< > wttHUUt ICUHIAIC ui cicfcHAnci nUS WIU TOC ON m u d wmi ocoimc CAAftiS WUlilUl icrimnc -0 l> Mill. AMO 1(Jl Figure 9 Beiidtx Ilydraultcolly Oporutod Broko -- Shcwinq Mechanical Operation o! Poor Wheel Brake# lor Parking 17 <n i . u n di tvr j i il is putii IIr i i i n i i i n | d m I*v muli* ,Sd utti. m i A n u i u . u i lli.duhlnk mi all iti dm % it \\w hi .tkrx ,\rc ino f Un t u r lor t ri l.im Im i <t i or if llirrr ti .1 trndrtK y for dir (.ir Iti |mll in olir inlt* vvhn tlx hr tk% ,m' . i p p l u d , thr fnltowinK u nir di s i im v l*r ti irti J ( !l>( 1 U slm r 11 (ni 11 spi m ^i Ifiin y c if 1111 mi .1p p 1.11 w r.ik ih ty slnm lil lir r r . pf 11 il w il! spi mi; of d ir <m r n t si di nei n If (In ht.tk* 11 ttm tdJt t live wtth tht ri *tniim*i>(li d <!<. tt. u h m d 010* ntl .mutui, ibis f li .11 .mi r hi tu ri n iti imi ,im] htMtthttui ( *h\r,meridmuld 111* I lp| il no .ili l\ ||Cf 11 S III linmi> un il IN tttt.it y N ito ri of 11ir (tour ht.ikfx nt.p hi <tt( oli .t( d ir n rntd rovi ! rn 1 t t Ami rum i lit.tki'hlokNt* S.SOui.tybc tiv d un hodi d iD M u l liu n t v\Itre 1 Itrt krd O n suntr i*.it k m 1 t .111 d ir bi.ikr ihoe ir <11111 pimi .n i p.tind il ,11 Itillows Prim .iry-- hhu (In durr ip nnu ) Srtond.t i y --yrllm v (hr.iv n i xpnm) I ir hold down iprm^s slinidil h r ntiM llcd .ti fol lo n i V< llovv .tt inp n u l ni r.it li shoe-- hl.tt k M hnttotn ul front vshrrl shnrv-- lilm .il hoitoni ni ri .ir n lt< rl hors* R F W T 1 T Y ^*WO'^ ^ OG S in g le Anchor Bralce D L l l J J 1 . . . M echonically Operatoci l Ins I n , ilo is ini 1 i.imi .iliv u ool ollrd Imi tu olii 1 m sj n i is ti 11 Mimi 11 lo dir Uri ni ix 11) di .m it i ,tl!y*( )pr r.tu il llr.tkr StCONOWlY noe USF ANUOLAN M 1N O K A D 1 D S I M I'.N I I j.u k iiji .ili fuor vvIim'Is .imi tnosru lui Lumi un .tdjmiiu ut A (! rl IO) i urn r< ( t m n r ndjm i itici il A , in forw.ird din < itoti uf u h re l ir.irci unni Iiiuiu; i.m hr frlt tinppim .t Olii nuli i1r Knnr 111 sr 1 1li (Itn mtt*1 1 lii.ikr drinn insptttion 11*li* Ituprc non hnli shunti! Ih* pj.n rd m ,1 posilion in .ir tln rrntrr of dir shur i Inld 1 1 criiii h tu dns pi imi tini .imi indilrn lui k mit lirinlw * uliiid tn m.iki* Min M is In c | Im 11 dnnr un .ili vvlic h 2 I in u il.ti vi f i n i H (t iy I 0) 11ud .1 Imiti dr.u; ti fr li u h m ( ih unii* ( .11 w tiri I In li.ind li n k oli slmhltv un li u n iti (.ir u l u l i ti fi r r I In i n dot ir ,if r.M li hr.tkr \ W id i <.it j.14 k <J 11j 1 hold p td .il in ti pi <u ri I pnviiioii ntd ir ) <.u li w lu r l In li.uni I* u h u l n l should fr rl .ilik r t ^t'.'srn (in u tu *h rii) . n ijm tn slc r n w < un dii tu*In w In K un ni (ir .tn n d ir i.u tir un .di u In 1 li AHrttlCAN 00AKC0L0K Ttsturo 10 tinnlu Two Shoo. SmqM Ancltor Brake Mochcitdcally O pcrolrd MAJOR A D J U S IM K N I Wh n xhun h.ive hrrn rrliurd or when iilln r ndpiiiiuruti f.nl tu ^ivr (hiircd IH ) temile lilt* am line put stimile} tir adpistril is follows csjiei I.illy piep irnl fin ibi lume popolar i .iis iipnppul n u li III mine lliakis 1 Ihscnitnct t i a lilt .it cross sh.ift lim ili l infumi Ululi mi III inlis Im i. Irvi is Militi* Min- miss sturi i flu ns io us .Mini lliak is mas Ite fiiimil h v iiliim n * stii|i Remove Imi.IiI.isIi fumi linkage In*, lo liti M i v ii e lo 1[ts oh pagi 1 1 isvt fn cross shall Irv ii and pedal 'I m o .m angi mi nls of die aline reumi 2 l.unsrn anchor pm imi C (Pig 10) i imt|ilt li ly fi mu lui k washer spimgs sviti usui oti Ibis l<.iter 'Mie im i In r air.mgc me ne li.nl a siimi spi mg l W illi .1 si II w ill Ifl i hi sun,itili innifrulli mie siine lo th nnclmr pio, and a liiiiisi.ii wliri I H (I'lg ID) low,ml m u ol lemg spuiig heiw cdi ilio |wo short *| In hacking piale mini Imiti sltot-s expand laler hi.tkes of (bis lype bave Isso siimi against cintili, making II imponibili lo springs, noe fi olii I a d siine lo die .ini lini Him wlirr! with limit hands. W illi n sufi piti, as slimvn In l igure 1(1 O n e of ibi si liiiiiittirr lap mu lior pin mi ilirr.ttlrt! end spitngs is paniti il il d miti is In uviri Ih.in Am linr pm will slnlt in elongated liolr llir otlirr spimg 'I Ile 111 iidix (lomp.iny whrn l.ipped ri imunirmi (bai ibis In evie i siine temili `I riglifrn .imlioi pm mil ,is uglnly .is possible willi ,i J,irjr wrriuli. spiutg alw.iys he aitai Imi lo die almi svini li "lich s" die lirakt opciatmg livir `i With brake almi s fully expanded re.idjutt cable In fills so rlcvia pm b.irrly mirra ilrvis mill cross sli.ift Irvrr ivlnlr m i t i U'itb Iccentnc Type Anchar-- Suine nf die Hendix Single Aneline Ilrnkes bave eccelline (ype niidiors, iiisliad of holding cable tight, lei rruiove backlasb, Tins is done- at carl) wbecl die slidmg ty|ie I he rei m in i lype ani Imr is iilrnldiril by die si irw ili ivrr alni 6 Hack oil udpistiiig errew H, unni svili el is pisi fre r of sir,if> 'I Ins is dime at III lite tlue.lclrrl end Ins.ni uf l.ippmt; Ibis lype ani Imr put uni li a sufi II.ninni I rat li wlirrl as cirsiriliril In sirp 1 uf die " M a |oii 7 I'lillow widi pruerduri given under " M inor A u p is iu ini " SERVICE HELPS Anjiisrui n i ," die am Imr piu d silf is luriiid by meaiis o f n si rcw tliivi r mini lite forre i eira cani re are ohfamrcl Il is usually nei ras,iry lo alleniate brlween figure* 10 sliowa ihe rerominrndiil rcrenlric A (I'"ig. 10) and die ccerntric brake lining when niaifrial out from roll stnrk Is used anelior pn in order to oblmn tbc correci mljuslnient. Dodi die eccelline A and die Anieriran Hrakeblok alao furiiialics eccelline anelior pui renale In dir sanie brake lining segment in boxed car seta direction to redure clearance BENDIX Two-Shoe, Double Anchor, Brakes (MCCIIANICRM A M IN O R A l)|U S I M F,NT Adjustments (a cm iijirii^ir Tor Imin^ wear nrr runtlc ,11 outlined for cttdix Two .Shoe S imjIc Anchor ly p e Urukca, cx< rpt th.it <m Double Anchor Hr.ikri dir dr.tr.uice h held ai 008 inch .ii ihr nmhor c m lio f (lie kIiocs, nnd 0 H im h.tt the ndjustmg screw cada 19 M A J O R A ! )| U.S 1 M f*.N 1 W l u ti vlim t h. iv r !>n n reltnc d or u Ih n otiti r . id jn s ii iir ii tt f u i lo |*t\# di tu n i ir t n ltt il o . imi lini flint tfm nld In* .i<l|iis|r*(l nt fullow t I I o il ou niMtiu liniit i*i\t n fin "M iN O I t A n j n s i mi n i " 1! tirukes u t r op< rutrd b y i .il 1/ s Itv mmiu < f <udir t u f u l l Tour in ukc % K < mss vi,ili |i vi ih | fi n uk r t urr ripe rute (I l> l o i li t ni.tkr ture (Im i t lm r s , u i mt lu mi* i x j M i u l i d u u . i v Ih itii d ir u n d m r Inix ? 1 miim ii , iih lini pin n u l i |) (I i^ | }) fi r ni ini k u itili i 1 R i ittitt r i m i i fii.ili s .imi %si il m r< w* di i\ i r iii (ih il hii ii si,u w Ih 1 111, ni udjiitt nif* t i r t u tn u .n d i i i m nf h .iik m jil.ile m idi Im iti tlm<>. espunti .motosi drud i iii.ikini' il mt|iiits]|)|i m m rii u h t d u n ii lindi h.m dt W iili u nifi tin m iu i tup mi Im i |iitiv .il l)wi\id<,d rn<R in iiiwiji |im t .istiiim iii* <m im i l |>nsdiMi) <1 '/ IL*I1f II ,MH Jli il M11(t ] ) ( I U( I I ) US (M'Ildv US (Hissllll' Mid i ,1 I HC<` l U I 'l ll ll S f h i i olili m p u od il f \ pi s, u d b In ,ik< riguto 1 1 ! t'Mf lix I w* i ` >|n I Vmi .| >A ih !w*i Mi.tkn tini* v m i t j i nul i d jinti im ti, r r u d p K i <ub le letti ih t t o <te \ is fini bui ri v ride rs ( l<*vu a n d i r u t t t l u f i 1.i< fcl.tdi *1 Ii k is d o n e at imi li w h r r i O n ro d *< oninillrd (ypn, all Imi kluth tlmtild ulto br rrinovrd fi ll.u k oli .uljusdnj stiew t(ur wbcel Il (l iU 11 ) noni lirukr k just fi ce of drng 1bit it doni* ur cui h u Iteci 7 l 'otlmv ud|iit(u\f; instnu don* glven fili " MlNOIt AdfdSIMI'NI " .SERVICI*' 111**1,!\S If difluidiy it rxprrum ril lo ^eldn^ hrukrv b.duot ed i nuove rover plulr from diiom m tp n don buie Slmr rlrnrnm e enn lie ( lu <k<il \vub Ceder Knuj*rt Wnh cor* rei i adttisimeno. frelrr g.mgrs wiU show nbiiid l u i i f ns m udi rie.ir,ime belwccn die di uni .imi tiniog ut die t<teiv udjiitt* ini; etttlt of die tlmet ut ut dir unriior rndt Nnmiully die t h a r.m m are .ilniid (loft liuti ir dii ud Imi end uud ubout 014 ut th ti trsv adpisiing ettd ligure II tlmwt die rrcnmmriulrd bi.tke hmm ulu n inntmn! rtd frodi roti slot k is tited l( it mi|miiuni io bu\e th ofiriuting tuoi ititi illrd so diut dieturved portimi of dir culti cipriu(et uguuist (he (or of (he pi mtur\ dure, ut thmvit iti l'igtirr 1 1 , witlt die ttrnuin tuie of dir urtuudng min on lite ter tmduiy siine ode Am eni un Ihukihlnk ulto furmshet hiukr Inditi; trqmrritt tn box<d rur xrix espi <tulli* pr< (.imi fnr dir moie popolar (urt i (poppe d ut di Ut tu11 x llrukt t Id i dui inforni.11 uni on Rrochx Iwo* Muu Krukrt mu\ !< fotitid by referrmg in ibi Si t i n i | (< ![>s on p.u*e I 20 ) FORD Brakes-- 1932-33-34 (MECHANICAL) M I N O R A D JU S 'I M K N I* S I.K V IC K M K U \S ] Adjust Imin^-in-dmiii rlraianre at external adjusting snrw A (h g 11) Turn A until l>r<ikr dings, then back oil mild wheel is Tier 2 T t M btakesfoi equalization and Inick d ia lle r on the front wheels of 19*12, 1911, ami 191*1 Kurd V - 8 cars is often caused hy the shoes not bruit' propedy centrali/id I hcic are rrplni cnicnt oper* aOng and adjusting wedges and iinrhor oir on wheel plus on the matket w lm b allow the tthoes M AJO R A D JU M M K N I 1 'Irsi from whit I and kpimlle pm Iwnnngs fu txtc stive loosinext 2 Ivxnim uespm ig shat klesluds, shock absorb* i lin ks, am i fu m i radios rod to (cntinlize tinmsiIves projx-rly 'llirse rcpl.itcoirm wedges and phis allow the shoes (o itM( In a manner similar to dint present on the later del Kord brakes. T he t ais wlm h make up tin shoe support Ui.uket also hu nme worn or b< ot down runiiMlings fm Inosrtuss 1 I >is um iik *< t In.tki mils .it win I m i l u imi h wlu*i 1 `I Scicw hi the I)i.ikr adjusting w trw A (Km. H ) until brake dings ll.it k oil ami tin ii suit is poor shoe u ntiah/ation and ilu t ii i If the cars ate hrm down tin y may be In nl b.x k tip, bin if tin y air badly worn the hacking plate should he u p la n d ll is also possible to osi p m i / f rimm'h so that biakts du not drag ruth i puis hi the bottoms ol the shoes oi S Adjust Irin*tit ol brake tods so llt.il oidi r to i.iisr thi shin s It is lirsl to d m k ihey are I / 1 2 nidi short when all haik- the shoe <t ntr.ili/atton with a dummy lash in binkrs has been taken out, and iti vi.ill c Jrvts pmt and (otters ( Krpi.di/c by harking oil adjusting m rrw A on libiti wheel drum in <interim; gauge Another rem uly whidi has been very successful In rhmmntmg d i.itlri is to have nut (he pms wlurh a ir used lo attai h die tops of the shoes to the adjost* in pins *1Ins allows the lops of the hoes in (foal and thus proprtly centralize (he short t( is usuilly only nriess.uy to do this on the front wheel htakes In i . isis of bad ih a lter on tin from isheds it is also possible (o drill holes in the It,ii kmg plait opposite the holes In the fi! VI fill ACtlNfr VlOl USI sutioAnti AMfSICAN BAMOIOK CARATINO WSP&l Tig uro 12 shot s, and use !h udix hold-down spi mgs, sot h as those usrtl on Hrndix two-shoe hrakts to hold the shins more bimly m place Hi moving the lining fnmi the tups of tin hoot shoes and the boiioms of die it.u shots also hrljis to rhm ioale hoot wheel brake noises *lbe lining sI iim iJi I he nit b u k to (In next row* of tivits .ind hnrd Broke (101? 34)--l**lt rioni du n w1 11 <bamh red 21 ) ) I)}/ sin folk i slfffifM .ilu .n s 1 pi k m ] Willi llu ( Min i pm i iid .iu iv hum lin h tr kmt* pi m If tin* li \* istu i h nut hi 11 hi ,ikrs pnH p ts( tin tt im It Hint huh in (hr holt ill (lx ui i)i;r .ipph * mi* i m i, In f u ii'ii tin |msti m il mitl (In* u 11It*i < im M u i n Iv I '>M I tills n sol'll i p c d .d nt iv h r tit(,tim <1 I iv h pi it iin> tin* i i us< sli ill 1< \i t u n it i l 'M ( .issi m l il v \\ Im ti li is i\ui p< 1 1 11 it \ i t In tit s I fit* h *p in if s h o ul d hr ti i <] win n ,i sitln pt tJ.il is il< sjji <1 t i*iit * It slums (hr h i utninr mil <1 hi ik'* ilium ; n In n m Hi u .il i ul fnuo lu ll vtm k is list il A fw ru .w ib.doM ok .iho /mmshrs lu.iki* limin' vi mn nts m |it\<<! < it sets i sp< 1 1 iliv pn p in it jut I nid ( ,\r* Vmw in im Backing Plain Side of 1(*ll kVnr I onl Broke FORD Brakes--1935-36 (MrcHANICAM - A M tN M K A D J l'S l M l N l* in .ivm d ,i filsi* .iilp iM n icn i u ln n litm us n r i \ p m ilt il liv in .it, .iilpishm nl should iinly I vUi m pn <1 win it (tu lu vk( s im l iti ums u i* i <ill I ) U use i ii fli if ill I w In i Is ,i(i /f it Adjust Inumpm-di mu cirMr.tiMc by si mutin' in i Ih* .i(!|inhmi w irw A (Mg. IS) until bi.ikc (It,ui, iIhmi h.ulc nil until win 1 1 is fl(c A .'lost hi.ikrs for rrjtt.ili/-.iiton and lut k nil mi liqlil U In 35 30) I nit Front M A JO R A D IU S IM I.N I I . Set band lr\t r m full tidrnM* |>odInin, m.tkmi'Mm* ih,u (fn lit ,lo * ,u<` fully m !<.im <1 unit li iml t* s< iii tins position. 2 K .iimm u soili.it,ill ) w))i< Is,iK'frrc. A 'list fmnt w h ui mil spiudlr pm htMi outs fur I X( t SSIVI* Ittost III SS 4. I A.umm* sjh im* sh u kti* studs, shock .ihsuitH r links, .uid ImiiH uidius rod motmtimpt for lomrix ss 5 D ism nu ut Inakv uxlt a \ w h n l cod oil ,di (our uiirrls 6 Suevv m the lu.tke ndpistmi' st rrw until hr,ike dr.ust then bnck oil (uough to frv r t ,u h win r|. 7 Adjust iemph of brake rods so that *>2 thry ,m 1/12 nuli siimi svili 11 ,ill h.ukl.isli lias lire lakrii <iul, .imi misi.ili i lem |>im .mcl (imi is K Kipiali/r liy h.ukuiK oli adjostmi; SI II IV (III li|||l| wlicrl .SI.RV1CIII I MCI .PS 'I Ite mmi fieqtietu Piilii|)l.iinl mi illese iiiihIi Is li li,irti |ilil.iI l'i dell li,ivi I is .listi .1 firipienl i tiiti|ilitliil Ailjtistinent svili liil|i Imili riimplumts Hi .1 <ci min (lr|>iep, i r , llir liiilnii-lii-ilriiiii lr.ir.im r .imi (akliift cip sl.uk In tuils Iii.m y iiiiiiilieriif 1916 .imi 19161-'iinls, ilir p iil.ile,in lie pmliril In lite [Inur wlirn lite r.ir is slamimi; sull, rvru wlien mi adpistmrid li.is lim i tn.itlr I lus is due in th iodi slrrlt Inni; mul .liso ilisliiiliim of lite (Iiiiiiis, .imi c.iiiiiul Ile liilp n l vciy umili uiiless 1111{*1 .11 p.uts sif lite lirakr sysliiu .ile repl.uiil Improper siine iriili.ili/.iliiin .liso friqtirmlyrntisrsfiiakriiiiisesnii llir 19 il-V i I ulti lu.ikes U n u iiii'du s ili si nini) un p iqr 17 muli i .Si is tir lltlp sfn i 19 12-1 I. 19 F im i lu.ikes .ue .ilsn useful in d m .....il. mu lit .ike muses mi 1916-16 Ford lir.ikes I liete .ue .liso scvci.tl types of icpl.u i . nirm .iiljiisunem pois .imi wedges mi die m .iikcl for 1916 .imi 1916 Kinds svinili allow tim er reiilr.ilir.iunn of tlic slims When die flnalini; adjustmi; pins are used die lu.ikes become similar lo 1917-19 |H Fold brakes ami the I917-1K fiielitm material should he usui It is also p en ally impuri.un to make soie that the brake rods arc not liinilini* io th .mti-ratlle ilevii hiRiire H shows the recommended Itiakr Illuni; when in.ili tial cui from toll stm k is used Ami rii an Ihakclilnk also furnish luakr limili; stj;mnits In boxed tar si is especially ptep.ued for Ford i.u s.m il it is pariieularly rirm im irm hd that (lose i ai sets lit used on 1916 and 1916 modi Is FORD Brakes-- 1937-38 (MCCHANICM.) M IN O R AI )J Ut I'MKNr I o avoid a false adjustment when drums ate expanded hy heal, adjustment should only be attempted when the brakes and drums are cold. 1 Raise c.irso that all <1wheels are free 2 Adjust IliiiMf'-to-driiiii rlcaianre by srri wmgin diemljiistint;screwuiiiil brake clr.ij;s, then buck ullTuntil wheel is free 1 lest litakrs for equalisation and b.u k olf on unlit wheel etite CONTROL _ RANGE /tutHo* fin lEcetmaio Figuro 18 ford Brolo (1017)--It'll Front M A JO R AD JUSTM EN T I Set hand lever in full irlr.ise |iomlimi, making; sure dial die brakes are full) released witii hand lever In this pmilion 2. Raise car so dial all <1wlm Is are free 1. "lest front wheel and spindle pm bcarnim for exi essive lomrnrss 4. Examine sprint; hatkle studs, shark absorber links, and fund radius mil motinunns for Inosriirss. 23 ) ) f )im u nn i << fx .i k i .dih s In .lit fotti \sfn f Is .if dn ( tnsssh.ifl fi N i i \s in hr.iki .idpisttm* si u w until u l u r l i tintili lx t in u n h) It,mil 7 Nil|tivi If tit*tit nf i .dilrs ,il ( tn.s-slufl mi tit (I ( It s is p m i .ii i lx* nisi illt ti wit h 'v ili (mil un ( ,i!t)i* H l i n k nil .nlpi'iuM' siirw oil (Mill w In 11 uniti f( i < 'I I f | i i .i li /i ` I n .i k i s hy h.u kuu nil ul* tiv!u 11* M t u on (it;})! v\ in 1 s i i n i n m . i ins In i . inis mi 1917 I nuis win it (hi' hi ulus h i tii t i t i l l i v i h i p . i h h } , tin Ih il 11li vri.up* i .in In <li. imo'il in li im (I) (Ins I lx p r d . d Ifril u l u i l i IIUIIIII Is litt il s ..vii.ill li vi i .nul (In i h ii. il It \ i i .in In pl.n i d in ( I k bu li ni li 1i1i on liti (loss* sfi ill b vi i I Ins ur li ui.ikt ,i h u d I JM*1 d ii l i t m i K i n u M lur fpi <fi di i l i o titoli I In u In s In i ii sunn i imi ils)' ni ln Ifit lu .iki m i m i i* fu Id 1 1 n timi (lu i i i i i i M in Mimi in u l iii li In nisi.ill (lit* VMtlfius i 'iln in l spnoijv in (In V 17 Im d ht do In i.tih lx tki .tssonibls (In i f ,tn sfvto spi nips nul liti t u lli i t posinoti of du st* Splllll's m.lN III fieli I lllllll (I IlV I * ft 111 Ml* In ( mini ( s h u i l l n non d l l t . i l litt M .in l u o lorn* .un I t u o sinn I in iiki sin' i tiltil spnui's I In i n n shot I In kt slim i r i u n spi mgs ui f 11 m lu I .ii du m p o f i h r Ix .ik f .is* si n i h h und v n (h u m du shuts in d i r idjusnm; m i m s I x i i k ' l u n i t ifw i r t i spi m<' im du p tiiu its slim un I du hi.uk pi nie ut I lu s i nod n \ dun lit ' (sin loin* in iki s|n h m Ini n spt nil's n i u i u In 11 . i l i l n In on itn ul (hi in tkf ivm niliis nul i*o li't in iln sl im s m (hi M lll'lll' lini pill Vsllft ill' 'll imp spi nu on d u p i n n ns *1" m id ih ipMi spilli, nil ( i f i t f o i l d l M *h*ri I Jri i n o o ns shin is du lost slim un i "tin in .du r I n nt; llw .tin Inn pin .mil o u r loti' m i In flin t (inn " f lm u .o d ilio n t ini mou I Inis vu sit dim >i.n mit* m (In mi Imi pm .m il in m im ; in lite d im (inn of foiss in! d ru m ritintim i d ir nuli r of d ir lit.iki shin Miutn spumts ( s O U A N f h , K M ), lil.A i'K , C U I l\N I In n llu'ii ni (wo slit ( hlm k hold* thnvu spimgs, m tr gnuti lu o.uli shoe 1 lu l.isi spnng is ,t Ioni;, sm.ill ili.im - f It t, hint k spi nu* vvlttc h is .itl.n lu d (n d ir upending li In n i Irvi i t Itr 19 17- J9)# 't tn i br.ikrs u v e .i ter(.tut .titiniiid ni It.insfrr of fun r fimo noe shot* In (hr olili r if du sprint** .lie noi ( o h m (ly msl.dlid, (Ins tr.msfrr of futre will noi (.du pl.urm id du' hinkt will |>r mell< t hsc A n obio r.nrsr of Ji.ird ptihd (Innubi) nd m no it in finer irmisfirnn 19)7 Kord in ,do* is dor (o Mupmpi i st unii nf dir .tdpisiutg wrdgr nu c Ii.imihiii I h r ndjust* UK svolge is (f)S'M(d hy ,i snudi mctnl (Its ,is shown m l` igue IS On Ote fu lly 19)7 moth Is when dir shoes were (Mil ut pi.tir it w.is possible lo inni dir .idprsiMig mu mid dtsiroy ihr Mtlmg nf ilir .ulpisimn imilumism O n du`scc.tn , du .tflptsltm nul should noi hr 1unit'd nuits* dir shoes .itt ut pimi In rtic of doiihi ii (.niltiu* (hi (miei 1M'Umg of (lie .t(|]iisiuu; hum hmnsm. it is iuttss.try to rtnmsr (hr mO.d thsr tuvrrmg dir id* pisimg wi dip I lie fi<ls of ad jtiMincm pins A mtd H (io* fi) fil into hnif* tumid di pifHMiins m dir atlpisiiug wrdgr im i ii.nnsni f h< .idpisiutt m pul A (from situe) should .dis.iss fu mio ihr siiiiiltcsl dt piissimi widi (tir ri,ir shoe .idptvltog pin II l!iiim> mio du l.xi'ii drpirssion f fns.dfosvs luifh pins (o ptof rude .m rf|o,il .iiiimiiiii fiom du .itl|Mstiiitf wedge haut* nu vsfu`ii dir spmigs .trr ou rroJy In M dh d fl ts (spM t.diy tm pm i.iiK io h.ve piV7*)H l' md brakes wi II lutirn .ned arid piopi if) .idjitsu d ssidi .dl sl.tt k irtnoved Iiix ii ih r In.ikr prd.d m unlrr (n rimi lo lie h.ud piif.d fompf.MMis Win o du n io it n i .nu hot pm nerds id|osiim n is desi io do dns hy using ,i duiiniiv (hum m hi iki shoe t oiu< ninctty iMimi With du dummy drum or mm nunc ns gnugr inst.'tli d, dir adjusting screw 24 ) nul die rctcnlru .itulmr put should hr sd tooht.im OOV' < r ,n thr u|>|>h .nul lim tr nuis nf hnh hiake shun Amrrienn tliakdilnk fiintislus spui.il iiuHri.il in buxtd ( h v ts fut l `M7 .iitif PHH luii1 1 In.ki s, Iml Si md.nd Am li rait llrakelduk mil n id ifia i may (h nu*<{ il desired Several different types nf ! lui k brakes are fourni ou (cMfr.ti Motors cars and while thcic .1 slight clilH m u r m dis!# thr f^rtirtil oprr.ilim) puiwiplr is (hr sanie .nul t(l|tisiui( itls .im* made substantially in die saine m.iimrr. ! n ont* type ut dus M INOR ADJUSTM ENTS 1 Ju k tip .ill four wheels 2 Iomen lock mil H (Id# 17) on brake (.mi oprr.Ktii lever .ml (tint the adjust* mj stnw O (l?lj{, 17), to (hr ri(ihl until wheel .in b an ly lie turned iiy h.inil Ke* h .isr drag .nul d un tijhten iotk nul II Kepe.it oil otlu i whet Is \ lx|ii.ilt/e lit.ikes U adjustin' mus (J (1*IK 17) hy liMvim; oil on tight ulus I (A petl.tij.uk forrxr rtim pressuteon die hi.ike jMtl.il e.m he usitl to .tpply die brakes ) M AJOR A D JU SIM K N T 1 Jack ii)i all four brakes l 2 A d ju st fro nt w lu r l b earings In pro|M*r tension. 1 Disconnect rocls or tab} s it t levises Ftguro 16 Iluck Uralr?--long au! SIhjiI Shoe fypo MnMnto.illy Opernled 1>, brake .i long luakr sbur mi buts against lhe h kmt{ plate hy un .ms of arm nlaied Imk A (lit; 16) lliMfuM, \sli< it lit br.iJu s ne applied 1 111 die lii.ike di mu revolving in lin frnw ml d im mai du r< t a tendeni y lu sivintf du* shoe iiioie ttih(ly ijamst du dnini. 11un hiake is hk'liiy rnrijp/ed `1lu* i.d< r iiiudt is of dus biakt* Itnvt* two loni* Uuxs instead o f .i Ion) md jborl shoe A I.nosen criitrnll/rr clamp holt l) (l`ig I7) makingsuite tli.it the centralizer is fire to move hy tappuij <am operating lever lightly with haiiuuoj 5 Aljmi .rrvv ( (l*Jg 17) tmid win el <an |tis( he turned |>y hand Tighten <t nnali/mg holt J) (J*ig J7), 6 Adjust rahh s or rods for tins \euim* and irt uutu <t dir ui 7 ll.u k oil ad/mtiin sirrvv <! (I n< 17) mild wlu el is free, H Check brakes forrrjuai diag making (mai .trljuslmeni at adjusting snew U ( % I?) 2s ) M U V U 1. M l U 'S lit# lintim tu -d to m iunls I <ss <fi a I * m u ill m this lit ii a li llit I mi jyi/li'* m Inm .uni in i\* i him ,i I> m l (in f il Ii It ( Mit Il Ml I Ut S I II Mtl I III `HU III! 1(11 ill/.Ihull liliM l iw I } < IMl) Il I , t |Nlt f , ,|||l ) Mil Ml should )m ( in I ki il a m i m n u l r i t if M it* I *\ ti \ Mi alii iij>l.imiv O n Unii lv t ii s In it <| \ m ili I Itti L In ila s I Imi I is ,t Itilo ii ahm ; In i imi mi ih r <alili' issi 111111\ < ni slamili hr t ikt u .tiMiitsi i m i lo lu n lim n at (Ins {m ini, as (hr Im i n n im( tv ill in ( (ti tin Inn n<* W o r n l>nslmn*s tn d i r km t it lion is. si in lilt1m i < 'In v I ul I ( it s i 1 1 w a l l l l m I M< t li u m il Iti tIvi s o ill also i misi lia ii t fu tl il t umj! mmis 5vt|M*als m vtjMt iks m Muik lir.tkos art* Him tally (.msttl |,y m to itrrt adjustMM Ills, MM|M<l|M t sfinC in ild lt llH l, fir l>y ItMist im ss im llir fn .ik t assi'M ihltts .S p u in ' j*Mtilr i lips should lir st|iit i /t d tnjrthn a m i sjit mi* uaslu is shou ld lie i Iwe k e d to s' that tlx y an nut loose I1uiim In shtmt (hr ir<ntiminidrd b/akr hiinii; win n mil siotk ti und A m k itran Brakcblnk aliti f u n n s li n box d t a r sr(s tif intuit nd is|>Miallv deiitfitul ff>l tliesr Make*. Figuro 17 V irw .Sliowinn Hai hnfi Pialo Side m Hnrk Broke HUCK Brakes--Hydraulically Operated ,, - I ( I n ri < n 1 ( lt< \ i oli t a r i are r<|iii|)|ird \v uh l i m i , In do s Ino m i *' l u i ) Inni short i m i liv t ndn dlv n | i i i ili d , ^l it> IH ) ( u;< m i l 'i s l a m i si i i n m il \ imv i if lltiMv I im I t sl mili t I l e | nsfMits pi i ss a* 'i m v( ait ( Mi( t i|i n l m li is ptlmi d dm i i ni idin iM l m i i I h ni iln t vhmli i I h r ad|ositntj si 11 v li is i sii iim 11 i m ] vv Ini li Ins ov t liti su li ni d a siine m d |*i# vi nis <h(' ii h w h im i fui im i" I Im* i w ilio nN m io liti I n d i ni ilr t inI i if * svilii h li ts an ad|MU* ih) u l n i I w lih I <m il | In ail|iiviim; vv li In alo v b n d r r an d r n ^ . t ^ n IhitOb mm ( tir dui siili' ih ami'fcr ni F ig u r o 1Q Chrvfolrl llnrk Brake, Hydraulically Ojirralrd, ^hnwnnj MrrhankMl Ofxfrrtllon el Perir Broken tur h'ufkoiq 26 (Mill t t l d t a p I h e V i t t i 1 ( f l u i t i c i IV muimiCfl cui iliv hacking plait liy means oflw ot tp ( t n w , wttli bhrdci valve ami (hud lint <outlet linn <xt< tiding ihumgh (hr Imi lung piali wheels arc u m in l Ki h atk lh< shuts away fioiii (hi d itim to hr stue ih< it isn u t|rag a lt ilio i shoe O n e adjusting whet h s then Shoe adjustmi it( is vri y simple, id fat t t iui( even a fetler gauge is rt<|iiiied. Ad justment it (onfme'd to (urnitu; (hr ml* justing wheels at rat li shoe ! lit* opt ra- . (um is pciroimet! |jy turning the adjusting wheels with a iew duvt r used an n lever insetted through die ad)iis(incn( opening ns shown m ligure 20. Hits opening <s located m (he weh of the drum im stime models mid m the hacking plate as shown Figuro 20 tn M guir 20 on olhrr modrls In adjusting (hr shoes, die adjusting (nrnetl <o hung ns shoe into contact will tlu drum with just sitlhr tent drag so (hat (hr <at whirl can just lie hirnrri hy Itmul, (hen hacked olT until (he wheel isjust fu r uf drag I he same procedure is follower] with (lie othtt shoe C luck die shoe ad* jusimeut liy applying the brake two to liner turns and making sine that rath shoe is si | as t lose m tlit drum as jtmsihh withimt thaggmg (In liydtooht systi in on |)ms< hi tkts is srrvued nt (he Kami in.inm i as d isn ih id uitdu lotkiued luakrs Hgute IH shows (hr uroinim ndnl matt nal when roll situk is used Arner* lean lhakehlok also ftnuishrs boxed ear SedlonoIVlew of Hydraulic Whool Cylinder on Muck Hydraulically Operai) Brokes sets of brake lining especially designed for these brakes 27 ) ) EXTERNAL TYPE Band Brakes ---------------------- tV ............ .......... ............................. ........... A I i I ii til' ll (In r x i n j m I t) p r o f lint it I l n , i k f li.ts mil In < o list <1 .is m .h u I. i m I t tii|nii`Ml * n iin itm v t )tic It < fui st*\ r i .it y f . n s , (line* Mill Ilf Mltllf ItMlItit < III (I,Illy 11 Willi h i m Ii. wih . il ly t m 11)*<11.mile ,tilv n p i t i t r d 'nt'in.il li m i t hi i k i t M i n t 1 .lit* ninny n p t t if ilrsijpi .inti v . i i n m t iiitMiit Imj " I 'M *um; liul in it i k i .i I i I h p n m i p l i is In m i i w A tv pit ill <m < t ii.il u pt* l i m t l ln.ikt it siuiw it hi 1*u; ' I I It "H It I h i In in I tilth IM. HUI till IJCH* i 1 ! is Hi " f (lit i tots hitiiitti.il mi 1 1i,m* u 111v -npr i Ilf <| <t it j n. il- U p r Im i h I h(.ikt it It n in slm iild lit* until e lu I*it* 2 2 I Ins dmws ilit* etuict t nl.vUvc postlmn uf tin tiit 1111 tii si it W l t i i i (lit li i . i k c i .in* i t * I. isitl m il die .tif|tlsiii( n(s .in* t o t i i t l ilic t tpuvii/t \ Im i vs kt pt p.n illi 1 w 11iv (hi 1 Inst sli ill Its l u i l p l l l lllltl{ " l sl imlfllHIU I'xh'iw il lypo Prole M^chnnlrnlly Ojn'rnloii low n in srr that die Irv m <!u riot pull p.vst . Mi.iu' Ut up ittvd dmvu position wIn ii Hit lii.ikts ,u r fully .ijiplnd (Iii Miii( .mil (c f( In. i k r m i l s <!ii v i m s .i n p i t i M l i l t i .VI tin i'tvtis n{ illi lolls ("I ||"IIU Mils M (.1 s s | n f if < ( )H |< | ( I ! I M .U A i.l S ills! it im v In.tin hI|iis( iim m .iih| up i i ,i* U " U tt t|UUI s l It St i hm { in s iHtiiU I ININO-1 O -D R U M C II.A U A N C K I.M tin.if lypc li.iiid In.ikrH Iv.ivr more limnu-iH-tlmm <Iim i.iik c d un internal tspts liu.uisr dn* Ivmm dvr lu.vkr drums i*ct, (In* ip cm ler tlti* <h im r fui hi.ikt* drag In im iiim tiiti witii Iniimpto-dnim t U uv me <* U.vkc dwnm mM lv< t tvccked > inks it it I I* v* rs slum n m I iv ' \ must fit sf | it U< h tllt'it M i l i u i m l m i PfOAt ROD CROSS SHAFT | HIS|||, nr | I I I | |\ I I " "IK H in d i . I I " |'f | I h I* cf* m i d pt i ssim i "I lit' 1 m i l s .I* h i m i |m I k tki <tl Hills pi if l! is (ft pH SSI if llmlH'Il lilt povilltilis III (l.lki l( W is .(till ,l| His \ h \ w i d i d i d t 1111r n n I. <i \ i !m l<, .i s.di i nit Ini d ir nn i Ii.ihh I" fill* ?K ) for (omhftuft or coned dnim^ tan lx m om him w d by tinning m grinding In suiiii*1 uses .1 new (limit must hr usul P .X TK R N A I. HAND IiRAK.1. A D JU S T M K N I* 1 ).uk up whet Is .mil iuhm oir .ill working purls a! hiakt system, 2 `I ty winking parts to scr if .ill cun* l i c i t 01 is and raeb shah is fu r . Brake prd.it slum!! he snapped mi .uul eilf <0 see if linkage is 1 Test whirl heatings Adjust ifbear* mgs *uc Innsr A Disinmirit brake poll unis 5 Note whctliti baud updating !rv< n ,ti r against thru stops 6 I urn .uu hor adjusting m rrw A 21) to get .t 0(5 nit ti ( h .u.im r biiwcrn di 11m .iiid lining 7 Turn mil 11 (h g 1) to get 4 (DO nidi clearance between drum and lining .it die levir (ml of the lining H *! titti nut C (I*ig, 21) In get 4 030 m di dr.tr.mcr .it otlur rod of the lining 9 Recount tt pull nidi mul note angle of operating liv r u ItyiialirrrharmuM hr paialM with hr.dcr urns shaft 10 'lest In.ikes If pcd.il (ton to tor ho.irrl before hrnkrs nrr ,ipplir<l, discou nt 1( pt d.d nxl .md t.ikr up phiy hy rJrvw .idjiisunrnt or mtcw.d of putts S K ItV ltt* fil'd PS Rrhm d hr.ikr hands should lx rr* shaped to proper dimti fit ht foie they or .ipphtd 'I h r hydi.ndu S)stein on hy* dr.iiiln .iMy-npt ruled xtttn.il brakrs is sc 1 vn rd in (lit s.imr m.tonri .is (hr l.m k* lit t <| systi m pirviously tit s ulirtl t si <pi th.it (hr (hud leservou is usii.illy stjia* lu te d ft 0111 <lu fillister t diode r and eepnpped n u l l ,t hind pump lut im hi bleeding huts *imt t< phn ini' fluid 1. clmimate d t tilt r, stjio.tl tit mini imoe. the tor*rnds of (hr hi.ike h mil should hi bent .tw.iy fttmt the di unis A htlle ml at nuts II and C (Fit; 21) as well is on (hr ( Irvin pma redurcs brake noise and makes for better hr.tke operation A better ,u mm usually is obtained hy Lotting dir timin' at the nnchor and chamfering tltt ends of Ihr lining Aim m an Hrakrblnk, ns well as most other lining inanuf.it hirers, retoimnrnd the use of a woven lining on external type brakes We do tins htrause cxitrua] brakes air, .ts a gcnrial rule, not very well pin* trt ted against the cnirance of sand, dirt ami otltci foreign materials When aiira* stve subsum rs, suclt .is partiden of sand or chit run t dir hr.ikr assembly ami i <m* tart the biakr lining, ilirtr is inuili hss like lihood of damage to the lining if woven material is used fins is liui because woven brake lining is soft and moie or less porous and under (tic {mssuir of braking (be abrasive substation ntilxd tlumsrlves in the biting and do hide damage tmliss (toy ate bard enough to cot (bested hraked i0 0 1 With a molded brake lining, however, the sand ami cflrf arc unable to imbed themselves became the molded lining is hard and nompormis As a su it, these abrasive suhst.mirs re* mam on thesuirnic nod are nibbed along (hr face o f die brake lining I hr rlfcc t is 111111I1 like dint of snmlpupcr and under these sand and do I (ombt/nm we hod molded lining wealing out faster than woven tilling However, if ext< mat Inakr assemblies weir (specially pioln ltd against the entraine of sand and dot it would lx* found best In use a molded hiakf hniMtt 29 ) ) WAGNER HI-TORK BRAKES U i/ NV jim if I h - I oik I 1.1 k<* ts m n l .11 lilt pH M III III fir IMI (lu I ( ,tr \\ ill fls n l f t ! I.Hit IJht. It Is i.l l i m b , tit ( uujitiu (um u u h vi uni m ! W a g n o I .<>< M m rI h v Iran he In al.rs un d ir fi m il u Ik r| 'flit lilt riling ul ili< Ii m Ii .iu Iii \s irn i is than in (In s iim i in ,m u ri n ivtdi (in stand,nd l.o< k* U 11ysu m tli si di it m tin t .n l\ p.u 1 nf 11us lllMlkit 1 In (lit W ae, im i I l i - l in It I m.ikr (J I M ) t |utli slm rsnpr i ilr ,i< I uns m l A< Iitti; M m* t\ In n ,i snip is m <dr u tili 11if \t (m It* im* in die in tu .u d tlm titiH i During mm It .1 slop llit Im iti shut ,mi lints again! ifit iru lin i (ini (A ) anti lltr o ,ti slint i him Iin< ti In lilt1.mi Im i pm (IO \ \ lit it a "rnsin,^ tup (s m u| i m t t s t t u , ilw I m u l Ilot pi i n <t is ,i I m i t m l \ t lini; SI Mit antl I im in h s n p n* I invi t ht m \ i I sr a tu Imi pin (C D n i n i t ; a i i w i m sm p, d i r i r a i siine Mpti i t t s i \ , i H m r M Ai t him Sin it .ulti is nu lu ut l ut il u tatst nt u m il u n i t i t i li\ i h r im Itili pin ( I I ) I Ins .m i m m i i,nt [m m I m I i I v I ir I m I i ri m u l i t si mit! In i i f r t . I mi* in flu f n l . i n t\ i h . u;t im ( I im n i t JM) 11 u ilM n In >l' I ili it 11ir n lu ( 11 \ Inuit 1 tisttl in ila Waipit r I li I utk U a k r m clif- fo rn i (han dircnnvenimnalstt pprd-bore tylttttlu m tlt.it lite lylimlrr .ut* nt nn tnpli li wIti alsn Iir liuti il di.it (Ite linai! sviti ri t yiimfri ptstnit d o n noi operate tini t dy adattisi dir tr.ir dine luit miteacf lt.Humus ufwm In dir m arsltor direnigli a s\ triti of lr\rr t miosting nf dir lever (I.) itiul dir sur \sIteri ton/irrior jtliafl (D) 1Ins ,m Unii t .m .dsu h< moro clrnrly nndfisinnd ly itftm u g tu Wgure 24 O u a ita nani hip dir Ante riniti die mali ptshui npoaim g duuiii'h (}.) mici (D) u d ita m i dir tt.n shnt* m move mio im itati vvtdt du* divini, Imi tt vsiU noi tausr riti finiti Ime m Itavi dir anrhor piti ( \) hot ano* dir latgr pitnn Itns Inumi dii ini of dir dniit siine mio die 1 fi imi and dii fi uni stmi i hrld dghdy ai misi dir ani Imi (A ) In dir <nergizmg finir ni dii roiaimg duini Ilnwrvrr, u h m a top n nt.tilr in rrvru r, dtrrc Is nn <ih iip/.unm ni dir front siine and die sin.di pistoni alili in fo ile dii Iin ln fd ie imiti sluif min fin dittiti and dir front stim titt Imi np aipuosi dir rrvrrsr aut hm piu (( I Ims, U i m lr si i \\ that imi a n u r s e stop, ilo stilali pisliMi oprrafts lutili dir filini ariti flit t< at Ime Mlhnugh llirn is miisidt r.ihfr ililferiu f in d>r si/r o( da liu p antl mini! pisium ttstd ntt lite W agm r lliU o r k in a b , rfir i<\ri agi use d aitiI th litanielo s ni i|m pisintt aie urli dtat die pres* un imi dn me nf dir fumi sfin m u n t e t i / dir uni as dii pii mi mi dir tur nf (he rt ar slmi* | (ns testili ni Unii siine domg die anir .nimimi of um k in Ahvani topi uhi u hot li shnt stipi ratr as hot w.nti Actitti; Shnt and llits ir nds fn krrp dir Hnitig ut ti pratili alls rtpial tn bulli Ime I he m brake is also v n y e ilu n v c because all of thr lining sctutgm el on forward stops, due to die two forward shoe nr (ion I lie Wagner I,In me Corporation m .m ufaom cts of die Wagner Ih-Tork drake, have published the following in* itrmtions tovermg the servicing of (his brake M in o r A d ju stm e n t-- l hese adjust* ntfrm should be can led out m sequence ns outlined Ik'Uiw, Hrst nuke sure dint wheel bearings me in good condition nod properly adjusted and (lint the lining is free fiom {reuse. 1 Loosen reverse anchor nut (C) (Fig. 25) su/ln ico ily to allow rota lion of anchor pin (t will tie net c*s,u y to tap anchor pin to loosrn it In the backing plate before it can hr rot.it d. With tin adjustable wrrm It, tiun Anchor pm in direction of forw.ud wheel rotation, ns shown by ariow, until a brake drag is fell 'Ihrn hack oil anc hor until ding is relieved ami a 012 feeler gauge can be tusrrtrd through (lie drum inspection hole \1/ / from the toe nut of (he hoing bank anchor nut sm ircly. Kotair drum to t hrt k for high spots or drum rcreulrlctty 2 Remove adjusting hole cover (F) (lug. 25), inscit a screwdriver and rotate die star wheel (!*) (Iig 23), moving (he iinndlc of (he screwdriver upward in di rection of the axle, until a drag ia felt Release rear shoe (I ig 23) from drag by rotating star wheel (U) in opposite dnee.* don from above, moving screwdriver handle dowuwaid away frurn axle, untd the drag Is relieved and n 012 feeler gauge* can Ik* user led through the drum mspertion hole I ]$* from the toe end of dir lining adjacent to the star whrrl Rotate chum to clin k fur high s|K>li or drum eccentimty Replace adjusting hulr covrr N ote: Audioi pins (A) and (II) are not to he disturbed tmlcn new lining is tnslallrd or nihet adjustments fad to give results No adjustments should he made unless drums are at normal temperature M a jo r A d ju stm e n t--U is uupiraiive that the following adjust me nts be ran ird out in sequence as outlined below* I Loosen the rear shoe hcrl anc hor pm nut (R) Loosen the front sluic Res l anc hor pin mil (A) and reverse anchor nut (C) suflicicntly to allow rotation of Ihe anchor pins W ith an Allen wrench, turn the anchor pins (R) and (A) to their off posi tions, winch may be determined by ol>. Diaqrcmi Showing Action ol II Waqnor 111 fork brake on a Forward .Slop s* rving the brake shoe funvemrnt !| uill bencussaiy to tap rrvusr anihui pm ((.) to loosen it m the backing plate before it can be rotated Witli an adjustable wrench, turn reverse mu hor (0) to hi ofT position Remove adjustment hole cover (F). Insert a heavy screwchiver thrtmgh the adjustment hole m the hark ing plate and engage star wheel (ft) Move si rewdi ivrr handle downward away from the axle and rotate the star wheel {?,) (Pig 2*1) to contracted position, 'llm position o f anchors and short permits die assembly of huh and drum over newly rrhnrd shoes 2 Insert 012 feeler gauge through In spection hole In drum approximately I Vi' from toe end o f front shoe lining Rotate anchor pm (O) in direction of forward rotation of the drum untd feeler gauge is just free between the hninj; and the drum 3 M ovr drum inspection hole to ap proximately J M ' from heel end of front shoe lining Insert 008 (t clrr gauge be- 31 lui ni lini mi .imi sinir P ululi ,iiii Itnt |i)n (A) hi h v i i m illuni mi idim lutiti (Ih f* t'i i* mjr is pisi fi(*i` K <In { k mi i mi ul ); li buia uf O P dus imJ r\sj, M(>t .Il opnatluns Mimi 012 ts ul i uu< il .11 (i.r .imi POH (liMr.uur at ibe li 1 >f li uni sin In ih it* { m l m h a ih Imi pi uh m ( u m i l i unii IH' ur 2*1" box a 11 m li l ! iim ri m i u d iv 11 t in i mi; li ad pisiuij; lin k in dir b illuni; p ia am i rotati star u l i u l ( 1.) )v l u m i n i ; burnii uf i m i n i l t m i i i | m a i <I in ( I m i lim i uf usi Mitili i Hi 1 li i Ir i j mi;t is jtist fir i 1 1/ f u imi un i m i ul M a i sin Piai r OHM f ri t K iu f 1 1j ' h uni li* 11 1 m i it i Ill un i' uf ti ar siili* imi n i i a n .un lini ( I I ) in m v m s i i ll u n i i i i la i i ii u u n n i tlu* li I n (j.myi |s |HM i n r Hi i lir i k Ih* tur r m l uf lumi); l i j i i | i i li',il .i m m tlu* s im i / \ is l , ri pi ut abusi n p i i i i i n u unt il Ut 1 i li ai uu i is ubl .u iu <1 a l i l i tu* ani I 00)1 ( li ai ani t al ( I h I h * 1 uf u ai slm* /ti'lrlr n un imi piu nid \i *}) , lisi)* IH'm J I" Ihix tu i m li Kipla* nl|Mshni> IhiIi* i ut i ih dir 1mi kun; pia Ir M S WSI Mlll \ MI IIHAKI, s i n n.s 11<( >m m a c k i n ; p i m i I Ui l i n a i di sptiMf*s ni ni di h a i diiir mitili s (<<) (i'it; 2*1) {lo* l i i . du imisi In liillt i ull ipsi d b* filli d u s p u t u ' s in* ir mi *iv r <I I b i l u m i slwir i n o i ma Ih i / turni 11 li uni ili* b u Lini; pial i ' ( il i mi m in' i \* i i i m <1 in 11 m i a ini' ibi* I m i H i n . i l i m ; pud ini! b u m d i r stil ili I u i * i( I I h In i li u ibi m lindi i tu i inni u m m \ i li un * ni si m in** d i r i \ 1 nuli) a di. n tm b u m ilil irsnh m a llnid le d. I n H n i i i u ibi 11ai sii, ti , lo si 11 m o t r Oh ( ) a isin i al un Imi pili ( A ) ( I II* M f I | h n i n t u p i i s s tlu' sI hm* ,ii liia tmt ; I m i ( I ), a l n i b is u t ,m l i n i lu tlu ri .ir sin ir tini h i ii unii* puslt i hi I, d o n m i nrd S i t a i dus li si t m i * 0 uu a p p l u t l posi* nuli n d i r t i unii uf dir i I m m u 1 lulilinj; 11m | n u in d i n pusilli ni, i ul ite t fir br tkr >litt m i n i m i I bis al Ina s lite ,u Ina tmi; pnsli t ttI tu Ir* iv r d a i \ liiult r l mi r a u b i m i u i O i b m u i I l a shui m n u n a Ih ri m u w d Imiti am Imi p m (II) 1n r< assi mli!*', ii s isr tlir altust o j m i * ifrrun, it it kj ou tri d ia f d i r pi r<| of tlu filini slmr ul> ts mi d i r vini o f tlir livdi.niln pision t,utinan* all beanti)* sudai s sp m iudy, a d ii apptovrd type Jiflirrrunt J hi luti lultttt,tl< du biperec# Vmw [ m m Uro kuuj Piolo *tdo of WtioMi't Hi lurk IJrukr si al u/ d ir a m l m r pm {</) ( `..iir sbollici Ih (aLru mi n im iik im ; d ir s|mi return spiim;s m i av uot lo s iim i h tltn o Adpist llir shoi l;mhIrs {{',) su d u i a " | P ` sli.tprd Off) firdcr ({iOiijr muy br u i s iiim ! I h t u r n i du slitte ^uulr waslirr and du* slmr sveli I oi k |.m i nirts sii iim ly la ttetnovt Cyfnjt/er-- A f l n rMtiov.il ol lu a k r slmrv, d m u u u c t ( u d im ^ ur bove al u Iter ) i yb w lt > mi i K n u o v e dtr tlirrr i a p si M a s ( I I ) (l*i)* 2*) a li li li liold a lo <I cvlmcler lo dir battetti# pi.de and du iv liuti r tii.i) b r svtduirau' for in . sp* un o (.`a u l u m must b r r x rr t is e d lo pi vr 111 hr.ikr (Inni from (tmiiM); m con* tati a u l du brake Imitt#, durili^ die tu fumi s u u t t upi ramni, i i d u 'r fi um drtpplng sol ini Im i k Is I hr use of a ( s'iiiulf r c la u i p is r n ottiuu ndrd 12 ) l>iut\\cmbly oj VFhtt! CyltntUt - R m ik iu hunts from tylimlri casitng. II laigr piston is iratbly removed 'In rrmovr rlu small piston, fumi a siimi nitric l#end in a U uutlt ttf small wire .imi ilir hole ptovnlrd m tlir insult hotly of (hr pisiun Willuliaw tbr piston and tup '/Jic <itp, tif (lie toll. l>Hlt<m type, is almi Iteti to tin* piston mul is easily nitm vitl ClAU H O N --Wh< n removing the small pisiun, rxrru'se caie and do not scratch tin* cylinder bote with (hr tool employed C y lin d e r h isjiectio ti --A ftci d iv inamb/ig i|jr rylm do, tnspn t H1 the billowing. (a) If iiimeial od is piescnt m thr \vs* inn, die lubber tups mil lie rolaigtd a n d v i i s soil H i m m in i In ills a id e d a m i it pi it ed svilii m u p 11 is. (b) (lybmh t walls must in sitnmih and not punti m sciattim i II dtrse tondo lions exist, the cybndt must be rrnevvrd (<) Pistons must be fn r fiom buns (<l) Ouasnuudly, gie.isc retainers lie. come worn, allowing tin grtusi from die wheel beatimi U) h^k tltroupi 1 into die binke dtmm When gttase um us into <otil.u ( with die nilibt r bonis, they be come sufi and ridmged, prt venting (lit in Cions pioli ( ting die <ylimit r from foreign m ailtr In casts of tins nanne, replace bools and grrase n Miners Oyhndt rs and parts must Ik*wnslird m clean nit olmi and dipfx cl m nn approvrd liydtaidic Militi Do poi wasii cylinder or pat Is m gasoline, k( rosrnt, or ml TIMKEN "DP" (Dual Primary) BRAKES --------------- * ----------- :-------------------------------------------- I hr design of the *1imk( n Dual Pninaiy hscbatdu biakes provides easy mainte name noi complitaied liy spinal tools m lu ti and toe adjustments As tlhts* naied hi I'igmr 26, die shots aie hind u dh |m< ts of t tpiai lutgtU ami identical nialrrial and an out am lioitd but *ilo.it'' tn die Itvtr aims 1In single siraighl lime hydianla itine I lylmdei ,11 to.m s dir )<vn aims uhnli in torn appi) ptessiue a! dx im iti n( the daws by means of the nio\ ibi (mismih flint ks I he shots oc \tll temeteti al die non nl <nidat Mvnh lit dimus Mini mia mm is pi< vi nn d In die self alignmi* iImiIiimmi bini ks svini li in at ai'almi lie ingbd f.tir of dii shots Mie pimnpai paits of lltt Itinkni " D I'" In,ike an slamo in 1n;nn Ph is follmss Fiour* 26 Imiken filmitloid Hired ' Di''' type brolo )bill oi lr*if broke) lever )ms been removed In show Ini do nhoe nhidinenf blocks, prro nut bbx.ks, rind oilier jxirK vdnrh olhnr wise would bo conconled irom viow 31 ) ) J Brake Shoe nnd lin in g Assembly, 2 Br.ikeShoeAnchorPm s -"stationary, 3, Brake Shoe Anchor Pm Abutment Blocks. 4 Broke Shoe Anchor Pin " C " Washer. 5 Brake Shoe Anchor Pin Washer-- Plain 6 Wheel Cylinder Assembly. 7 Wheel Cylinder Cover. B Wheel Cylinder Push Rod 9 Wheel Cylinder Push Rod I'm. 10. Brake Mine Lever Assembly M Hiakc Shoe and Lever Spring 12 Brake Shoe and Lever Spring Retainer H Brake Shoe Lever Pressure Block. 14 Brake Shoe Anchor Pin-- Lower-- Adjustable 15 Bi.ikc Shoe Anchor " C * ' Washer. 16 Brake Shoe Anchor Pin Washer-- Plain 17 Brake Shoe Abutment Block -- Lower IB Biake Shoe ami Lever Spring-- Upper 19 Brake Unit Shield Assembly , M INOR AD JU STM EN TS (',,In Figure 27 the Utter MA " indicates (he cccciuitc anchor pins that control the shoe m m cnirni P m .m l or away from the dt urn T n decrease the lining to drum rlraiancc * proceed as follows I Raise vclmle so wheels ate free to rotate. 2. Use a I wrench to loosen 3 Position a Y f open ernl wrench on the Bat section of anchor pm " A Mto that the wiench hand extends away from the vertical line of the brake Apply pressure toward the ground until shoe contacts drum, then back ofT to a minimum run* ning clearance. (Approximately \ Y * travel at end of 8' wtrnch ) 4 Lock adjustment with nut " IF* and rotate wheel m both directions and check for free running clearance 5 Lach brake is equipped with two hi.ikr shoes and eccentric adjusting pins. Adjust r.x h shoe in the manner described hove, which is illustrated graphically In Figure 27 CAVl'tONS I Make sure wheel bearing adjust* nient is correct before attempting brake adjustment 2. Make mire (he adjustment is se* rurcly locked 3. Make sure liners are not worn exces* sively permitting rivets to contact drums. M AJO R AD JUSTM EN TS As illustrated in Figure 28, it Is not nec* rssary to disturb the mam retracting spring when lemovmg shoes for rclintng Shoe assemblies are removed as follows* F ig u t 27 Method ol Adiuotmg Timken ' DP* Brakes 34 Figure ZB Removing Broke Shoos lor Rellning 1. Remove limite shoe .inti lever pres and retainer fitiin the wrrmh into die sure spring nml retainer by m im in g a lever slot crew driver under the side of the spring near the retainer and prying them out of C A U 'I IO N S the recess Do not remove main retract ing springs 2. Shoes ran now he removed from levers 'I lie pressure block inay also he M ake sure there is a free movement of abutment blocks on the upper anti lower anchor pins M ake sure the iprtng re tainer is properly sealed m the lever arm removed if desired '1 lie retainer should be Hush with the out 3 When re-assenihling the shoes,side o f lever arm apply brake grease lubricant to both angle faces and the pressure blink sur ARM R EM O V A L IN STRU CFtO N S face of the slior If the pressure block has To disassemble (he lever nrm, first been removed, it can be "s tin k " hi posi remove the brake shoes ns described tion on the shoe by means o f the grease under " M a jo r AujusiM im rs." Then re 4. Uotatr die eccentric pins to fullmove up|>er, or stationary anchor pin releasr position " C " waslierNo 4 and fiat washer No. 5 5 Insert die shoe spring and retainer shown in Figure 26 Rem ove11C " washer in tlie lever slot and forte into rentrai No IS and flat washer No 16 which will position permit the removal of the arms and links N O I F. from the upper and lowrr nuc hnr pms, No 2 and No 14 As illustrated in Figure 29, the spring anti retainer must he compressrd com pletely to permit insertion in die sJot For lie a ty D u ly Type Tim ken " D P " H y d r a u lic 13rakes held servicing where n tool with a square Figure 10 is anilliistialinn of llie heavy taprred hole is not available, the use of a duty " D P " hydraulic brake. It will lie "plier wrench" or " crescent wrench" noted that this brake is similar to die will be found very satisfactory for rom- standard " D P " brake, except dial it is prcasing and holding die spring and re larger The service instructions are die tainer. With the compressed spring in same for both type brakes, except for a the wrench, it can be placed against the few additional opera dons to be made on lever and aligned with the slot A small hammer can he usrd to tap die spring the largrr brake to compensate for slight variations in design Figure 29 inslnlling Brako Shoo and Lover Spring and Retainer 35 Figure 30 Heavy Duly "D P ` Brakes ) ) W ink il Mit.illr f In .ik fs ,u e m u oiU ol nti h.uknu* plutei im o rp u f.ifm g Itisi shtrliK it mi in tn p .d p .m , the l.titpr hi ikrs ,irr m nm itrd mi n fl.il pl.il sptdn \Milt the dust ifu cM hoiif* m.mtif.tt lu m i vrp.ii itrly .11 in npiion.il fruirne I lose Invi shield* .n r ir o n e d in the spider bv tin in< u f Ilu* M.ilio n .h y .ou tiiir pin loi k mi! intis .imi the m n i t r u ,int hor pin nipotini; nuts ! In h t.iv ie r type In.ikes .o r rip u p p id s\ills iwn m u lin i pm sii.ipv s m u u l t it i lli .un lim jn iK u-iili " iv islp t < `In m tnm e Pu* h t,ike |i \ i 1 it w ill h r n n o * .u v to K tnovr th e " ( M w.tshrM .nul th o i lift d ir slMps n/J d ir .1rn Inn pin I Itr wheel cvlm der push m d tm the In .0 o r (> pe In ik<* tv vet m id 10 the hi nkr ( r \ i hv .1 pnvh m il pin whit It 1 nitriteci ih m iiuh lio* (u.ike tro u .nul iltr du lled m il of (In posi) ioti is h ru m til wuh n MC U w.ishr Jl vi nHt li I hr im lu u l tli.u tu 1 It; m e 26 showing l!iest,iiid.U(!" l>P*'hi.ike,ilirpush roti, Nn K, 11 drMt' iird with ,m open end ili it is ttoi vet m i t! to tin h i.ik r !rw `t'( hut has h e r im m iii m i i on the push rod pin the mi (hod of adpism irnt or tlir .o u iio r pm it th r s.mtr on both In.ikts, Logo wrt min's w ill h t irqu irrd tm th r lusts v duty p r 441>f*** hi,ike A uprn rnd w trn rh w ill h r required on th r (I.i/ s irin m of iJn ,m i l>or pm, and n ! $h# w in u h w ill be requited m loosen the n m ln ir pm lot king nut Ih r.im c of the iru rv.tsrd st/t of th r broke bori, ivheeit .ou! tors on thr h r.iv lrr ht.ike, u w ill also h r nei rss.it y tu use wrenchei w ith n g i i.it o filis i( tu ohi.m t rr.ir.iiu rs for (hiv .nl|iivnrn( VACUUM POWER BRAKE EQUIPMENT l l i i i r , u r t u o g n i r r . i f t y p e i o f v . i i u u m ,m ) tvpe of n in Ii.uiic.il or hydrm iljc p o n t i h i .t k r is st rm O n e 15 kn o w n ,11 hinkt When i( n in n i un n vehicle (lu .or v u v p t n d t d ut stupir bu e systtm .ioti th o t l n r ts km ns ii ,i< (he s.u tit ill i htted sodi in rd u n itr.il brakes, d ir vaco* im i tr|uiptnriU u lived to heip npply s m p r m h d u r t lu n h lr line s) strio llosv* die hi.ikes li) iddio# i l i pow o to die r \ r r , ho th Iv pr s ose th rnc i n im 0 ihr cmpne nuttifohl ru (tir m o rte uf p t m r r ss lui h lielps th d m o ' s foni .ipph* th hr.iM li dumU! he r n o r n ih r ir d t l u l w lirn il tv s.ntl f lu ,i vrhit Ir Ii.it v.it tiutii power In ilvi rfpoppn iti, tl is uir.m t lh.it thr rn g m r y.h utili) 1 iisrd in hr ip die di ire i .tpplv thr h r.ik ri V .m m m |>ower h i.ik r rqotpm rrK d o ri noi in r.iu .1 i r r t nji n p r uf hrnkr niirtnhlv In f.u t, die v.ionm h r.ik f rq m p m rn t I 1.11 mdnm tu do sodi cfir ty p r of b r.ik r bori or hr.ikr tlrm iK tnrd A vacuim i power hr.ike lyitcrn m .n hr urd tm n s e lm lr rq m p p rd sstrh Layout ol Atmospheric Suspended Vacuum Broke System (Single Line! 36 dnw t's lone .tfijilitl in dir In*ik< (nidi s or tods When .1 v.iromu system ts used on 1 vthule fund with hydraulic biakes (hr vMumiii equipment add us power (o (he duvet's push on die tiiitsnr cylimlcr puton rod, thus making il easier for tht dtivrr lo build up a high picssmr id tlir hydraulic btake system ATM O SPUKIUC SUSPENDED (SIN GLE LINE) SYSTEM lifture 31 shows ihr layout of n single Imr (atmnsphettr suspended) vacuum power brnke sysUttt W hin dir cinvrr presses die brake pedal die bmkc valve is opened and die vaumm from the engine manifold ensues die piston m die booster cylinder lu move and thus help apply (lie brake 'I Ins system Is called "Atmospheric smj>cmlcd" because when die brnke Is oil there is atmosplierlc pressure on both sides of die booster cylinder piston W inn die driver presses the brake peiinl opening die brake valve (here is vacuum on onr side of the piston and atmospheric pressure on the other aide. Naturally under these conditions the piston moves and helps apply die brakes As can be seen from (he diagram dm atmosplierlc system can be set up, using only a single hue from the brake control valve to die booster cylinder Instead of "single line" or "atmospheric suspended," this system is sometimes re i(erred to as simply an "air suspended" system In certain installations, espeeially on trailers, the brake valve is con trolled by a hand lever rather than by the driver's foot operating through the brake pedal From an examination of thr layout shown m Figure 31, it can lie seen tl int each tune the brakes are applied there is a quantity of raw mr wlmli travels into llie engine tnnmfolcl from the homier cylinder It can be easily seen why this occurs when we remember (hat with (Ins system, diere Is ordinary ntr pressure on both sides of the booster cylinder piston with the brakes not applied Pressing the hiaki j>f<!al opens die brake valve ami lem mes the an (nan one nidi of Mu booster piston and tins taw air (lastIs into the rntpiK nininlold With a large booster cvl/mlu tin amount of i.nv an hoveling into the engine manifold ts con siderable and iheit ts quite likely to be detitmeutal <d<( ts upon engine enrhuretmn suuc the engine is usually at low gas throttle position when the brakes are applied Th< it foie, in order to avoid (his, wc find that large bimster cylinder ran tint hi use d sue eessfully with (lie "alums* pheru suspi idrd"orusingfe line"system Sm ut large liuostir cylinders cannot lie used successfully with this system, we hnd that the "Atmospheric suspended" lys* tent's use is limited to passenger cars, light trucks and in a few cases, light traihrs v a c u u m suspended (l)O U llU i U N I S Y S I EM Figure 32 shows a layout of tin "v.nu iiiii suspended" or "double line" vai tititti power inak( system 'I his system is calh (I " vacuum suspended" betaine there is vatmiui mi both sides of the homier <yluider piston when the brakes are not applied 1 lie brake valve is therefore open to both lines A and il, thus Admit ting vacuum to both sides of die booster cylinder piston when the brakes nre off When die driver presses on the biakc pedal he operate the brake valve which shuts off the vacuum to line 11mid Admits atmospheric pressure to this line There i# now vat uum cm one side o f the piston and tlnifisphf lie pressure cm the other side and the piston therefore moves and In Ip apply the brakis ft wilt be noted (hat there is a check valve used between the brake valve and the engine manifold 'I his seals (he system at maximum vani llin nml permits at lenstone power brake application even if the engine should stall. 11 will also he noted that die vacuum suspended system requires two lines from the biake control valve to booster lyltndrr, thus giving It the name "double line" system, ) ) W m I i f* r v,n li u t o 5tisprnd<d i s t r u l l i r n n u k u .1 q u n i i t i l y n i ai w l m h liavrls fiuto (tu Imoslri cytimhr (u dii rupnr in iiufnld U o vvivri, ttm (tenti 5 w l u n d ir hi .ila * n r r relrusrd ividt d m sysicm in s tru nf M itro th biakes ,ur npphnl w tt h d i r u t m n s p l i n u sus* p r n d r d ystem VVIo i d i r tir d u i .irr rr I c u v d d i r r n j p u r i* m u . d i y starlitiR fi p u l u n i i m i .id v r t iM r d r .i ( { i n d i l e posi* i u h i .u ni d i r .u I m i t a i n o f a i r io di e t a r i n o n u n d m s uni h a v r ,is n n u f i r i f r r l m il dot s m o i r i d i r nti suspended syd( m u u h dir rinpnr a I hnv (hi olili pominti 'M u ir* (d ir !aii;e hoostri t y h t u l r t s t . m tir usrd Widi d i r d o t d i l r lnu* 5V5li ni .ind tiii<t <ys* ir m ta o )ir usui oli tn irks ,uid li.iilris h Ik k (Ih sm ^lr I m r svsfetu d n r M m l tvork unt ,is u r li A vai in li il lio iK lri r y h iid n (.iti tir iiim d lid un .i n ,o lii ,tnd liti ( v%<i li ih k lim im i' im iii i Ih1 n .iilr t ,\ri liu o kn l <<u lo .1 irr i olm i < li un io lnu A .m il lo .1 ir r (a n n i i Unii m im r Ih m d ir u lrr 111 d m i,o< ihr h .u lr i hta k rs w o iild li r i onirnllr d iy d ir 5,mu b ia k r v .d v r w)i< li to n lio lh d du li.u n ir h i.ik rs In niany <ases limv* i w r, dii li ,ii 1>r hrakrs ,irr t i mi rolli d hy ,i li ind <n iih iii v.dv r m o m itn l m tfir fr.u mi ( ih M .m y si.u r l.tivs rrrp iiie clini die li .ilIr r hi .tkr sy Mi ni h r i .t palile of apply* iin: d ir li id rr hrakrs in <asr nf a ir.id rr tut.ikiN v.iy M m r.in brM ir a m m v pltslu d hy lisina a v,o m uti rrscrvoir tank .uni ,t d . iil ii r in r iR r iit y \. lv r \s h iih is imi i r l i ,i s( ji,u ,in ( l i n k N .ih r fin d ir u uh r I Imi., if du h n lr r dtiudd break ,ni' iv fiu m d ir n .ir in r d ir im rrR ency i ih i m ,i is d ir s m in u ii in (lo onr Im r uni d ir aim n tp h rtu pirv^urr m irim i dii o llu i loie <ansi (he hoi itin lo .ippiv tlu h lit i hi aki i In .iddiMun lo d ir font unir! i.ih r , itim i (iiiih i.l \ . i l \ r , i tiri k v .d ir .imi n i i n i ; u i i i i In k \ ih r un ii I ii un 11.tlirn r, du i ( i h ,i m iM ih ri i if oi h rr v ih ( s i m d in i' h m ini hi ,ik r u m k A t < 1.1\ s ilio in use 11un .i tr.u lrr hi <tkr s> m i-iu to spi ( ti np tiu app io alm o of d ir 11 ad r hr ikrs W jj huid ,t ri t.iv \ ah e dir -tir in .ijipiy die it.idi i lo .iU s woiild Imvr lo ci uri all th muv fumi (hi notim i valve u dir pimi t c ) linci i oit dir irnilrr bifore lic tia ih r btakM wimld hr^lu to iippty once d trnutlin! valse, rid ia foot typr or itami typi is mouiind orar dir duvrr and th p m n r i ylimlcr mny br orai dir tradrr rrar \shcek, dm repre siili) nm sidn alile distaiti t nud Imi dmr ni dir case of a Imi# Irai lui-iraitrr rom- " S . orfani rwHirou) A AtKWKRlC niuutr hKAhf PIOAL V / - S J i R MAI! H.Vt ili MKIRIACIU* 'h(uwMmxtti MmKitowanwiiaQc, Aivi.ii ti |y (.1111 A 1IKQLK V A C U I VAIO* u t Al 11HO Alili Al NI UNlll K VAI IIUN WUIN AITI 1(1 Ska* i > A m t Figure 32 t^ayou! tri Vcirtiuni SiKi>mdrd Vucuurn hrako Sy^U'in (Douhlo Lmo) Immuni! '1 h e id .iy valveiitm nuduJ nenr du li.uh r poner yhndrr and diere U lildr lime Ioni sime die sur oidy tini to h .iu t frnm die relay (o die pourr cyt* huid iu o u U i io ayp'.y die irattn hrnkes A rrf*idnimR valve may fie msiallcd on dir (lasht so tliat die driver may i onirol dir ainount of vatuuni in dir sverni A piiriunaiic rriay valve n used wlien il in (Irsirrd io operad a (rader ripiipped unii vaam m iirakrs in tonpinrtiou widt a (tai mi etpupped widi au hrakts A io u v r i5inn rria y valve t5 usrd wlien h isdtAUdl lo u p ir a tr a tia iirr etpnpped M illi an .m ixpliri li 5tisp<itded vntuum lu .ik r 5) 5irm in ro tiju m limi vsilli a irne* lor rrpnpprd vviih a vaeuum 5ii5pende<l posi brnkr iv 5lrm A nvih lirooi/( r vali is (Hrasumnlly iisrd lo ninniti dir pioprr 1 1 1.tive aiiiiMmi5 of biaknu liriMrt o trai ira and traili r no trai (oMr.ult r (omhinadoni tu some < :\ vanum i <hnmher and diaplti.ium au iisnl im untf of a %anioni > </litic h i .imi putnn I m i! d ir o p riittio li nf d ir puwti ly s ir in iilh i s a n im i ri d i r i aie I h r p m w i i ) lineici ni t vaem int lualcr i/H m in,iv hi inntiiili d so tli.it d ir plslcin r x r r l i .1 " iiu IIih k " .h timi m a p p i) in du h ia k ri, ,it ilitiw n ni (lituir 31 ,md 32, tu il m.iy lir mtmnn d so di.it tltr pisinn c*x<Tti ,i " |m ih m n M .il lim i in np plyin j' d ir h r a k n in must hydruiihi ly s trim it h lindi ntu ^r.il w illi a ltyclr.ndit ty lm d c r S K K V IC K UBI PS In ordrr tu iIti <k n vacuimi power (u.ikr ayitrm for h aki, it n nricn.iry tu liuvr n vanumi (piuftc, tinse mici D ir vanumi r.iiikc n ^rrtiunlrd frmn 0 lo 30 inebri uf me re ut y. Atrnoiphrnr prm m r n nmni.dly tcju.il tu nbotii IS pmmdi pri iipi.ur mi h and (lui prrsiure svili supplii t n redimili of ntrrniry 10' lu^h Ihrrrfoir a p rifitt vacuimi wmihl show a traditi}; ut 10* mi rem y mi dir vanumi gatiRr Howc vr, die vacuimi in au lottimivr cugine n i nrvrr prrfu tim i in rnjjinci m goud i oiicIiik iu it sfmule! rmi^c hrtwrrn 20* ami 26* nf m rruiry For iatiifncinry hrakr oprinomi n vanum i hotulrr syiirni ilinuld thmv a iradmK of 16* un dir trit ()n a (rm k m Imi ihM.dialmn thr vanmni lrnku/;r wtu n li su il ilm u lil im i r t i r r d V p ii n u m iir In dir i asr nf a n ai lui It.td i i i ih uhm, t inni wlm h must t mifni m io ita d i i lo r.ik away (a n i tilt iiakap.i ih ntild noi i o i u t 1\* pri im ttiftr ( I * m 1 tintitiu < ) Vacuim i puun imits nf dir pnii.uly lim lir lypr ihoulll lir lutti et .Unti willi nlmut ? ornici s nf vai unni <yImiti r etti lui rvrry 1,000 unici nf operatimi Vanum i power m ilim f (he diapliMipu(h.unhrr typr rrtpmr mi lubricatimi ut thr dtnphrni'in and u ai ihmild he rospi 1 1 . rd legularly nrnl replncnt if ncm saiy In mici wrnthrr, die ri* is aiw.iyt danari nf moiKuic conile mi u nnd firi/utj' in thr linrs and odici parti of a vai moti powrr braki sysii m In orile r lo pri vrnt frrriin^, wr ireommrml plachi a ima!! ntnoont of prm u nnti typr nnii*fer/r m dir imri ami a miai! amutint in dir pow rr unit In diaphra^uw Itamlii r lypi im m about \4 mine r of arili firr/r is mihi u ni, whdr in dir putniwyllntlrj lypt umis, il is tirsi (o piai r aboid 2 m ini 11 un e ,i< {> iidr of d ir piiton, T h r a ir c im u rri m rd al thfTcrem p in o li im a vai m ini power iyK ni simuli! hi i li a n n i regolaiIv lo iusine i (Ih Si ni opi i. alim i of dir hrakn, ~ AIR BRAKE EQUIPMENT 'I lr layout of a ty p iia l nir h ia k r iys|< in is dm wn tu In durr 3 3 1 lu i lavout ih o w i w hal is (otm nooiy la ilid a " s lia ii'h l n ir" iysii in It will ]>r un irli dia( n pn\srr unii m un d at ra d i wht r i hrakr a uri t in i dii i r power un n i tn.iy tir rillir r llu 'ih a p iu ujm --i h.uuHr typr -- ni d ir pisioiw ylm ih r lypr `ib i possi r unds in ibis sii.nubi att syitnn art n lla ih rd lo Ir vns vsiui li opi i * ntr tbr hrakr r a m i nf ini ( ii.iiiir.il biakrs t lin i lisn ri arr m u n ii/ r r fin r d lo m " ij.u k ndpislrrs*' situi dii lu .ik r adprM* ini; mi eb.m iiiii n hin(t m io (In ir li vi n Somr ir bmhr lyslrim upiraouu mi ihanira) lirakri li.ivr a liydraulic (ani hinkr ailnatnr tri plair nf dir star k ad* |uvtn | Itr atr finiti dii ininprrisur n m nl io oprratr ari air pinoti 'vini li in hu u opi rale sa hydrnutu inasli r cylinde r I lir p iism ir frodi du hydianJu masln i/lindi r rs lim i frammillr il lhtnuj;h dir Ji'df.m lii limi! Iiiim lu die hydraulir i un In ike ai tualiirs ai rae li whrrl lu akr ) Itr hsdr.Hitu min hrakr ai hialm t dirti loto dir i am i nf dir mrt barin al hrakn 1bus, M (alt hr irrn (hai lini lyitrni li a inni 39 ) ) b ill lllU M >111 11\ d i m iti 11|r i {| i<t|( li ||| il 1 M S lrm l h m r \ * r , il i m i n i ilK i i f . i i . d In ns .ut " an Im h min * m ^I' ih fui Miri h mn li In ,tk< e I I n m is .u in ilii i .111 !m il.i s\ h ut iv lui li uv s ( tir ,ur lu m i 11n uopi t v o i tu UfIM IH .111 .HI | 1 im i Vlui II III lui >1 lf MI u n .i h w h .m lu m usiti lindi i l l i i n . i w i , h i llm i im (li pitssui* fu m i d ir M i t e n i < \ inni i r 11. i u s i m i i<*il tlu u k ' li u h i ksi H i m i tu r r\v*t Figuro 33 I iiyout o{ {yp lcn l Aultunnlivr A ir Bulico Syelnn d ir livilr.iiiln fluid lune in im ln iin In d i min In ukr \\ I n I i \ lindi i s m si md* .m i 1\pi In d in id h hrnkf Tssiinblirs I 11ii**, il e.vi fu sr v i om ]iu s<*I m pi ris im li je i" i> n ,d l\ ir f m r | ( n< im pl\ ,m **,m . h v d n n lu * sveleni Im Im h i h I n I n ikrs I hej t ai r a m im i ri i f v dw s usm I ui in In ik r Wlllk lini il ts u r li fm (In mrr li nix (n n u d r jtl mi) (In rum (imi nf f M Jl \ n I m .d ' a p p io ilorn \ u h <s , n m I i\ id rd m i n t u n i>r m t >1 i \ j ih ti u fm t-npi i . .i f r d l n . i k r v. ilw od h sin hnpei u tri! in ikr \ i l i n I I n lim d m p i ruh d In ikr valve is m u d l \ usd m ti u lui tra d nji r. i t m n A tvvo-uav v a i v i , nr d o u b l 11ir * k vulve, k ue rd m M it im li i d r i npi*t nuu < (Im i d i r II m d l i m i m i i dve ni iv Ir i n n i tu c o n im i uiiK d ir ii. u li r In kit nini dr |nu( lim im i In kr valve Will ipplv lindi du n n ini md i i .iiIm In nitri I tns tvp* ni hi ( ttininmi iu w s ntldcd <!<h, Im . ni nufnni (Imititi dir fuu( jn d d ud ipplj (mih lini lui .inrl fiodrr binkis nnd mi slippri\ paventi nle or in monili.mi d in in p , dir Im o tnn npply dn tindo lunkis donr dtrmii' h nee aftlie li md 'mini vulve In siittir rnsis .t piceemr dtstribudng v iIm is iivhI un imi ini-ii.nltr tumhma iinm ni mdi't (u pi modi fot Application ni dir (indo liinki s tir foie dir application nf dir tinr ini Itinkr s A <pm k irli aer v.tlv is uscii In provici f.K lo ic Iraee ni dir binkrs O m nr more i]im k n Irnvr v,d\< sa ie n\rd and they are tnumvtrd orai dir hiakr nuemblim on vbi< I dir rjnn k rrlr.isr 15 dreirt d With* nut (hr <pmk irleaee v.dvr dir rxhamt ir musi travi) fimn (hr hiakr aeecmbly In dir hr ike npphrnliuii vulve Ih fore (he hi.ikr irlr.tNM U hmsh dir tptu k rrlcnsc vulve, tlu* rxhnml .tir intimi trave! ortly from dir hrake nesrtnbly tn dir qulck rrlmsr valve before dir hr.ikr releaie. A rrlny vulve 1 nerd io sprrd up th npplunion nf hrnkre u b id nrr a long disun r (mm dir hrake applicatimi vntvc sin h ns dir 1 nr hink s u( Imi/; tvlnrlbner vridi tre A irl.ty rmrittmy valve ie nere! In n ni li r i ij 11mono tn epi <d np tlu npplicn* Unti n( tlir u.itlrr Innkrs and al ihr 5amr (Ulti K pmvtiire a mrlhoil nf automati* ( dlv npji^m/; dir trailer Inakcs In c n v nf a lurnk avsay O f cmise, it te nrcfssnry m lune un nr r rv n n ir tank inminird mi du nud ir and nnnrrird In th relay rnu im in v vaio u ord r ut piovute the .nr p n n o fnr dir utilnmniN application nf dir ir>11 h i hrnkre I In ir is nlsci a spo ini nday emrrgrncy vniw whn li un hr ninnntrd on (rurkf (o piiAidr fot numnintH applnatinii of th rrm hrnkre in < isr nny hnsr or tubing of dir ,nr brukr eyefrm ehonld lircomr Inni u 11<rr, tnn, \\ is un rseary tu bave n epi <mi a ir rrerr \ nir tank io Bnpply air fm ilo* uormnnla apjihrnfton of dir Ad ) htnkcs I Inssysti in n tml% dm d on hi avv dill) ((pnpiiiml Dpi i tu t! mi Sjx i I.i! lyjw s nfvtvu v A i< l.ty-qtmk*i< li asm un tpi m y \nlv< iv uved in tiadet oprratum tu speed up apphiniion of the tmitrr brakes ,nul pro vide for quick release of the trailer Ix.ikn and At (he same tune provide for auto* mntic application of thr trailer hi .ikes in case of a trailer Ixeaknway I h re, ton, ii is uciess.try to have an an it set volt lank inotiutrd on (hr tiStic r and conn* <led in die rrlaynpiiek-relensi <tin rguu y. valve to puwidc for the auioinatu appluatimi of tin hsakts A safety valve is mounted at the ait rest rvoirionnettlon m ptevt m die budd ing up of loo great a piessuir tu die sys tem 1he safety valve Is usually set to release any air prrssmc above 150 pounds per square Inch In some cases a pressuit regulator valve is tot tl to govi rn the air pressiu e in an nlr brake system and to prevent loss of air due to too mm h use of oilier air opr rattd d evu n , stub as hoi ns, windshield wipers, door openers, etc *1be pressuic regulator valve is ,ibo ustd in brake sys tems requiring a rapid build up m air pressure mi older to provide brake power m die case of stops matte a few tmmitts after starting Tins condition Is p.irticularly prevalent in fire engine operation A limiting valve infrequently mounted on die Instrument panel so that tliedriver may control the amount of In.ike pressure and thus reduce the brake power wlun driving on wet or ucovered roads O n some vehicles an air supply vnlve u nistithd in du sw um i<* pM'ttii' hi j l M S S U i r f i l l M l H M ' M M l I i n (till t f " n I nthu iims M -.K V IC b I l l . U '.S Although the safi (y valve is usually jr t for H O pounds per scpiaa u u h , it Is recommended as a gr nernl rule, to keep the lute pressure below 10*5 pounds per squat e irn ti on air brake systems 'Die air <leaned used liunughunt die systr tn should be i leaned rtgolaily In the ruse of s< If-lnbitiaird atr coin* piessors the od should be (lin k ed daily and (hamed at the proper mteivaW In du cusr of ingnu lulu it and air (omprrssois, dir oil line feeding the mmpicvsor slumld be <hn ki<t itgulaity In av<iag< service die diaplnagins in hiake tham ltcis should be teplatcd at least oner a year In stvere servor the diaphragms should be fepbuni iimie often I'owrr units of the piston-cylimh i type should lx m sp n tn l tegulaily and ui rxliem r heat or dust or in wm iii opei ation two outues o f S A K 10 od should be fiut into the atmosphetu end of the power cylinder If an mr btake system is not opeiatiog properly, it is advisable to first check the enure system for leaks and attempt to determine winch unit is musing the trouble O rdm aiy soapsuds are generally used for hunting leaks m an an brake system All air brake reservoir tanks should be drained daily in older to eliminate any condensation firnn die system A\ ) ) STOPPING DISTANCE CHART U n i i hi ,l.i s n i |u tfi i ( <if I* i il mi <uni! I Unit, ill *11| *i h | ii * i h M i n i ili p Mils i If (ill i In l i i i i i u i i I 1 iti 11 ii (1m m i ,tii< I ni.nl M ill I I I I I I ill III II tilth liuill'lslllllli th, t( i \ i m v\ K h | 1111 I hi t i t s i n lui ti i turn if in it i i vi i \ i . i j m l stop mi ,t s1111f m is I i \ uh ni i In M u | i | ii m ` i lisi in* i s 11mu v u imis spi #i Is ini t n tin II w till pi I I m ( In tki 111h i | nut m m il in i i n mis npi .l i uti m i liti IV I I It* ill \ , I HIM II tl , III il 1 HI t u l l i ivf tit lit t u t t i vi ii f tit VMnili I lit .is sl um it In Invi I in |l* ill i l l s , ,i m Ini li u t il i p i l l i t i In Ixi* 11j itif m n til must l i m .i Militi it nils p i m i i li t) I n . ikt h i m t i l i u l i t i l mi ih.it til u In Is m u h r hitti iul il u p In (In lui I.mi* )ti*iii I In vi lut it is shippini it ii n l .i s d I i id j 11 l .is s k nl il im * is tin |i> lu ll i n ' t( ill I n i n u li< < Is I n u n i t i in l i m i ili it pi it <>< ti sitt|i p i n t i l l ( . t i n r x f*i iti [ I n \ it n 1is sp i I s 1 1 ts n t i t s v i t v |t it 1I I m i t i Ml i n H U ( t i l , .1 p l u l l i n ' n n l l m i n s p u t l , I n t . t k t t i n > -I 11if i|| s( ,n tti (In i .it h ,i m Is tini itit* tin Il II It till I V 11 I Ml VM I Ik till* Ills! IMI I III' d i m i il t nit s In slop .Ulti (In4 nisi,m l ills inni .Il (it lllv Ipplfi s (lit4 III.ik e I III* Stop* piti, ilist ild is .lilt I (lit4lii.lk l s ,11( .tppltcil tml (In lul.i! stoppini* disi,m i is which l i l t mm h h iiiii (lit im i if*4 eh ivrr re ti imn litui ni sr fid ili .ut ,is follows V " i "I l **.. U< li timi 1>ISlt|lll 1 'rotai lli.tlong Stopping Disinoci Distance 'll M I ' l l 111 M I M I III M 1*11 'iti M I M I (.( M 1* 11 7i> M I M I 2> li M il I l fi SS li Mi fi 77 fi IH li IO II 70 II 110 fi IMI fi ' 20 fi 40 fi 73 fi 114 fi 165 ft 226 fi, 297 fi li >!.<<.!<1 Im1 ii un mix m i lli.it the iIiiim ln;tiu s .ut for t, which with perft i I ikt s nod m i it su Is opt rating on n dt\ Itili k, eohi ii ti tu n tld .is p iu li rond U m ili li ss htvm .thlr tnm Htum s, dir m liti Ir t imiti mil In stop p iti m ns short n ihsi.im i us storno lit n 1 ' ) INOFX o r RRAKFS USED ON VARIOU1 PAISTNOn? C A P M.ll>< Yi .ii Muili 1 J \ 1M 1lt Itl lU s i'.if.f llllll l> llllllll.ll <ilii'vnih l CIlClIllll 1 <:I|I y-li i Di .Sulu 1 )<m I|>I' I'i i i i I | Ulli 1 M .l 1 <li.ilt.nn I I ii iIm iii I I i i i Im iii | lutnnuliili* Ivllst 1 1 .iS .illi 1 iS.illi l.ilHulll I imnin N.i'li N.i*'li N .i- I i N.n.li ( llilsinulillr ( IliK iliu b tlr l'.u k.ml l '.u k .m l P ly iiiu in li l 'flltll.M l'uuli.ll Km S i i i i Ii l i .i k r r Smili'li.ikcr \Vil(> s Willy WilK DM /. Ili DM7- Ki DM 7- Ki D ill- III DM/.Kl DM7-Kl DM7-III DM7 K l DM ?H DM I DM0. KJ DM M O D/11-KI DM'I Ki DM/ DM0. Ki D M I-It DM/-Kl DM. Ki DM7--HI Dl K l-17 DM'I 1/ Dl Ki II DM7 11 DI 11-1(1 DM / 17 l'M/i 10 DM7.11) D M 7 -11 DM1.12 DH6- Kl DM/ 11 DM1 Dl IO >11 DM' II DM'I V All All All All All All All All All All All All All All All All All All / | t l i \ All Sulllt. Sum All All All All All All All All All All Sun It Sutiu> Sum All U o i l i s ! l y i l i . m i u Mi m h s I l yi li .m li c i fot k t ^tti in lu 11 iic k M n hiii m al 1 ni U m m I l l v f l i . i u l i c I,ik U n i (1 I l u l i . m h c 1 iu U n i el 1 Iv i Ii .miIk 1 od 1tjili.inln 1 o d M n It.tim il til MlllX 1 l)tll,Hl1l< l.otklunl llyih.m lir Mi iiiIix 1 l y d i . H i l i i ili mlix M n l t .n m .i l I ni k l i r i d t l v i l i . m l l i Mi m il x 1 l ) il i .iu!n M<oilix I 1\ i (i . im1u Mi o i li x M i i !iokm .ti Mi Milis 1 Mi iuIix M u Ii ion *if M< in l l s ( f >li mili M> iuIix I Iw Ii . u i Ik 1 o k t m (1 i Ivili .Mito Mi Milis M< <ll.lOK it Mi n<hx 1 l yrh mili Mi in l is M n li.iim al M< i h i s 1 l y i l i . mi li M m ch x NW i Im o k .ti f oikliMtl Ityili.iulu Mnulix t Iviliiiulu Mi Milis M< i Im m I .i! i o ktirnl f lyili.iuln I .ni Uln n i ] Jyihiiiiln M< n it is M i r tomii .ti 1 o< M t m f 1 ly t li . m li i Mrmlis 1lyitranlir H OlllS M i ( ll.MMl .ll 16 16 26 21 7 7 7 II 21,??,' I 16 7 16 IH A D) 7 16 16 I R A DI 16 |H.\ l `l 16 16 7 IU K 1 " 16 I K K DI 16 IK A D) 7 16 1 K & D) 7 M UI IR A D> 7 16 IH A DI >11 i