Document 2jZVvmKdXoJpxexKwMQ6XXwdp

i 19 of 30 AR 826 - 1503 C-8 DATA SUMMARY REPORT CONSENT ORDER GWR-2001-019 DuPont Washington Works Facility and Local, Letart And Dry Run Landfills February2003 ProjectNo.T74o23mes Preparedby 18)9 ON NIvInDD QUPORR CORPORATE REMEDIATION GROUP An Alliance between i DuPont and URS Diamond : Barley Mill Plaza, Building 27 00000: # Wilmington, Delaware 19805 3 i OEPA 4053  ary DuPont Engineering February5,2003 Er WestVigini DeparofEtnvmiroenmnenttal Protection Divisionof WaterResources C12h01GarerenlbWreieessrtStVtiroregenitn,ia 25311-1088 tdSeraaee mtnehu IFi "Tre mn FEB - 6 2003 ofic i - oe RE: CCo4nsDeanttaOSrudemrmaGrWyRR-e2p0o0r1t019 DearMi. Watkins: DasusPoocniatteids lpalndesaislelds atnodsoufbfmsiitte tahriesasCi-n8oSrduemrmtaorsyatiRsefpyotrhte froermatihneinWgasGhIiSnTgtroenquiWroermkesntsfoacfiltihtye, Multi-Media Consent Order. This report consists of seven sections. An introduction is presented Section 1. C3 analysis nd Teporing are discussed in Secon 2. A. summa of the investigations conducted and results generated for the Washington Works facility, Local Landfill, Letart Landfill, and Dry Run Landfill are presented in Sections 3 through 6, respectively. @ ThiRs ereplorit iis dcomiprneheSnsoivne.,It summarizes al wrk perf*ormed and includes all sampling results generated through November 2002. For each main area investigated, C-8 analytical rWehseutlthserahruemsaunmomrareiszdefdgiaendd.pcoomptarepdal(b0watphse wSecrreecnoimnpgetLeovls eslianed by. the CATT. Additionally, an exposure assessment was performed for the areas investigated to identify cSIofndctuarcihtngmeeyfoodrauFtreu(br3re0luv2ia)erew9y91od29-f,6t82h2i00s0.3doc1umleonotk, fyooruwarhdavteowquaersdtiSoenesinogr ycooummsetnts,npexltesGeISfeTlmfeetein1g0 Sincerely, APrnodjercetwD.ireHcatrorten G`IASnnTBrMaedlmebyeSrpsillman Thomas & Basle `PArnodjreetaFiihlemowski DuPont Legs 000009 Crmr-------- Horeca | | C-8 DATA SUMMARY REPORT CONSENT ORDER GWR-2001-019 DUPONT WASHINGTON WORKS FACILITY AND LOCAL, LETART AND DRY RUN LANDFILLS @ `CORPORATE REMEDIATION GROUP An Alliance between DuPont and URS Diamond Barley Mill Plaza, Building 27 Wilmington, Delaware 19805 18983753.00036 000030  @ D CCo-8pDmataa sSuemmnarsyiReepoert. TTaabblleeooffCCoonntteennttss rasicor CONTENTS 10 Introduction so --------------] EXECUive SUMMAIY........oocovrescnsrrennnrenece SASS S----------"|] 1.1 DOCUMENt OTGAMIZAUON ...c.cccovrsrvrercrcsevesssssssssssesessssoseseesres 3 2.0 C-8 Analyses and Analytical Reporting.................. 2.1 Independent Quality Assurance Review ............. messes hott STI. FUG 15 3.0 Washington Works Facility. seas neerssans nna ss 7 3.0 INOAUCHON ....oooevereeveresessnse serene essere arasasens -- 3.2 STaAskMAP: HGgro.un.dvwavterrvWrelrl ranrdeWater-UesenSunrveeyninmg amnd--C---8------------] 3.2.1 One-MileRadius Sampling ..........c..ooc.oocerrce.e.. a-------- 322 Two-Mile Radius Sampling...............oc..o.. NV wn 323 Ohio One-Mile Sampling ............... -- sam m---- wd 3.24 Ohio Two Mile Sampling................. -- ssreverrsasssnan I 3.3 Task B: Assessment ofExisting Groundwater and Surface-water Monitoring Data................ v-- -- resus 10 33.1 3.32 MOohniiotRoirvienrgoWfatCe-r8 QiUnaGlriotuyn.d.w.a.t.e.r..a.ncdvvScuvrrfaecrermWaotmere.s..o.s..s.s..n.s..e.n.en 10 12 3.33 Public Water Supply Sampling................. sessensoronie - 3.4 TasCk: Plume Identification/Groundwater Assessment -- 34.1 342 HInysdtraollgaetoilonoogifcNTeewstiWnegllosf aNtetwheWWealslhsiantgtthoenWWaosrhiknsFgatcoinlity .......... 14 `Works Facility. ccersererrerass weressersemmessen sr asanasseses winssor 1 343 Washington Works Groundwater Model Refinement ....... -- 3.4.4 Surface-water Field Reconnaissance at the `Washington Works 3.45 C-8 Monitoring in Groundwater and Surface Water at the `Washington Works Facility ........... ST ssssensssssssssenes 1S 34.6 Washington Works Facility Site Conceptual Model RREFBRNEI cssonsessssssmmseserssspssmmmiin S------------------| 3 3.5 Revised 35.1 CSuirtreeCnOtNECnEvPiUrAoInmMeOnMtEaLl..S.E.M.i.n..gc.o.v.v.r.e.r.r.v.r.r.r.r.r.ror.ross.eooosoeososoeneosnsoosnoernoeonns 16 16 3.5.2 Current Human Health and Ecological Exposure Pathways ............ 21 3.6 Washington Works Facility Summary ................ seesserarasnses win 34 4.0 Local Landfill.......ccocevecermrrrrsrrrne ap essemmssssssssssss------" 26 41 Twoduction....._..____ 42 Task A: Groundwater Well and Water-Use Surveying and C-8 Sampling........c..... cesrrersiass eressss rT -- MOROTING DG. 21 4.3 Task B: AssessmentofExisting Groundwater and Surface-water CSD Soma we Fm E00 Himnaen, 08 000011 80a Summary Report Table of Contents 4.4 4.3.1 Task C: MonitorofiCn-g8 in Groundwater Plume ldentification/Groundwater and Surface ASSeSSMENt Water................27 ............. 2 44.1 C-8 Monitoring Landfill in Groundwater and A Surface Water A at Local rom2 442 Surface-water Field Reconnaissance at the Washington Works 443 Fol mn Installationof New Wells A at Local Landfill nnn 2 ......................29 4.5 4Re.v4i4sed LSiotcealCOLNanCdEfPilIlUSlitMeOCGoEnLceptr ual Moo del Rer finemes nt.............M .....C . 29 4.5.1 4.52 Current ERVIrONMENtal SEUNG... Current Human Health and Ecological Exposure Pathways ......... 29 34 4.6 LoCal Landfill SUMMATY vss 36 50 Letart Landfil .. rrp 5.1 Introduction............. ----------] regp----" 52 Task A: Groundwater Sampling. Well and Water-Use -- Surveying and C- sogup--l 5.3 MTaOsNkIOBT: iANsGseDsastmaen.t.o.fExisting Groundwas ter and Surfm ace.water s 53.1 Monitoring of C-8 in Groundwater and Surface Water at 5.4 Task C: LPtlaurmteL IdentificationA /Groundwater AI SSESSTIENT ..: .............. 38 40 dD 5.4.1 LaCn-d8fiMlolnitoring iinpGr-- oundw-- ater and Surfacs e Wats er at Letart --] 5.42 543 SIurnfacse-wtatoaefrNlFeielwldWaeRlecltosnaintaiLosestnaarntceLaantdtfhiel.L.e.t.a.r.t..La.nd.f:llc....o..r..o..r.o. ror. 40 40 5.44 Letart Landfill Site Conceptual Model Refinement 5.4.5 Ohio River Water Sampling Near Letart Landfill. ..................41 ---- 5.5 RevisedSite CONCEPIUAl MOE]. 55.1 Current Environmental Setting........... 1 -- 5.6 5.52 Letart Current Human Health Landfill SUMMA... and Ecological Exposure Pathways ......... 46 48 6.0 D6I.1YRUInDtrLoduActiIon......c C n -- n O50 62 Task A: Groundwater Well and Water-Use Surveying and C- 63 Task B: Assessmentof MonitoringData... Existing Groundwater and Surface-water a ---------- --l 63.1 MRoUnitLorAiIngRof.Cv-sinaGriouindwgatrersanmd Smurnfacoe WmateersatmDrny inY 6.4 Task C: 6.4.1 CP-l8umMeonIidteonrtiifnigcaintiGorno/uGnroduwnadtweartearnAdsSsuersfsamceenWtat.e..r at Dry nds 64.2 FE Surface-water Field Reconnaissance at the Dry Run wos Landfill... 3 54 @ 6.43 6.4.4 IDnrsytaRlluantioSnitoefCNonecwepWteulalls aMtodDerly RReufninLemeAnt.R..S....................5.544. A WinigonC ,DoOtFaSuC mmary tS oxfol Fe 5.03 -- 000012 TW C808 SummaryRepo Tableof Contents 65 R65e.v1isedCSuirtreeCnOtNCEEnPvIiUraolnmMentOalESe.tti.ng.. I54 66 6Dr5y2RunCLuarnrdefnitllHSuummamnarHye.a.l.t.h and Ecolm ogicam l Expm osure-- Pat-- hway-- s...--57 70 References... sn--------] TABLES Table30 SWausmhmianrgytoonfWOfofr-ksisteFaScailmiptlyianngdPLroocgarlamLan(dCf-i8llSampling) - DuPont Table3.1 (Suug/mlm)a~rWyaosfhiCn-gtAonnalWyotrickasl FRaecsiullittysainndGrLooucnaldwLaatnedfrilalnd(OSfufr-fSaictee WWealtlesr, Springs, and Cistern-s One-Mile Radius) Table3.2 SWourmkmsarFyaciolfiOtfyfa-nSditLeoScaalmpLlainndfgiPllroTgwroa-mMi(lCe-8RSaadmipulsing) - Washington Table3.3 (SOufmFmSiatreyWoefllCs-,8SApnrailnygtsi,caalndReCsiuslttesrnisn)G-rWoausnhdiwnagtteronanWdorSkursfFaacceilWiattyearnd Local Landfill Two-Mile Radius) Q Table3.4 SRaudmimuasrRyesoifdeOnftfi-aSlitSeaSmpalmipnlging Program (C-8 Sampling) ~ Ohio One-Mile Table3.5 `SOuhmiomaOnrey-oMfilCe-8RaAdnialuystRiecsaildReenstuilaltsSianmpGlrionugndwater and Surface Water - Table3.6 Summaryof Off-Site Sampling Radius Residential Sampling Program (C-8 Sampling) - Ohio Two-Mile Table 3.7 Summary of C-8 Analytical Results Radius Residential Sampling Zones A, B, and C ~ Ohio Two-Mile Table 3.8 Monitoring Washington Well Construction Works Facility and Groundwater Elevation Data - DuPont Table 39 Summary of Analytical Results: Washington Works Facility C- in Groundwater - DuPont Table 3.10 SWausmhmianrgytoonfAWnoarlkytsicFaaclilRietsyults: C-8 in Surface Wate-r DuPont Table 3.11 Ohio River Water Letart Landfill Sampling C-8 Results- DuPont Washington Works and Table3.12 Outall 005 C-8 Concentration (ug) - DuPont Washington Works Table 3.13 aSnduOmhimo ao-fDrCu-yP8onitn GWarsohuinndgwtaotnerW-orPkubslic Water Supplies, West Virginia @ Table 3.14 SLoycnaotpitoincsG-roDuunPdownattWearsEhlienvgattioonnsW,oFrekbsruFaarcyil2it0y02, and Well Screen WWiIrmGn'gSonOo0t8 Summary toa Fen 5.09 -- 000013 CCo8o0wsatsSuwmwmaarytReepoortt TaTabblleoofCCoonntents Table 3.15 SummaryofOn-Site DuPont Washington and Off-Site Exposure Works Facility Pathways Evaluation - Table 4.0 Monitoring Landfill Well Construction and Groundwater Elevation Data ~ Local Tabled! Summary of Analytical Results: C-8 in Groundwater - Local Landfill Tabled2 SumomfAanalrytiycal Results: C- in Surface Water - Local Landfill Table 43 Summary Landfill ofOn-Site and Off-Site Exposure Pathways Evaluation - Local Table 5.0 TableS.1 Table5.2 Tables.3 Table 5.4 Table 5.5 Summary of Off-Site Sampling Program (C-8 Sampling) - Letart Landfill SLaunmdfmiallry(OoFfF-CS-i8teAWnaellyltiscaOlnRee-sMuilltes RinadGiruosu)ndwater (ug/l) - Letart Monitoring Landfill Well Construction and Groundwater Elevation Data - Letart Summary of Analytical Results: C-8 in Groundwater- Letart Landfill SummaryofAnalytical Results: C-8 in Surface Water - Letart Landfill SLandufilml mofaOn-rSiyte and Off-Site Exposure Pathways Evaluation Letart Table 6.0 Summary of Off-Site Sampling Program (C-8 Sampling) Dry Run Landfill @ Table6.1 Summary of C-8 (ug/) - Dry Run ALannadlfyitlilca(lOfRfe-sSuilttesWienllGsr,ouSpnrdiwnagtse,ranadndCiSsurtfeamcse~WaOtneer- Mile Radius) Table6.2 Monitoring Well Run Landfill Construction and Groundwater Elevation Data ~ Dry Table 63 Summary of Analytical Results: C-8 in Groundwater ~ Dry Run Landfill Table6.4 Summary ofAnalytical Run Landfill Results: C-8 in Surface Water and Leachat~e Dry Table 6.5 Summaryof Run Landfill On-Site and Off-Site Exposure Pathways Evaluation ~ Dry Figure 10 Figure 3.0 FIGURES DuPont Washington Works Propertics. Site wv Location Map -- DuPont Washington Works Facility, Washington, Figure 3.1 Onc- and Two-Mile Radius Map - Local Landfill, Washington, WV @ Figure32 One- and Two-Mile County, OH Radius ~ SummaryofC-8 Results - Washington VWOiRmOigonn, OaF Summary~ nt ral Fob 5.03 - % 000014 Ctv0a0sT smumamaya rytowretbleofConteTabn le oft Conts ents Figure 33 Monitoring `Washington Well and Surface Water Sample Location Works Facility, Washington, WV Map - DuPont Figure 34 CWa-s8hiinngGtroonu,nWdwVate-r 4Q02- DuPont Washington Works Facility, Figure 35 OWhoiroksRiFvaecirliWtayt,eWrasShaimnpgltionng,LWocVations ~ Upstream - DuPont Washingion Figure 36 WOahsihoiRnigvteornWWaotrekrsSaFamcpilliitnyg, LWoacsahtiinognison-,DWowVnstream - DuPont Figure 37 CD-u8PoCnotncWeansthraitnigotnosn(Wugo/rlksinFtahceilOithyi,oORhiivoer-aWnedstPuVbilrigcinWiaater Supplies - Figure 38 IWdaesahliinzegdtoOnhiWoorRikvserFaVciallilteyy, CWraosshsi-nSgeicotni,onWaVnd Block Diagram - DuPont Figure 3.9 GWeansehrianlgitzoend GWeoorlkosgiFcacCirliotsys,-WSeacsthiionngtaotnR,ivWerVMile 190 - DuPont Figure 3.10 CWraosshsi-nSgetcotni,onWLVocation Map - DuPont Washington Works Main Plant, Figure 3.11 CWraosshsi-nSgetcotni,onWAV-A" - DuPont Washington Works Main Plant, dD Figure 3.12 Cwrvoss-Section B-B" - DuPont Washington Works Main Plant, Washington, Figure 3.13 Cwrvoss-Section C-C" - DuPont Washington Works Main Plant, Washington, Figure 3.14 CWraosshsi-nSgetcotni,onWDV-D' - DuPont Washington Works Main Plant, Figure 3.15 Cwrvoss-Section E-E" - DuPont Washington Works Main Plant, Washington, Figure 3.16 Cwrvoss-Section F-F" - DuPont Washington Works Main Plant, Washington, Figure 3.17 CWraosshsi-nSgetcotni,onWGVG - DuPont Washington Works Main Plan, Figure 3.18 RWeavsihsiendgt-oFneWbrourakrsy M2a00i2n GPlraonut,ndWwaastheirngEtloenv,atWioYn Map - DuPont Figure 40 Site Location Map -- Local Landfill, Washingion, WV Figure4.1 L~LoocaclalLaLnadnfidlilllM,onWiatsohriinnggtoWne,llWaVnd Surface Water Sample Location Map Figure 42 Cross-Section Location Map ~ Local Landfill, Washinglon, WY @ Figure3d Geological Cross-Section AA" - Local Landfill, Washington, WV Figure 44 Geological Cross-Section B-B' - Local Landfill, Washington, WV E Ving T 000015 809 Summary Report. Table of Contents Figure 4.5 Geological Cross-Section C-C" - Local Landfill, Washington, WV. Figure 46 A-Zone Groundwater Elevation Contour Map -- 4Q02 - Local Landfill, Washington, WV. Figure 47 C-Zone Groundwater Washington, WV Elevation Contour Map ~ 4Q02 - Local Landfill, Figure 5.0 Figure 5.1 Figure 5.2 Site Location Map - Letart Landfil, Letart, WV. C- in Groundwater- LetartLandfill, Letart, WV Monitoring Well and Landfill, Letart, WV Surface Water Location Sample Map - Letart Figure $3 LRett.a3r3t LSatnrdefialml,anLdetaBrrti,nkWerV's Run Surface Water Sampling Location-s Figure 54 Ohio River Water Sampling Locations- Letart Landfil, Letart, WV Figure 5.5 Cross-Section Location Map - Letart Landfil, Letart, WV Figure 6 Cross-Section A-A" - Letart Landfill, Letart, WV. Figure 5.7 Cross-Section B-B' - Letart Landfill, Letart, WV. Figure $8 Geologic Cross-Section C-C' - Letart Landfill, Letart, WV Figure 5.9 Geologic Cross-Section D-D' - Letart Landfill, Letart, WV . Od Figure 5.10 Dam Groundwater Contour Map - 4Q02 - Letart Landfill, Letart, Figure 5.11 Figure6.0 Figure 6.1 Figure 62 Figure 63 Figure 6.4 Figure 6.5 Figure 6.6 Figur6e.7 Figure 68 Figure 69 F-Zone Groundwater Contour Map - 4Q02 - Letart Landfill, Letart, WV Site Location Map - Dry Run Landfil, Lubeck, WV C-8 in Groundwater- Dry Run Landfill, Lubeck, WV Monitoring Well and Wood County, WV Surface Water Location Map - Dry Run Landfill, Cross-Section Location Map- Dry Run Landfill, Wood County, WV Geological Cross-Section A-A" - Dry Run Landfill, Lubeck, WV Cross-Section B-B - Dry Run Landfill, Lubeck, WV Geological Cross-Section A-C - Dry Run Landfill, Lubeck, WV Geological Cross-Section D-B'- Dry Run Landfill, Lubeck, WV. A-Zone Groundwater Wood County, WV Elevation Contour Map - 4Q02 - Dry Run Landll, B-Zone Groundwater Wood County, WV Elevation Contour Map -- 4Q02 - Dry Run Landfil, KC DuSuma terfea Feb 5.05 hd wi 000016 CoC8o0wasSwummmanryRReepoertt TaTbablleeooffCCoonntteennttss APPENDICES @ Appendix A Boring Logs Facility and Well Construction Diagrams - Washington Works Appendix B Boring Logs and Well Construction Diagrams ~ Local Landfill Appendix C Boring Logs and Well Construction Diagrams -- Letart Landfill Appendix D Boring Logs and Well Construction Diagrams ~ Dry Run Landfill VWOiCnEgDo,aOaF Sunray tent Feb 03 -- i 000017 8 ata Summary Report. Executive Summary EXECUTIVE SUMMARY Aintmoublteit-wmeeedniathceoWnesesnttVoirrdgeirni(aOrDdeeprarNto.meGntWRo-f2E0n0v1i-r0on1m9e;ntCaolnsPernotteOcrtdioenr)(WwaVsDEenPt)e,retdhe `(WWesVtDVHiHrgRi-niBaPDHe)paarntdmeDnutPoofnHteaolntNhoavnedmHbeurma1n5,R2e0s01o.urcTehse--CBounrseeanut OforrdePrubildiecntHiefailedtha sBePrHie,soafndreDquuPiornemte)nitnsoarndderttaoskdstetoebremipneerwfhoertmheedrbtyhetrheehpaasrtbieesen(WanVDimEpPa,ctWoVnDhHumHaRn- h(Ce-a8l)t,h CanAdSthNeuemnbveirro3n8m2e5n-t26a-s1a, rfersoulmtoDufProelnetasoepseorfataiomnmsoant ithuemWpaesrhfilnugortooonctWaonroaktse facility Letart, (facility, also and Dry Run). referred to as the "main plant") and the associated landfills (Local, `toThoevCeorsneseenitnvOersdtiegrateisotnasblainsdheadcttihveitCi-es8ofGtrhouendCwoansteenrtInOvredsetrigiantciloundSitnegeTrainsgkTAe:am (GIST) GExriosutnidnwgaGtreorunUdsweaatnedrWaenldlSuSrufravceey/WGartoeurnMdownaitteorrMionngitDoatrai,nga,nTdaTsakskB:CA:sPsleusmsmeent of IthdeenCt-i8fiAcsasteisons/mGernotuondfwaTtoexricAistsyeTsesmaemnt(CaAtTeTa)c,h swihtei.chThcoensCiosntseednotfOsrcdieenrtiasltssofersotmablished aricsakdetomihau,mgaonvheeramlethnta,ndnotnh-epreonfviitroorngmaennitzaatsisooncsi,ataendd wiintdhusetxryp,ostuoraessteosCs-t8heretloexaisceistyfarnodm DuPont activites. dD r`TehqiusiCr-e8mednattsaofsutmhmeaCroynsreenptorOtrddeorc.umeInntadsdailtlioanc,titvhietiresevciosnedduscitteedcotnocmeepteutatlhmeodels are phryedsreongteeodl,owghyi,cghrobuetntdewrarteeprrefsleonwt, tahnedcuwrarteenrt qeunavliitryo)nmaenndtaculrsreetnttinhgu(mgaenolhoegayl,thhyadnrdology, ecological exposure pathways for the conditions at and near the sites. TashseestsaebdlewbheeltohewrshhuowmsanthaenrdeseuclotlsogoifctahlereexcpeopstourrsewpeartehweaxypsoseevadlutaotCio-n8. imTphaicsteevdalmueadtiiaon c(eo.lgl,ecstoeidlsu,nsduerrfatcheewCaotnesre,ngtrOorudnedrw.atePra)thbwoatyhsonw-esrieteclaansdsioffife-dsiatse coonmpthleetbeasoirsoifncdoamtpalete. Tmeodbiea cwoanssecrovamtpiavree,dthteo htihgehCesAtTTC--cstcaonbcleinsthreadtihounmmaenashueraeltdh fporrocteaccthivteypsecorfeaeqniunegocursiteria efsotrawbaltieshre(dCA-q8uSaLt)icoLfi1fe50Adugv/ils,orreygaCrodnlceesnstorfatmieodniafotryCpe-.8 (NCo-t8e,AhLoAwCev)ero,f t1h,a3t6t0huegC/lAiTsTa- msuorrfeacaepwpartoeprr,iagtreobuendnwcahtmearr,kprfoorceesvsalwuaatteiro,napnrdovlieadcehdatteh.at Iwnattehirsstaarbelen,ohtiignhgleisgthetdedsbucohxeass mineddiicaateevmaeludaitaedthaftoretxhceeefadcitlhietyCa-ndStLh.e tThhriese tlaabndlfeilslhso,wosnltyhaltefaocrhaatlel oann-dsistuerafancdeowffa-tseirteat LAeLtaArtCLoafnd1f,i3l6l0euxgc/el,edontlhye Cle-a8chSaLt.e aItftLheetsaretmeexdcieaedwsertheecCo-m8paSLr.edMtoosttheimepsotrabtlainsthleyd, Cth-i8s table shows that all drinking-water sources are substantially below C-8 SL. VWiOmiNnKgiCo8n,Co0t%a Summary~ nt rol Feb 5.03 EE 000048 in C8Data Summary Report Executive Summary pours PatwaIynRceommpmlmeetr(e)t ompiers ) or b [FurmanReceptors[EcologlealReceptors | [Grw onee r &2[||Di[[ePDkrioincniengsgswvWaaatttaeer (rvroaomms.grroosuwnnpdevveeatteond||GCTBLoraowgn | w wa a] ] 22S||| Nl|aannoddoorrrcciicswstatatiome-mwsrws)n(vy)e-tie,snpinggs ces 607 up csv csoruan 3|gPen merm AI ------ 28|[2[aaNnncoiorrociisstmorswmse))-e-i rOofGnont sgoe c@ssugn ces C.50ug) cssun [[PO I OWhSoMWeVraef ntde c | catrouowgg-- n |-- Clazcetou-- oeunan------]| p[[LT serwscmhu_ist_eo--stios eres|| ormmp uwn| | ormown | - [[S[GurrotianncgedWWaetaretrls 51 5s| c(1 itsun |Commun] & aNnoorncis-amwasa)tr-erWn(Yrlks,i7n7g5 ces cau [aOnsoreivatteermssouWeeys Coe |1 g cara ------] f[T sowmusonsites aers p |] ] [[[D1 CSiouvnisgnewgaWWtaaetteerrvals s| iaG ] C@(oar0r] uugn| |Co carm wn m| [[[NUOonvnuo-sreRedrkvaairtnwegravtsaeorruvaslTeoLwo| na| |GCN@ma1e(ucog0)57| | Cl0oizcmouosg]) 1----] [[[uSLSWmooMacUcsho/LWaCnaacpwtiteudsdMaatneraioalmsien|||C--oo 1 Uwnkm nnow)| | |cG Ga 1 (UUnnkw knnaon--w)] --]| CJO anTdor ciWstaoti mse)-GDlnysf5ug 5n 7--6-- ---- E-- E -- cz un cuzin aonornisaosva)ltaOroiylr,nn7g755 g Costu HN)iAgZhbioagtnsaiepedlccooawstlnedcatsexceadoafCnAcTTe-establshed C-8 SL (150 ugh) F WWinCgero8a Sumy oni f 000019 00aSummary mepon Executive Summary Fwoirthtthhee WcausrrheinntgireovnisWeodrgkrsofuacnidlwitayt,erthmeocduerlr,enttherecvuirsreedntsiotne-csoitneceapntduaolffm-soidtee lC-c8ombined concentrations measured, and the current exposure pathways evaluation show that: SsooluirdceWoafstCe-8MamingargaetmioennttoUgnriotusn(dwSaWteMrU.S)Aior dnepo-asirtseiboienloitfeCve-ed toonbtehethgeropruinmdary. surface and migration to groundwater also may have occurred @ No offsite migrationofgroundwater i occurring 3 NemoispsoiteonntsiaalregbreoluinedvweadtteorbmeigtrhaetpiroinmpaartyhmwiagyraetxiiostnspbaetnhewaatyhotfheC-O8hiforRoimvetrh.e Air- facility to adjacent arcas in Ohio. Acoinrceemnitsrastiioonnsos fdeCt-e8ctefdroimn WtehestfacViilrigtiynailasoadajraecebnetliteovethd tfoabcielitthyeasnodurLcoecaolfC- Landsil AmiigrreamtiisosnipoantshowfaCy-so8fanCd-8difsrcohamrtgheeoffacCi-l8itythtrootuhgehOohuitofaRlilvearr,e abneldieinvetdumt,o bferotmhe the river to public water supplics (PWS) located downstream. Trehceerpetoarrse tnhoatkenxocwenedctohmeplCeAtTeT-eexsptoasbulriesphaedthCw-aysSLfororhuthmeaCn-o8rAeLcoAloCgiactalthe facility. D FcuorrretnhteoLno-csiatleLaannddfiolflf,-stihtee cCu-r8recnotncreenvtirsaetdisointse cmoenacseuprteudalanmdodtehelccuormrbenitneexdpwoistuhrethe pathways evaluation show that 3 Cma-t8eirsiablesltioevgerdoutondmwiagtraetreatvitahewaLtoecraltrLaannsdpfoirltlfrom C-8 containing landiilled 2 G(raowuanydfwraotmeroflFsoiwtefrreosmidLenotciaall Laarenadsf)i.ll flows toward th facility o the northwest @ CLo8cadleLteacntdefdilinlsthleikoenley-toanhdavtewob-eminletrraandsipuosrtseadmpflrionmgtahreeafascinleiatry vtihae afiarcility and emissions. 3 TrehceerpetoarrsetnhoatkenxocwenedctohmeplCe-t8eSeLxpoorstuhreeepsattahblwiasyhsedfoCr-h8uAmLaAnCoraetctohleogLioccaall Landfill. FcuorrretnhteoLne-tsairtte Laannddfoiflfl,sitthee Cc-u8rrceontncreenviirsaetdiosnitsemceoanscueprteudaalnmdotdheel ccuorrmebnitneexdpowsiutrhethe pathways evaluation show that Q mCaitesribaelltioevgerdoutondmwiagtraetreatvitahewaLteetrarttrLanaspnodrtifrom C- containing landfilled p oGfrfosuintdewraetsiedrenltioawl aatrcLaestart Landsil is toward the Ohio River and is away from CWiEnSgt0o8r Samy A FE -- -- 000020 C8 Data Summary Report Executive Summary Q TC-h8e caonnncueanltrCa-tiolnoaidnitnhgefrrivoemrgfrrooumndtwheatleanrdftiollt,hewhOihcihoiRsisvueprpionrdtiecdatbeys tahevevreyrylow Tow C- concentrations measured in the Ohio River. Q Air emissionof C-8 is not a viable migration pathway because there are no air emissions at Letart Landfill. Q CLeotnatratcLtawnidftihllsuarnfdacienwtahteerwe(tC.awpeaRtuhneorfsftlroecaamtisounr)faacnedwlaetaecrhattheatatditshcehtaoregeosf ttohethe `Ohio River are complete exposure pathways for human or ecological receptors that exceed the C-8 SL. However, exposure is limited becauseofthe remote. locationofthe landfill, the very steep terrain, and the wet-weather nature ofthe stream. In addition, fencing limits access to the area. Further, the useofhealth and safety plans, standard operating procedures, and personal protective equipment also limit exposure. For Dry Run Landfill the current revised site conceptual model combined with the c`uprartehnwtayosn-esviatleuaatnidonofsf-hsoitwe tCh-a8t:concentrations measured and the current exposure Q C-81s believed to migrate via water transport from C-8 containing landfilled `materials to groundwater at the Dry Run Landfill. Q Groundwater flow at the site is toward the west. C-8 concentrations measured `within the one-mile radius sampling arca show that no off-site migration ofC-8 impacted groundwater has occurred. @ Q Dry Run Landfill is located within eight miles ofthe facility. Transport of C-8 via air emissions concentrations of fCr-omdtehteecftaecidliwtiytphoitnentthiealolnye-cmoiulled be the radius ssaomurpcleinogftahreea.very low Wing Te 000021 C8 ona Summary Reon Introduction 1.0 INTRODUCTION iStisnfcleuothreopeoalrylmyer1-9r5e0lsa,taedmmmaonnuifuacmtuperrifnlguporroocoecstasneosaattet(hCe-W8)ashhaisnbgeteonnuWsoerdkbsyfDacuiPliotnyt in p(fraoccielistsye,sahlsaoverebfeerernedretloeaassetdheto"tmhaeianiprladnits"c).harRgeesditdouetshecoOnhtiaoinRiinvgerC;-d8isfproosmetdohefseat the oWtahsehriwnigsteosnhiWpoprekdsofffa-csiiltietyfoarndd/eosrtrautcttihoenDourPdoinstpoLsoaclal(,scLeetFairgtu,raen1d.0D).ryCR-8unhalsanbdfeielnls; and adsestoeccitaetdeidnlvaandrfyiilnlgs (cLoonccaeln,trLaettiaornt,s ainndanDdryarRouunn)d,tihnepWriavsahtiendgrtionnkiWnogrwkelslsfaacinlditiynapnudbltihce water supplies (PWS) located in West Virginia and in Ohio. iAntmoublteit-wmeeednitahceoWnesesnttVoirrdgeirni(aOrDdeeprarNtom.eGnWtoRf-2E0n0v1ir-o0n1m9e;ntCaolnsPeronttecOtridoenr)(wWaVsDEenPt)e,retdhe (WeWsVtDVHiHrgRi-niBaPDHe)paarntdmeDnutPoofntHeoanltNhoavnedmHbeurma1n5,R2e00s1o.urcTehse--CBounrseeanut OforrdePrubildiecntHiefailedtha BsePrHie,soafndreDquuPiornetm)enitnsoarnddettaroskdsettoerbmeipneerwfhoertmheedrbtyhetrheehpaasrtbieesen(WanVDimEpPa,ctWoVnDhHumHaRn- health and the environment as a result `DuPont operations at the Washington Woofrrkes lfaeciolaiftsyCea-n8sd, tChAe SasNsoucmibateerd 3la8n2d5fi-l2l6s.-1, from 1`0ThoevCeorsneseenitnvOersdtiegrateisotnasblainsdheadctthieviCt-e8s tGhraotuwnedrweactoenrdIuncvteesdtitgoataisosnesSstetehreipnrgeTseenacme a(nGdIST) oO aexntdentthoe fasCs-o8ciainteddrilnankdifnigllwsa,taesr,degsrcoruinbdewdatinerA,tiaancdhsmuernftacAeowfattehre at and around the Consent Order. facility aPunrdseuvaanltutaoteAdttbaycthhmeenGtISATo,ftTahseksCoAn,sBe,ntanOdrdCe.r,TtahsrkeeA:tasGkrsowuenrdewapteerrfoUrsmeedanbdyWDeulPlont aSuornvee-ym/iGlreoruanddiwusatferromMotnhietWoarsinhginigntvoonlvWedorekvsalufaactiilnigtyCa-n8ditnhgertohurnedewlaatndefrililnsitbiyallsyamwiptlhiinng swaatmeprlifnrgoomfwPelWlSs, cliosctaetrends,oannedmsiplreinugps.strIenacmluadnedd tweinthmitlheessedoswanmsptlirnegamacotfitvhiteiefsawcialistyt.he w`Tihtehianreaaroifveirnvreesatcihgaetxitoenndwiansge3x.p5amnidleeds buapssetdreoanmraensudll5s3ombitlaeisneddo.wnTswterlevaemPwWerSelocated Ssaammpplleidn.g RAevpaoirlatbalnedretshueltOshwieorReiivnecrlPuudbeldiicnWtahteeOrnSeu-pmpillye SRaamdpiulsinSgur(vDeuyPoanntd, C2-00823). Task A activities are re-summarized in this report, `iTnacslkudB:edAcsosmepsislmienngthoisftoErxiicsatliCng-8Grdoatuan,dmwoantietrorainndgSaulrlfwaeclelsWaattetrheMloannidftiolrlis,nganDdata adenvdetlhoepiLnogcaal,GrLeotuanrtd,waatnedrDMroyniRtuonriLnagndPflialns.(GTMhPe)hifsotrortihcealWaCs-h8idnagttaoncoWmopirlkastifoancirleitpyort mwoansitsourbimnitgtCe-d8tointhseurGfIaSceT wfaotrerevaanlduagtrioonun(dDwuaPtoenrt,at2t0h0e2bl)an.dfTilhlse, sbeecgoannd ipnarDtoecfeTmabsekr B, a `2T0h0e1.ProSpaomspeldinGgMwPasfoprerthfeorWmaesdhimnognttohniyWfoorrkfsoufracmiolinttyh(sDuaPnodntis,n2o0w02co)nwduacstseudbqmuiatrtteerdlyf.o [) the GIST for review and was approved following minor modifications (DuPont, 20024). WTirCinCgonGa0t%Summary to F5b .03 -- 000022 -- C8 Data Summary Report Introduction Groundwater sampling at the Washington Works facility pursuant to the approved GMP began in late January 2002. TaskB activities also are re-summarized in this report. Task C: Plume Identification/Groundwater Assessment at each site began following the completionof Tasks A and B. This activity included delineating the vertical and `ohfoCr-iz8onitamlpaecxtteendtgorfouCn-d8wiamtpearcattedthgerLoeutnadrtwaLtaenrdfailnld asnpedciitfsiciamlplaycitnoclnutdheed OahniaossReisvsemreanntd PWS along the river as required by the Consent Order. The C-8 Plume Identification Groundwater Assessment Work Plan was submitted to the GIST in May 2002 (DuPont, 2002). For the Washington Works facility, Task C included groundwater modeling using GIST-approved groundwater modeling tools. Groundwater modeling was used to evaluate possible C-8 migration pathways in groundwater from the facility. A separate groundwater modeling report was issued to the GIST in January 2003 (DuPont, 2003). `This report documents Task C activities and re-summarizes briefly the groundwater `modeling results. `While conducting the activities identified in Tasks A, B, and C, which were designed to assess the presence and extent of C-8 in drinking water, surface water, and groundwater, an evaluationof transport mechanisms for C-8 migration also was conducted. This evaluation was conducted to gain a better understanding of how C-8 migrates in the environment and to better understand the results generated during the implementation of Tasks A, B, and C. Two main possible transport mechanisms were considered in evaluating results These [}) `wereair transport and water transport, Air transport was considered because DuPont had i. released, and continues to release, C-8 in air emissions from the facility. C-8 particles in air emission may have been deposited on surfaces of structures (roofs, etc.) and then have been dissolved and transported by precipitation into cisterns. C-8 in air emissions also pr`emcaiyphitaavteibonee0nsduerpfoasciet:ewdaotnergbrooduiensd sourrtfoagcersouannddwdaitsesro.lveIdnaandd trdansCipo-r8ttwedaisbydeotecnted,at low concentrations in someof the water samples taken from cisterns. If the cistern was. sources filled using a PWS that had been shown to contain C-8, then the sourceof the C-8 in the cistern may have been the water used to fill the cistern. Alternatively, the sourceofC-8 in the cistern may have been from air emissions. It also may have originated from both `Water transport, including transport via surface water and groundwater, was considered because C-8 bearing materials were disposedofon-site (i.., facility and landfills) and (C-8 had been detected in surface water and groundwater from various sources at and near the Washington Worksfacilityand the three landfills. Sampling performed under Task A ofthe Consent Order resulted in detections of C-8 in the Little Hocking Water Association well field, which is the PWS located immediately across the Ohio River from the Washington Works facility. A formal groundwater modeling evaluation was performed to determineif imported groundwater from the facility migrated off-site toward Little Hocking. `The Consent Order also established the C-8 Assessmentof Toxicity Team (CATT). The @ CATT consisted of scientists from academia, government, non-profit organizations, and industry. The CATT was assembled to assess the toxicity and risk to human health and ECs2 on 0 000023 C8 0ata Summary Resort. Introduction @ athfeineanlvrierpoonrmteinstsuaesdsoicniAatuegduswitt2h00e2x,potshuereCAtoTCT-8esrtealbelaissehsedfrtohem hthuemDaunPhoenatltahctpirvoitteicetsi.ve:In screening criteria for water (C-8 SL)of 150 ug/l (WVDEP, 2002). The results presented in this report, which were obtained for Tasks A, B, and C, are compared conservatively to rtehfelCecAtTeTd-einsttaheblAiusghuesdtC2-0802SLroepfor1t,50thueg/Cl,ArTeTgaradllseosesostfawblaitsehredusaeC.-8Insacdrdeietniionng, carsiteria of 240 mg/kg for soils (WVDEP, 2002). However, development of2 method for analyzing C81 soils has not yet been completed; therefore, no soil samples have been analyzed. o`Tfhe1,C3A60TuTgalisno Oecsttaobbleirsh2e0d0a2n(AMqeuantziiceL-iCfuer&AadvAisssoorcyiaCtoensc,e2n0t0r2a)t.ioSnufrofracCe--8wa(tCe-r8rAesLuAltCs) presented in this report are compared to these screening criteria and to the C-8 SL. 1.1 Document Organization Section 2 ofthis document provides information on C-8 reporting and data validation. a`tThteherefmaaciilnidtyeranodf tthhiesLroecpaolr,t LdeitsacrutssaensdsDpercyifRiucnacLtainvdiftielslsc.onSdeuccttieodn a3npdrerseesunlttsstohbetained Washington Works facility data. Sections 4, 5, and 6, present data for the Local, Letart, A`abndriDerfyinRturonduLcatndifoinlliss,prreesspeenctteidv.elyT.heWnietxhtintheraecehsusebcsteicotni,onassitmhielnardefsocrrmiabte asctfiovlitlioewsed. performed and results obtained for Tasks A, B, and C, respectively. The revised site aconndceecpotluoaglicmaoldeelx,powshuircehaisnsteesgsrmateensttfhoellnoewsw. reFsiunlatlsl,y,isotbhseenrvdaistciuosnssedf.or eAachhumsiatenahreealth @ summarized. Section 7ofthe report provides a reference list, including Consent Order related documents previously submitted to the GIST. WWinHigoKnG,t0Ga8Su-mma8ry et el Feb. 5.03 -- -- 3 000024 C80st Summary Report C-8 Analyses and Analytical Reporting .ocs ANALYSES AND ANALYTICAL REPORTING pTrhoetoQcuoallsitdyevAeslsoupreadnctoe ePnrsoujrecetthPaltanpr(oQjeAcPtPi;nfDourPmoatnito,n,20d0a2ta1,) adnisdcduescsiessitohnes pdreorcievdeudrfersoamnd oasrsboacsieatdeodnladnadtfailalcsqaurieretdecdhunricianlgltyhseogunrdo,unudswaabltee,rainndvepsrtoipgaetriloyndaotcTuhmeenftaecidl.itSypaecnidfically, Sceucsttioodnysp5r,oc6,edaunrdes1,0oanfdthineteQrAnaPlPquparleisteynctonstarmopllcihnegcpkrsottohcaotlws,erseamfpolleloawnedd ddourciunmgenthte field sampling activities associated with the groundwater well and water-use survey. `fTrheequQeAncPyP, aanlasloytpirceaslenptrsociendfuorremsa,tidoantaonredquuacltiitoyn,asvseurirfainccaet,iocna,liabnrdatrieopnorptriongc.eduIrnefsoramnadtion on the analytical method summarized below. and the precision criteria used for the C-8 reporting are: EdexvyegleonpeRdesaenadrcthe,stIendc.a (nEexwygaenna)l,ytlioccalatmeedtihnoSdtattheatCoultilleigzee,s PLeinqnusiydlvania, originally Chmertohmoadto(gLrCa/pMhSy/TMaSn)dfeomr aMnaalsysziSnpgecCt-r8omientwrayte(rLCi/nMNSo/vMeSm)b.erD2u0P0o1n.t Caudrorpetnetdlyt,hiEsxygen pOpeerrfaotrimnsgalPlrCo-ce8dwuartee(rSsOaPm)plitedaenvaellyospeesd.for DuPont using the laboratory Standard EarxeyegveanluraetpeodrtfsoCr-p8rerceissuilotns bfyorctohmeplaarbionragttohrey frieeplldicsaatmepolfecraecshulftietlodtshaemcpoler.resTphoensdeinrgesults laboratory replicate result: Q sIFabmoptlherfeosrultthsataraenalleystsetihsacnotnhseidprearcetdictaolhqauvaentpiatastsieodntlhiemiptre(cPiQsLi)on, ctrhietreerpilaicate Q c[ofnosniedeorrebdottoh hreasvueltmseatrethbeeptrweeceinsioonnecraintderifaiivfe tthiemetswtoherePsuQlLts,dtihfeferrebplyiclaetses itshan the PQL. Q Ifone result i less differed by a value tlhesasn tthhaenPtQheLPaQnLd,tthheeortehpelriciastneoits asnadidifttohheatvewomeretsutlhtes acceptance criteria Q tFoinhaallvye,miefbtotthhercersiutletrsiaiarfethatelreealsattfiivveepteirmceesnttdhiefPfQerLe,nctehe(RrePpDl)icbateetwiseeconntshiedetrweod driesfufletrsenisceleosfsttwhoanmoerasequuraelmetont2s0%d.iviTdheed bRyPtDheiisrtahveeraabgseo.lute valueofthe `fiWehlednsathmeplpereacnidsitohnecrliatbeorriaatoourtylrienpeldicaabtoevreesaurletsmeatr,e rEexpyorgteend.repIforctristtehrieaafvoerrpargeecoifstiohneare eFixncaeleldye,dw,hEexnygoneen rreespuolrtts(ftrhoemhithgehesraomfplteh/elasbaomrpalteoraynrdepllaibcoartaetopraiyrr)eipsliacbaotveeretshueltPs.QL and oConrepboerlaotwe,Etnhveirreosnumletntthaalt iDsaatbaobvaeseth(eCEPDQ)Lainsdreaproertreedp.orCte-d8arsesFuCl-ts1a4r3efroerccoorndseidstinentchye @ with historical results. WVOiNKn.Ci8 nGgo, OaF Summary enfos Feb 5.03 a 000025 C:80va SummaryReport C8 Analyses and Analytical Reporting AMnSaalniaqluyostisofearaecuhsefdietlod sasasmepslseaaclcsuoraicsya.naTlhyezeMdSasraecmoavterriyx vsapliukee (mMuSs)t. falRlesbuelttwsoeefnt7h0e to `1m3a0x%i,muunmleasmsotuhnetsaumspedletocosnpcieknetrfaietlidonsaimpaltelseaisst5f0o0urugt/ilmes the amount spiked. The T20h0e2QiAnPoPrdeArdtdoednodcuumme(nQtAaPrPedAudcdteionnduinm,thDeunPuomnbte,ro20f0l2a)bowraatsorgyenQeCratseadmpdluersin(gmaMtariyx sgrpeiakteera)ndforregplriocuanted)watotearfarnedquseunrcfyaocfe-w5a%t,erorsaomnpeleesaccholpleerctaendalwyittihcailn btahtecfhac(iwlhitiycahnevder is laatntdhfeilflabcioluintyd,arLioecsa.l SLpanedcfiiflilc,alLleyt,aratnaLlaynsdisfoilf,wealnld,DorutyfaRlul,naLnadndsftirlelawmesraempsluebssecqoulelnetcltyed pfreerqfuoernmceydwwaisthmtahdeerebdeuccaeudseQaCssubasmtpalnteiaflredqauteanbcays.e TexhiisstsrefdourctthieosneisnamQpCless,amipnlceluding at lferaesqtutehnrceye froorusnadmsoplfessamcopllleecatneadloyustissiadteEtxhyegefanc.iliTtyhearned wlaansdfnilolrbeoduuncdtairoinesi,n sQuCchsaasmpolffe- site well, ap water samples, cisterns, PWS, and Ohio River water samples. Atlhle dlaabtoarpaatocrkyagSeOsPgeannedraQtAedPbPyAEdxdyegnednumha,vaenbdefeonrrdeavtaieuwseabdiliint-yh,ouussienfgorthceocmhpelcikalinscte with pErxoyvgiednedhainvethbeeQenAPgPe.nerRaetseudltinsocfotmhpeliiann-cheouwsiethretvhieelwabionrdaitcoartye tShOatPdaantad rQeApoPrPted by `diAsdcduesnseddumbewliotwh.feAlwledxacteaptrieopnosr,teads bnoytEexdyignetnhehainvdeivbiedeunaljurdegveidewussaubmlmeafroiretsheanpdurposes of the project. oO Eblxayngkes)n frrepoomrotendetdhaattaspeavceknoagfe,thaendOhtiwootswaom-pmlielsefrraodimusLoscaamlplLeesnd(siinlcllucdoilnlgecttwedodfuierlidng hNoolvdetmibmeerof210402daanyds r(easpopretredthien SaOnPo)t.herTdhaetsaepsaacmkpalgees, wweerree aannaallyyzzeedd wbietyhoinndttwhoetsiammepsle tshaempslpeecsifatie1d0h0oladndti1me,.000Thuge/ll,ahbaorvaeteoxrhyiablistoedhasstarbeilpiotrytefdortphaetrinoodns-parsojleocntg, afsieolndespyiekaerd (iEnxclyugdeend,i2n00t2h)e.QATPhPe,daatnadptahcekraegseusltwsewreereexdaemtienrmeidniend-htooubsee,usuasbilneg tfohreprreovjieectw ppurroptoosceosl. All data reported by Exygen have been judged usable for the purposes of the project. 241 Independent Quality Assurance Review AStasnudbasredtso,ftInhce(dEaStIa)piancVkaalgleesygFeonregrea,tePdenbnysyElxvyagniean,wfeorreansuibnmdietpteenddetontEnicv.i,rtohnimredn-tpaalrty) qiunaclliutdyinagssfuireladncbelarnekvsieawn.d Tduhpilritcya-teeisg,htwedarteaspuabcmkiatgteesd, fcoorntvaaliindiantigonr.esulTthsefosram3p2l6essamples, smuiblmeirtatdeidusf,orOhrieovioenwe-reapnrdestewnot-smialmeplreasdicuosl,lOechtieod RfirvoemrtshaempWleisntg,ViarngdinPiWaSo.ne-Thaendstawmop-les saunbdmNitotveedmfboerrre2v0i0e2w, rferpormestehnetW2e3s.t7%Voirfgitnhieasoanmep-leasn,dctolwloe-cmtieldebreatdwiuese,nODheicoeomnbee-ran2d001 sutrwfoa-cmei.lewartaedriuss,amOphliiongR.ivDeartasapmapclkiangge,sP/sWaSm,plaensdsfuabcmiliitttyeadndforlatnhdefiilnldgerpoeunnddewnattqeuralaintdy @ assasmuprlaenscewerreeviperwefwereernetisaellleyctseedleactterdanbdecoamu;sheotwheevseer,saomfpflseistewreerseidceonltliealctaenddfrPoWmS.drinking- RCD ota Sumywna Fob 5.03 imagen 8 -- -- 5 000026 C8 ot Summary Report. C8 Analyses and Analytical Reporting ywiaetledrinsgouprocseist.ivIenaandaldyittiicoanl, sreasmuplltsesforfopmartthiecOuhliaro iRnitvereerststaomptlhienGgIwSeTr,essuucbhmiatstseadmpfolres review. The quality assurance review was performed by ESI with guidance from the Region lll Modifications to National Functional Guidelines for Organic Data Review [United States Environmental Protection Agency (USEPA), 1994). Data were examined by ES to determine the usabilityof the analytical results and compliance relative to the QAPP, QAPP Addendum, and the laboratory SOP. Results of the quality assurance review indicated that the qualityofthe data is acceptable and qualification of the data was not warranted, with the exception that positive results for two samples reviewed were qualified J, as estimated, due to precision criteria between the sample and lab replicate not being met. It should be noted that the laboratory, and DuPont, in this case and any similar cases for data not submitted for independent review, reported the higher of the two results. VWiAmKiCng.o8n,t0a% Surry ex na Feb. 5.03 Ts 000027 CoCo8m0a8sSmummmaayryRReepeortt WaWsahshiinnggttoonnWWoorrkkssFFaacciilliittyy 3.0 WASHINGTON WORKS FACILITY 3.1 Introduction "sTehveenfamciillietsy issoultochawteesdtaolfonPagrtkheersObhuirog,RiWveesrtiVniWragisnhiiang(steoen,FiWgeusret 3V.i0r)g.inCiao,nsaepnptroOxridmeartely required tasks following: to be conducted at or immediately adjacent to the facility included the Q Task A: Groundwater Well and Water-Use Surveying and C-8 Sampling-- csoanmdpulcitngaadlilsgtraonucned-pwhaatseerdwgerllosu,ndspwraitnegsr.wealnldacnidstweamtserw-iutshiensaurovneey-midielnet(ifaynidng and possibly Landfill two- and three- mile) radial distanceof the facility and the Local Q DTaastka--Bd:eAvsesleospsmaenndtiomfpElxeimsetnitngaGmroonuintodrwiantgerplaanndthSautrfeavcaeluWaatetserthMeopnrietsoernicnegand efaxctielnittoy fanCd-8peirnfdorrimnkainnagswsaetsesrm,egnrtooufndCw-a8teirm,paacntdtsoutrhfeacOehwiaoteRrivienraannddatroouPnWdSthe wmiitlheisnuopnsetrmeialmeaunpdst2r0eaamndan3d0 m1i0lmeisldeoswdnoswtnrsetarme)oafmt(haendfpacoislsitiyb.ly two and three @ Q TanadskhoCr:izPolnutamleeIxdteennttioffiCca-t8ioinm/pGarcotuneddwagtreorunAdswsaetsesrmeexncie--eddeitnegr1miung/eltohreavserdtiirceaclted bmoydtehleiGnIgSiTs,dounsei.ng groundwater modeling tools approved by the GIST if IrneqSueicrteimoennst3so.2ftthhreouCgohns3e.4n,tdOirsdceusrsairoensporfetshenetesdpeacliofincg awcittihvittiheesnceowndduacttaedactqouimreeedtwthhiele ccuornrdeunctteinnvgitrhoensmeeancttaivlitsieetst.ingIn(gSeeocltoigoyn,3h.5y,drtohleorgeyv,isheyddrsiotgeecoolnocgeyp,tugarloumnoddwealteurpdfaltoews, tahned water quality) and current conditions at and near the human sit. health and ecological exposure pathways for the. 3.2 Task A: Groundwater Well and Water-Use Surveying and C-8 Sampling 3.2.1 One-Mile Radius Sampling oTfhteheLoLcoaclalLaLnadnfdiflilllistlooctahteefdaciimlimteyd,igartoeulnydswoauttehrowfetlhles lfaoccialitteyd. wiBtehcianutsheeofctohmbeipnreodxiomniet-y ``mgirloeurnaddwiautse(rowfebloltahnsditweast)eirn-uWsees!suVrivregyinainadwsearmeplsianmgplweidth(isncethFeiognuere-m3i.l1)e. raTdhieusof the eo tfhaceilrietsyulatnsdotfhteheLoocnael-mLialnedfrialdliwuserseurcvoemypltoettehde oGnISFTebirnuAaprryil122,0200202(.DuDPounPto,nt20s0ub2m)itted VWAiVmeKgGi.o8n,Do0t8a Summaryextra Feb 5.03 EE 7 000028 8000 Sumy upon Washington Works Facility "ATtaobtlael3o.f0 s2u69mmhaormizeesswtehreeofsfu-rsvietyeesdu,rvaenyd aantdotsaalmopfl4i4ngwpatreorgrsaomurfcoerstwheeroenes-ammpilleed.radiSuis.x fwoerlldsriunskeidngfowatderri.nkiTnagblweat3e.1r wperorveisdaemspdleetda.ilsNfoorccisatcehmnssaomrplseprcionlglsecstaemd,pliendclwuedrinegutsheed cCo-l8leccotnecde,nrtergaatridolnesmseoafsuwraetder(uugs/el.). EFaicghurceol3o.r1esdhcoirwcslethreeplroecsaetnitosnsa of all samples sampling location and Fthoerceoxlaomrpalned, ssimzaelloftblhaeckcicricrlceleisndriecparteesctahte smaamgpnlietsudheaovfintgheC-C8-$cocnocnecnetnrtartaitoinosnrmaenagsiunrged. cfoinocmen1t0ra1t.i0o1n0s1g0reuagt/el,r wthhialne10l.0argeugb/l.acNkoctierctlheastrtehperenseuntmsabompfelCe-rs8hadevtiencgtiCo-ns above 10 ug/l are limited. oTnaeb-lmei3l.e1 rsahdiouwssstahmapltihnegCr-a8ngcoendcefnrtormat0i.o3n2s8itnos2x.8durgi/ln.kinBge-cwaautseer tshaempdlreinskdiunrgi-nwgattehre Osradmeprl,esthheaGdICS-T8 ocrodnecreendtrtahteioenxspaanbsoivoentohfe t|heugr/aldituhsretsohotlwdolmeivlelesdeasncdrirbeesdambpylithneg Ctohensent ndroinndkirnigk-iwnatgesrosuarmcpelweasswi5t.h0i7nugt/hLe.onTeh-emihlieghreasdtiuCs.-TchoencheingthreasttioCn-$incuonnucsenetdrwataitoenrin a sources was 14.3 ug/l. (Cs-c8ecToanbcleent3r.1a)t.ionTshemseeasreusrueldtsiinntdhiecastxedctihsattearintsrsaanmspploerdtroafnCg-e8d farsoamm0i.g5r6a1ti1o0n3p.a52thuwg/aly awnaosthpeorsssiobulrecie (cgsrtoeurnmdswwateerre,fPilWleSd,beycp.r)ectihpeitnatwiaotne.r tIrfawnastpeorrtoisfaCd-dedistopotshseibclies.terSnufrrvoemy @ prreescuilptistfartioomn.individual residents show that stems were filled predominantly by 322 Two-Mile Radius Sampling oTfhtehegrfoaucnildiwtaytaenrdwtehlelLaoncdalwaLtaenrd-fiulsle wseurrevecyoamnpdleCt-e8dsoanmJpulnieng3,wi2t0h0i2n. thDeutPwoon-tmisluebmriatdtieuds the resultsofthe two-mile radius survey to the GIST in August 2002 (DuPont, 20021), WTiatbhlien3.2thesutmwom-amriilzeesratdhieusofaf-tsoittael soufr1ve0y9 ahnodmessamwpelriengsuprrvoegyread,m afonrdt6h5e wtawtoe-rmisloeurrcaedisus. Nweorneesoafmtphleede.ighStevciesntteerensn swaemllpsleadndwaosneussperdiansgausderdinfkoirndgr-iwnaktienrgswoaurtceer.weTraeblsea3m.p3led. (pruogv)i.deFsidgeutraeil3s.1forinccalcuhdessatmhpelCe-c8olrleescutletds, fionrctlhueditnwgo-thmeilCe-radciounsc.enAtlrlatsiaomnpmleeassaurreed psoasmtpelde)rehgaadrdaleCs-s8ocfownacteenrtruastei.oOn fgrtehaeter18thdarnin1k.i0nugg-/wl.ateTrhseaCmp-l8ecso,nocnelnytroanteio(naisnptrhieng csopnicnegntsraamtpiolneswlaesss 1t.h8anug/1l..0 uAgl/ll drTihnekihnigg-hweastterC-s8amcpolnecsenftrroatmiwoenlmlesahsaudreCd-in nocdornicneknitnrgawtiaonemeaansduurneudseindtwhaetweerlslosufrcreosmwtehereon1e.-6m7ialnedra2d.i3u2sutgha,t wreesrpeecrteivsealmyp.leCd8ranged from 0.526 to 2.48 ug (sec Table 3.1) Casey i ov 5 -- T 000029  Dd =} C-8 Data Summary Report Washington Works Facility Again C-8 concentrations measured in the eight cisterns indicated air transport as a pporsesdiobmlienCa-nt8lmyifgirlaltediovniapaprtehcwipaiytaftrioonm.the facility because the cistems were The results for the two-mile radius showedatrend toward lower concentrations than were found in the one-mile radius sampling area. While the two-mile radius was being. conducted, the CATT released the human health protective screening criteria for water (C-8 SL)of 150 ug/l (WVDEP, 2002). In August 2002, the GIST determined that no further off-site surveying or resampling around the facility and the Local Landfill was needed. 3.2.3 Ohio One-Mile Sampling Off-site surveying and sampling also was conducted in Ohio. C-8 was initially measured in the Little Hocking Water Association well field (a PWS sampling point), located in Ohio directly across the Ohio River from the facility in December 2001 (see Section 3.3.3). DuPont and the Ohio Environmental Protection Agency (OEPA) agreed that the groundwater well and water-use survey would be expanded to a distance one mile from the facility boundary into Ohio. The groundwater well and water-use survey and C-8 `sampling within the one-mile radius in Ohio were completed on June 7, 2002. DuPont submitted the resultsof the one-mile radius survey to the OEPA and the GIST in August, 2002 (DuPont, 2002i). `Table 3.4 summarizes the one-mile radius survey and sampling in Ohio. The total `numberofhomes surveyed was 150, and the total numberofwater sources sampled was 68. Of the 68 water sources sampled, 17 were from drinking-water wells, and one was from a drinking-water spring. No cisterns sampled were used for drinking water. Table 3.5 provides details on the samples collected, including the measured C-8 concentration. The C-8 concentration measured for the drinking-water wells ranged from non-detectable [<0.01 ug/l (ND)] 10 8.59. The C-8 concentration for a drinking-water spring was 1.29 ug/l. The highest C-8 concentration measured in non-drinking-water sources and unused sources was 23.6 and 16.9 ug/l, respectively. Figure 3.2 is a map showing the locationofsamples, regardless of water use, collected within the Ohio one-mile radius. `This figure uses the same symbols as were used in Figure 3.1. Locations of samples `having C-8 concentrations greater than 10.0 ug/l appeared to be clustered to the northeast and northwest. C-8 concentrations measured in the five cisterns ranged from 0.748 to 7.33 ug/l. These results indicated that air transportofC-8 was apossible migration pathway from the facility, providing the cisterns were filled by precipitation. Even though the highest C-8 concentration measured for a drinking-water sample within the one-mile radius was an or ofd mage nitur de lower that the CATT established C-8 SL of 150 ug/l, nine non-drinking-water and unused water source samples had C-8 concentrations above 10.0 ug/l. Based on these results, OEPA requested an expansion of the survey area to a two-mile radius. 3.2.4 Ohio Two Mile Sampling `The groundwater well and water-use survey and C-8 sampling within the two-mile radius of the facility were completed on September 30, 2002. DuPont submitted the results of SN.58 Ba Summary inate Feb. 5,03 9 000030 CCooDwassSwumemaaryyRRret WaWasshhiinnggtonWWoorrkkssFFaacciility @ D. = t2h0e02t)w.o-mile radius survey to the OEPA and the GIST in December, 2002 (DuPont, FwiotrhthteheOOhiEoPtAwoa-nmditlheerGaIdiSuTs., tThheesatmwpol-imniglestrraadtieugsyswuarsvemyodairfeaiewdafsodlilvoiwdiendg dinitsocutshsrieoons atrweoa-sm,i"lAe"r,ad"iBus,, aanredas"C""A("s,ec"BFYi,guarned3".2C)"., Awlelrehosmurevseyweidt.hinInthaereean"trBe"aarleaidweintthiifnietdhe wwealtlesr,, soprriunnguss,ead)ndbecicsatuesrensthwiesrpeorstaimopnleodf,threegtawrod-lmeissleofraudsieus(dwraisnkaidnjgawcaetnetrt,onaonn-adrrainking wadidtihtiinont,healolnied-emnitlifeierdaddiruisnwkihnegrewattheer,hingohne-sdtriCn-k8incgonwcaetnetrr,atainodnsunwuesreedmweealslusr,esdp.rinIgns, and csaimsptleemds.frIonmarreesai"deAn"ceasndlo"cCa"te,dwaelllosn,gsTporiwnngssh,iapndRcoiasdte9r7ns(wleocraetesdamwpitlheidnoanrlcya i"ftCh"e)sew.ere ssaomurpcleesd.weArreeausse"dAf"oradnrdin"kCi"nga-rweataedrj;acneonnt-tdorianrkeiasngi-nwtahteeronaen-dmiulneusreaddisuosuwrhceesrewelroewenrot C-8 concentrations were measured. Twaebrlees3u.r6vepyreodv,idaensda6s2uwmamtaerrysoofurctehse Ohio were two-mile sampled, sinucrlvuedyinregsu4l9ts.welIlns total, used 7fo3r3dhroinmkeisng walastoers,hoNwosctihsetleomcsatoirosnporfinsgasmpslaemsp,leredgawredrleesussoefdwaastedrrinuskei,ngc-owlaltecetresdouwrictehsi.n tFhieguOrheio3.2 t`mweoa-smuirleed rCad-i8usc.oncTeanbtlreat3i.o7nsp.rovTihdeesC-de8taciolnscoefntthraetisoanmsplmeesascuorlleedctiend,driinnckliundgi-nwgattheer samples ranged from ND to 6.5 ug/l, with only 11 samples having C-8 concentration greater 1.0 ug/l. samples ranged The highest C-8 concentration was 6.85 ug/l. The highest C-8 measured for concentration the non-drinking-water measured in an unused sfoiuormce0.w2a1s7 81.0608.5ug9/2l.ug/Tlh.eOrvaenrgael,oftCh-e8C-c8onccoenncternattriaotniionnsthaerethlroeweecrisitnetrhnestawmop-lmeislewas radius samples than i the one-mile radius. `cWohnidluecttheedgirnotuhnedownaet-eranwdeltlwaon-mdiwlaeterard-iuusse isnurOvhieoy,angdroCun-dwsaatmeprlimnogdewleirnegbaelisnogwas being cthoendluickteeldi.hooOdntehoatfotfhfe-siotbejemcitgirvaetsioofnotfheCg-r8ouinmdpwaactteerd mgordoeulndiwnagteefrfowrtaswaoscctuorrdientge,rTmihnee bgernouenadtshiathteerOhmoidoeRliivnegrs(hDouwPeondtt,h2a00n3o4)p.oteTnhteiralefgorro,unadiwattreanrspmoirgtroaftiCo-n8paisththweaymoesxtists likely migration pathway for C- from the facility. 3.3 Task B: Assessment Monitoring Data of Existing Groundwater and Surface-water 3.3.1 Monitoring of C-8 in Groundwater and Surface Water Groundwater Monitoring "sTahmepCloendsfeonltloOwridnegrtrheequdierveedlothpamteantseolefcat gnruomubnedrwoaftfearcimlointiytomroinnigtoprlianngbwyelDlusPwoenrte to be @ (DuPont, 20020) and its approval by the GIST (DuPont, 20024). Frequencyof sampling WWirCingO5a% Saran ete FR 508 -- -- 000031 Dat Summary Report Washington Works Facility ae wOradsert,o btheemnoqnutahrlteyrlfyorthtehreeaffitrsetr.fouMronmtohnltyhssafmoplllionwgiongftghreoeufnfdecwtaitveerdabteegoafn tihneJCanounasreynt 2s0u0b2m.ittQeudarttoetrhleyGsIamSpTliinngDebecgeamnbeirn M2a00y22(0D0u2Po(n2t0,22)0.02Tk)h.e 4Q02 monitoring report was T`garboluend3w.8atperrovmiodneistoarilinsgtofprtohgerapmrofdourcttiheonfaacinlditmy.oniWteolrlincgonwsetlrlusctiinocnludadtead ainndthe `mgornoiutnodrwiantgerweelllesva(tAioJnOdSa-tMaWa0l2so,aNr0e4pr-oMvWi0de3d,ianntdhiYs t1a4bl-eM.W0T2h)e tthharteewenreewibnestdarlolcekd in p3rQo0g2raams pianrt4oQf0t2h.eFCi-g8urpel3u.m3esdheolwisnetahteiolnocwaotrikonptlhaenwweelrlse laidsdteedditnoTtahbelemo3n.i8t.orTianbgle 3.9 ptrhersoeungthsOaclltoofbtehre20C0-28,cionnccleundtirnagtiCo-n8s dmaetaasaucrqeudiriendthpersioerptroodtuhcetiisosnuianngodfmotnhietCoorinnsgenwtells O2r0d0e2r.C-T8hceonmcoesnttrraetcieonntsdiantagraorunldiwsattederf.irst for each wel Figure 3.4 shows the October haTlabfloef3t.h9esfhaociwlsittyhhata,viensghenoewrnala, Cm-onictoonrcienngtraantdiopnrordauncgteifonrowmel0l.s07l1octaote2d.8o2nutgh/el eastern p(rAoEdu1c1t-iMonWOw1el,lsAMinOt7h-ePwWeOst1e,rnAhOUaSo-lfPtWhfOe1s,itaengdenAeXra1l3l-yPhWaOv1e)s.hoMwonniatoCr-ingcoanncdentration range of 0.117 1051.2 ug/l (VOS-PWO1, L04-PWOL, NI3-MWOL, Y14-MWOL, KI6-PWOI, West Well Field 1, adjacent to the Ohio River near E13-MWOI, and DOS-MWO01). the former Anaerobic Digestion Monitoring Ponds have wells located higher C-8 oO cMoWnOc0en2t,raatnidonRs0,4r-aMnWgOi0n2g).froHmolweesvsetrh,anev1a0l0uattoio8n4o,1f0b0orugi/nlg(lPoOgsSf-oMrWtOh1e,sePwOe4ll-MsWhOo2ws, tQhOa4t- tthharteesotfratthiegrsaephwieclallslyaroevesrclryeetnheedsainndaspaenrdchgerdavwealtseorf-tthabeleprliocmaatreyd siintetwhaetcelra-ytsabalnedasqiulitsfer (site aquifer). Q04-MWO2 is the only well included in the groundwater monitoring paqruoigferra.m RleoccaetnetdCi-nthceonfcoernmterratAinoanesrmoebaiscuDriegdesftoirotnhiPsownedlsl ahraevaetbhaetenishsicgrheleynevdariianbtlhee, site ranging from 32.2 t0 7,720 ug. (Further discussionofthe wells screened in the perched water-table are presented in Section 3.5.1.) nAovna-iqluaabnlteifdiaatbalfeor[<t0h.e0b5eudgr/olc(kNaQq)u)ifienrtahreecveenrtryallismoiutetdhe(ronnlbyoutnhrdeaerywe(llYs1)4b-utMWra0n2g)estofrom 0.133 ug along in the eastern portion (AJ06-MW02)ofthe near the former Anaerobic Digestion Ponds (NO4-MW03). site to 21.2 ug/l in the area. The next 2003, groundwater sampling event for the facility is scheduled for the first quarter Surface-water Monitoring `VTihregiCnoinas/eNnattioOnradlerPoalllsuotaindtenDtiifsicehdarsigxe oEultifamlilnsa'taitonthSeyfsatceilmit(y WthVa/t NaPreDrEeSgu)laPteerdmibtyNWo.est WloVc0at0i0on1s2o7f9thaendsiwxhoeutrfeallmso.ntMholnytshalmyplsianmgpolfinCgo-8fowuatsfarlelqsuibreegd.an FiingDuerece3m.3besrho2w0s01t.he.The @ ition atresia ilbeen clive outfall. C Winingono,S OmFSoy ton Fb S08 ar 000032 80st Surman Report Washington Works Facility N20o0v3em(bDuePro2n0t,0220S0u3rbf)a.ceTWaabtleer3.M1o0nistuomrmianrgiRzeepsotrhtewCa-s scuobnmcietntteradttioontshemGeaIsSuTreind Jianntuhaery outfall, including C-8 data acquired prior recent data are listed first for each outfall to the issuing of the Consent Order. The most TRihveers.ixTohuetfWllVsDsEamPplpeedrmdiitscrheaqrugierepdromcoenstshlwyatreerpoarntdinsgtoofrmefwfaltueerntrufnloofwftvoolthuemeOshiaond C- cloonwceesnttrcaotnicoennst.ratOiutofnasollfs C0-082,, 0r0a3n,gianngdf0r0o7m tNyQpictaoll8y.5d6i,screhsapregcetievfefllyu.entOuctofnatlalisn0i0n1g tahned 010055 hhaasvesdhioswcnhatrhgeehdihghiegshtercoCn-c8enctornacteinotnrsaotifoCns-, raanndgidnigscfhraormge2s.1t5hetola5r4g.e6stugv/ol.luOmuetfoafll ehfaMvueernatncgoedmpfarroemd 1t.o43thteoo1th9e9ruogu/tl,fawlilsthatotnheeafnacoimliatyl.ouCs-h8igchonccoenncternattriaotnisonfoorfO9ut1f5alulg/0l05 Hfoolwleovweirn,g tthhee iCn-staclloantcieonntorfata iocnarabtoOnutffielltlra0ti0o5n thraesatgmeennetraslylsytdeemcrienatsheedfilno2u0r0op1olaynmde2rs002 process. `bOeutsfaulledsatmoptlhiengGIfoSrTDiencFeembbreurar2y002200h3a.s Obuetefnalclomspalmeptleidn,gfaonrdJtahneumaornyit2o0r0i3ngharsepboeretnwill csoammpplleitnegde,vbeuntt tihsesCch-edruelseudltfsohraFveebrnuoatryyet20b0e3e.n validated. The next monthly outfall 33.2 Ohio River Water Quality A Crehqauriarcetmeernitz.ingInOhadidoitRiiovne,rthweateevralquuaatliitoyn,rwiivtehr-rweastpeercqtutaoliCt-y8,wawsasidaenCtoifniseednatsOarddaetra gap in the CompilationofHistorical C-8 report (DuPont, 2002b) recommended activity in the C- Plume Identification Work and was included as a Plan (DuPont, 2002). The `Ohio River 20021) was Water Sampling Proposal for the facility and the developed and submitted to the GIST in January Letart 2002. Landfill (DuPont, NOehairo tRhievefra.cilTithye, OsahmipolRiinvgeirnvweastteirgawtaisonswaamspldeedsitgonmeedatsourmeeectontchernetermataiionnsobojfecCt-iv8esi:n the Q Characterize facility. background C- concentrations in river-water upstreamof the Q Assess C-8 concentrations in river water along the facility reach. Q Evaluate C-8 concentrations in river water downstream. `sTaambpllei3n.g11neparrestehnetsLeatasrut mLmanadrfiyollf. tThheeOhLeitoarRtivLaenrdfwialtlersasmapmlpelsinagndprCo-g8rarme,suiltnsclaurdeing d3.i5scsuhsosewdsitnheSelcotciaotnio5n.4o.f5.upTsatbrleeam3.s1a2mpplreovsiadneds tshaempCl-e8sraelsuolntgs tfhoer fOauctiflailtyl r0e0a5c.h. FiFgiugruere 3.6 are shows posted. the concentrationof downstream samples. C- concentrations for cach sample @ AIndjtaotcaeln,t46tortihveerf-acwialtietry,sraimvpelre-swawteerresacmolplleecstewde,riencclouldleicntgetdwaot dthurpeleiclaotceatsiaomnpsleasl.ong two transects across the river. Samples were collected at three depths (dip, mid-column, and WWWimKingCon0, m08Suma totalFeb503 .1 000033 0a Summary Report Washington Works Facility sbaomtptloem.) aDtueraicnhgltohceatsioanm.e tFiiemledppearriaomdettheartsriwveerrewamtoenritwoarsedsadmuprliendg,coelflfelucetnitonforfomeaOcuhtfall 005 was sampled to evaluate dispersion downstream of the oulfal, OOfftthhee 2s7evseanmspalmepslceosllceocltleedctaeldonugpstthreeafamciolftithyereafacchi,liatyl,wseixreweNrDe NeDxc,epatndfoor etwwoatshaNt Qwere. N1Q.0.9 uTg/hl.e rTahnegetowfoCh-i8ghceosntceCn-t8ractoinocnenftorratthieon1s2wdeorwenmsetarseuarmesdaimnplaedsipwaasnd0.m0i9d4-9cotolumn sample collected approximately three miles downstream from the facility. dIitrsecltirkeesluyltthoaftinthceretawsoehdigCh-e8stcoCn-c8enctornacteinotnrsatdiiosncshamregaesdutrherdouignhthOeutOfhaillo 0R0i5v.erTwaabtleer3a.r1e2a wsehroewsnotthacoltlheecCte-d8 fcronocmenOturtaftailon0s05mebaestuwreeednaJtuOluytf1aallnd00JSulayre10h;ibguhtl,yivfaCri-a8blceo.ncCe-nt8rdaattiaon iwnatshheirgihveerr dounrtihnegsethdiasyssa,miet mtiigmhetferxapmlea.in why the higher concentrations were measured "cTohnetarienviinsgedggrroouunnddwwaatteerrexmiosdtselbesnheoatwhedthtehaOthnioo pRoitveenr.tialThmeirgerfaotrieo,naiprattrhawnaspyorftoroCf-C&- to the Ohio River is a likely migration pathway, in addition to the direct discharge of C- containing surface water to the Ohio River through the permitted outfals. 33.3 Public Water Supply Sampling oO pPuWrsSuainntWteosttheViCrognisneinataOnrddeOrh.ioSaatmvpalriinogusopfoPinWtSs uwpistthrienaomnoef-mtihleefaucpisltitryewaemraendsa1m0p-lmeidles ddioswtnasnctereuapmstbreegaamnainndDdeocwenmsbterrea2m00w1.asBeaxspaenddeodn.theSiCx-t8eecnonPcWenStrlaotciaotnesdmaesafsaur raed,thtrheee (msielcesFiugpusrtere3.a7m).anBdas5e3dmoilnetshdeovwenrsytlroewamC-w8erceonucletnitmraatteiloynisnmcelaudseudreidn tahtethseamvpalriinougsevents rPeWdSu,cetdhebynuthmebeGrIoSfT PinWMSaryeq2u0i0r2e.d to be sampled and the frequencyof sampling were Table 3.13 presents all the C- concentrations rmeesausltusreadrilnisttheedvianrcihoruosnPolWoSg.icaFlorordPeWr.S sampled more than once, the sampling event HCuorcrkeintnlgy,(Oohniloy)tahrreeesaPmWpSl,edLuobneacqkua(rWteesrtlyVbiarsgiinsi(aD),uPTounptp,er2s00P2lma)i.ns C(O-h8ioc)o,ncaenndtrLaittitloens amteTauspupreerdsatPlLauibnsecrkanrgaendgefdrofmroNmD0.120803.7to261.u2g1/lug(/slc,ewThaiblleeC3-.183)c.oncentrations measured Little Hocking concentrations ihnadprtohdeuchitgihoenswteCl-ls8 hcaovnceerntarnagteidonfsroomfa0l.l42th1e0P8W.5S8 usgalmlp.leCd-.8 C-8 hcoanvceenrtarnagteidonfsroinmd1r.i6n9ki0ng4.w2a9teurg/dl.ispTeWr-se4d,tao tceussttwoemlelr,shafdrotmhethheisgehewsetllmseaasutrheedPCW-S dceocnrceeanstirnagt;iotnheatm3o7s.t1 ruegc/el.ntTrheseulctonfcoerntihriastwieolnlswmaesas1u4r.e5duga/tlT. WBa-sehdavoenbteheesnesrteesaudlitsl,y o TOWE-P4Aarnedquveisctineidtyt,haatnadnDiunPveosnttigaagtrieoendbetoccoonndduuccttedthteo ienvvaelstuiagtaetitohne. C-DuPcoonnctehnatsrastaimonpsleatd h`gerotuenstdwaantderpraondducsotiilonsawmeplllessafrLoimtlbeoHroicnkgisnagn.d Gcorloluenctdewdagtreorurnedswulattsehrasvaempbleeesn pfrreosmenaltled WCinoCginSGoD8 Soman io Fo 5.63 -- -- = 000034 C8 0atSummary Report Washington Works Facility ttohetrheefoOreE,PAn.oneoThfethmeetshoioldsdaemvpelleosphmaesntbefeonr aannaallyyzzeidngyeCt-.8 Aisn saoirlessuilst,stnilo ifninparlogress; tchoencslaumspiloinnsghianvveesyteitgbateieonn darnadwtnhefCr-o8m trheissulitnsvefsotriggartoiounn.dwaHtoewrevaenrd,Soailrewpiolrltbdeoscuubmmeintttiendg 10 the OEPA and the GIST when the analytical results have been finalized. The next PWS sampling for the first quarter 2003. event at Litlle Hocking, Lubeck and Tuppers Plains is scheduled 3.4 Task C: Plume Identification/Groundwater Assessment (BDausPeodnotn, 2th0e02dba)t,atghaepsC-idePnltiufmieedIidnetnhteifCiocmaptiiloan/tGiroonuonfdHwiastteorrAiscaslesCs-menDtatWaorrekpoPrtlan was developed and submittedto the GIST (DuPont, 2002). Included in this work plan were tspheecaicftiicviatciteisvirteiecsormemceonmdmeednidnetdhetoCf-i8l pthleumdaetdaeglaipnse.atiIonntwheorfkolplloawninisgssuecmtmiaonrsi,zeeadch of briefly. Detailsofthe activity status and the data acquired are then presented. 34.1 Installation of New Wells at the Washington Works Facility `Three new bedrock monitoring wells were installed at the facility. These wells were finlsotwaldlierdecttoifounrtahnedr tdoeldienteeartmeiCn-e8tchoenvceerntticraaltigornosuinndwgarotuenrdgwraatdeire,nttso beevtalwueaetnetghreobuenddrwoactker and the overlying sand and gravel. tFhiegunreew3l.y3 isnhstoawlsledthbeeldorcoactkiowneollfsm.onWietlolricnognsatnrducptrioodnudcitaigornawmesllfso,ratnhed ntheewlwoeclaltsi,onAsJo0fG- MWO02, NO4-MW03 and Y 14-MW02, are provided in Appendix A. bGeedorloocgkicudnadtearloybitnagintehde fdaucriilnitgytwhheeirnesttalhleasteiowneolfltshaerseelotcharteeed.welTlhsesceonnfeiwrmdeadtathaelsdoepth to permitted refinementofexisting These revised cross-sections are cross-sections that discussed in detail were developed for in Section 3.5.1.1 the facility. 3.4.2 Hydrogeologic Testing of New Wells at the Washington Works Facility aHqyudirfoegrecohlaorgacitcertiessttiicnsgofotfhthee utnhdreeerlnyeiwngbbeeddrroocckkwaeqlulisfewraisnrtehceoCm-m8ePnlduemdetDoeelvianleuaattieon wweolrlks splcarn.eenTehdeinbetdheropcrkimmaornyitsoitreinwgatweerl-ltsabwleeraequcilfuesrt.erTehdiwsitahlloorwelodcafotredthneeaervaelxuiasttiinogn,of the vertical gradicnts between the primary site water-table aquifer and the underlying bedrock aquifer. 2002) and other weOlnllsynoeanrebyr.oundof water levels was measured for these wells (October aTqhueifgerrowuenldlws,attehrereeleisvamtoisotnsliiknedliycaatne uthpawtaartdQg0r4ad-iMenWt0b2etawnedensutrhreougnrdoiunngdwsaatnedrainndtghreavel bedrock and groundwater Digestion Ponds area, in the overlying sand and gravel near the former Anacrobic WWCiniCglonD,aOsFSuman tenfea Feb 8.08 # 000035 Co80osmtasSoummmaaryyRRegpoertn WaWasshhiinnggttoonnWWoorrkkssFaFcaciilliittyy AbotuwnedlalrcyolufsttehreYs1i4t,-tMhWeOg1rouannddwYa1t4er-MgWrOad0i2e,ntlaocpapteeadrsnetaorbtehdeoswountwhaerrnd property from the sand and g2r0a0v2eli tohitghheeurntdhearnlyiinnwgebleldsrlooccka.tedThneeawrabtyerthlaetvwelermeeamseuarseudreidn AinJFOe6b-ruMaWrOy220i0n2O,ctober indicating a and gravel, ilniktehilsy aurpeaw.ard groundwater gradient from the bedrock to the overlying sands 3.43 Washington Works Groundwater Model Refinement AWagsrhoiunngdtwoantWerormkosde(lDuwPaosntd,ev1e9l9o9p).edTfhoirstmheodfaeclilwitaysarsepvairstedofduthreinRgFtIhirsepionrvtesftoirgation pParrottieacltliyotnoAagdedrnecsysatnhde cthoemmUneinttesdgSetnaetreastAerdmbyy CthoerUponiftEendgSitnaeteerssEn(vUiSrAoCnmOeEn)t.alThe `eCvoanlsueantte Othredeerxtaelnstoorfeqgurioruenddrweaftienremcaepnttuorfedthbeygtrhoeupnduwmaptienrgmwoedlells aftorthtehesiftaecialnidtyttoo re- determine occurring the likelihood that off-site migration of C-8 impacted groundwater is Tcoompmleeettetdhewsiethreiqnupiurt,emgeunitdsa,ncree,fiannedmecnrtitiocfalthreevgireowunfdrwoamtetrhemUondietleidngStwaoterskGweaolsogical Survey, the USACOE, the and GIST members during West Virginia Department ofHealth the model development, calibration, and and Human Resources, finalization process. `sTuhreroruepnodritngofarfeinaalwafsinsduinbgmsitftoerdthteo trheeviGsIedSTgrionuJnadnwuaatreyr2m0o0d3el(DfuoProtnhte,fa2c0i0li3t)y.anTdhtehe D rmeivgirsaetdiognrooufngdrwoautnedrwamtoedrelisskunppoowrntstoDubPeoonctc'usrrpirnegviaonudstchoantcnlouspiootnesnttihaalt gnroooufnd-swiatteer `migration pathway exists beneath the Ohio River. 3.4.4 Surface-water Field Reconnaissance at the Washington Works Facility Csiotnedauncdtisnagmpfliielndgrseucrofnancaeiwsastaenrceftroomidnenetwiflyoacdadtiitoinosnaildesntuirffiaecde-dwuartienrg ftehaistuerfefsorltocwaatsedaoCn--8 pnleuwmseudreflaicnee-awtaitoenr rfeeactoumremsewnedreed iadcetnitviitfyi.ed Fbieeyldonrdectohnonsaeisloscaantcieonwsatshapterarfeorcmurerdenatnldy no sampled. 3.4.5 C-8 Monitoring Works Facility in Groundwater and Surface Water at the Washington Cunodnetrilnyuiinngg bteodmroonciktoaqruCif-e8r i(nutgirloiuzinndgwathteern,ewinlyboitnhsttahleleudnbceodnrfoicnkedweallllsu)v,iaalnadquiinfseurrfaancde: winattehre aCt8expisltuimneg ldoeclaitnieoantsioindewnotirfkiepdlainn.thTehCeonresseunlttsOorfdceornwtainsuaend macotniivtiotyrirnegcoofmmended `groundwater and surface water are presented in Section 3.3.1 VWOiNmiKg.iCo8n,otOaF Summary ~ent alF5e .03 000036 w= C8032 Summary Regt Washington Works Facility 3.4.6 Washington Works Facility Site Conceptual Model Refinement TgahtehefrineadldruerciongmmceomnpdleedtiaoctnioviftTyafsokrsthAe,fBa,cilaintdyCis tinhteoiantreegvriasteidonosifteacllontcheepntueawl dmaotdael (SCM). section. This activity was completed and the revised SCM is presented in the following 3.5 Revised Site Conceptual Model `hTyhderorleovgisye,dhSydCrMogeidoelaolglyy,rgeprroeusnednwtasttehre fcluorwr,enatnednvwiartoenrmqeunatlaitly)seatntidngcu(rgreeonltoghyu,man health and ecological exposure pathways at sections present the revised SCM in detail. and surrounding the ite. The following 35.1 Current Environmental Setting Geology "3T.h8e, mfaocdiilfitiyedresftrsoomnSQiumaatredrn(1a9r8y9)al,luisviaalmotedrerlacbeldoecpkosdiitasgirnamthsehOohwiiongRitvheercVoamlplelye.x sFeitgourfe taenrdrarceetsreaantsdofftlohoedpplraeisn,setahralty-foarnmdeldaitne-tWhiesOchonisoinVaanllaenydbtehceauresseoulfttinhgesgulcacceisasliavdevpahnacseess oifdeanltliufviieadlffiivlelsfaancidesthoefitnhceisOihonisoiRnitvoetrheVaalllleuyv:ialsafnildl abnydthgeraOvheilo(cRoiavresre.-gSriaminaerddO(h1i9o89) Q gRriavienreadlOlhuivioumRiovrerouatlwlausvhi)u;mtorribouvtearrybasnakndseadnidmegnrtasv)e;l;acnodllsuavniduam;ndsislitltancodlcilaany).(fine- AfieglednienraOlhiizoe,dtnhorrotuhg-hsotuhtehOchriososR-sievcetrioanndfraocmrotshsetLhiettflaeciHloitcyk,iins gprWeasteentreAdsisnocFiiagtuiroen3w.9e.ll "PTlheiissctroocsesn-essecatnidonansdhogwrasvetlheoHuotlwoacsehndeepsiolstiatnsdancdlatyhoevfeirnberanrkewdoerpokseidtsPltehiasttoovceernleic the afllalt,uvriiuvme,r-tshcoouugrhetd tboedurndoecrkliseurtfhaeceroifvetrh. eThDeunaklalurvdiaSletreirersactehadterpiosseistsstaereepluyndaenrdlafionrmbsy tahe vfaaclilleiyty.walFlisgutroet3h.e0NsohrotwhsofthLeitrtelleaHtiovceklyinflgatWtaotpeorgArsaspohcyiaotfitohne aanllduvtioatlhteersroauctehodefpotshiets and the steep topographyofthe valley walls to the north and south. TSihxe odfetthaeisleed cgreoossl-osgeyctuinodnesrwlyeirnegdtehveeflaocpileidtyduisrisnhgotwhne oVnersiefivceantigoenolIongviecstcirgoastsi-osnec(tDiuoPnosn.t, 210909225))abnadsreedviosnedadidnitciaornlayl2f0i0n2difnogrstfhreoCmomtpheilRaFtI.ionoFufrtHhiesrtorreifcianlcDmeanttaoRfetphoerste (sDiuxPcornots,s- sections, based on the installation `generalized cross-section near the of three former bedrock wells, and the generation ofa Anaerobic Digestion Ponds were completed as p`amrotniotfotrhinegCw-e8llPslpuomretrDaeyleidneianttihoencWroosrsk-sPelcatinoancstiwveitriees.temSpoomrearoyfatnhde nteostlowneglelrs aexnisdt. Tmaebalseur3e.m14enptrsovfiodrewselwlesllcucrornesnttrluyctiinoenxiinsfteonrcmeataitotnheanfdaciglritoyu.ndFwiagtuerree3l.e3vasthioowns the locationsof monitoring well that curently exist a the site. The locations of the geologic WWiCniCngO,n0t% Summary total Fa 5. -- 000037 6  oO @ C8Data Summary Report Washington Works Facility Sownon igre 2.17. cross-sections A-A' through F-F' are shown in Figure 3.10. The location of G-G' is "Two east-west cross-sections, A-A' and F-F*, are shown in Figures 3.11 and 3.16. Four north-south cross-sections, B-B', C-C', D-D, and E-E" are shown in Figures 3.12, 3.13, 3.14.and 3.15, respectively. Cross-section G-G', Figure 3.17, shows an expanded view of the riverbank area near the former Anaerobic Digestion Ponds and the Riverbank Landfill. Note that wells RO4-MW02 and PO4-MW02 are screened in a perched groundwater zone within the Holocene overbank deposits. `The main and oldest Quaternary alluvial terrace at the facility is topographically flat and lies approximately 50 feet above the Ohio River while the remainsof younger terraces exist at lower elevations along the riverbank. The Holocene overbank deposits consist of silt, sandy silt, clay, silty clay, and clayey silt. The overbank deposits are approximately 35 feet thick near the riverbank and decrease in thickness away from the riverbank. Under the central portionof the facility, these overbank deposits range from approximately 5 to 15 feet thick. The overbank deposits are absent in the western portion ofthe site. The Quaternary alluvium (sand and gravel outwash deposits) ranges from 30 feet thick (near the river) up to 90 feet thick (under the central portionof the facility). The alluvium consistsof coarsening downward unconsolidated poorly to well-sorted, brown and gray sand, silts, clay, and gravel. The Dunkard Series bedrock consists primarilyofred and varicolored sandy shale; gray, green and brown sandstone; gray and lliigmhetstgornaey.siltstone; and minor bedsofcoal, claystone, black carbonaceous shale, and Hydrology, Hydrogeology and Groundwater Flow Hydrology Surface water at the facility discharges through drains and storm sewers (outfalls) and drainage swales. Six outfalls (001, 002, 003, 005, 007, and 105) collect facility process water and stormwater runoffand discharge it to the Ohio River. These six outfalls are regulated by WV/NPDES Permit No. WV0001279. The locationsof these outfalls are shown in Figure 3.3. Two drainage swales, one located in the facility's southwest comer, and the other located on the extreme eastern end of the facility, convey surface runoff during rainy weather to the Ohio River. During dry weather, the drainage swales are dry. `The main groundwater seep area at the Riverbank Landfill was identified, RBLL1 and `sampled during the VI (DuPont, 1992). This seep likely originates from precipitation that has infiltrated topsoil or fill and flows along the top of the underlying shallow clay and ultimatelydischarges along the riverbank (see Figure 3.3). An active French-drain groundwater collection system has been in operation at the Riverbank Landfill since 1991. The RFI verified that the collection system effectively captures water at the seep area (DuPont, 1999). Surface water from the seep is treated by a carbon filtration unit. `This treated water discharges through Outfall 005 to the Ohio River. FAigsuerceon3.d3)s.eeSpeeatp twhaeteRrivaelrsboainskcaLpatnudrfieldla(t RtBhiLsLl2o)caitsiolnocbaytewdauyproifvearn farctoimveRBFrLeLnIch-(dsreaein collection system. Seepwater is contained in an underground collection vessel that is Ed Himoen08 000038 @ @ _ [] C809 Summary Report Washington Works Facility opnusmitpee.d out periodically, and the seep water is treated at the wastewater treatment facility Hydrogeology Regional groundwater supplies River alluvial terrace deposits. are obtained from the Dunkard Group bedrock and Ohio The saturated portionof the Ohio River alluvial terrace deposits comprise the principal regional aquifer used for water supply purposes. Production wells completed in this aquifer have been known to yield up to 500 gallons cpeormmmeirncuitael(wgaptme)r (sSucphpulltyzc,o1m9p8a4n)i.esBaosbetdaionnwattheesrefhriogmh tyhieeladlsl,uvniuamlearquoiufser.indTushteriyailealdnd wferlolmaasllfuovriamlataiqounifgerraiwneslilzeiarnedlattheidcktnoestsh.e well' position with respect to the river, as `ATlhoenHgotlhoecerinveersiblatnska,nidnctlhaeyvsiucinndietryloyifntghethfeorfamceirliAtynaceonrtoabiincpDeirgcehsetdiognroPuonnddsw,ataerre zsoenveesn. Gmornoiutnodrwiantgewreelllesvtahtaitonasrefocromthpelseetemdoniinttohriisnpgewreclhlesdagrreotuynpdiwcaaltleyr6zotone18(sfceeetTahbilghee3r.1t4h)a.n etlabelveataiqounifsemr.easDuurreidnginthmeonFietborruianrgy w2e0l0l2s scyonmopplteitcedwaitnerthleevuenldeevrelnyti,nggrporuinmdawryatseirte water- (elMeSvaLt)iotnos5i8n3t.h4e6pfeeretchMeSdLw.atGerrotuanbdlweartaenrgeedlefvratoimon5s71i.n9t1hefeuentdaebrolvyienmgeparnimsaeraylseivteelwater- ctarbolses-asqeucitfieornrfaonrgtehde afrreoamo5f5t2h.e15fo0rm5e6r6A.6n2aefreoetbiMcSDLi.gesFtiigounrePo3.n1d7ssshhoowwsinaggtehneeralized relationship between perched water table, the and Ohio River (normal pool elevation of 582.0 feet the underlying primary site water-table aquifer. MSL), the `fTachieliptryiamraeray. sTitheewastaetru-rattaebdlezoaqnueifiserapocpcruorxsimaattaeldyep3t0htoof4a0bofuetet6t0hitcok,70exfteeentdbiensg tino tthhee. surfaceof the underlying Dunkard Group bedrock. completed in the site aquifer yield 200 to 450 gpm. The on-site production water wells The underlying Dunkard Group is wnohticahmcaojnosrisatqsuipfreir.marTihlyeoufppshearlzeoannedofstilhtestoDnue,nkbaorudndGsrtohuepl(oWwaesrheixntgetntonofFotrhmeastiitoen), aquifer. Natural recharge to the alluvial aquifer comes from various sources, including: Q Infiltrationofprecipitation falling directly on the alluvium Q Lateral movement gavel zones of the iver water through the alluvium via permeable sand and Q Seepage from stream tributaries that discharge to the Ohio River h`Tyhderamualixcicmounmneactmioounnttoofthweartieverr.avaTihleabdleegtroeetohefahlyldurvaiuulmicdecpoennnedcstoinonthiseadefgurnecteioofnof the. apenrdmehaybdrialuiltiycagnrdadtiheinctknbeestsowefenthethreigverrobuendd,wpaetremreaabnidlitthye arinvder.thiPcuknmepsisonfgothfeona-lsliutveiaucmt,ive: well fields near and parallel to the river i.., the Ranney Well, the DuPont-Lubeck Well aFlileulvdi,alanadqutihfeerEatsotbWeellolw Friievledr ssthagoew.n TihniFsigiunrdeuc3e.s3)waltoewrerfsrtohmetghreoruinvdewrattoefrlloewveilntiontthhee WVinCingEionDDaE Say ete Fb G 5 1 000039 C80sta Summary Report Washington Works Facility [J alluvium toward the wells, which helps sustain high-yield pumping replaces wells. water pumped from storage in the aquifer, and IDnuaPo1n9t9-0LuhbydercokgWeeollolgFiiceladssaensdsmtehnet,EapsrtodWuecltlioFniewledlwlasspeccoinfidcucctaepda.citTyhetersetsiunlgotfs twheer:e uaqsueidfetro (cDalucPuolnatt,e t1h9e90t)r.ansImnitshseivviitcyinaintdy tohfethhyedDruaPuloinct-coLnudbuecctkivWiteyllofFitehled,prtirmanasrmyissistievity vthaeluveiscirnaintygoefd btheetwEeaestn W1e1l4l,9F0i0eladn,dth1e2t7r,a5n0s0migsaslilvointsypvearludeasyrpaenrgseqdubaertewfeoeont (1g6p,d/0f5i0%)a.ndIn 5va0l,u0e0s0 fgoprd/tfhte'.EaHsytdWrealulliFcieclodn.duFcotrivwietlylsvaAluXe1s3w-ePrWeOcIalcaunldatAeZd1f3r-oPmWtOhLe,trtahnesmhiysdsriavuiltiyc c0o.n0d1u1c0ti0v.i0t4y9vcalsueecs,rarnegsepdectfirvoemly.0.013 to 0.055 centimeters/second (cm/sec) and from Uvasliunegstdheetheyrdmrianueldicfrcoonmdgurctoiuvnidtwyatvaelrueelsefvartoimontsheme1a9s9u0rsetdudiny a1n9d90thaendhyadrsasuluimcignaragndient seefvfeerctailveweplolropasiirtsy vwaalsuecaflocrulsaatnedd.anTdhgergavreolunodfw3a5te%r,ftlhoewgvreoluoncidtwyatwearsfelsotwimvaetleodciatty for pSorfteieto/nodafyt(hfeVds)iteb.etAwegernomuonndiwtaotreirngfwleolwvlesloTc1i3ty-oMfWO3IldanwdaLs1e8s-tiMmWaOte!d ibnetthweeesnouthwest `InmotnhietocraisntgewmelplosrtPiOonGo-fMtWheOIsitaen,daKg1ro4u-nMdwWaOt1erinfltohwe vweelsotceirtny coenftr2a.5lfpdortwiaosn eosfttihmeatseitde for the site aquifer between monitoring wells AL10-MWOI and AC0S-MWO! oO Groundwater Flow dAastapaarntdofwtelhlecCo-nstprlucutmieondedlaitnaeawtaisoncwomoprlketpeldan., Tahtihsoervoaulguhateivoanludaettieornomifnweedltlhasturinvceoyrrect minecalsuudreidnginptohientmoelnetvhaltyioannsdwqeuraertuesreldy imnoncialtcourliantginrgepgorrtosu.ndSwiantceertehlisevdaitsicoonvserthya,tahllad been ginrotuhend4wQa0te2rCe-l8evmaotniiontocrailncgulraetpiorotn.s hIanvaedbdieteinonr,edthoenegraonudncdowrarteecrteedlevvaaltuieosnwmearpe fionrcluded `Fweebrreuainrcylu2d0e0d2,,htahsebmeoesntrreevciesnetdgursoiunngdtwhaetecorrmreecatseudrignrgouenvdewnattwehreerleevaaltmioosnts aalnldsiitseswheolwlsn in Figure 3.18. site Overall, the revised map did not alter groundwater flow directions on- Foni-gsuirtee 3a.r1e8stsrhoonwgslygirnofulnudewnactederbeyltehveatOihoinsoaRnidvefrloawnddibreyctpiuonmsp.inIgt aolfsoons-shiotwesprfoldouwctraitoens weellelvsa.tioNnoorfmatlhepporoilmealreyvasittieonaqfuoirfetrh,e iOnhdiicoatRiinvgeraisgra5d8i2e.n0t fferetomMSthLe,rihviegrhteor tthheanprtihmeary swietlelawquhiifcerh.puTmhpeson8-0s0itteopr1o,d0u0c0tgiponm;wetlhlessienvcelnudweeltlhse iRnatnhneeEyasWtelWle,lal rFaideiladl,cwohlilecchtoprump 2abcooumtb7i0n0edgpavmecroamgbeirnaetdco. fA2,0g0r0ougnpdmw;ataenrddtihveidfeiveexiDsutPs oinn tt-hLeucbeentcrkalweplalrst,ofwthhiechspteumwpi.th `digvrioduendawnadtetroftlhoewwiensgttoonthtehecawsetsttoewmarsdidtehoefEtahset Wdievlilde.FieGldroounndthweatcearstoenrtshiedewoefsttehren side ofsotuhtehwdeisvtidteowualrtidmtahteelDyufPloonwts-eLiutbheerckbaWcekltlo Ftiheeld.norFtrh otmowtahredntohrethRwaensnteerynWceolmleroorftotthhee VWiriAngonD,NoOtFaSKunCy--:tox 8folFeb5.03 - 00004= 0  a @ C-8 Data Summary Report Washington Works Facility site, groundwater flows southeast toward the DuPont-Lubeck Well Field. The revised groundwater model supports the interpreted groundwater flow direction generated using groundwater elevations measured in the monitoring wells (DuPont, 2003a). As discussed in Section 3.4.2, the vertical gradient between groundwater in the sand and gravel and in the underlying bedrock has not been verified, although preliminary evaluationofavailable data indicates a predominantly upward gradient especially near the river that potentially may be reversed near the groundwater mound/divide located under the central and eastern portion ofthe facility (see Figure 3.18). The revised groundwater model supports an upward groundwater gradient between the bedrock and the overlying sand and gravel (DuPont, 20033). Further data are needed to complete this evaluation and will be collected during future quarterly groundwater `monitoring events. Water Quality Groundwater Quality `The available C-8 concentration data for groundwater at the site was presented in Section 3.3.1. These data show that concentrations of C-8 in the groundwater are variable with the highest concentrations being measured in wells screened in the perched water-table located near the former Anaerobic Digestion Ponds. Historic C-8 concentrations in these `wells range from less than 100 to 84,100 ug/l. Groundwater from wells screened in the primary site water-table aquifer has much lower C-8 concentrations than those screened in the perched water table. In addition, C-8 concentrations are variable depending on locationof the monitoring well with respect to the locationsofthe pumping wells. Historic C-8 concentrations in wells located in the eastern haoflthfe facility range from 0.071 to 2.82 ug/l. Historic C-8 concentration data for wells located in the western portionofthe site are higher, ranging from 0.117 to 51.2 ug/l. Available data for the `bedrock aquifer are very limited but range from 0.133 ug/l in the eastern portionof the site, to NQ along the central southern boundary, to 21.2 ug/l in the area near the former Anaerobic Digestion Ponds. `The C-8 concentrations in groundwater from the monitoring wells screened in the perched water-table is not considered to be representativeof the primary site water-table. aquifer. Based on measured water elevations in the wells, the perched groundwater in the fine-grained silts and claysof the Holocene overbank depositsis mostlikelymigrating downward into the underlying site aquifer. The rateofmigration of groundwater from the perched water table to the underlying site aquifer is likely to be very slow because of the fine-grained sediments present in this area. Therefore, the contributionof the C-8 from the perched groundwater to the overall site groundwater quality is likely to be `minimal. In addition, the groundwater at the site is currently captured by the facility production wells. Groundwater elevations at the site show that the site aquifer is recharged from the Ohio River and that groundwater at the site does not discharge from the site aquifer to the river. C-8 concentrations in groundwater pumped at the site and used for potable or industrial `purposes are significantly below the C-8 SL of 150 ug/l established by the CATT (WVDEP, 2002). For example, production well AMO7-PWOI (historically known as R RESO g imoien 02 000041 80st Summary Report Washington Works Facility well 336) supplies AMO7-PWOI have potable ranged water from to the facility. 0.071 (J) to 1.9 C-8 (L) concentrations ug/L in groundwater from Surface-water Quality `STehcetiaovnai3l.a3.b1l.e CT-hecsoinxceonuttfraaltlisonmodnaittaofroerdsautrftahceefwacaitleirtyaatllthdeissictheawrgaespprroecseesnstewdatienr and slotwoersmtwactoenrcernutnroaftfitoonstohfe OC-h8i,orRainvegri.ngOfurtofmaNlsQ00to38a.n5d6 0ug0/7l.diOsucthfaarlges e0f0f2l,ue0n0t1,wiatnhdth1e05 d0i0s5chhaarsgsehhoiwgnhetrhceohnicgehnetsrtatcioonncsenrtarnagtiinognsforfomC-0.81a1n8d10ha5s4.d6isucgh/alrgHeidstaorliacraglelry,voOlutufmaellof e1f.f4l3ue1n0t9c1o5mupga/rl.edNototethtehoatthtehre o9u1t5falulgs/latmethaesufraceimlietnytwiits huncuosnucaelnltyrahtiigohnscoramnpgairnegdftrootmhe owtahsertevmaploureasrmielyaosfurelidnea.t tEhixscoluutdfianllgathnids lainkoelmyalwoaussamseaamspulreemceonllte,cttehde wC-h8encotnhceenstyrsatteimon 2r0a0ng1eainsdfr2o0m021.f4o3lltoow1i9n9g utgh/el.insTthaellaCt-i8oncoofncaenctarrabtoinonfialttrOauttiofnaltlre0a0t5mehnatssdyesctreemasiendthine fflrooumrtohpeoloyutmfearlslsp,ro9c1e5ssu.g/lC,otmoptahreiCnAgTTth-eeshtiagbhelsitshmeedastuhereAdquCa-t8iccoLnicfeentArdavtiisoonriyn effluent Concentration for C-8 criteria (Menzie-Cura (C-8 ALAC) of 1,360 & Associates, 2002). ug/l shows that all values are lower than the 3.52 Current Human Health and Ecological Exposure Pathways @ `iTmhpeacmtaionnohbujemcatnivheeoafltthheanCdontsheenetnvOirrdoenrmweants atso daerteesurlmtionferewlheeatsheesr otfheCr-e8hatso bthee.en an eLentvairrt,onamnedntDrfyroRmunD).uPoTnhetreofpoerrea,tihonusmaatnthheealfatchilaintydaencdoltohgeicaaslsoecxipaotseudrleanpdafitlhlwsa(yLsocbaolt,h coonn-ssiitdeer(eatd.theThfeacihluitmya) nanhdeaolftfh-saitned (eacdojlaocgeinctaltoetxhpeosfaucrieliptyatahnwdatyheseLcotciaolnsLbanedlfoiwlld)ewsecrrei:be tfahceiploitteyn/tLioaclaleLxapnodsfuilrle.roPuotteesntfioarlheuxmpoasnuraendroeuctoelsogwiecrael erveacleuptaotresdoann-dacnladssoifff-iseidteasthe. caonmdpelceotleogoircailnceoxmpploestuer.e pTaatbhlwea3y.s1e5vsaluumamtairoinzfeosr tthhee ofanc-isliittye.anTdoobffe-sciotnesehruvmatainveh,eaflotrh eiamcphacctoemdpalqeuteeoeuxspomseudrieapiastchowmapysa,retdhetmo athxeiCm-u8mSCL,-8recgoanrcdelnetsrsatoifomnemdeiaasutyrpee.d in the C-8 On-Site Human Health and Ecological Exposure Pathways OEnc-osliotgeichaulmraecnerpetcoerpstionrcsluidneclaundiemaaultsholriiviznegd wfiatchiliintythweorfkaceirlsitay nbdoufnadcailriiteysv.isitors. UDniirtecst(eSxWpoMsUusre)tiosCli8mitbeedaroirnngomna-teexriisatlesnctobnetcaaiunseed twhietsheinmattheeriSaollsidhaWvaestbeeeMnarneamgoevmeednt aDingdersetigornadPeodnodrs)paovrecdov(eRrievderabnadnkveLgaentdaftieldl., BIunrandidnigtiGorno,uinndst,itWuatisotnealIcnocnitnreroaltso(rss,ucahndas. fencing) and excavation permits also limit exposure. Therefore, human and ecological @ receptor pathway. contact with these materialsis considered to be an incomplete exposure WWinCingiConOOF Seyot Feb6 8 -- 000042 7 C803 Summary Ror Washington Works Facility cAonltaarcgte wpiotrthiCon-o8fitmhpeacftaceidlistoyilissocovgerroeudndwwitahtearspihsanlottalnidkecloyncirnetthee.seSaurrefaasceT-hwearteefrore, tshuerfparceeciwpaittearticoonnftaalcltiinnggonC--s8itiemipsarcotuetdedsotiolswaisrdandrianicnosmapnldetsetcoxrpmosseuwreersp,atwhhwiacy.h Much of euiltthiemratienlfiyltdriastcehsairngteo itnhteostohile oOhiruonRsiovfefr.toPtrheecirpiivetra.tioTnhefasllcienpgsotnhattheocrciuvreribnapnlkacselsopaelong tihnethreivleorwb-apnekrmareeabliilkietlyy cHaoulsoecdenbey siinflilatnrdatciolnayofovperrecbiapniktadteipoonstihtasttahcactuumnudleartleise taobposvoeiloarnd ifinllcoamlpolnegtteheexrpiovserubraenkp.atHhwuamyadnureetcoeptthoeraccotnitvaecFtrweintchh-idmrpaaicntgerdosuenedpwawtaetrercoilslaenction psyastthewm.ay DbierceacutseextphoesrueraeretoeenfgMiuneeenrtidnigsacnhadrignisntgittuhtrioonuaglhctohnetrooultsfa(lsulcihs aasn fiennccoimnpg)leitne place. fDaicrielcittyebxepcoasuusreegtroogurnoduwnadtwearteisrliomcpaatecdteadt abbyoCu-t830istaols3o8afneeitnbceolmopwlegtreopuantdhswuaryfaactet(hbegs) pnoetaerntihaelrciovnetrabcatnrkouatnedfaotr6g0rotuon8d0wafteeetrbigssviuandcoenrttahcet cweintthrawlaptoerrtpiounmopfedthefrsiotem. prTohdeucotniloyn wells. water aWnadtperrovpiudminpgedindfursotmriparlopdruoccteisosn wwaetlelrs. is used for two purposes: supplying drinking 1`oWetlhleAfMacOil7it-y.PWTOhLe oisthtehre wperloldsuctthiatonprwoevlildtehadtripnrkoivnigdewsattehre amtajvoarriitoyuosftitmheesdarrienkAiOnOgSw-ater oD iPnWtOhIe garnodunAdQwOa9t-ePrWmOo1n.itorBiencgaupslaenAfMoOr Tth-ePfWacOilIityp.rovCi-descodnrciennktirnagtwioantse,inigt rwoausndiwnacltuedred sfirgonmifAicMaOnt7ly-PloWwOe1r thhaavnetrhaenCgAeTdTf-rcosmta0.b0l7s1he(1d)Ct-o81.S9L(Lo)fu1g/5l0. ugT/hle(seWVcoDnEcPen,tr2a0t0i2o).ns aIrne `amdidxittuiroeno,favweartearge fcroonmcetnhteratthiroeneswoefllCs-)8wiilnl dbreinlkoiwnegrwtahtaenrtahtepmoianxt iomf uumsec(owncheincthraistions adectoemcpteldetien eaxnpyossiunrgelepawetlhlw.ayH.uman receptors contact with impacted drinking/tap water is VC-O8S-wPaWsOd1e,teacntdedLiOn4p-rPoWdOuIc)t.ionTwheellmsapxriovmiudmincgoinncdeunsrtraitailopnroofceCs-s8wmaetaersu(rKe1d6i-nPtWhOes1e,. dwreilnlksiwnga,sb5u1t.r2atugh/elr,fdoertiencdtuesdtriinalweplrlocVeOsSs-esPWinOcIl.udiWnagtneorn-fcroonmtatchtesaenwdelclosnitsacntoctouosleidngfor awantde/ro,r cfiorneswuamteprt,iopnroicnestshewmataenru,faccotnuvreirnsgiopnrofcoedsesmesi.nerTahleirzeediswaaptoetrenotigaelnfeorratleimsitteeadm, fcornetqacute.ncyHoowfecvoenrta,ctthaisndcobnetcaactusies heexapletchteadndtosbafeetmyinpirmocaeldduurees(0intphlealcoewardeurfaotliloonweadnd wwahteenr aworthkeinpgoiwnittohfuorsear(owuhnidcphrioscaegsasiwnataerm.ixtAuvreeroafgewactoenrcefnrtormatsieovnesroafl Cp-roduicntpirooncess wells) will be lower than maximum concentrations detected in any single well oAnniedceonltoigfiycianlg ewvhaeltuhaetriosnigcnoinfdicuacnttedecaoslopgairctaolfrethseouRrcCeRsAmaFyacibleiteyxpIonvseesdtitgoatsiitoen-rfeolcautseded ) @ scounrsfiaicteuesonitls artetlheeasReidvferrobmantkhLeaSndWfMilUlsDi(gDeustPioonnt,Po1n9d99s).waTshithseoenvlaylupaottieonntciaolncelcuodleodgitchaalt `exposure medium within the RFI study area. However, topsoil and a vegetation cover pane ee Tr -- = 000043 80a Summary Rort Washington Works Facility prevent human and ecological receptor contact with surface soils (i.., 0 to 1 feet). @ Therefore, the contact with surface soil at the Riverbank Landfill Digestion Ponds is an incomplete exposure pathway. Surface-water contact with C-8 impacted sols or `groundwater is not likely because the Waste Incinerators and Buming Ground SWMUs are covered with gravel, asphalt, or buildings and do not provide ecological habitat. Subsurface soil (greater than 2 feet) and groundwater are not exposure mediaofconcern for ecological receptors, and groundwater does not discharge to surface water at the sit. Therefore, contact with surface water or groundwater or subsurface soil is considered an incomplete ecological exposure pathway. Off-Site Human Health and Ecological Exposure Pathways. gOfrfo-usnidtewahtuemrawnelrlecaenpdtowrasteirnc-luusdeesruersviedye.ntEscuoslionggictahle rweacteeprtosrosuricnecslusdaemlpilveedstdoucrkiunsgitnhgethe water sources sampled during the groundwater well and water-use survey. West Virginia One- and Two-Mie Radius Groundwater and Surface Water iDinrceocmtpleextpeospuartehwtoayC-i8n siimtpuaactitoendsswuhrefraceetwhaetweartearndsogurrocuendiswantoterusiesdc.onTshideepraedthtwoabyeiasn considered to be a complete pathway in situations where the water source is used but the `wmaitneimrails.noTthuesehdigfhoerstdrCi-n8kicnogn-cweantterratpiuornpoisneas,noanl-tdhroiungkhitnhge-weaxtpeorsusraempils ecownassid5e.r0e7dutgo/lb,e o iwselulsebdelfoorwdtrhienkCi-n8g-SwLatoefr1p5ur0pougs/el.s. TThheepahitghhweasyt Cis-cocnosnicdeenrterdattioobnemceoamspulreetdeiifn dtrhienwkeinlgl. water was 2.8 ug/l, significantly lower than the CATT-established C-8 SL of 150 ug/l (WVDEP, 2002). Therefore, even though the pathway is complete,i also is considered to be limited due to the low C-8 concentrations measured. An evaluation of ecological exposure to groundwater and surface water shows that there pisurapcoosemsp.leWtietphaitnhtwhaeyWfeosrtexVpiorgsiunrieatooneli-vaesntdoctkiwof-tmhielseerwaadtiuesr,stohuerchiegshaerset ucsoendcefnotrratthieosne of C-8 measured in water tht was specifiedas a non-drinking-water source used for elicvoelsotgoicckalisre5c.e0p7tougr/sl,iswleilmlibteedlodwuethteo tChAeTTl-oewstCa-b8lciosnhceedntCr-a8tiSoLn.s mEexapsousreudr.e of C-8 to Ohio One- and Two-Mile Radius Groundwater and Surface Water iAnscosmtaptleedtienttohceopmrpelveitoeusdesepcetnidoin,ngthuepeoxnpwoastuerre upsaet.hwWaiythfionr tghreouOnhdiwoatoenre-vaarnidestwfor-ommile radius, the highest drinking-water C-8 concentration measured was 8.59 ug. This tchoencpeantthrawtaiyonisiscosnisginidfeirceadnttloybleowceomrptlheatne,theexpCo-s8uSrLeaolfso15is0cuogn/sli(deWrVeDdEtoP,be20li0m2i)t.ed.WhTihlee tphaetohnwea-ymiislecormapdlieustewafosrssaumrpflaecde.waHtoerwebveecra,usteheonCe-8spcroinncgeuntsreadtifoorn dirsilnokwi,ng1.w2a9teugr/lw,ithin compared to the CATT-established C-8 SL. @ iAsnaecvoamlpulaettioenpoaftehcwoalyogfiocraelxepxopsousruer1e0tloigvresotuoncdkwiafttehresaendwastuerrfascoeurwcaetserarsehuoswesdtfhoart tthheesree purposes. Within the Ohio one- and two-mile radius, no water sources identified as a WCimin3glon,OnDaE Sumy ot rl Feb 5,03 2 000044 C8 0at Summary Report Washington Works Facility cdornicneknitnrgawtaitoenrmoerasnuorn-eddriinnkainnognw-adtreirnkwienrge-wuasteedr fsoarmplilvee,stwohcik.chHmoaweyvbeer,ustehde hfiorghest C-8 livestock, was 23.6 ug/l. `Ohio River Water Direct exposure to Ohio River water is a complete pathway, although the exposure is wcoantseirdiesreudlttiomabteellyimtihteerdebcehcaarugseesoriuvrecrewfaotrePr WisSnoatlodinrgectthleyOuhsieodRfiovredrr.inHkoiwnegvweart,ert.heRiver highest C- concentration in the Ohio River water, 1.09 ug/l, is well below the C-8 SL. Public Water Supplies `The highest C- concentration measured in connection with sampling related to PWS along the Ohio River was measured in a test well at Little Hocking Water Association, Ohio. However, this concentration does not represent the concentrationofC-8 in drinking water supplied to the public. The highest C-8 concentration measured in the drinking water from the Little Hocking well field was 4.29 ug/l. Compared to the CATT- established C-8 SL of 150 ug/l, this concentration is significantly below that level (WVDEP, 2002). The human health exposure pathway for groundwater from the Little: Hocking well field water purposes. is complete because the water is used for drinking and non-drinking- 3.6 Washington Works Facility Summary Many different activities were conducted at and around the facility in order to determine whether there has been an impact on human health and the environment as a result of releasesof C-8 to the environment from DuPont operations at the facility. The C-8 concentration in groundwater and surface water from many sources (on-site, off-site, PmoWnSi)towriansgmweealslus,repdr.oduMcotrieonthwealnl6s,70prsiavamtpeleweslwlse,resparnianlgsy,zecds.teBmass,edrivoenrawlalotfert,haenddata evaluated for the Washington Works facility, the following observations were made: Q The current exposure pathways are incompletefor human and ecological receptors contact with the following C-8 impacted media + Onsite SWMUs Onsite soil Onsite surface water Onsite groundwater Q In addition, the current exposure pathways are incomplete for ecological receptors contact with the following C-8 impacted media: On-site drinking water Onsite process water Q Current on-site human receptors contact with C-8 impacted drinking water is a complete pathway. However, this pathway is considered to be minimal because S the highest C- concentration measured in drinking water at the site was 1.9 WOatC Summary `Waminglon, OE ttn Fen 5.03 --2 000045 C8 0ut Summary Report Washington Works Facility ((LW)VuDg/ElP, ,sig2n0i0f2i)cantly lower than the CATT-established C-8 SLof 150 ug/l Q cCuormrpelnetteonp-astihtweahyu.maHnowreevceeprt,ortshicsopnatatchtwawiytihs Cc-on8siimdperaecdtetdo pbreomceisnsimwaaltebreicsaualsseo a aheraolutnhdapnrdocseasfestwyatperro.ceTduhreeshiagrheesint pCl-a8cecoanncdenftorlaltoiwoendmwehaseunrewdoriknipnrgocweistsh woarter at the site 150 ug/l. was 51.2 ug/l which is lower than the CATT-established C-8 SL of Q cCuormrpelnetteofbfu-tsimteineixmpaols,urdeuepattohtwhaeyvserfoyrlhouwmCa-n8acnodnceecnotlroagtiicoanl mreecaesputroerds,tihantclaurdee sreosuirdceenst,iaalndanOdhpiuoblRiicvedrriwnaktienrg.-wFaotrerthseoudrrciensk,inregs-iwdaetnetriaslounrocne-sd,ritnhkeihnigg-hweastteCr-8 ncoonnc-ednrtirnaktiinogn-wmaetaesrusroeudrcweass, t8h.e59hiuggh/el,stweCl-l8bceolnocwentthreatCi-o8n SmeLaosfur1e5d0 wuga/sl. For the. R23i.v6erugw/alt,erw,hitchhe ihs igshiegsntifCi-ca8ntcloyncleonwterrattihoann wtahes C1-.809SuLg/olf a1g5a0inug/sli.gniFfoircaOnhtliyo Tower than the C- SLof 150 ug/L Q tThhaet ncuororfefntsirteevimsiegdragtrioounnodfwagtreorunmdowdaetlersuipspkonrtoswDnutPoobnet'osccpurrerviinogusancdontchlautsnioons potential groundwater migration pathway exists beneath the Ohio River. Q The current groundwater modeling observations combined with the current C- tchoantceanirtrtartainospnosrotobsferCv-e8diisntgheropurnidmwaartyerm,igsruartfiaocen-pwaattehrw,aaynfdorPCW-S8 finroOmhitoheifnadciiclaittey ltiokaedlyjatcoenbteamroebasi.lizCe-d8btyrapnrsepcoirptietdatiinonaiarnedmimsisgiroantse avniad wdaetpeorsittreadnsopnorsturtofascuersfaisce water and/or groundwater. Q dAiisrcthraarngsipnogrttohfroCu-g8h ifnaaciilrietmyiosustifaolnssianntdo twhaeterrivterraanrsepobretloifevCe-dtodibreectthley sources of wCaitenr wtahse O1h.0i9ouRg/ilv.er.ThiTsheC-higchoensctenCt-r8atcioonnceinstsriagtniiofnicmaenatlsyurleowdeirntOhhainothReivCeArTT tehsetaObhliisoheRdiCv-e8rsAlLiAkeClyotfo 1b,e3t6h0eusg/olur(cMeeonfziCe--8CuinraP&WSAslsooccaitaetdesd,ow20n0s2t)r.eaCm-o8fitnhe. facility. Q gSrWouMndUwsateonr-.sitAeirardeisbpeolsiietvieodntoofbCe-8theonprtihmeagrryousonudrscueroffacCe-c8ommibgirnaetdiownittoh surface. water transport to groundwater also may have occurred. Q cTohnececnutrrraetnitognrsooubnsdewravteedrimnogdreoluinndgwaotbseerravtattihoenfsacciolmitbyianlesdo swuiptphotrhtepcoutrernetniatlC-8 gmirgoruantdiwoantoefr Cv-ia8 wfartoemrCtr-anscpoonrttaining materials in the SWMUs directly into WTimAigCon,DOaFt Summary ot Fb 5.03 ~ -- 000046 = C8Data Summary Report: Local Landfill @ 4.0 LOCAL LANDFILL 4.1 Introduction c`oThnseiLsotcsoafl Ltahnrdefeilslepiasraltoecactleodsiemdmceedllisa.teTlhyestohurteheocfeltlhseoWpaesrahtiendgtfornomWo1r96k4stfoactihleitmyiadn-d 1980s under WV/NPDES Permit No. WV0076538 (see Figure 4.0). When the cells were closed, the cells were covered with approximately 2 feetoflow permeability soil and vegetative cover. Consent Order required tasks to be conducted at or immediately adjacent to the Local Landfill included the following: Q Task A: Groundwater Well and Water-Use Survey and C-8 Sampling--conduct a distance-phased groundwater well and water-use survey identifying and sampling all groundwater wells, springs, and cistemns within a one-mile (and possibly twoand three- mile) radial distance of the facility and the Local Landfill Q Task B: AssessmentofExisting Groundwater and Surface Water Monitoring Data--conducting monthly samplingfor C-8 at Local Landfill at certain outfalls identified in WV/NPDES No. WV0076538 as Outfalls 101, 004 (Old), 004 (New), 005 (OIdY'SS-1, and 005 (New). C-8 samples were to be taken from all the wells at the Local Landfill monthly for the first four months and quarterly thereafter. QQ 9 Task C: Plume Identification/Groundwater Assessment determine the vertical and horizontal extent ofC-8 impacted groundwater at Local Landfill exceeding 1 ug/l or as directed by the GIST. In Sections 4.2 through 4.4, discussions are presented of the specific activities conducted to meet the requirementsof the Consent Order along with the resultsofthe sampling activities. In Section 4.5, the revised site conceptual model that better represents the current environmental setting (geology, hydrology, hydrogeology, groundwater flow, and `water quality) and current human health and ecological exposure pathways for the conditions at and surrounding Local Landfill is presented. 4.2 Task A: Groundwater Well and Water-Use Surveying and C-8 Sampling `The Washington Works facility is located immediately north of the Local Landfill. Becauseofthe proximityofthe facility to the Local Landfill, groundwater wells located within the combined one-mile radius (ofboth sites) in West Virginia were sampled. The results for the groundwater well and water-use surveying and sampling for the facility and the Local Landfil are presented in Section 3.2.1 and 3.2.2. Briefly summarized, expansionofthe one-mile radius was required by the GIST because the C-8 concentrations in five drinking-water samples within the one-mile radius were above the ; 1 ug/l threshold level. Within the two-mile radius, only one drinking-water sample had a @ C8 concentration above 1.0 ug/l. The results for the two-mile radius showed a trend toward lower concentrations than in the one-mile radius. Based on these results, and the VWiOgWtKoCnE,GoOaF Summa~rynt Feb 5.09 % 000047- 90 Summary Rept Local Landfill o e1s5t0abulg/ilshbmyentthoefCtAhTeT,hutmhae nGIheSaTltdheptreortmeicnteidvethsactreneonifnugrtchreirteorfifa-sfiotre wsautrevrey(iCn-g8aSrLo)unodf the facility and the Local Landfill was needed 4.3 Task B: Assessment of Existing Groundwater and Surface-water Monitoring Data 43.1 Monitoring of C-8 in Groundwater and Surface Water Groundwater Monitoring "The Consent Order required that all monitoring wells at Local Landfill were to be: sfaolmlpolweidngfotrheC-e8f.fecTthievefdraetqeueonfctyheofCosnasmepnltinOgrdwears, ttohebneqmuoanrttehrllyy ftohrertehafeiefirr.st MfoounrthmloyntCh-s8 sampling ofgroundwater began in December 2001 and quarterly sampling began in May `2g0r0o2un(d2w0a0t2e)r.moTnaibtloer4i.n0gpprroovgirdaems afolrisLtoocfalthLeanmdofniillt.oriWnegllweclonlstirnuccltuidoend ainndthgeroundwater elevation data also are provided in Table 4.0. Al the time monitoring started, only four `LmLoMniWt-o1ri0n.g weAlnlostheexirstfeivdeawteLlolcsawleLraendifnisltla,llLeLd MduWr-i4ng,3LQL0M2Wa-s6p,arLtLofMtWh-e9C,-8anpdlume idnel4iQn0e2a.tionFiwgourrek4p.l1ans,haonwdstthheeselowcealtlisonwoefrethiencmloundietdoriinntghewemllosn.itToarbilneg p4.r1ogprreasmensttsartthieng C-8 concentrations measured in these monitoring wells, including C-8 data acquired prior od to the issuance of the Consent Order. The most recent data are listed firs for cach wel Aintctlhuedepdreisnetnhtetmiomen,itoonrliynggepnreroaglraombsbeercvaatuisoenosfctahne bleimmiateddedfatraomsett.heAfdidvietwieolnlasl recently groundwater monitoring data will be obtained during the 1Q03 event. However, for the rfoeusrulwtelflosr twhiethnemuwltwieplllesCc-a8n mbeeacsoumrpeamreentds(,0stohemehiosbtosreircvaaltdiaotnas acvaanilbabelem.adeL,LManWd-4th,e LLMW-6, and LLMW-138 show the highest C-8 concentrations ranging from 1.32 to 79.6 ug/l. Shallow, overburden well LLMW-11A, only sampled once, had a C-8 croanncgeinntgraftrioomnNoDfto2.221.u1g/2l.ug/Tlhe other five wells at the landfill have lower concentrations, q"Tuhaertneerx2t0g0r3oundwater-sampling event for the Local Landfill is scheduled for the frst Surface-water Monitoring "The Consent Order also identified three outfall at Local Landfill (regulated by WV/NPDES Permit No. WV0076538) where monthly C-8 sampling was to be performed, Outfalls 101, 004 and 005. Monthly sampling of these three outfalls began in pDreocgermabmedru2e00t1o.a mIondMiafirccahti2o0n0o2f,tthweoWaVdd/iNtiPonDaElSoutpfearlmlist.wer[Tehaedndaedmetso otfhtehmeontiwtooroinfgt.he } oruetnfaamleldalOrutefaadlyli0n0cl4u(de1dd)i,n tnhoet mtoonbietocroinnfgusperdogwritahm Owuetrfealmlo0di0f4ie(dN.ewO)utafnadllOu0t0f4alwla0s05 @ was changed to Outfall 005 (Old)/SS-1, not to be confused with Outfall 005 (New).] CWirinSgon.O0% Soma iota Fan 80 000048 7 C809 Summary Raper _ Local Landfill 0Fi0g4urouetf4.a1llsshmoownsittohre alosctarteiaomnsoofntthheenfoirvtehosuitdfeaollfstihnethperompoenrittyoarnidngtphreotgwroam0.05Tohuetftalwlos `monitoar stream located on the westem sideof the property. Bothofthese streams discharge stormwater runoff from the landfill. Surface water in the two 004 outfalls ultimately discharge to Pages Run, which crosses the facility and enters the Ohio River. uSlutrifmaacteelwyatdeirscihnatrhgeestwthor0o0u5ghoOuuttffaallll c0r0o3ss1e0stthherOouhgiho tRhievefrac.ilOituytfinalst1o0r1m,wlaotceartepdipaelsonagnd ctohenvneorytshesaesetppweartiemretaenrdoflteahcehaltaendffrilolmparospeerriteyso,fitshlroeceathedolidninagplpaosntidcssleowceatrepdiopen tthhaetcast s1i0d1eoisfctohenvleaynedfdilvlicaetlhlse sinewadedriptiiopne ttoo sttheorWmawsahtienrgrtuonnoffW.orWkastefarciplaistsyianngdtuhlrtoiumgahteOluytfall pdoiisncthatrhgaetsmtohnriotuogrhs Oluetafcahlalte00en1teirnitnogthPeonOdhi2o, oRinveeor.f tLheMIhol(dLienagchpaotned)sisthaasutrhfeanced-iwsacthearrge through Outfall 001. LM! (Leachate) and is monitored bi-annually for C-8. `Table 4.2 provides the C-8 concentration data for the outfalls, including C-8 data acquired prior to the issuing of the Consent Order. The most recent data are listed first bfoergienancihnogoutffatllh.e COu-t8famlolni1t0o1riisngthperoonglryamo.utfTahlletohtahtehrafsoucornosuitsftaelnltslyhahvaedhfaldownos-ifnlcoewthe ocfonCd-i8tiionnsboftohr t0h0e4poausttftahlrleehamvoentbhese,nmionsttheli1k0el-y15duueg/ltortahneged,rowuhgihlte. tThehecocnocnecnetnrtartaitoinonisn. the both 005 outfalls a wider rangeofC-8, have been higher, in from 12 to 115 ug/l. the 20 LMI to 50 ug/l range. Outfall 101 has shown (Leachate) has had the highest C-8 concentration at Local Landfill (120 ug/). bOuetifsaslulesdatmopltihengGIfoSrTDiencFeembbreurar2y002020h3a.s Obuetefnalclomspalmeptleidn,gafnodr Jtahneumaornyi2t0or0i3ngharsepboeretnwill scoammpplleitnegde,vbeuntttihsescCh-edurelseudltfsorhaFveebrnuoatryyet20b0e3.en validated. The next monthly outfall 4.4 Task C: Plume Identification/Groundwater Assessment (BDausPeodnto,n 2th0e02dba)t,atghaepCs-idePntliufmieedIidnetnhteifCiocmaptiilona/tGiroonuonfdHwiastteorrAicsaslesCs-m8enDtatWaorrekpoPrtlan was adcetvievlitoipeesdreancdomsmuebmnidtetdedto10fitllhethGeIdSaTta(gDaupPso.ntI,n 2t0h0e2f)o.llTohwiisngwsoercktipolnas,n ciancchluodfedthsepecific oafctitvheitiaecstirveitcyosmtmaetunsdaendditnhethdeaCta-8acpqluuimreeddaerleintehaetniopnrewsoerntkedp.lan is summarized. Details 4.4.1 C-8 Monitoring in Groundwataenrd Surface Water at Local Landfill bCeodnrtoicknuaiqutnigofemro(nuittiloirziCn-g8thien ngerwolunydiwnasttaelrleidn mtoheniotvoerribnugrdweelnlsa)n,dainndtihnesuunrdfearcleywiangter at Cex-i8stpilnugmleocdaetliionnesatidieonntiwfoiredk ipnlatnhe(CDounPsonetn,t 2O0r0d2er),.waTsheanreascutlitvsiotfycroenctoimnmueenddmeodniitnotrhieng _ @ ogfrgoruonduwnadtweartecronatnidnuseusrfoanceawqautaretreralrye bparseisse,ntwehdilien sSuercftaicoen-4w.a3t.1e.r mMonointiotroirnigngofofC-C8-isin conducted on a monthly basis. WinCioCgoSnG,a0t8a Summary exfrFo5b.05 -- -- 000049NE 8012 Summary Reson Local Landfill 4.4.2 Surface-water Field Reconnaissance at the Washington Works Facility @ t`hCeonLdouccatlinLganfdifelidllreacnodnnsaaimspslainncgestuorfiadcenetwifaytearddfirtoiomnnaleswurlfoaccatei-ownasteirdefnetaitfuireedsdluorciantgedthaits pefefrofrotrwmaesd,aaCn-d8npolnuemew dseulrifnaecaet-iwoanterrecfeoamtmreensdweedreactiidveinttyi.fieFd.ield reconnaissance was 4.4.3 Installation of New Wells at Local Landfill `iTnhteheinCst-a8llpaltiuomneofdefloiunreaatdidointiwoonarlkwpellalnctlousftuerrtshe(rovceharrbaucrtdeernizaentdhebebderdorcokc)kwsatsraptriogrpaopsheyd `ugnrdoeurndtwhaetseirte,fltoowfudrirtehcetriodne.linOenateewCe-l8l ccolunscteenrt,raLtLiMonWs-i1n1grAouandnwdaBt,era,ndantdhrteoeebveadlruaotcek owevlelrsb,uLrdLeMnWw-e1ll2sBw,erLeLnMoWt-i1ns3tBal,leadnadt tLhLreMeoWf-t1h4eBpwroeproesiendstwaelllledcdluusrtienrgl3oQc0at2i.onsThe sbehcoawussethveelroycalittitolensoovfearlblurmdoennitwoarsinegncwoeullnstearetdheanLdoctahle oLvaenrdbfuirldiennclwuadsindgryt.heFliogcuarteio4n.s1 ofthe newly are provided installed monitoring in Appendix B. wells. Well construction diagrams for the new wells, o`fThseugbesoulrofgaiccealcolnodgistifoonrsthaet tfhievesiwtee.llsIinngsteanlelreadl,ins3omQe02thciocnkfniersmsofprcelvaioyuasnidntweeraprtehtearteidons cboendsriosctkso(fshaalltee,rmsaatnidnsgtolnaey,erasnodf/sohraslieltsatnodnel)ayiserusnodfesrlaanidnstboynuemwaenda/tohrerseildtsbteonder.ocWk,hewrheicthhe oO `dTahtea nweewregaevoaliolgaibclael, ditatcaonwfeirremeudsetdhatto trheefilniethtohleoggiecolunoigtisc diinptesrlpirgehttaltyitonowuasredd tfhoer ntohreth. revised SCM, which is presented in detail in Section 4.5.1 4.4.4 Local Landfill Site Conceptual Model Refinement d`Tahtea fgiantahlerreedcodmumrienngdceodmpaclteitviiotynofforTtahsekLsocAa,lBL,anadnfdilCl iwnatso athreeviinsteegdrSatCiMo.n ofThalilstahcetinveiwt.y has been completed, and the revised SCM is presented in the following section. 4.5 Revised Site Conceptual Model hTyhderorleovgiyse,dhSydCrMogeboetltoegryr,epgrreosuenndtwsattheercufrlrowe,ntaenndvwiarotnemreqnutaallitsye)tatinndg c(ugreroelnotgyh,uman Lhaenadlftihlla.ndTehceolfooglilcoawlienxgpsoescutrieonpsaptrhewsaeynts tfhoer rtehveicsoenddSitCioMnsinatdeatnadil.surrounding the Local 45.1 Current Environmental Setting Geology RInic1h9a8r9d,soeingh(tLmLoMnWit-o1ritnhgrwoeulglhsLwLeMrWe-i8ns)t.allHedowaet vteher,LofciaveloLfatnhdelsel mboyniTtetorrawTelelcsh @ t(hLeLwMeWll-s1w,eLreLMscWr-e2en,edLLinMtWh-e3d,isLcoLnMtiWn-u5ou,sasnhdalLlLowMWcl-a7ys)awnedruencdleorsleydinign w1e9a9t6hbeerceaduse: WWiImGiSngonS,Oo0o2 ra tora F5 b 0 --00050 =n  @. [2] C80ata Summary Report Local Landfill bLeLdrMoWck-.9LaLndMWL-L8M,Wa-1be0drwoecrkewienlslt,alwlaedsicnlo1s9e9d5iannd199179.97,Twreospaecdtdiivteiloyn.al LbeLdMrWoc-k9wewlalss, tihnasttawlalesd saeslaecbtaedckagsrtohuensdigwneilfli.caTnhteusnedetrwloyiwnegllasquairfeerscfroereSneWd/wNiPthDiEnSa psearnmdisttomnoeniltaoyrering. a`Tdadbilteio4n.a0lswuemllmsa,rLizLeMsWt-h1e 1weAl,l cLoLnMstWr-uc1t1iBon,dLatLaMfWo-r 1th2eBe,xiLstLiMngW-mo1n3iBto,rianngdwLelLlMs.W-Fi1v4eB were installed at Local (DuPont, 2002K). Landfill in 3Q02 as partof the C-8 plume delineation work plan `FTihgeurleoc4a.t2i.onTsowfothcrroeses-csreocstsi-osnesc,tiAo-nAs'deavnedloBp-eBd',fworertehepLroecsaelntLeadndinfitlhleaCroemsphiolwatnioinn of pHrisetvoiroiucsallyDaavtaailRaeblpeorftor(LDuLPMonWt-,920a0n2db)LLanMdW-ha1v0e.beIennadmdoidtiifoin,edLtLoMiWn-cl1u2deB,daatanneowtly pinosrttailolneodfwLelolc,awlaLsanpdrfoijlelc.teBd-oBn"trouBn-sB'n.ortAh-tAo"soruutnhs. west to east through the central Cross-sections A-A" and B-B' are shown in Figures 4.3 and 4.4, respectively. Cross-section C-C", shown in Figure 4.5, is a snheowwcirnogsst-hseegcetoiolnogtihcaatlstdaarttas oibnttahienseoduftrhoamndmarnuynosfntorhteh,naenwdlythiennstraulnlsedtmootnhietcoarsitn,g wells. The Local Landfil valleys, and lower riesliseiftuoaftaedppirnoaxihmilaltyelaryea10wi0th25hifgehetrealietfh,eulpantdofil1l00celflese.t in some The slopes appear to be a combination of natural topography with terraced outcropsof massive pslaantdcsautso.neAansdhaslilltoswt,onteiguhnt,decrllayyionvgevrabruyridnegnalmaoyuerntlsieosfatsotihlecsouvrefracaenadnmdarna-nmgeasdefrloamndf3iltlo a2n5dfefertatghmieckn.tsoTfhesacnldasytcoanne cionnstaoimnes lsoocmateiomnisn.orThseancdlyayasnadresioltfylzoownepsl,asatincditsyoamnedpaepbpbelaers ttohebsehwaellllowcocmlpaaycltaeyde,r iosftweenatdhiesprleadyishnaglae,lwaemaitnharersetdruscatnudrest(oDnueP,oanntd,/o1r99w0e).athUenrdeedrlying siltstone zone ranging from 1010 35 feet hick (see Figure 4.3). Below this weathered bedrock, at depths ranging Figures 4.3, 4.4, and 4.5). from 21 to 40 feet bes, competent bedrock is present (see c`Tahlecabreedoruosckshaaltet,heanLdocgaraly,Lagnrdefeinl,l aconndsibsrtosowfnisnatnedrs-tboendedeadndresdilatnstdonveaorfitcohleorPeedsraminadnyoagre Dunkard Group. Cross-section B-B" (see Figure 4.4) shows that the sandstone layers dip sgternattliygrtaopwhaircdsetchteionnoratrhe. lMenotsitcoulfatrhaendsalnadtesrtaolnlye dliasyceorsntlioncuaotuesd.inHotwheevueprp,erfpoourrtliaotneoraflltyhe. (csocnetiFniugouursessa4.n3d,st4.o4n,eaanndd/4o.5r).silTthsteosnee wlaayteerrs-abreearlioncgatuenditisnatrheerleofwererredsttroataisgrAa-phZiconsec(ttiheon "luanbedleerdlyoinngthseigcnriofsisc-asnetctaiqouinfsear"n)d,aBr-eZdoinsec,usCs-eZdonine,detaanidl Di-nZtohneeh.ydTrhoegseeolfooguyr szeocnteisonartehat follows. Hydrology, Hydrogeology and Groundwater Flow Hydrology In general, infiltrationofprecipitation is limited due to the very low hydraulic conductivity (5 x 107 cm/sec)of the surficial clays (where these clays exist) and the WWiWmKinCioSn,DuOaFSamay te tealFeb 5.05 000051 30 800 SummaryRepent Local Landfill iwsealtimhietreeddbbyedarsoucrkfa(cDeucPoovnetr,t1h9a9t2i)n.clIundeasddaiptpiorno,xiimnfaitletlrayti2onfoeeftoprfecliopwitapteiromneaibnitloitthyescoeillls and vegetation. oStnoerlmocrautneodfofnfltohwessoinuttohetrwnossitdreeoafmst,heonperolpoecrattye.d Sounrfthaecenowrattheerrninstihdeeosfetthweo sprtorpeearmtsyiasnd s`miodneisttorreeda.m aOnutdfOalultsfa0l0sS(0O0d4)(/OSlSd)-1anadnd00040(SN(eNwe)w)momnointiotrorsusrufrafcaecewawtaetrerininthtehesonuotrht-hs-ide astnrdea0m0.5, Fionrditchaetipnagstthfaetwthmeosnethsstr,enaom-sfhlaovweconnodibtaisoensflhoawv.eLbeeaecnhaotbesefrrvoemd tahteOsuotuftahllesrn00ce4ll paonnddtsh,ePeoanstder1n,2c,elalnfdlo3w(ssfeeroFmigtuhrees4e.e1p).s iHnotwheevsetre,epduvarlilnegytwhaelrlescteontledarcohuagthetccoollnedcittiioonns o0b2s0e0r2ve,dmfalnowymseaeypsb,ewahirceshulntoorfmtahlelyddrooufglhotw,cowndeirteionnost. obLseearcvheadteflforwoinmg.theTsheepolnadcks oisf pdiipseclhianregeisdcoinntdouactpiepdelaitneO.utMfoanlit10o1r.inPgoonfdcoefmfbliuennetdispoconndveefyfeludetnthrcooungvheOyuetdfailnlth1e01 to the facility where it passes through stormwater Outfall 001 into the Ohio River. Hydrogeology dGirsocuonndtwianutoeursuunpdpeerrlylianygerthceonLsoicsatlsoLfantdhfeiclllaoycscuarnsd iunndmeurlltyipilneg swteraatthigerraepdhibceudnritosc.k aAnd has avery low hydraulic conductivity (DuPont, 1992). The lower layers consist of the continuous and discontinuous sandstone units having low permeability of 1 x 10 cm/sec. Q C`T-hZeolnoew,earnsdaDnd-sZtoonnee banads/eodrosnilrtset-oenvealluaayteirsngatrheenoolwd giedeonltoigfiicedanasd thhyedrAo-gZeoonleo,giBc-Zdoantae,and `tThheenseewfoduartzaoonbetsaianreedinwdhiiclaeteidnsotnalltihnegcarnosdsm-soencittioornisnwghtehreenveerwpwoeslslisblaet (LsoccealFiLgaunrdefsil4l.3, 4la.y4e,ras.ndW4e.l5)l. yiTehledsAf-rZoomnethethsraonudgshtoDn-eZaonnde sairletssteopnaerlaatyeedrsbyarlcatveerraylllyocwo,nrtainnguionugs shale from <0.5 gpm to 1.5 gpm (DuPont, 1992). `fTeehte ahibgohveestMlSatLer(asleley cFoingtuirneuso4u.s3,s4a.n4d,staonnde4l.a5y)earnid lisocdaetseidgnatateeldevaastitohnes"buentdewreleynin7g10-740 psiegrnmiifticaatntmoanqiutifoerri.n"g TwehlilssuLniLtMiWs -cu4r,renLtLlMyWmo-n6i,toLreLdMWse-m9i,anannudalLlLyMaWs.r-e1q0u.ireBdabsyedthoen Ath-eZnoenew oguetoclorgoipcsailndtahteawoebsttaeirnne,d,notrhtisheurnni,taanlsdoewaisltlerbnevraelfleeryrewdaltlosaosfththeeAp-rZoopreir,ty.The L`TLhMeWn-ex1t2lBo.werThsaenBds-tZoonneeunisitloiscadteesdigatnaetleedvaatsiotnhse bBe-tZwoeneenaanpdpriosxmiomnaitteolryed66v5iaand 694 fect above MSL. The B-Zone valley wallsofthe property. also should outcrop in the western, northern, and castern TLhLeMCW--Z1o3neBiasntdheLnLeMxWt-l1o4weBr.sanTdhsetoCn-eZ/soinletsitsonleocuantietdaantdelisevmaotniiotnosrbeedttwhereonugh wells approximately 612 and 640 feet MSL. LLMW-11A, located to the southof oneof the @ tlahnedfciolrlreccetllsc,lemvaatyiobnefsocrrCe-eZneodnei,n aanwdeatthehelrietdhoploorgtyitohneroefiCs-dZeosncer.ibTedheassccrleaeynoviserlloyciantgedsialtt WKCEOm Sy ea Fn 50 rimoe0% El 000052 80s Summary Res i} Local Landfill raencdenstandde.poHsiotwsevinesrt,eabdeocfauwseeatitheireldocbaetderdoicnk.a vIanllaedyd,ittihoen,clbaye,casiulsteatnhderseanids sctorueladmbe: lnoecaartbiyo,ntwhehreenisthleikseilryetaombfeloawcs.omTphoeneOnuttloeftssu0r0f4a(cOe1-dw)ataenrdin0t0e4r(acNteiwo)n,inwvhoilcvhedmoatnitthiosr this asvtarielaamb,lew,erLeLdMryWd-u1r1inAgisAucgounssti,deSreepdtteombbeerp,aratndoftOhcteoCb-erZo2n00e2.monBiatsoerdinognwtelhles.datTahe WloawsehsitngelteovnatWioonrkosn ftahceilniotrytihseadpgperooxfitmhaeteLloyca6l50LafnedctfiMlLSa.nd tThheeshoiugthheesrtneeldegveatoifonthoef iCn-dZiocnaet,inagptphraoxtihmisatzeolnye6i4s0nofteeetxMpLosSe,diastatbhoeustur1f0acfeectbultomweorrethlainketlhy,e tshuerfeadcgeeeloefvtahtiison zone contacts the alluvial material directly. `"TmhaedeD-uZpoofnseiliststthoenleoawnedstshanyddsrtoogneeo.loLgiLcMuWni-t1e1ncBouinsttehreeodn,l3y4w5eltlo Sth6a2t fweaest MdrSiLll,edadnedeips oefnothuigshuntioteinscoavuanitlearblteh.e TDh-iZsonueni;ttmhaeryefhoarev,elbteelniennfcoorumnatteiroendaabtouLtLtMhWe-la1t;erahlocwoenvteirn,uitthye ndiosttoauntccerboeptowneetnhethseusrefatcweoawnedlmlsosits 0li0keflayrctoonteaxcttrsaptohleatPeletihsetdoactean,e aTlhleuvDi-uZmodniereacltsloy dinoes the subsurface. Groundwater Flow cGlreovuantidownatceonrteoluervamtaiponss fhoarvtehebesiegnnimfeiacasnutruenddseermliyainnnguaaqluliyfesri(ncAe-Z1o9n94e.) Groundwater have been SD Fpirgeupraere4d.6frporemstehnetssetdhaetgaraounrdeqwuaitreerdcblyevtahteioWnVm/aNpPfDorE4SQP0e2rmfiotr tNoh.e AW-ZVon0e0.765A38. dgartoaunfdrwoamteLrLeMlWev-a1ti1oAn mwaaps fuosred4Qt0o2mafkoretthheisC-mZaopnbeeicapurseestehneteodutifnalFlisgmuroeni4t.7o.rinNgottehethat eslterveaatmionnesxtintothtihsewseelwlewllesreshnootwehdignholy-filnofwluceonndcietdiobnys.surifawcaeswaatsers.umeCdomtphaatriwantgerFigures sa4.m6eadnidre4c.t7isonh,owtsowtahraditnhegennoerrtahlw,esgtr.ounTdhweatdierrecitnitohneosef gtrwoouznodnweastebrasfilcoawlyinftlhoewBs-tZhoene ganrdoutnhdewDa-teZronfelocwainnnotthebsee dtewtoerzmoinneesdswiltihkeltyhetolibmeitseidmidlaatrataovatihlaatbolbe;sehrovweedveinr,A-Zone saennderCa-lZloynfel.owFnroormthatroewgairondalthpeeOrshpieoctRiivve,eralalllbuevdiralocvkalgleryo.undwater is expected to iEnvsatlaulaltatiioonnoifnfloirmmiatteidognr)oiunnddiwcaatteesraeldeovwantiwoanrddatvaerftoircatlhegrcaldoiseendtwbeeltwse(ebnastehde ounppweerll udinsdceornltyiinnugosuisgnwiaftiecranbteaaqruiinfgerzo(nAe-Zaonnde)t.heElvoawleuratsiaonndosftognreoluanydewrsatceorntdaaitnaifnogrtthhee A-Zone Ban-dZotnheeCa-nZdotnhee aDn-dZoofneliamlitoedingdricoautnedswaatdeorwenlweavartdiovnerdtaitcaalfogrratdhieenmtonbiettowreienng twheellzsonienst.he "BT-hZeasnaendosuttocnreolpsiilnttshoenevsalolfteyhewaAll-sZoadnjeac(etnhte tuondtehrelfyaicniglitsyigwnihfeirceangtraoquunidfewra)tearndditshceharge & mthaeyQuflaotwedmoawrnyslalolpuveiawlittehrirnactehedefproascitturuenddreorclkysinogftthheeWvaasllheiynwgatlolns Wanodrkusltfiamcailtietlyy. enter Alternatively, groundwater also may discharge as seeps in the valley walls. Groundwater TET ter A -- = 000053  =) @ C-8 Data Summary Report Local Landfill tfhrroomugthheaAn-uZmobneeraonfdpaBt-hZwoanyes.thaItt dciasncdhiasrgcehsartgoesdeocpwsnwulatridmattoellyeamcihgartaetceosltloectthieonfapcoilnidtsy dainsdchpairpgeess(tOouttfhaellOh1i0o1)Riavnedr.floGwrotuontdhweaftaecirliatlysowhcearneseiteepnttoerssmsatlolrsmtrseeawmesrsdraanidning the `property to the north [mon 10 the Quaternary alluvial itoring terrace points Outfall 005(Old)/SS-1 and 0 unconfined aquifer where pumping 05 of (New)] on-site and flow active `well fields controls groundwater flow. Groundwater seeps in the southem valley wall can seep to the small stream that drains the southern partof the property and ultimately flows toward the north back on to the facility [Outfalls 004(Old) and 004(New)]. Groundwater from C-Zone and D-Zone, which are located in the bedrock at elevations lower Groun than the alluvium surface, dwater flow in the alluvial likely discharges aquifer, adjacent to to the the alluvi valley um in the subsurface. wallsof the Local Landfill, is toward the `pumpingofthese well pfiuemldpsilnogwewerlsltshelogcratoeudndnweaatrearndlepvealrailnletlhetoatlhleuvOihuimotRoibveerl.owTrhiever stage, inducing surface water from the river 10 flow into the alluvium and toward the `pumping wells. Water Quality Groundwater Quality `Tcaobnlceen4t.r1atpiroenssenintsthteheAd-aZtoaneav,aitlhaebulnedfeorrlCy-in8gisnigLnoicfailcaLnatnadqfuiilflerm,onairteohriignhgeswtelalts.LLCM-8W-4 (maximum of 79.6 ug/l) and at LLMW-6 (maximum of 19.9 ug/l). These two wells are MpoosniittioorniendgawdejlalceLntLMtoW-la1nd0f,illloccealltsedanudndaerre the downgradient a landfill cell and wells within the A-Zone. upgradientof LLMW-4, h as shown a range in C-8 concentration of 0.15 to 1.12 ug/l. Monitoring well LLMW-9, an upgradient well located to the southwest of one of the landfill cells has shown C-8 cfornocmentthrealtainodnfsilrlacneglilsng(afnrdo/mornofnr-odmetaeirctdaebploesittoi0on.)14isugm/il.graTthiensgeddoawtnawiandridcaatnedthraetaCch-i8ng groundwater within the A-Zone. Water levels in the A-Zone show groundwater flowing from the southeast to the northwest within this zone. The C-8 concentration measured from the one well screened in the B-Zone (LLMW-12B) is very low, 0.0658 ug/l. Groundwater flow gradients indicate a downward gradient from the A-Zone to the B-Zone, which could be B-Zone. However, groundwater flow with the the migration B-Zone is pathway for C-8 to toward the facility reach in the the northwest and away from the one- and two-mile sampling area. C-8 concentrations for the one round ofdata for wells in the C-Zone, LLMW-11A, LLMW-13B, and LLMW-14B, are higher, 2.22, 6.61, and 0.488 ug/l, respectively, 1s0utphpeorCt-iZnoagnedoaswniwndaircdatevedrbtiycaglrogruanddiweanttefrorclgervoautinodnwsa.teGrrofurnodmwtahteeAr-fZloonweintothteheCB--ZZoonnee is likely to be in the same direction as in the A-Zone and the B-Zone, to the northwest. `The one C-8 value from the D-Zone is NQ (LLMW-11B). This may indicate that tdhoiws nwwelalrdis muipggrraatdiioennotoffC-th8e tloantdhfeilDl-cZelolnse has not taken place. However, the location of FE oe 000054 C803 Summary Report Local Landfill GWrooruknsdwfaactielirtyf(lnoowrtinhwaelsltz)o.neIts imsounniltiokreleyd tahtatthCe-L8ociamlpaLcatneddfiglrloiusntdowwaatredrtfhreoWmaasnhyionfgttohne zones at Local sampling area Landfill because would of this have migrated northwest flow off-site into direction. the one- and two-mile radius Surface-water Quality (sCt-o8rcmownacteenrtrruatnioofnfsainnd seufrfflauceentwaftreormatrheeplreeascehnatteedpionnTdasbalend4.s2e.epOsuttfhaaltldr1a0i1n mionntiottohres. phoansdsh.ad Otuhtefhalilgh1e0s1t,Cw-h8iccohncheanstnreatvieornhmaedansou-rfeldowincsounrdfiatcieonwsatwehrilaet iLtohcaaslbLeaendnfimloln,itored, r[aLngMin(gLferaocmha1t2e)t,0w1h1i5cuhg/clo.llTehcetsCs-e8epcownacteenrtrfaltoiwoinnmgetaosPuornedd i2,n awassam1p2l0eugf/rlo,minIniet 002 November 2002. + Oluotcfaatleldsa0l0o4n(g0t1dw)o,s0t0r4e(amNsewo)n,tahnedso0u0t5h(eOrIndYa/nSdS-no1rtahnedrn00sSid(eNseofwt)haerepmroonpeirttoyr,ing points oruetsfpaelcltsivhelayv.e aTllhehsaed onuot-ffallloswccoolnldecittisotnosrmfowrattheerprausntofsTevferraolm mtohnetlhasn.dfiHlowceelvlse.r,ThOeutsfealflour 005(O1d)/SS-1 historically has shown outfall, ranging from 6.8 to 51.4 ug/L the highest C-8 concentrations of these four 45.2 Current Human Health and Ecological Exposure Pathways oO The main impact on ohbujemcatnivheeoafltthhea nCdontsheenetnvOirrdoenrmwenats to as daerteesurlmtionfe rwehleetahseesr there h of C- as to been the an easnsvoicrioantmeednltanfdfriolmlsD(uLPoocanlt, oLpeetraartt,ioannsdatDrthye RWuna)s.hinThgetroenfoWroer,khsumfaacnilihteyaaltnhd atnhde ethceolfoagciiclaitlyeaxnpdostuhereLopcaatlhwLaanydsfiblolt)hmouns-stibtee(caotntshiedeLroecda.l TLahnedfhiullm)aanndheoaflft-hsiatned(aedcjoalcoegnitcatlo eecxoploosguircealpraetchewpatoyrsseocnti-oannsdbeoflfo-switdee.scProitbeenttihaelpeoxtepnotsiuarleerxopuotseusrweerroeuteevsalfuoratheudmaannd and classified as complete or incomplete. On-Site Human Health Environmental Setting and Ecological Exposure Pathways Current `tThhaitsasreecftioounnddeastcrtihebeLsotchaelpLoatnednftiilall.eOxnp-ossiutreehruomutaens rfoercehputomrasninacnldudeecoaluotghiocrailzreedcefapctiolristy wTaonrdkfielrlsbaounnddafraciielsi.ty vPiostietonrtsi.al Eecxoploosguircealroruetceesptwoerrseinecvlauldueataendimaanldscllaisvsiinfgiweidtahsincotmhpelete oarndineccoomlpogliectaelaenxdpoasruerseupmamatrhiwzaeydevianlTuaatbiloen4.f3o.r tThaebLloec4a.l3Lsanudmfmilalr.izTeos tbheechounsmearnvahteiavlet,h Cfo-r8ciamcphaccotmepdlmeetdeieaxpisoscuormepapratehdwtaoy,thteheC-m8aSxLi,mruemgaCrd-l8escsoonfcemnterdaitaiotnypme.easured in the . Access to entrances. the Local Landfill is However, a posted restricted by electronic and locked nature trail has been established on gates at the cast the road sideof the & landfill property. The trail loops around the casten partofthe landfill starting and VWiOmNinKgCo8nD,oOtFaSummary ~ ental Fen 5.03 -- 000E 055 D C-8Data SummaryReport Local Landfill deoncdsinngotnecaormtehenelaanrdftihlel'celellse.ctrAicccalelsysotpoertahteesditgeatfer.omThseurnoautnudreintrgairloiasdsa imsaproksesdibtlreaibluatndis discouraged due to the heavily wooded natureofthe property and the hilly terrain. The three cells at the Local Landfill are covered with a low permeability soil and vegetative cover. This cover prevents human and ecological receptors" exposure to the landfilled materials. Permit WV0076538 requires that the landfill surface will be inspected `quarterly for evidenceofcracking or erosion (which could allow surface water to enter the solid waste deposit) and evidenceofsettlingofsolid waste (causing ponding of surface water). Per Condition G-16 of the permit, a stormwater erosion inspection is conducted annually. Therefore, human and ecological receptors' exposure to C-8 containing landfilled materials is an incomplete pathway. At the landfill, precipitation is expected to take oneof two paths. It may infiltrate `downward through the vegetated soil cover and into the cells, although, the low `permeabiolfitthey soil cover reduces the amountofinfiltration. If the precipitation does infiltrate the soil cover, it will possibly encounter the landfill materials and will continue migrating downwards. It may be prevented from further downward migration by the low `permeability clays and weathered bedrock. However,if this water does migrate further downward, it should encounter the sandstones and shale layers. Groundwater flowing through the sandstone layers that outcrop in the valley walls located above the facility's southern edge would be exposed at the surface in seeps,ifseeps exist. No seeps were identified in the valley walls during field reconnaissance. Seeps near the leachate collection ponds flow almost continuously although the amount of flow is variable. Ad Contact with leachate from the landfill cells that has reached the ponds and surface water via these seeps is possible and therefore, is a complete exposure pathway for human and ecological receptors. However, contact would be very rare since only facility representatives enter this area on an infrequent basis. The highest C-8 concentration `measured in leachate from Local Landfill 120 ug/l, which is lower than the CATT- established C-8 SLof 150 ug/l (WVDEP, 2002). Depths to groundwater at the Local Landfill ranges from around 20 feet to 130 feet bgs (see Figures 4.3, 4.4, and 4.5). In addition, groundwater has not been observed seeping in the valley walls indicating that ground water is not exposed at ground surface on valley `walls, but most likely flows in the subsurfaceof the valley walls. Therefore, contact with C-8 impacted groundwater as an exposure pathwatyo human or ecological receptors is considered to be incomplete. Off-site Human Health and Ecological Exposure Pathways Off-site human receptors include residents using the water sources sampled during the. groundwater well and water-use survey. Ecological receptors include livestock using the `water sources sampled during the groundwater well and water-use survey. West Virginia One- and Two-Mile Radius Groundwater and Surface Water Results for the West Virginia one- and two-mile radius groundwater and surface water was presented in Sections 3.2.1 and 3.2.2. The exposure pathway is incompleteif the water source is not used. The exposure pathway for human and ecological receptors is @ completeif the water source is used for drinking water. The exposure pathway is Ey ess 000056  0u Summa ron Local Landfill cexopmopsluerteeiiftchoenswiadteerredsotuorbcee imsinusiemdalfobrencoanu-sderithnekiwnagt-ewratisernopturipnogseestse,d.altThhoeughhi,ghtehset C-8 c2o8ncuegnlt,rarteisopnesctfiovrelnyo,nw-hdiricnhkairnegs-iwgnaitfeicaanndtldyrbienklionwg-twhaeteCrAsTouTrcCe-swSaLs o1f4.135ug0/luga/ln.d The pathway is complete but exposure i limited due 10 the low C- concentrations. 4.6 Local Landfill Summary Mtoadneytedrimfifenreenwtheatcthievrittiehserheahvaesbbeeeenncaonndiumcptaecdt aotnahnudmaarnouhnedaltthheaLnodcatlheLeanndviilrlonimneonrtdears a "rTehseultC-ofreclonecaesnetsroaftiCo-n8intogrtoheunednwvaitreornmaenndtsufrrfoamcethwealtaenrdffilrlomcemlasnayt tshoeurLcoecsal(oLn-asnidtfei,lloff- smietaes,umroendi.torBiansgedweolnl,allporfodtuhcetidoantaweevlall,uaptreivdaftoerwtehlelL,oscparlinLgsa,nadndictihsteefrnosl)lowwaisng observations were made Q TrehceepctuorrrsenctonetxapcotswuirtehptahtehwfaolylsowairnegiCn-co8mipmlpetaectfeodr hmeudmiaan: and ecological ++ OOnnssiitteesolainldfilled materials + Onsite groundwater 2 SHuurmfaacnewaantderecaorleogciucmaelnrtelcyepctoomrpslceotnetapcatthwwiatyhs.on-Hsoitweelveearc,hattheesaendpaCt-h8waiymspaacrteed Q cmoannsaigdienregdtthoe bleealcihmaitteeadnbdecbaeucsaeuosefohfeailntshtiatnutdiosnaafletcyonptrraocltsicienspfloalcleotwoedliwmihteanccess twoattehre astitet.heTshteehwiegrhees1t2C0-a8ncdon1c1e5nturga/lt,iornesspmeectaisvuerlye,d iwnhilecahchaarteelaonwdersutrhfaancethe CCoAnTcTe-nctsrtaatbiloinsfhoerdCC--88(SC-Lo8 fAL1A50C)ugofa1n,d36t0heugA/qlu(aiWiVcDLEiPfe,A2d0v0i2s;orMyenzie-Cura & Associates, 2002), @ cCoumrrpelnetteofbfustitleimeixtpedo,sudrueeptaotthhweavyesryfolrohwuCm-ancaonndceenctorlaotgiiocnaslmreeacseputroerds,tihnactlaurdee dresiindkeinntigawlatderirnksionurgcaensd, tnhoen-hdigrhiensktinCg-:wcaotnecesonutrrcaetsi.onsFomreatsheurderdinwkeirngea2n.d8 nanodn. 51.5007uugg., respectively. These concentrations are well below the C-8 SL of Q EfvlaolwudaitrieocntioofntshiendCi-c8atreessuCl-t8s mmeigarsautrieodnavtiaLowcaatlerLatnrdafnislploratnfdrtohme gLorcoaulndLwaantdfeirll dinoetshennootrotchcwuerstinbautnyoudtisriedcetitohneobtohuenrdtahrayn tofowtahredfatchieliWtaysahnidntghteoLnoWcaolrkLsafnadciility 3 Cbe8endtertaencstpeodrattedlofcraotimotnshewWitahsihninthgetoonneW-oarnkdstfwaoc-ilmiitlyeviraadaiiurseimsisbseiloinesv.edCt-o8have @ ptrreacnisppiotratteidoninaanidr meimgirsastieonvsiaanwdatdeerpotsraintsepdorotntsousrufrafcuecseswaltikeerlyand0/boer mgroobuinldiwzaetdebry. Ceora sayare 5m " -- --= 000057 C8012 Summary Report Letart Landfill @ 5.0 LETART LANDFILL 5.1 Introduction `The Letart Landfill is located about 46 river miles downstreamofthe Washington Works facility, northof the townofLetart in Mason County, West Virginia (see Figure 5.0). `The landfill was operated and closed under WV/NPDES Permit No. WV0076066. The Letart Landfill was permanently closed by installing an engineered multi-layer geosynthetic and soil cap (DuPont, 2001). Included in the closure activities were the installation ofa leachate collection system, erosion and drainage control measures, and chain-link fencing. The cap construction was completed in April 2001. The permit requires quarterly groundwater monitoring, surface-water monitoring, and engineered cap maintenance. Consent Order required tasks that were to be conducted at or immediately adjacent to the Letart Landfill included the following: Q Task A: Groundwater Well and Water-Use Surveying and C-8 Sampling--conduct a distance-phased groundwater well and water-use survey identifying and sampling all groundwater wells, springs, and cisterns within a one-mile (and possibly two- and three- mile) radial distance of the Letart Landfill. a Q Task B: Assessment of Existing Groundwater and Surface Water Monitoring of iDdaetnati--fcioedndinucWtVm/oNnPthDlEySsaPmeprlmiintgNof.or C-8 at Letart WV0076066 Landfill at as Outfalls certain outfalls 002 and 003. C-8 samples were taken from all the wells at the LetartLandill monthly for the first four months and quarterly thereafier Q Task C: Plume Identification/Groundwater Assessment--determine the vertical and horizontal extentofC-8 impacted groundwater exceeding 1 ug/l or as directed by the GIST at Letart Landfill. This task included an assessmentofthe C-8 concentration in Ohio River Water in the vicinity ofthe Letart Landi In Sections 5.2 through 5.4, discussions are presentedofthe specific activities that were conducted to meet the requirementsofthe Consent Order,along with the resultsof the sacacmuprlaitneglyevreenptrse.senItnsStehceticounrr5e.n5t, etnhveirreovnimseendtsailtescetotnicnegpt(ugaelolmoogyd,elhyidrporleosgeyn,ted that more hydrogeology, groundwater flow and water quality) and current human health and ecological exposure pathways for the conditions at and surrounding the Letart Landfill 5.2 Task A: Groundwater Sampling Well and Water-Use Surveying and C-8 `The groundwater well and water-use survey and sampling activities conducted within the osnueb-mmiitleedrtahdeiursesouflttsheofLetthaertonLea-nmdifillelrwaediruescsoumrpvleeytteodtohne GFeIbSrTuairnyA2pr4i,l2,020020.2D(uDPuoPnontt, @ 20020). PRTE ington, OE 37 000058 C8003 Summary Report Letart Landfill Table 5.0 summarizes the off-site surveying and sampling program for the one-mile radius. A total of 46 homes were surveyed, and a totalof 30 wells were sampled. Eleven ofthe wells were used as drinking-water sources. Table 5.1 provides details for each sample collected including the C-8 concentration measured (ug/l). Eight other wells `sampled were used for non-drinking water and the other 11 wells were unused. No cisterns or springs were sampled. Figure 5.1 shows the locations sampled, regardless of water use. Each colored circle represents a sampling location, and the color and size of the circle indicate the magnitude of the C-8 concentration measured. Small blue circles represent samples having C- concentrations less than 0.05 ug/l. Small green circles represent samples having C-8 concentrations ranging from t0 0.05 to 1.0 ug/l. `The C-8 concentrations measured in all Letart one-mile radius samples were ND or NQ, except for one sample collected from a well used for drinking water that had a C-8 concentration of 0.139 ug/l and one sample collected from an unused well that had a concentrationof0.636 ug/l. The GIST required that the drinking-water well sample with a C-8 concentrationof0.139 ug/l be re-sampled. However, the resident declined to have: the well re-sampled. Based on the very low C- concentrations measured when compared to the human health protective screening criteria for water (C-8 SL) of 150 ug, the GIST determined that no further surveying and sampling was needed. 5.3 Task B: Assessment of Existing Groundwater and Surface-water Monitoring Data 5.3.1 Monitoring of C-8 in Groundwater and Surface Water at Letart Landfill Groundwater Monitoring `The Consent Order required that all monitoring wells at Letart Landfill be sampled for C-8. Monthly C-8 sampling ofgroundwater began in December 2001 and quarterly sampling began in May 2002. Table 5.2 provides a listof the monitoring wells included in the groundwater monitoring program for Letart Landfill. Well construction data and `groundwater elevation data also are provided in this table. At the time monitoring started, 13 monitoring wells existed at Letart Landfill. Another five wells were installed during 3Q02 as partofthe C-8 plume delineation work. These wells were included in the monitoring program that began in 4Q02. Figure 5.2 shows the locationofthe monitoring wells. Table 5.3 presents the C-8 concentrations measured in these monitoring wells, including C-8 data generated prior to the issuingofthe Consent Order. The most recent data are listed first for cach well. The water-bearing units at the Letart Landfill are named from ground surface to depth as the A-Zone through the F-Zone, with the A-Zone being the shallowest and F-Zone being the deepest. Groundwater in the A-Zone, the uppermost water-bearing unit, is monitored through three wells, LMW-1, LMW-7, and LMW-8. These three wells are located along the northwestern edgeof the landfill cell. C-8 concentrations in LLMW-1, LMW-7, and @ LMW-8 have ranged from 0.1 to 30,500 ug/l. WWCa0v Saray ol Fon8.0 `Wamigion, OE 3% 000059 C8001 Summary Report Letart Landfill tGhriosuznodnweaitenroitnltahteernaellxytcloonwteirnuwoautsera-tbtehaerisnitg.unit, the B-Zone, is not monitored because LGrMoWu-nd3waatnedrLfMorWt-h5eAn.extC-lo8wceornwcaentterra-tbieoanrsinign uLniMtW, -th3e Ca-nZdoLneM,Wi-s 5moAnirtaonrgeeddtfhrroomugNhQ to m2,e2a7s0urueg/dlfaonrdLfMrWom-S0.A8 t(ose1e1T2abugl/el,5.r2e)sphecatvieveally.wayNsotbeeetnhaattidnepthtehsgrloouwnedrwtahtaenrtehleevbaottitoonms obfetehnemosncirteoernedi.ndicGartoiunngdtwhaattethrissawemlpllehdasfbreoemntheisssewnetlilalalnyddraynatlhyrzoeudghfoorutC-th8empaeryionodtitbheas representative of the C- concentrations in the C-Zone. LGrMoWu-nd3wAa,te-r4,i-nStBh,e-D1/2,E-~Z1o3nAe,,atnhde n~e1x4tA.lowCe-rwcaotnecre-nbteraartiinognsuniint,LiMs Wmo-n3itAoraenddt1h3rAo.ugh rraannggeedd ffrroomm 6107.23110035,10060ugu/gl/.l.CL8McWo-nc1e2ntwraatsiodnrsy dmueraisnugrethdei4nQL0M2W-sa4m,pl-i5nBgaenvednt~.14A L`GMrWou-n2d4wa,teLrMiWn-t6he,FL-MZoWn-e1,0t,heLuMnWde-r1l1y,ingLMsiWg-ni1f3icBa,ntaanqduiLfeMrW, -is1m4oBn.itoCr-e8d by tcohnacnen1 turg/alt.ionCsonmceeansturraetidoinnsoLfMWC--810in, LMW-11, and LMW-6 ranged LMW-13B have always been from 9.4 10 30 ug/l. C-8, less concentrations in LMW-2A and -14B ranged from 50 to 990 ugl. LAMnWa-d9d.itioTnhale sCa-ndsctoonnceenatnrdatsiiolntsstmoeneaszuornee,d lioncLatMedW-un9derrantgheedF-fZroonme0.i2s m1o0n0i.t9o0r7edugb/ly do `Table 5.2 shows that groundwater elevations in this well have consistently been below the bottomofthe screen, indicating that this well has essentially been dry during the `period that is sampling and has been monitored. In takes days to recharge. addition, LMW-9 typically runs dry during Therefore, C-8 concentrations measured in this well (0210 0.907 ug/l) may not be representative of groundwater quality in this zone. `The next groundwater sampling event a quarter 2003. the Letart Landfill is scheduled for the first Surface-water Monitoring P`TehremiCtonNsoe.ntWVO0r0de7r6i0d6e6nt)iftiheadt trweqouiourtefdalmlosnatthLleytaCr-tLsanadmfpilliln(gretgoubleatpeedrbfyorWmeVd/,NOPutDfEalSls O0u0t2faalnld000023.theOnutdfiaslclh0a0r2gecsotloleactssmlaelalcwheatte-waenadthsetrorsmtvraetaemrartunthoefftfoeroomf tthheellaannddfiillll DOuetcfealmlbe0r0320c0o1l.lectDsuPstoonrtmwaalstoerisrsuanomfpfl.inMgonsutrhflayceswaamtpelrinsgaomfptlheessaet tsweloecotuetdfaoltlshebregan in FToicgautrieosns5,.2inacnldud5i.n3gsShtoowrmtwhaetleorcaRtuinoonfsoff, tRth.e3s3xStsruerafma,ceB-rwiantkeerrssaRmuplninagndpoCiantps.RuTnoafbfl.e g5.e4nesruamtmedarpirzioerstothethCe-i8sscuoinncgeonftrtahteioCnosnsmeenatsuOrredderi.n tThheeoumtofasltlsr,eciennctluddaitnagaCr-e8lidsatteda first for each outfall 4Ou.t5f2a1l0l 30,02240coullge.ctsUlsaindnSgiltlhelea1c4ha(tsee.e TCa-bleco5n.c4e)nCt-ra8trieosnusltast ftohrissoaumtpfallelshcaovlelercatendgeadftferrom TthheelCan-d8ficllonccaepntwraastiionnsstailnletdhisinlAeparcihlat2e0h0a1v,ethbeeernanhgieghislysmvaalrliearb,lefrsoinmce4.t5h2e tloan2d,fi0l5l0cuagp/l. WVininOgon,OWa08SSummary ~ ental Fos5.03 -- 000060 C80 Summary Report Letart Landfill Ln was installed. Cap Runoff C-8 concentrations ranged from 65.1 to 371 ug/l. The 003, and Brinker's Run samples' C-8 concentrations ranged from 0.0612 to 3.92 ug/L Outfall sampling for December 2002 has been completed and the monitoring report will be issued to the GIST in February 2003. Outfall sampling for January 2003 has been completed, but the C-8 results have not yet been validated. The next monthly outfall sampling event is scheduled for February 2003. 5.4 Task C: Plume Identification/Groundwater Assessment Based on the data gaps identified in the CompilationofHistorical C-8 Data Report (DuPont, 2002b), the C-8 Plume Identification/Groundwater Assessment Work Plan was developed and submitted to the GIST (DuPont, 2002). This work plan identified specific activities recommended to fll the data gaps. In the following sections, each of the activities recommended in the C- plume delineation work plan are summarized. Detaoiftlhse activity status and the data acquired are then presented. In addition, Task C included an assessmentof the C- concentrations in Ohio River Water in the vicinity of the Letart Landfil, and these results also are presented. 5.4.1 C-8 Monitoring in Groundwater and Surface Water at Letart Landfill `The delineation work plan recommended continuing to monitor C-8 in groundwater in the overburden and in the underlying bedrock aquifer (utilizing the newly installed monitoring wells), and in surface water at existing locations identified in the Consent Order. The resultsof continued monitoring ofgroundwater and surface water are presented in Section 5.3.1. Monitoring of C- in groundwater continues on a quarterly basis, while surface-water monitoring of C-8 is conducted on a monthly basis. 5.4.2 Surface-water Field Reconnaissance at the Letart Landfill Conducting field reconnaissance to identify additional surface-water features located at the Letart Landfill and sampling surface water from new locations identified during this effortwas a C-8 plume delineation recommended activity. Field reconnaissance was performed, and no new surface-water features were identified. 5.43 Installationof New Wells at Letart Landfill `The installationof three additional well clusters (overburden and bedrock) was proposed in the C-8 plume delineation work plan to characterize the bedrock under the Letart Landfill, to further delineate C- concentrations in groundwater and to evaluate `groundwater flow direction. One bedrock well, LMW-12, and two well clusters, LMW-13A and LMW-13B and LMW-14A and LMW-14B, and were installed during a3lQl0m2o.nitAotrLiMngW-we1l2ls, anothoeveLrebtaurrtdeLannwdfaisllenicnoculnutdeirnegd.theFliogcuarteio5n.s2osfhtohwesntehwellyociantsitaolnlsedof `monitoring wells. Well construction diagrams for the new wells, are provided in @ & Appendix C. WeWiKmCinagOonw,aOsFummary todrealFeb 83 i #0 000061 8001 Summary Report Letart Landfill iDnattearpfrreotamtitohneofgeosluobgsiucraflacleogcsonfdoirttihoensfiavtetwheellsiste.insCtlaalyleadnidn w3eQa0t2hesruepdpobretdrtoheckpr(esvhialoeu,s sshaanldestaonndesaanndd/sotronseil,tostrosnei)ltisstounnedeorrlbaoitnh.byTbheedrAo-cZko,nceontshirsotuignhgotfhaelFt-eZmoanteinagnldayoenres of eaxdidsittsioinnalthweantoerrt-hbeeranrianrgeazso,nteh,inusndoeurt tthoewaFr-dZotnhee,sowuetrhewihdienlteifDi/edE.-ZTohnee Bex-iZsotnsei,nwthheicshouth uannidtsthdiinpssoluitghttolythteownaorrtdh.theOvseoruatlhl., tThheenneewwgegeoollooggiiccdaaltdaactoanwfeirremeudstehattotrheefilintehtohloegic geologic 55.1 interpretation used for the revised SCM, which is presented in detail in Section 5.4.4 Letart Landfill Site Conceptual Model Refinement d`Tahtea fgiantahlerreecdodmumrienngdceodmpaclteitviiotynofforTtahsekLsetAa,rtB,LaandnfdilCl iwnatosathreeviinsteedgrSaCtiMo.nofTahlilstahcetinveitwy was completed, and the revised SCM is presented in Section 5.5. 5.4.5 Ohio River Water Sampling Near Letart Landfill cAodnjcaecnetnrtattioontsh.e LTetwaortlLoacnadtfiiolnls,wOehrieosRaimvpelredw.atTerheaslesoswaamsplsianmgplloecdattioomnseaasreursehothwenCi-n8 rFaivgiunreeo5r.4i.ginOantiengsaamtptlhienlganldofcialtlidoinswchaasrgpeossistuirofnaecdeiwnattheerriinvteortnheearritvehre.poTihnet owthheerre the Q Aslalmpslaimnpglepsoiwnetrweacsollloeccatteedd naepaprrothxeimsahtoerleyli1n,e0(0a0ppfereotxdimoawtnesltyre1a00moffetcthceasftiorsft ltohceation. rshiovreerl-iwnaet)e.r sDaimppalneds wmeirde-ccoollluemcntesd,amipnlcelsudwienrgeonceoldluepclteidcaattebsoatmhplleoc.ations. In total, five "The Ohio presented River at the water C-8 bottomof results for Table 3.11 samples and are collected shown in near the Letart Landfill are Figure 5.4. C-8 concentrations in these five samples ranged from 0.0971 to 0.128 ug/l. 5.5 Revised Site Conceptual Model hTyhderorleovigsye,dhSydCrMogebeotltoegryr,epgrreosuenndtwsattheercufrlrowe,ntaenndvwiartoenrmeqnutaallitsye)tatinndg c(ugreroelnotgyh,uman Lhaenadlftihlla.ndTehceolfooglilcoawlienxgpsoescutrioenpsaptrhewsaeynts tfhoer rtehveicsoenddSitCioMnsinatdeatnadilsurrounding the Letart 5.5.1 Current Environmental Setting Geology mAotntihteorteidmetCheonwsaetnetr-Obredaerirnwgazsoniesssuiedde,nt1i3fimeodnaittotrheinLgetwaerltlsLaenxdifsitleld, tathaLteatracrtlLaabnedlfeidllasatnhde " CA--8ZopnleumtehrdoeulgihneFa-tZioonnew.orAknotto hbeerttfeirvcehwaerlalcstewreizree tihnestbaeldlerdocdkuruinndge3rQt0he2 LaestapratrtLoafntdfhiell, VimDaroV,AWKC.8 tOFSaummary ~ en raFo 5.09 a 000062 3 00a Summary ron Lotart Landfill dtiorfecutritohne,r delineate C-8 concentrations in groundwater, and to evaluate groundwater flow 5".T5h.e lTowcaoticornossso-fsefcotuirocnsr,osAs--sAe"ctainodnsBd-eBv"e,lwopeerde pforrestehnetLeedtairntthLeanCdofimlplilaarteisohnoowfnHiinstFoirgicuarle 5D.a8taanRdep5o.9r,ta(rDeunPoenwt,cr2o0ss0-2sbe)ctainonds,arwehsihcohwsntaitnsFiingutrheesno5.r6thanadnd5.r7u,nsressopuetcht,ivsehlyo.wiFniggutrhee ~ geological data obtained from the newly installed monitoring wells, "VT-hsehLaepteadrtvLalalnedyfs.ilRlessisdiutaualtseodiloncoavehresavmiolystdilsasnedcfitleldaprleaast.eauIncognesniesrtailn,gtohfesseovieraatltshteeseipte thhaeswbeeaetnhedresicnrgoibfebdedasrorceks.iduAaltimnonsattulraen,dfciollnsairsetaisn,gtphreicmlaaryiily olfeshsetahvayn c1l0ayfseedtetrhiivcek,d wfirtohm maximum thickness of 20.5 fect, s`Tahneduynodrerclaylicnagreboeudsrsohcaklea,tatnhde Lgertaayr,tgLraenednf,ilalndcobnrsioswtnsosfanidnstteornbeedadnedd/orredsialntdstovnaeriocfolthoered aPsetrhmeiaAn-ZagoeneDutnhkraourgdhGFr-oZuopn.e,SwiixtshtrtahteigAr-aZphoincewabteeirn-gbtehaerisnhgalzloonweesstthzaotnweearneddethseignated cFo-nZsoinste otfhemadseseipveset,.veTrhyesfienezotnoefsinaeregriadiennteidficerdysotnaltlhineecsraonssd-ssteocnteioannsd./oTrheislestzoonneeswith cococnatsiinounoaulssshhaalleeluennistess.thaTthaereA-geZnoenrealtlhyro10ufgehetthoerFg-rZeoanteerairnetsheipcakrneastse.d bTyhelocBa-lZlyone Q stihnrgoluegzhotnhee iDn/tEh-eZofanrenoarrethlaatnedraslelypadriastceonitnitnoutowuso.diTsthiencBt-zZoonnees ianndthteheceCnt-rZaolnaereaar.e Tahe uBn-iZtoinnethtehinnosrotuhterannadreias.miTshsiisngunfirtojmoilnosguspfrwiotmhtEhe-Zsoounteheinrnthaerecae.ntDra-lZoarneea.isIannthiesolated asroeutlhaeterrnalalryeac,ontthienDu-ouZso.neThanedAt-hZeoEn-eZaonnde tahreeCa-sZionngleeozuotnec.ropThi etAh-eZvoalnleeyanwadlltsh,e wFh-iZloene the D/E-Zone F-Zone likely oouuttccrrooppss ianlotnhge trhieveOrhbiaonkoRfitvehrenOeahriothReivseoru.thern endofthe landfill. The n"Tehwe lcorgosssf-osrecLtMioWn-s9a,ndLaMrWe-n5oAw,bealnidevLeMd Wto-b5eBscwreereenirneg-oetxhaemrinzeodnedsu.riLnMg Wco-n9strisucntoiown of oinntleyrporneetewdeltol binetshcirseneenewdlyiniadenstainfdisetdoznoenez,oniteilsonwoetrctlheaanrifthtehiFs-Zzoonnee. isBleactaeruaslelythere is 1c0onbteinsucoruese.neLd MinWt-hSe BD/pEr-eZvoinoeu.slyWetlhlouLghMtWt-o5bAe,mopnrietvoiroiusnlgytihnetFer-pZroentee,d iassnmoonwibteolriienvgetdhe D/E-Zone, is now interpreted to be monitoring the C-Zone. Hydrology, Hydrogeology and Groundwater Flow Hydrology lTahnedfLieltlaerdtmaLtaenrdifaillsl. enPgrienciepeirteadticoanpfsalylsitnegmonprtehveenetnsgisnuerefarceed wcaatpesryfsrtoemm ctoankteascotnineog ftwo piamtphse.rmeItabmlaeygienfoimltermatberdaonwenawnadrdthtehnrfoluogwh ltahteervaelgleytdaotwednssloiolpaenodnetnocpooufnttehrethe @ v`eggeeotmaetmibvreaaney.erAdlotwenrnsaltoipvee.ly,Inprceictihpeirtsaittiuoantimoan,ytfhlisowsuvrifaacoevewraltaenrddfolcoswnoont ctoonptoafctthte.he TCG Ge a re on = 000063 80ataSummary Report Letart Landfill landfilled materials and migrates downslope toward drainage ditches constructed in or adjacent to the cap system. Precipitation falling on the northwest sideofthe upper part of the cap flows downslope toward the southwest, away from the landfill, into a drainage ditch that flowstoa sediment trap near LMW-6. Precipitation falling on the remaining. portionsofthe cap flows downslope and toward the south in drainage ditches. Hydrogeology Hydraulic conductivity testing [i.., slug tests (A-Zone) and borehole packer tests (C-Zone, D/E-Zone, and F-Zone))ofthe bedrock zones indicates that these zones display Tow hydraulic conductivity (Tetra Tech Richardson, 1990). The A-Zone hydraulic conductiviitsy low, ranging from 10 cm/sec to less than 10 cm/sec. (Thereareno wells monitoring the B-Zone; therefore, it was not tested.) The C-Zone and the F-Zone have very low hydraulic conductivities ranging from 10 cm/sec to less than 10 cm/sec. The D/E-Zone hydraulic conductivities also are very low and range from 10 cm/sec to n1a0turcemoifstech.e wTahteerl-obweahryidnrgauulniitcs.conIdnuacdtdiivtiitoine,s mcaannybesaatntdrsitbounteedutnoittsheinvtehreyrfeignieo-ngrained typically display effective porosity as low as 1 percent. This low porosity resus from pore space being filled in by authigenic minerals (c.g. kaolinite) sometime after original sediment deposition. `The F-Zone has been designated the "underlying significant aquifer" as defined by the West Virginia Solid Waste Management Regulations because it is laterally continuous Q under the landfill and is thought to be hydraulically connected to the Ohio River south of the landfill. The F-Zone groundwater average lincar velocities were calculated for flow from the north to the southwest and from the north to the southeast (DuPont, 2000). These values are relatively low, 0.01 and 0.003 Uday, respectively. The low velocities calculated in the F-Zone indicate that groundwater flow bencath the landfill is very slow, atributable to the low hydraulic conductivity present in the F-Zone and all the overlying units as well. Low vertical hydraulic conductivities in the overlying shallow zones limit infiltration and recharge down to the F-Zone. The saturated thickness of F-Zone is higher in the upgradient wells (LMW-2A and LMW-11) and is lower in the downgradient wells (LMW-6, LMW-13B, LMW-14B, and uLnMtiWl-4180)h.ourIsn (moarnlyonignesrt)aanfcteesr, ptuhregmionng,itwohreinng awesulflfsicaitetnhtequlaanndtfiitllyocfangnrootunbdewsaatmeprlheads recovered 52). in the well screen interval. LMW-10 appears to essentially be dry (see Table Groundwater Flow `Groundwater elevation contour maps for the significantunderlyingaquifer (F-Zone) were prepared as required by the WV/NPDES Permit No. WV0076538. Table 5.2 provides ggrroouunnddwwaatteerr eelleevvaattiioonn dmaatpa ffoorrw4eQl0l2s idnattahefmroonmitthoeriDn/gE-pZroongrea.m.FigFuigruer5e.151.1p0repsreenstesnts a grervoiusneddwcaotmepraerleevdat10iotnhemagrpofuonrd4waQtUe2r dealteavaftrioonmmFa-Zponfeo.r 4NQoOt2etthhaattwFaisguprreo5v.i1d1edhaisn btheeen @ 4Q02 groundwater and surface-water monitoring report. Figure 5.11 now includes the WTiniCng,OOF Say i Feo 8 -- 000064 @& Ct0ommsSeuwmmwaryymReeend LeLteatrarttlaLanndffiill & nbeeewnwreelmlosvtehda.t monitor the F-Zone. LMW-9, which is screened below the F-Zone, has Gtorwoaurnddwtahetesroufthl.owFionrboFitghutrhee5D./10E,-Zthoen4eQa0n2d tghreouFn-dZwoanteeir eblaesviactailolnycfornotmoutrhemnaoprtfhor the `Dc/oEm-pZloincaet,edtwion twheellssoutthhatermnopnoirttoironhoifstzhoenelawnedfriellnaorteau.sedI.n tThheeveDr/yEn-oZrotnheerbneacroemase,stqhueite Dap/pEe-aZrosnaes daoseisngnloet leixtihsot.logIincatlheunniotr.thI-ncetnhtersaoluptohr-tcieonntroafltphaertl,atnhdefiDl/rEe-aZ,ontheespDl/iEt-sZionnteo:a. tmhoinninteorrutphpeerD/uEnitZoanned,atwthoicakreerslcorweeerneudniti.n tAhetutphpeteorcuonfitth(eLMlaWnd-i3ilAl aanedtLhrMeWe -we4l)lsatnhdat otongeet(hLerM,Wt-h5e Bg)roiusnsdcwraeteenredelienvatthieolnoswmeerausnuitr.edAilntthhoeusgehtthhreeseewwelellsldaifrfeerresliagtniivfeilcyanctlloys.e `eTlheevraetfioorne,maLpMWbe-c3auAseantdheLeMleWv-at4iownsertehantowteurseedobisnecrovnesdtriunctthiensgetwheelglsrowuenrdewantoetrthought twoatbeerrfelporwesiennttahtiisvzeoonfeoviesrfarlolmgtrhoeunnodrwtahtetrowfalrodwtwhiethsionutthhis zone. In general, ground `Fgirgouurned5w.a1t1erpraelsseonftlsotwhsef4rQo0m2thgeronourntdh.watHeorweelveevra,tiionntmhaepsofuotrhetrhen Fp-orZtoinoen.ofTnthtehilsazndofniel,l, `sogurtohuenadswta.teFrofrltohwisstgarrotsuntdowbaeteprerepleenvdaitciuolnamratph,e OthheiowaRtievrerleavenldmfelaoswusrteodwaforrdLtMheW-10 wwiatshinnot1 ufsoeodt. ofTatbhleeb5o.t2tosmhoofwsthtehastcrweaetne,ralnedveslsamipnltihnigs wtheilslwhealvlehcaosnbsiesetnendtilfyfibcueletn abdedciatuisone,twheatweerlllefvreelqsuiennttlhyisgwoeelsldarryedmuurcinhglpouwregrintghaannedxpisecvteerdy scloomwpatroerdecthoaragdej.aceInnt wells. "pTrheevelnotcsatdieotnearmnidnalitmiiotnedofnugrmobuenrdowfatmeorniftloorwidnigrewcetlilosnswiwtihtihninthteheAs-eZzoonnees.andHotwheevCe-rZ,one cthleevsaittieognrsomuenadswuarteedr isnysttheemm.onitoring wells indicate a downward vertical gradient within sRyasptiedmdiencr2e0a0s1esinidnitchaeteobthsaetrvgerdouvnodlwuamteeorfflwoawteurnddeirscthhaerglianndgffilroims btehienlgeagcrheaattelycroleldeuccteidon in response to the instalationof the engineered cap system. Water Quality Groundwater Quality TLeatbalret 5.L3andpfrielsle.ntDsatalal ihistthoirsictaalblaenaalryespirseasveanitleadblaendfordiCs-c8usfsreodmbmyoznointeo.ring wells at the Fthiegufrielli5n.g7osfhtohwesvaalclreyo,ssh-issecctrioosnst-hsercotuigohntshheoswosutthheartntheendA-oZfotnhee,LtehtearBt-LZaonndfei,lla.ndPrtihoer to Cea-sZtoernnevmaolsletylwiaklell,y oauntdctrhoeppDe/dE-inZotnhee wleisketleyrnouvtaelrloepypweadlli,ntthheeCv-aZlloenyefloouort.croFpuprtehdeirnutphe @a tohuetcvraolpleoyntboowtahrdthtehewensortteh,r iatnid lciaksetleyrnthsaitdtehseofA-tZhoenvea,lletyh.e BT-hZeonlea,ndafinldl tisheanC-uZnolinneed WCaCnSg OFSey ea FREE @ 000065 800 SummaryRept _ Letart Landfill plranidofriltlo.tThehiisnsmtaelalnatsiotnhaotftCh-e8 einmgpianceteerdedwactaeprmmiagyrahtaivnegbtehernouagbhlethteo lmaingdrfaitlleeddimraecttelryiailnto the C-Zone, then the B-Zone, then the A-Zone as the landfill was filled. The Agr-oZuonndewattoetrheelFe-vZaotnieo.ns Tahlisos idnodwicnawtaertdhatgrtahdeireenit aalnsoovweorualllddhoelwpnwtraarndspgorratdCi-e8ntdforwonmwtahred from one zone to the next lower zone. Groundwater flow within the zones also would move C-8 around within the individual zone. However, the installationofthe engineered a`mpatewriiall.minimize the amount of precipitation able to infilrate into the landfilled "iTmhpeaccotnicsenttheragtrieoanteosftCa-t8diiffetrhiengvalroicoautsiownesllwsitihnitnhtehedizfofneeresn,twzhoincehs iisndeixcpaetcetdedthgativtehne tCh-a8t Ath-eZoCn-e8,cLonMcWen-t1ratsihoonwisn tthhee hliagnhdfeisltlecdonmcaetnetrriaatlisonwsa;samndo,stinlgikeenleyrahli,ghtlhye Cva-r8iable. In the concentrations appear to be increasing over time for all three wells. In the C-Zone, C-8 chiognhceesnttrCa-t8iocnosnhceanvterabteieonnshiagrheefroiunnLdMinW-L3MWt-ha4n ainndLMLWM-WS-AS.B,IbnotthhelDo/cEat-eZdonate,thtehetoe of tahnedlalnd,filhla.s tIhnethhiegFhe-sZtonCe-,8LcMonWce-n2trAa,tiownhsi.chIinsLlMocWa-te9d,nweahricthhemnoonritthoerrsnaedzgoenoeflotwheer than the F-Zone, C-8 concentrations have always ben less than 1 ug/L Cra-d8iucsoonfcetnhteraLteitoanrst iLnangdrfoiullndhwaavteercofnrcoenmt2ra8trieosnisdetnhtaitalarweeNllDs loorcNatQed(wDiutPhoinnta,o2n0e02-2m)i.le Two groundwater samples had higher values, 0.139 and 0.636 ug/l. These data indicate > ltheavtelaslotfhoCu8gh,tthheegCr-o8unidmwpaatcetredingrtoheunzdownaetseurnhdaesrnaontdmniegarrattehed lfaarn.dfiTllhceell0.h1a39suhgi/glhsearmple is located amongst many other samples that had C-8 concentration of ND or NQ. The sloacmaptlieonisofcotlhleec0t.ed6.36Cu-g/8lcsoanmcpenlteraistiaolnmsositn tthhee Rs1.am3e lSotcarteiaomn saasmwphleerehatvhee rRta.ng3e3dSftrroemam 0.57310 3.92 ug/l. Iti possible that this wel is in communication with C-8 impacted swuartfearcreunwoatfefrfraomthitshelolcaantdfiiolnl.. TThheesCt-r8eacmonthcaetntirsabteiionngmseaamspulreedddwoietshirnectehievOenseu-rmfiaclee- radius are significantly lower that the CATT-cstablished C-8 SL a of 150 ug/l. Inthe Compilationof Historical Data Report (DuPont, 2002b), the annual loadingof C-8 to the Ohio River from C-8 impacted groundwater at Letart Landfill was calculated. The Aes-tZiomnateiodnowwanswabradsetdo otnhetFhe-ZaosnseumapntdiounlttihmaattielmypamcitgerdatgersotuontdhweatOehrioflRoiwvserf.roTmhteheC-8 historical mean for LMW-SB can be used along with the estimated groundwater flux to calculate the C-8 loading to the river. The estimated annual loading was 1 x 10-3 Ib/yr. "aTvheirsacgaelcluilnaetaerdvemlaoscsitiisesreoabssoenravbeldeignitvheenFt-hzeolneo.w hTyhdirsaualnincuaclonldouacdtiivnigtsiehsoualnddrelsouwlt in a Very low C-8 concentration in the Ohio River. `The annual loading estimation was recalculated using a new historical mean value for the nC-e8wcmoenacenntvraaltuieonisi1n,L14M9Wu-g/Sl,BhingohwertthahtenmothreepCr-e8vimoounsimteorainngusdeadt.a aTrheeraevfaiolraeb,let.heTrheevised @ aannnnuuaall llooaaddiinngg aelsstoimsahtoeiulsd0r.e0s1ul7tIibnlyar,vaelrsyolhoiwghceornctehnatnrparteivoinoiunsltyheesOthiimaoteRdi.ver.ThTeher.evised TCT oa Sy a Feo ees = 000066 8 ta Summary Report Letart Landfill measured C- concentrations in the Ohio River near the Letart Landfill are indeed low, with the maximum concentration measured being 0.128 ug/l. These concenirations arc orders of magnitude lower than the C-8 SL of 150 ug/l and the Aquatic Life Advisory Concentration for C-8 (C-8 ALAC) of 1,360 ug/L Surface-water Quality `Table 5.4 presents the C-8 results for surface-water locations monitored at the Letart Landfill. Sampling locations, Outfall 002, Cap Runoff, and Stormwater Runoffare associated with leachate from the landfill and have had the highest C-8 concentrations `measured in surface water at the Letart Landfill. Cap Runoffand stormwater runoffhave had C-8 concentrations ranging from 50.9 to 317 ug/l. Outfall 002, which discharges leachate and stormwater runoff, has had highly variable C-8 concentrations that have wrahnigcehddfirscohma4r.g5e2s 1s0to2r,m0w5a0tuegrlrusnionfcfe, thhaesibnesteanlldartyioonorfhatshehaldanCdf-i8llccoanpc.enOturtaftailoln0l0o3w,er than 0.4 ug/l. The Brinker Run sample, which was collected from a stormwater drainage ndiotrcth,hehmadpaartveorfytlheowlaCnd-f8ilclofnlceonwtsadtioownn, 0t.he06s1t2orumg/wl.ateSrtodrramiwnaatgeerdriutcnho,ffofffrtohme tphre.operty sainddeoifnttohBerilnankdefri'lsl Rpruonp.ertByr.inkTehre'sRtR.u3n3dSitsrcheaarmgessamipntloeaips oconldletchtaetdiastltohceatpeodionftfwthheerneorth Brinker's Run enters the pond. The C-8 concentrations for the Rt. 33 Stream samples thhaavneOruatnfgaleld 0f0r2oman0d.5C7a3ptoRu3.n9o2ffugs/la.mplTehse,paollndthtehseunrdfaicsec-hwaartgeers stoamtphleeOshfioor tRhieveLre.taOrtther Landfill are less than the drinking water and the C-8 ALAC (WVDEP, 2002; Menzie- Cura & Associates, 2002). 5.5.2 Current Human Health and Ecological Exposure Pathways "iTmhpeacmtaionnohbujemcatnivheoeafltthheanCdontsheenetnvOirrdoenrmwenats atso aderteesurlmtionferewlheeatsheesrtohferCe-h8atso tbheeen an aesnsvoicrioantmeednltanfdrfiolmlsD(uLPoocanlt, oLpeetraartt,ioannsdatDrthyeRWuna)s.hinThgetroenfoWroer,khsumfaacnilihteyalatnhd atnhde tehceolLoegtiacratlLeaxnpdfoislulr)empuastthbweaycsonbsoitdheroend-.sitTeh(eathtuhmeaLnethaertalLtahnadfnidlle)coalnodgiocfafl-seitxepo(sadujraecent to rpeactehpwtaoryssoenc-tiaonnsd bofefl-soiwted.esPcortiebnetitahleepxopteonstuirael reoxuptoessuwreerreouetveaslufaotrehduamnadnclaansdsiefcioeldoagsical ecxopmopsluertee poratihnwcoamypleevtael.uatTiaobnlfeor5.t5hesuLmetmaarrtiLzaensdftihlel.huTmoabnehceoanlstehrvaantdiveec,olfoogriccaalch icmopmapclteetde emxepdoisaurisecpoamtphawraey,d tthoetmheaCx-imSuLm,Cr-e8garcdolnecsesntorfatmieodnimaetayspeu.red in the C-8 On-Site Human Health and Ecological Exposure Pathways Current Environmental Setting t`hTahtisasreectfioounnddeastctrhiebeLsettahretpoLtanednftiilall. exOpno-ssiutreehruoumtaens froercehputmorasniannclduedceoaluotgihcoarlizreedcefpactiolristy @ workers andfacility contractors. Ecological receptors include animals living within the WViOnWinKgCi.o8n,OOaFSummary ~ en fra Fo 5,09 - -- 000067 0a Summary Fort Letart Landfill olrandifniclolmbpoluentdaeries. Potential exposure routes were evaluated and classified as complete "eTnhgeinLeetearretdLcaanpdfsiylsltecml.osuTrheewacsapcsoymsptleemteddraiinnAapgreiclon2t0r0o1lswwietrhethdeeisnisgtnaleldattiooncoonfaveny the rfuornorfufnofffo-mretlhaeteldaenrdofsliocnoapfothae dcaeps.ignIantaedddidtiisocnh,arthgee lpaonidnftialncdatpoisclriemqiuniarteedtthoebpeotential ithnespleacntdefdial'sleSatsotrqmuwaarteerrlyPo(lpleurtmiiotn rPerqeuviernteimoenntPlCa.n1.2.TAh)efoerngeivniedeernecdeocfapesroyssitoenmapsrepavretntosf himupmaacnteadndbyecCo-l8o.giCcoanltcaocnttawcitthwiCt-h8tcheonltaanidnfiilnlgedlamnadtfielrlieadlsmaatnedrisaolislsatnhdatsomialsyihs ave been considered an incomplete exposure pathway to human and ecological receptors. "lTahenLdeetadrtmaLtaenrdifaillsl. enSguirnfeaecreedwactaepr sfylsotwesmtaolwsaordprdervaeinntasgseudriftaccheewsactoenrstfrruocmtecdonitnatcthincgap soyesstenmotancdonitsadctistchhealragneddfialtltehdemsatoeurtihaelrsn, eitdgieonofttihmeplaacndtfeidll.byBCe-8c.ausHeowtehivsesru,rflaecaechwaatteer dwihsecrhearitgimnigxefsrowmitthheslteoarcmhwaatteecrolrluencoftfi.onOsuytsftaellm 0is02picpnetdertsoaOustmfaallll,0w0e2t-(wleeaatchhaetresbtarseian)m, tehxaptosfulorwesiaplpirmiotxeidmabteeclayus4e0o0ffteheet beemfoorteeitlodciastcihoanrgoefstthoe tahnedfOihli,otRhievvere.ryHsoeweepveterr,rain, aFunrdthtehre,wtehte-uwseeaotfhheeranlatthuraenodftshafeetsytrpelaamn.s, Isntaandddiatridono,pefreantciinnggplriomcietdsuarcecse,sasntdo ptehresaorneaal. QQ protective equipment also limit exposure, The highest C-8 leachate since the instalationof the landfl cap was 2,050 ucgo/ln.cenTthreathiiognhemsetaCsu-r8ed in ceonntecresnttrhaetiivonermewaassu0r.e1d2i8nutgh/el Ohio River adjacent to where this wet-sweather stream sTyhseteDm/.E-GZroonuendawnadttehrefFl-oZwoinneg efxriosmt attheesleevzaotnieosnstlootwheersotuhtahn tdhiesclheaarcgheastetocotlhleecOthiioon Rtihveerv.allCeoynwtaalclts.wiHtohwtehviserw,atienrgiesnelriamli,tegdrtoounthdewaatreerasfwlhowesredotwhensselozponeewsitmhaiyn othuelcsrhoaplloonw ssouir,faccoeliflsuevieupms, eaxnisdt.fraFciteulrdedrercoocnknsaoifsstahnecevadlildeynowtalildsenatnidfywnouyldseoenplsybinetheexpvaolsleedy awtaltlhse; therefore, this exposure pathway for human and ecological receptors is incomplete. Off-site Human Health and Ecological Exposure Pathways O`sfrfosuintdewhatuemrawnelrlecaenpdtowrasteirnc-luusdeesrurevseiyd.entEscuoslionggictahle rweacteeprtosrosuricnecslusdaemlpilveedstdouckriunsgitnhgethe water sources sampled during the groundwater well and water-use survey. West Virginia One-Mile Radius Groundwater and Surface Water DpiartehcwtaeyxipnossuitrueattoioCn-s8whiemrpeacttheedwsautrefracseouwracteerisannodt gurseodu.ndTwhateepraitshawnayinicsocmopnlseitdeered to bwaeatercopmuprlpoesteesp,aatlhtwhaoyugihntshietueaxtpioonssurweheisrecotnhseidwearteedr tsooubrecemiiniumsacld,bbeuctaunsoet tfohe dwraitnekrinigs: @ nwoetlilnbgeesltoewd.theThCe-8hiSgLheosft 1C5-08ucgo/nlce. nTtrhaetipoanthinwaaynoisn-cdornisindkeirnegd-wtaotebre scaommpplleetweasiftNhQe,well TVRrCsD?aa Saray oo Fo 5.6 Kd 000068 800 Suma ot Letart Landfill @ iwsatuesrdwafosrd0r.i1n3k9iungg/wl,atsiegrnipfuircpaonstelsy.loTwheer thhiagnhetshteCC-A8TTco-nccsetnalbraltsihoendmCe-a8suSrLedofin1d5r0iungk/ilng ({oWtVhDeElPo,w C2-0082c)o.ncTehnetrreaftoiroen,semveeansutrheoudgh the pathway is complete, i also i limited due 56 Letart Landfill Summary M{0adneytedrimfifenreenwtheatcthievrittiehsehrahvaesbbeeeenncaonndiumcptaecdt aotnahnudmaarnouhnedaltthheaLnetdarttheLeannvidrionimneonrtd2esr 2 eEsruolutndowfarteelreaasnedsosfurCfa-cetowattheerefnrvoimromnamneynsforurocmetsh(eonla-nsdiftiel,l.of-TshieteC,-m8onciotnocrenitnrgawtieolns,in pGartoaduecvtailounatweedllfso,rptrhievaLteetawretlLla,ndnfidllO,htiho Rfoilvleorwwiantgeorb)sweravsatmieoansuwreerde.mBaadsee:d on llofthe @ TrehceepctuorrrsenctonetxapcotswuirtehptahtehwfaoylsowairnegiCnc-o8mpilmeptaectfeodr hmeudmiaa:n and ecological + OnOsnsiitteesloainldfilled materials + Onsite groundwater OQ Hleuamchaantea(nCdaepcoRluongoifcaflarnedceOputtolrest c0o0n2t)acdtiswcihtahrgCi-n8gitmoptahcetweedts-uwrefaatcheewrastterreaanmdat ctohnectenotroafttiheonslamnedfaislulraerd cautrtrheenstelyloccoamtpiloensteareex3p7o1suarnedpa2t,h0w5a0ysu.g/lThreespheicgthievsetlyC.- @ Hveorwyevsteere,petxerproasiun,reanids ltihmeitweedt-bweecaatuhseeronfatthuereemofotthee lsoicraetaimo.n oInftahdediatinodn,if,entchieng Joipmeirtastiancgcepsrsocoedhureesa,reaa.ndFpuertrhseorn,althperoutseectoifvheeaelqtuhipamnednstafalestoy pmliants,exsptoasnudraer.d Ccuormepnlteofbfustitleimeixtpedo,sudruee poatthhweavyesryfolrohwuCm-a8n caonndceenctorlaotgiiocnalmeraescueprteodr,s itnhcaltuadree rreisnikdeinntgiaalnddrinnokni-ndgrainndkinnogn--wdartienksionugr-cweastetrhesohuirgcheesstaCnd-8ricvoenrcweantreart,ioFnosr the m1e5a0suugr/eld(wWeVrDeE0P.,132900a2n)d. NTQh,erehsipgehcetsitveCl-y, wcohniccehntarraetiwoenllmbeeasluorwetdheinC-O8hiSoLRoifver wAaLteArCisd0e.v1e2l8oupged bywetlhlebCeAlTowTt(hMeeCn-z8ieS-LCuorfa1&50Ausgs/olciaantdest,he2010,326)0 ug/l C8 3 GsoruotuhnwdewsattaenrdflthoewOihnitoh Risvteer.sigCn-i8ficiamnptacaqtueidfegrrouunnddewrattheerlafnrdofmiltlhieswtaotwearr-dbetahreing zones at Letart Landfill ultimately lows into the Ohio River. @ EmvialleuraatdiiounsoCf-theregsrulotusnsdhwoawtesrthfaltowC-d8iriemctpiaocntseadtgtrhoeulnadndwfaitlelranisdonoftthmiegrLaettianrgtone- toward offsite residences. @ TC:he croenvciesnetdrCa-ti8oanninnuatlhelOohadiiongRievsetrimfartoemftrhoemLgertaorutndLawnadtfeirlli.ndTihciatselsoawveesrtyimoawted @ concentration is supported by C- concentrations measured in the Ohio River T ng035a2SS eaee FE 5 -- = 000069 C-8 Data Summary Report Letart Landfill (0.128ug that are well below the C-8 SL and the C-8 ALAC that were determined by the CATT (WVDEP, 2002; Menzie-Cura & Associates, 2002). Q The transport pathway of C-8 at the Letart Landfill is believed to be via water transport from C-8 containing landfill materials. Q Air emissionofC-8 as a migration pathway is not possible because there are no air emissions at the Letart Landfill. In addition, the Letart Landfill is too far away from the Washington Works facility to be impacted by C-8 containing air emissions emanating from the facility. C Vinigonon 08 mts 00007-0 C-8Data SummaryReport Dry Run Landfill @ 0 prYRUN LANDFILL 6.1 Introduction The Dry Run Landfill is located westof the town of Lubeck, in Wood County, West Virginia, about eight miles southwestof the Washington Works facility and the Local Landfill (see Figure 6.0). The landfill covers approximately 17 acresof a 535-acre parcelofland owned by DuPont. The landfill was constructed within the drainage basin ofDry Run,atributary of the North Forkof Lee Creek, which is a tributaryofthe Ohio River. The landfill began operation in 1986 and the central portion is still active and operates under WV/NPDES Permit No. WV 0076244. The upper portion of the landfill is closed andis covered withasoil and vegetative cover. The lower portionof the landfill also is closed and is covered by a engineered landfill cap. Consent Order required tasks to be conducted at or immediately adjacent to the Dry Run Landfill included the following: Q Task A: Groundwater Well and Water-Use Surveying and C-8 Sampling-- conduct a distance-phased groundwater well and water-use survey identifying and sampling all groundwater wells, springs, and cistems within a one-mile (and possibly two- and three- mile) radial distance of the facility and the Dry Run Landfill. D. Q Task B: AssessmentofExisting Groundwater and Surface Water Monitoring Data--conduct monthly sampling for C-8 will be performed at Dry Run Landfill a0t03o,utafnaldls00i4d,entCi-fi8edsaimnpWleVs/wNePrDeEtoSbPeertamkietnNfor.oWmVal0l0t7h6e 2we4l4lsasatOutthfeaDlrlys 0R0u1n, Landfill monthly for the first four months and quarterly thereafter. 3 TaansdkhoC:rizPolnutamleeIxdteennttiofficCa-t8ioinm/pGarcotuneddwagtreorunAdswsaetsesrmeexncte--eddeitnegrm1 iung/eltohre avserdtiirceaclted by the GIST at Dry Run Landfill In Sections 6.2 through 6.4, discussions of the specific activities conducted to meet the requirements of the Consent Order are discussed along with the new data generated during these activities. In Section 6.5, the revised site conceptual model that better represents the current environmental setting (geology, hydrology, hydrogeology, groundwater flow, and water quality) and current human health and ecological exposure pathways for the conditions at and surrounding the Dry Run Landfill is presented. 6.2 Task A: Groundwater Well and Water-Use Surveying and C-8 Sampling The groundwater well and water-use survey and sampling within the one-mile radius of the Dry Run Landfill were completed on February 28, 2002. DuPont submitted the resultsof the one-mile radius survey to the GIST in April, 2002 (DuPont, 2002a). r Winger 2 ere " y 000071 800 SummaryReport Dry Run Landfill Table 6.0 summarizes the off-site surveying and sampling program for the one-mile. @ radius. A totalof 64 homes were surveyed, and a total of 53 water sources (wells, cisterns and springs) were sampled. Thirteen wells, one cistern, and one spring sampled were used as drinking-water sources. Table 6.1 provides details for each sample collected including the C-8 concentration measured (ug/l). Figure 6.1 shows the locationsofall samples collected, regardless of water use. Each colored circle represents a sampling location, and the color and sizeofthe circle indicate the magnitudeof the C-8 concentration measured. Small blue circles represent samples having C-8 concentrations less than 0.05 ug/l. Small green circles represent samples having C-8 concentrations ranging from t0 0.05 to 1.0 ug/l `The C-8 concentrations measured in all the Dry Run Landfill one-mile radius samples were less than 1.0 ug/l. The highest C-8 concentrations measured for unused and nondrinking-water sources were 0.974 and 0.54 ug/l. Sevenofthe 15 drinking-water samples were ND or NQ, and the rangeof C- concentrations in the other eight drinkingwater samples was between 0.0505 and 0.339 ug/l. Based on the very low C-8 concentrations measured when compared to the human health protective screening criteria for water (C-8 SL) of 150 ug/l, the GIST determined that no further surveying and sampling was needed. However, the GIST did require resamplingof the cight drinkingwater sources with measurable concentrationsofC-8. Residentsoffiveofthe eight drinking-water sources declined to have their water sources resampled. Resampling of the three drinking-water sources was completed in April 2002. C-8 concentrations ranged from NQ 10 0.422 ug/l in these samples (DuPont, 2002h). In addition, a surface-water sample was taken from the Lee Creek near the Graham residence, which is located a few miles west-northwest outsideof the Dry Run one-mile: radius. This sample was taken to evaluate C- quality in the Lee Creek before it dischargesto the Ohio River. The Dry Run creek, which begins af the toeofthe landfill, discharges surface water to the Lee Creek. The C-8 concentration measured was 0.28 ug/l (DuPont, 2002). At this same residence, a drinking-water well and a spring used for non-drinking-water purposes also were sampled and analyzed for C-8. The C-8 concentrations measured in these water sources were ND and 0.331 ug), respectively. 6.3 Task B: Assessment of Existing Groundwater and Surface-water Monitoring Data 6.3.1 Monitoring of C-8 in Groundwater and Surface Water at Dry Run Landfill Groundwater Monitoring `The Consent Order required that all monitoring wells at Dry Run Landfill be sampled for C-. Monthly C-8 sampling ofgroundwater began in December 2001, and quarterly sampling began in May 2002. Table 6.2 provides a listof the monitoring wells included in the groundwater monitoring program for Dry Run Landfill. Well construction data and groundwater elevation data also are provided in this table. At the time monitoring started, eight monitoring wells were installed at the Dry Run Landfill. Another seven wells were installed during 3Q02 as partof the C-8 plume delineation work plan, and these new wells were included in the monitoring program starting in 4Q02 (DuPont, 2002K). vamngn5 000072 80st Summary Report Dry Run Landfill cFoingcuernetr6.2atisohnoswmseatsheurleodcatiniotnhoefstehmeonmiotnoirtionrginwgelwe,llsi.nclTuadbilneg6C.3-8prdeasteanatcsqtuhiereCd-8prior to the issuing of the Consent Order. The most recent data are listed first for each well. The `water-bearing units at Dry Run are named from ground surface to depth as the Overburden, and the A-Zonc, the B-Zone, and the C-Zone. `Wells monitoring the overburden include DRMW-6A, DRMW-12A, DRMW-128, DRMW-13A, and DRMW-21A. DRMW-13A has shown the highest C-8 concentrations in overburden, ranging from 0.07 to 15 ug/L. This wel is located at the toeofthe landfill DRMW-6A has shown a C- concentration range of 0.096 to 1.24 ug/l. DRMW-124, DRMW-12B, and DRMW-21A have had much lower C8 concentrations, ranging from ND 10 5.4 ugll. Wells monitoring the A-Zone include DRMW-16B, DRMW-17B, DRMW.-18B, DRMW-19B, and DRMW-20B. DRWM:-14 is a continuous open hole; therefore, effectively monitors all water-bearing sandstone and siltstone units above the A-Zone as well as the A-Zone. Allofthese wells are new wells, except DRMW-14, and have only been sampled one time. C- concentrations in these new wells has ranged from ND to 0.155 ug/l. C-8 concentration in DRMW -14 has ranged from <0.1 10 2.5 ug/l. Wells monitoring the B-Zone include DRMW-12, DRMW-13, and DRMW-15. DRMW-12 has shown the lowest C-8 concentrations, ranging from <0.1 to 0.16. DRMW-15 has had higher C-8 concentrations ranging from 0.263 to 5.0 ug/L. DRMW-13, which is located at the toeof the landfil, has had the highest concentration od of C-8, ranging from 3.6 t0 20.9 ug! Only one well monitors the C-Zone, DRMW-21B. This is a new well that hasonly been sampled once, and the C- concentration measured was NQ. The next groundwater sampling event for the facility is scheduled for the first quarter 2003. Surface-water and Leachate Monitoring `The Consent Order identified three outfals at the Dry Run Landfill (regulated by 'WV/NPDES Permit No. WV0076244) where monthly C-8 sampling was to be: performed, Outfalls 001, 003, and 004. (Outfall 002 is a required outfall sampling Tocation as stated in the WV/NPDES permit. However, it was a temporary relocation of Outfall 001 and no longer exists). Outfall 001 collects stormwater and leachate. Outfals 003 and 004 collect stormwater only. Monthly samplingofthese three outfalls began in December 2001. In addition, there are five other locations thatare sampled quarterly for C8. These include Stream Samples-1 (SS-1) and -2 (55-2), Pond Underdrain, Property Boundary, and DR Leachate. The locationsofthe surface-water and leachate sampling points arc shown in Figure 6.2. The Property Boundary sample location is located along the westem property boundary where the Dry Run creck crosses over the property boundary (see Figure 6.0). Table 6.4 provides the C-8 concentrations measured in the outfalls and leachate, including C-8 data acquired prior to the issuingof the Consent Order. The most recent data are listed first for cach outfall WVimOinCgiEon,O0o8a Summa~rtynt ra Fob 5.03 000073 = 80m Sumy pt Dry Run Landfill OUuntdleertdr0a0i4nisfluopwgriandtioe5n5t-a2n,dwhfliocwhsfilnotwosSSu-l1t.ima5te-l1y,iOtuotltehte 0P0r1o,peOruttyleBtou0n3d,arayndsaPmopdling point. Owuhtilceht 0sa0m4phlaess hcaodulndo-bfeltoawkecno,ndtihteiCo-ns icnon1c0enotfra1t2isoansmpwleirneg0e.v7enatnsd, I1n5t8hueg/tlw,omaevkeinntgs iitn sdihfoiwcunltthoe ldoewteesrtmiCn-eacroenpcreensternattaitoinsv,e Cra-n8gicnogncfernotrma0t.i5o4nftoo 1t.h6i3s ulgo/cla.tiTonh.e SCS8-1 has c1o0n3c9enutgra,tiaolntshoiungOhu,tlOeuttl0e0t300a3ndhParsohpaedrtnyoB-oluonwdacronydhitaivoensbeiennnihnieghoer,tfhran1g2insgamfpolimng0.68 ecvoennctesn.traTthieonOsutrlaentgi00n1g,f5r5o-m24.6and0P8o7ndugUlnderdrain sampling locations have shown C- CT-he cDoRnceLnetarcahtaitoenssainmpsluirnfagcpeoiwnatt,erf,rroamnwghinigchfrloemac2h7at.e4 its0s7a0m4plueg/dl,, hTasheshinoawcntitvheeohwieghrest hsaylsfteomf.thLeelaacnhdafitlel aits tchoeveDrreydRbuyngeLoantdefxitlllesdoacnsdngoetodmiesrcmhbarragneetsoosfutrhfaecelewaactheart.e cLoelalcchtaitoen WisacsahpitnugrteodnbWyotrhkeslefaacchialtietycwohlleercetiiotnsstyrsatteemdat Dry Run and is transported to the ObuetifsaslulesdatmopltihengGIfoSrTDeinceFembbreurar2y0020203h.as Obueteanlclomspalmeptleidn,gafnordJtahneumaornyi2t0or0i3nghasrebpeoretnwill cSoammpplleitnegd,evbeuntt tihsescCh-e8druelseudltfsorhaFveebrnuoatryyet20b0e3e,n validated. The next monthly outfall 64 Task C: Plume IdentiicationiGroundwater Assessment B(DausPeodnotn, t2h0e02d0a)t,a tghaepsC-i8dePntliufmieedIidnentthiefiCcoamtpiiolnaGtrioounnodfwHaitsteorrAiscaslesCs-menDtatWaoRrekpoPrltan was sdpeevceilfoicpeadctaivnidtisesubrmeictoemdmteontdheedGtIoSfTill(tDhuPodantta, g2a00p2.6).In tInhclfuodleodwiinntghissecwtoirokn,plcaanchweorfe btrhieefalcyt.iviDteiteasirlsecoofmtmheenadcteidviitny stthaetuCs-3anpdluthmeeddaetlainaecaqtuiiornewdoarrektphleannpiresseunmtmeda.rized 6.41 C8 Monitoring in Groundwater and Surface Water at Dry Run Landfill CboendtrioncukianqguitfoemrountiitloirziCn-g8thien ngerowulnydiwnasttealrleidn tmhoeniotvoerribnugrdweelnlsa)n,dainndtihnesuunrdfearcleywiantger at e(xCi8stpilnugmleocdaetliionnesaitdieonntiwfoircdkipnlatnh.e CTohneserenstulOtrsdeofrc,onwtaisnaunedacmtoivniittyorreincgomomfegnrdoeunddiwnattheer aconndtisnuurefsacoenwaatqeuraratreerplryebsaesnits,edwhinilSeecstuirofnac6e.3-.w1a,teMromnointiotroirnignogoffCC-8-8inisgcroonudnudcwtaetderon a wmoansthrleycboamsmie.ndeIndaidnditthieonC,-8sapmlpalminegdoelfiLneeaetiCornecwko,rwkhpilcahn.crTohsissessathmeplsietewabosundary, also prreec-oexmimsetinndgesdurtofaecvea-lwuaatteerCm-onictoonrcienngtrpaotiinotn.s fTuhrteheDrrdyoRwnusntcrreeacmk fbregoimntshae ltahnedtfoletohfatnhe _ andl nd then discharges to Lee Creck, which discharges fo the Ohio River. This @ sample was collected, and the C-8 results are presented in Section 6.3.1 C WirR es S 000074 C800 SummaryReport Dry Run Landfill 6.4.2 Surface-water Field Reconnaissance at the Dry Run Landfill CthoendDurcytiRnugnfLiaelnddfrielcloannnadissasmapncleintgo siudrenftaicfeywaadtdeirtifornaolmsnuerfwacloec-awtaitoenrsfiedaetnutriefsieldocdautreidngat this effort was a C-8 plume delineation recommended activity. Field reconnaissance was performed (during drought beyond those locations that conditions) and no new are currently sampled. surface-waer features were identified 6.43 Installation of New Wells at Dry Run Landfill SCi-xapdlduitmieondaelliwneelalticolnuswteorrsk(polvaenrbtuorbdeetntearncdhabreadcrtoecrki)zewtehreebiendsrtoalclkedatasthperDorpoysReudnin the gLarnodufnidlwlattoerfufrltohwerddireelcitnieoant.e CD-u8ricnognciemnptlreamteinotnsatiinognorofufnidewladtaecrtiavnitdietso, roev-eervabluuradtee.n was wmeirneimianlstaolrlewd.asFdirgyuartem6o.s2tshloocwastitohnes;lotchaerteifoonrsoe,failvlemboendirtoocrkinwgelwlesllanadt tohneeDwreyllRculnuster cLoannsdftirlulctiinocnluddiianggrtahmeslfoocratthieonnseowf wtehlelnse,walrye pirnsotvaildleedd mionnAiptpoernindgixweDl.ls. Well Tcohnefigeromlporgiecvailoulsogisntfeorrprtehteatfiiovnesobfesdurbocskurwfealclse acnonddtihteioonnseatwetlhlecDlrusyteRruinnsLtaanldlfeidlli.n C3lQa0y,2 ssialntdysctloany,e oarndflslilmtastteorniealseipsaruantdeedrlbayinlbayyerbsedorfocshka,lec.onsFiurstthienrg,ofthaeltneernwatgienoglolgaiycerlsoogsf also confirm that the lthologic units are essentially horizontal. New to our geological ainstAer-pZroentaet,ioBn-Zisotnhee,iadnendtCif-iZcoantieo.nofTthherseeezoinnedsivairdeuadliswcautsesre-dbeianrdientgaibledinroScekctzioonne6s.5l.a1b.eled 6.4.4 Dry Run Site Conceptual Model Refinement `nTehwe fdiantaal graetchoemremdendudreidngacctoimviptlyetfoirontohefDTrayskRsuAn,LBan,dafinldlCwaisntothae rienvtiesgerdatSiConMo.f aTllhitshe activity has been completed, and the revised SCM is presented in the following section. 6.5 Revised Site Conceptual Model T(gheeolroegvyi,sehdydSrColMogiyd,eahlyldyrsohgoeuolldogayc,cugrraoteulnydwraeptreersefnltowt,heancdurwraenttereqnuvailriotnym)eanntdalcusrertetinntg hDurymaRnunheaLalntdhfialnld. eTcohleogfioclalloweixnpgossuercteiponasthpwreasyesntfotrhethreecvoisnedditSioCnsMaitnadnedtasiulrrounding the 6.5.1 Current Environmental Setting Geology "FTihgeurleoc6a.t3.ionTswoof fcoruorssc-rsoescst-isoencst,ioAn-sAd"evaenldoBp-eBd',fowretrhee DprreyseRnutnedLainndtfhiellCoamrpeislhaotiwonnionf Historical Data Report (DuPont, 2002b). Cross-section A-A" was based on minimal data. @ `iTnhcilsuodreisgminaanlycorofstsh-seecnteiwonwhealslsbeinesntaalbleadndionn3eQd0,2a,nwdaasngeenwercartoesds.-seTchtiisonnAe-wA'c,rowssh-iscehction WViRmoCgonG,atOaFSummary to fr Fob 5.00 000075 = C809SummaryReport Dry Run Landfill @ ris A-A", which runs northwest to south east along the northeast side of the landfill, is landfill, has been modified slightly but the basic information in the cross-section remain. The modified cross-section B-B" is presented in Figure 6.5. In addition, cross-sections A-C' and D-B' (see Figures 6.6 and 6.7), which include the new wells, were developed. Cross-section A-C runs from the northwestto the southeaosnt the southwest sideofthe landiill. Cross-section D-B" runs across the cenotfethre landfill crossing from the northeast 0 the southwest. "The Dry Run Landsil is situated on 2 heavily dissected plateau consistingof several steep V-shaped valleys. Residual soil covers most landfill areas. In general, the soi at the site has been described as residual in nature, consisting primarily of heavy clays derived from the weatheringofshale. A geotechnical investigationof the overburden underlying the Dry Run Landfill was completed by DuPont (1996). The investigation consistedof advancing soil test borings, test pits, laboratory testing of soil physical properties, stability analyses, and setllement analyses. DuPont (1996) determined that the natural residual soil underlying the landfilled materials consistedof fF to very hard silty clay and clayey silt with occasional rock fragments and a traceof sand. The thickness of this natural soil ranged from 1210 28 feet in the test borings within the landfilled area. In 1989, a monitoring, well installation program, performed by Tetra Tech Richardson Inc., indicated similar siltyclay and weathered shale overburden. Currently, there ar five monitoring wells that `monitor the water-bearing overburden (DRMW-6A, DRMW-12A, DRMW-12B, Oo DRMW-13A, and DRMW-21A) at the Dry Run Landfill (sce Figures 6.4 through 6.6). `Completion depths for these wells range from approximately 12 t0 20 feet bgs `The underlying bedrock at the Dry Run Landfill consists of inter-bedded red and varicolored sandy or calcareous shales, and gray, green, and brown sandstones and/or siltstonesofthe Permian age Dunkard Group. Based on the new geological data, three separate water-bearing silstones and/or sandstone units have been identified within the bedrock at Dry Run. These zones are shown on the cross-sections when possible. These are labeled the A-Zone, the B-Zone, and the C-Zone, with the A-Zone being the uppermost unit and the C-Zone being the lowest uni bes. The A-Zone is laterally continuous under most of the landfill area, while the B-Zone is known to be laterally continuous under the toe of the landfill in the northwest. None of the new wells were drilled deep enough to encounter the C-Zone. The B-Zone was not observed in DRMW-14, the well ocated furthest to the southeast. However, no additional sandstone or siltstone units were encountered under the A-Zone at the projected elevation of the B-Zone. The DRMW-21B. C-Zone was only encountered at the furthest northwest location, Hydrology, Hydrogeology and Groundwater Flow Hydrology "The Dry Run Landfill i situated on a heavily dissected plateau consistingof several stecp @ V-shaped valleys. The Dry Run ereck drains the valley in which the landfill i located. TCG Sony fe Fo5.03 5 000076 C-8 Data Summary Report Dry Run Landfill e Q. @ jMoainnsyuspmawlilthttrhibeutNaorritesh dFiosrckhoarfgLeeferoCmretehke. nearby valleys into the Dry Run creek before it The installationof landfill cap and a leachate collection system at the Dry Run Landfill encompassing the inactive lower haoflthfe landfill was completed by Potesta & Associates, Inc. in 1999. Leachate from the landfill discharges intoaleachate collection sump located northwestof the landfill (see Figure 6.2) through perforated pipes buried at the low edgeofthe fill area. The leachate is pumped from the collection sump to a 50,000-gallon collection tank located at the topofthe hill. Leachate is pumped from the collection tank to a tanker truck, which is then hauled to the facility for treatment in the `wastewater treatment plant. Six surface-water sampling points are located near the toe of the landfill (see Figure 6.2). Four of these six points are man-made monitoring points associated with the leachate collection system and the lower landfill cap. Two points, SS-1 and SS-2, monitor surface `water in streams located near the toeofthe landfill. Ultimately, all ofthese surface-water `monitoringpoints discharge into Dry Run creek. Dry Run creek ultimately discharges into Lee Creek. Lee Creek discharges into the Ohio River. Hydrogeology Groundwater occurs in the overburden and the underlying bedrock aquifers. A total of 22 `monitoring wells were installed at the Dry Run Landfill to monitor the overburden and bedrock aquifers. Currently, five overburden wells and 10 bedrock wells still exist. The other seven wells were abandoned in 1999 by Potesta & Associates, Inc. as required by the permit because these wells were not being utilized for quarterly monitoring (Potesta & Associates, 1999). Groundwater Flow In the 4Q02 Surface Water and Groundwater report (DuPont, 2002k), revised groundwater elevation maps for 2Q02, 3Q02 and 4Q02 were generated. These maps did not include data from the new wells because the site conceptual model had not yet been revised. Using the new geological interpretationof three distinct water-bearing zones and using groundwater elevation data from the new wells, new groundwater elevation cmoanptsouarremaprpessewnetreed cionnFsitgruurcetsed6.f8oratnhde6A.9-.ZoTnheeagnrdoutnhedwBa-tZeorneeleuvsaitnigon4Qm0a2p dfaotra.theThese A-Zone (see Figure 6.8) shows that overall the direction of groundwater flow is toward the west. DRMW-14 was not used in the construction ofthis map because it is an open `hole well and water levels measured in this well may be influenced by shallow water `bearing zones that are higher in elevation than the A-Zone. Figure 6.9 shows the. direction of groundwater flow in the B-Zone. The groundwater contour lines on this map are dashed because there are very limited data for the zone. However, groundwater flow dtihreeucntdioenrliynitnhgisthzeonCe-Zaolsnoeicsagnennoetrablelydettoewramridntehdebweecsta.useGrtoheurnedswaotnelryfolnoew wdeilrlecitnitonhsein zone. However, a downward vertical gradient is indicated from the A-Zone to the B-Zone and to the C-Zone based on groundwater elevations observed in the three zones. TEC wa Fo 5 ee % 000077 8001s SummaryReport Dry Run Landfill Water Quality Groundwater Quality Groundwater quality data for the Dry Run Landfill were presented in detail in Section 63.1. Fifteen wells monitor the overburden and the three underlying water-bearing zones (A-Zone, B-Zone, and C-Zone) a the Dry Run Landfill. Thehighest concentrations of C8 measured in the overburden and underlying zones are found in the wells that are the closest 0 the toe of the landfill. The highest C-8 concentration measured in groundwater a the Dry Run Landfill is 20.9 ug/l, significantly lower that the CATT-cstablished C-8 SL of 150 ug/l. The highest concentrationofC-8 in groundwater used as drinking-water source by residences located within a one-mile radius of the landfill was 0.422 ug/l. The highest concentrationsofC-8 in groundwater used as non-drinking-water and unused sources by residences located within aone-mile radiusofthe landfill was 0.54 and 0.974 ug, respectively. These values are also significantly lower that the C-8 SL of 150 ug/l Surface-water and Leachate Quality Surface-water and leachate quality was discussed in detail in Section 6.3.1. Surface- water and leachate sampling points have been monitored at the Dry Run Landfill. The leachate samples have shown the highest C- concentrations with a maximum concentration of 704 ug/l. It is expected that leachate from the landfill would have the highest concentrationof C-8 because the source for the C-8 i likely the landfilled SQ `materials. Leachate at the Dry Run Landfil does not discharge to surface water. It is collected at the landfill and is treated at the facility. Six ofthe surface-water sampling points are located in the vicinityofthe toeof the landfill, and four of these are associated wthiethotthheerltanwdofisllamcpapl.ingThpeoinfotusrlsocaamtpeldinogn psotirnetasmasstshoactiadtiesdchwairtghetshteorlmasndvfaitlelrcfarpofmlothweianrtcoa. `The maximum concentration measured for these six sampling points has been 87 ug/l. `The other sampling point is located at the western property boundary. The highest concentration of C-8 observed at this location has been 39 ug/l although, sevenofthe 11 samples collected from this point have had C-8 concentration less than 10 ug/l. With the exceptionofthe leachate samples, the C-8 concenration ofall surface-water samples have been less than the CATT-established C-8 SLof 150 ug/l. Further, these concentrations are significantly C8 (C-8 ALAC) of 1,360 ug/L less than the Aquatic Life Advisory Concentration for 6.5.2 Current Human Health and Ecological Exposure Pathways "The main objective of the Consent Order was to determine whether there has been an impact on human health and the environment as a resultofreleases of C-8 to the aesnsvoicrioantmedenltanfdriolmlsD(uLPoocanlt,oLpeetraartt,ioannsdaDtrtyheRWuans)h.inTgotmoeneWtotrhkissofbajceicltiitvyea,nhdutmhaen health and ecological exposure pathways both on-site (a the Dry Run Landfil) and off-site (adjacent to the Dry Run Landill property) must be evaluated. The human health and S ehcuomlaognicaanldeexcpoolsougriceaplartehcwepatyorssecotni-onasnbdeolfofwsidtee.scrPiobteentthiealpoetxepntoisaulreexrpooustuesreweroruetes for VWiWrogonO.t0a8 Srey en fo Fo 5,63 5 000078 8008 Summary Report Dry Run Landfill @. @ ehevaalltuhataenddaencdolcolgaiscsiaflieedxpaosscuormepplaetthewoaryienvcaolmpulaettieo.n Table for the 6.5 summarizes the human Dry Run Landfill. To be conservative, for each complete exposure pathway, the maximum C-8 concentration `measured in the C-8 impacted media is compared to the C-8 SL, regardless of media type. On-Site Human Health and Ecological Exposure Pathways Current Environmental Setting `The on-site current human health and ecological exposure pathways section describes the potential exposure routes for human and ecological receptors that are found at the Dry Run Landfill. On-site human receptors include authorized facility workers and facility visitors. Ecological receplors include animals living within the landfill boundaries. Potential exposure routes were evaluated and classified as complete or incomplete Access to the Dry Run Landfill by is controlled by electronic gates on the major roads and locked gates on smaller roads. In addition, because the landfil is active, there is a crewofworkers in the central portionofthe landSill area during normal working hours. `The institutional controls and the daily activity discourages trespassers on the site. Direct contact with landfill materials or soils impacted by the materials in the inactive, lower halfofthe landfill i incomplete due to the leachate collection system's geotextile and `geomembrane cover. However, direct contact with landfilled materials or soils impacted by the materials at the limited to the workers active, upper haolfthfe in active portionsof the llaannddffiillll is a complete pathway and is Pcroevceirpiatnadticoonntfaalcltintgheinlatnhdefiulplpeedrmhaatlefroiaflsthaes liatndmfiiglrlamteasydionwfinlwtarartde.theHosowielvaenrd, vtehgiestative impacted surface water flowing within the landfill wil be collected by the leachate collection pathway. system. Contact with leachate captured at the landfill is an incomplete If this impacted surface water migrates downward through the landfilled materials, it may edvoewnntwuaalrldy caosngtracotuntdhweautnedrerilntyointgheshbaeldersoacnkdaqsuainfdesr.tonCeoonfttahctewbietdhrogcrkouannddwamtiegrraitse considered to be an incomplete exposure route. The water-bearing zones that arc `lamnodnfiiltlo.reIdnatthtehelolwanedrfielnldoarfetlheocaltaenddfaitlls,evtehreaAl-hZuonndereidsseoxfpfoeseetdbaglsthate tshuerfuacpep.erHeonwdevofert,he 1en0dsoefeptshewelranedfoiblls,erthveeddeipntthhetoargcraosunwdhwearteerthiins tzhoeneoviesrebxuprodseedn.is I5ntaodd8itfieoetn,bgisn;the lower therefore, contact with this groundwater as an exposure pathway is also incomplete. CcoonmtpalcettewietxhpoCs-u8reimppaatchtweady.surHfoawceevweart,erthniesaerxtphoesutroeeopfatthhewalyandifsilllimiistcedonbseicdaeurseed saite wmoarnkaegrisngfoslulrofwacheeawlatthearnadt tsahfeestiytep.roTcheeduCr-e8s c(io.nc.c,enpterrastoinoanl mperoatseucrteivdeienqsuuirpfmaecnetw)awtehrenin tahnids asirgenaihfiacsanrtalnygleedssfrthoamt 0t.h5e4Ct-o88A7LuAg/Cl, olefss1,t3h6a0nutgh/le. C-C8onStLacetstwaibtlhisCh-e8d ibmyptahceteCdATT surface water at the property boundary is also a complete exposure pathway for human 3an9duegc,olowghiiccahl raerceepbteolros.w tChe-8C-c8onSceLntarnadtairoenssiagtnitfhiiscalnotclaytiloonwhearvteharnantgheedCf-r8omAL0A.8C8.toIn TACDotSarena ot Fb 5.03 Sanpete = 000079 2 Oats SummaryRor Dry Run Landfill wadedrietiloens,sCt-h8anco1n0cuegn/tl.ratTihoenrsefmoeraes,uarletdhoiungthhethsiesveexnpoofsutrhee p1a1tshawmapyleisscformopmlethti,s litocisation limited due to the low C-8 concentrations measured. Offsite Human Health and Ecological Exposure Pathways Offsite human receptors include residents using the water sources sampled during the `wgartoeurnsdowuartceresweslalmpalneddwdautreirn-gustehesugrrvoeyu.ndwEactoelorgwieclallarnedcewpattoresr-iunscelusduervleiyv.estock using the West Virginia One-Mile Radius Groundwater and Surface Water Direct exposure to C-8 impacted surface water and groundwater is considered to be an incomplete pathway in situations where the water source is not used. The pathway is cwoantseirdpeurrepdotsoesbeal2tchoomupglhetthee peaxtpohswuaryewihsecnontshiedewraetdertosobuermceiniismuasledbebcuatunsoettfhoerwdartienrkiinsg- 0n.ot54inugg/els,iewde.llTbheelhoiwghtehsetCC--88ScLonocfen1t5r0atuigo/nl (inWaVDnoEnP-d,ri20n0k2i)n.g-wTahteerpsaatmhpwlaeywisas considered to be completeifthe well is used for drinking water. The highest C- concentration measured in drinking water was 0.422 ug/l, significantly lower than the CisATcoTn-scisdtearbeldistohebde Cl-im8itSeLd odfue15to0tuhg/el.loTwheCr-e8focroen,cetnhteraptaiiohnwsamyeaissucormepdl.ete, and exposure Onuetasairdeproifvattheeroensied-emniclee. raTdhieus,C-a8scuornfcaecnet-rwaattieornsmaemapsluerweadsintatkheenLreoemCrteheekLweaesC0r.e2e8kug/l (noDnu-Pdornitn,ki2n0g0-2wga).terAtputrhpiossseasmaelsroeswiedrenecse,amapdlreidnkainndg-awnaatleyrzewdelfloranC-d8.a spring used The C-8 for concentrations measured in these water sources wereND and 0.331 ug/l, respectively. The exposure pathwaysfor these water sources are complete. However, all theeof these. concentrations measured are significantly lower than the C-8 SL. 6.6 Dry Run Landfill Summary Many different activites have been conducted at and around the Dry Run Landfill in eorndveirrotonmdeentteramsianerewshuletthoefrretlheearseeshoasfbC-e8ntaontihempeancvtiornonhmuemnanfrhoemaltthhealnanddftihlel. The C- `cmoonncietnotrriantgiownelilns,grporuondducwtaitoenr waenldl,suprrfiavcaetewawteelrlsf,rsopmrimngasn,yasnoducricsetse(nosn)-swiates, moeffa-ssuitree,d. Based on allof the data evaluated for the Dry Run Landfill, the following observation were made: 2 Trehceepctuorrrsenctonetxapcotswuirtehpoant-hsiwtaeysleaarcehaitnecaomnpdlgertoeufnodrwahtuemr.an and ecological Q aHnudmsaunrfauncde weactoleorgiarcealcurreceenpttloyrccoomntpalcettewietxhpoCs-u8reimppaatchtweadysl.andHfiolwlemvaetrer,iatlhse,sesoils, pathways are considered fo be minimal because of institutional controlson the property, personal protective equipment wom, and health and safety procedures @ twhhaetnarmeainnapgliancge athned lfeoalclhoatweedcowlhleecntewdoratktihneg DwriythRournaLraonudnfdiltlheanadctsiuvreflaacnedfwialtlearnd T Winogon E 02 SomanS nf Fob 5.63 -- = 000080 8009 SummaryReport Dry Run Landfill 9 Contact with surface water exiting the site that has been impacted by C-8 is also & currently a complete exposure pathway for human and ecological receptors. The highest C-8 concentration measured in surface water exiting the site was 39 ug/l, which is lower than the CATT-established C- SL of 150 ug/l and lower than the C-8 ALAC of 1,360 ug/l (Menzie-Cura & Associates, 2002). C-8 concentrations measured in sevenof the samples taken at the property boundary were less than 10 ug/l, indicating that while this exposure pathway is complete, exposure is limited becauseofthe low concentrations of C-8 detected. Q Current off-site exposure pathways for human and ecological receptors that are `complete but limited, due to the very low C-8 concentration measured, include: residential drinking and non-drinking-water sources. For the drinking and nondrinking-water sources, the highest C-8 concentration measured were 0.422 and 0.54 ug/l respectively, which are well below the C-8 SL of 150 ug/l and the C-8. ALAC of 1,360 ug/l (WV DEP, 2002; Menzie-Cura & Associates, 2002). Q Evaluationof the C-8 results measured at the Dry Run Landfill, of the `groundwater flow direction at the landfill, andofthe one-mile radius C-8 results shows that C-8 impacted groundwater is not migrating off-site. Q The on-site C- results for groundwater and surface-water support water transport as the migration pathway for C- from C-8 containing landfilled materials to surface water and groundwater. However, the Dry Run Landfill is located within eight miles southwestofthe facility. Therefore, air transportof C-8 by air oO emissions from the facility cannot completely be ruled out, and may be the source of C-8 for the very low concentrations measured within the Dry Run one-mile sampling area. VWirAingiIonD,KoOtFaCSum:ma8ry ner a Feb. 5.09 -- 000051 w 80a Summary Report References @ 7.0 REFERENCES DuPont 1990. Washington Works 1990 Preliminary Hydrogeologic Assessment. Solid `Waste & Geological Engineering Department. 1992. Verification Investigation E.I DuPont de Nemours Co. Washington Works `April 1992. (Vol. 1). 1996. ReportofGeotechnical Investigation Dry Run Landfill, Washington `Works Main Plant, Parkersburg, WV. Geotechnical Group, Civil Engineering Systems, DuPont Engineering. 1999. 1999. RCRA DuPont Facility Investigation Report, DuPont Washington Corporate Remediation Group and URS Diamond. Works, June 30, 2000. Letart Landfill Groundwater Protection Plan SWINPDESPermit No. WV0076066, January 7, 2000. DuPont Corporate Remediation Group and URS Diamond. 2001. Certification Report Letart Landfill Cap Construction, June 2001 `Corporate Remediation Group. 20024. One-Mile Radius Survey and C-8 Sampling Report and Ohio River Public Water Supply Sampling, DuPont Washington Works (December 2001-February 2002) January 2002. DuPont Corporate Remediation Group and URS Diamond. 2002. CompilationofHistorical C- Data, DuPont Washington Works Main `Plant and Landfills January 2002. DuPont Corporate Remediation Group and URS Diamond. 2002. Proposed Groundwater Monitoring Planfor Washington Works Facility `PlantandLandfill January 2002. DuPont Corporate Remediation Group and URS Diamond. 20024. Email with attached map from Andrew Harttenof DuPont to the `Groundwater Investigation Steering Team 2/25/02. 2002. C-8 Plume Identification/Groundwater Assessment Work Plan, DuPont Washington Works Facility and Local, Letart and Dry Run Landfills May 2002. DuPont Corporate Remediation Group and URS Diamond. WWimCingEonO, m08 Samay oa Feo 8.0 000052 oF C8 00a SummaryReport References . & Jo2r00W21a.shJianngutaorny W2o0r0k2sGlraonutndWwaastheirngItnovens,tiYga,tioJnanQuuaarlyit2y00As2suDraunPcoentPrCoojrepcotrPaltaen Remediation Group and URS Diamond. 20028. May 2002 Groundwater Investigation Quality Assurance Project Plan `Addendumfor Washington Works Plant Washington, WV, January 2002. DuPont Corporate Remediation Group and URS Diamond. 2002h. Two-Mile Radius Survey and C-8 Sampling, DuPont Washington Works Facility/Local Landfill, West Virginia (March-May 2002) August 2002. DuPont Corporate Remediation Group and URS Diamond. 2002. One-Mile Radius Survey and C-8 Sampling Report, Washington County, Ohio (March - June 2002) August 2002. DuPont Corporate Remediation Group and URS Diamond 2002]. Tiwo-Mile Radius Survey and C-8 Sampling Report, Washington County, Ohio (June - September 2002) `Group and URS Diamond. December 2002. DuPont Corporate Remediation 2002K. Fourth Quarter 2002 C-8 Surface Water and Groundwater Monitoring `WRaesphoirntgFtoorn,WWasVhiDnegcteonmbWeorrk20s0F2a.ciDliutPyoanntdCLoorcpaolr,aLteetRaretmeadnidatDiroynRGurnouLapndafnidlls URS Diamond. L2e0t0a2r1t.LOanhdifoilRlivNeorveWmabteerrS2a0m02p.linDguPReosnutltCs,orWpoarsahtiengRteomnedWioartkisonFaGcriloiutpy aanndd tUhReS Diamond. 2002m. DuPont 3002 and 4Q02 Public Water Supply Results, Washington Works, Washington IV November West Virginia 2002. DuPont and Ohio, Corporate. Remediation Group and URS Diamond. 20032. Revised Groundwater Flow Model, DuPont Washington Washington, WY January 2003. DuPont Corporate Remediation Words, Group and URS Diamond. ____W2o0r0k3sb.FaNcoilvietmybaenrd 2Lo0c0a2l,SuLreftaacrte aWnadteDrrMyoRniutnoLrainndgfiRlelpsorWtasFhoinrgtWoans,hiWngVtoJnanuary 2003. DuPont Corporate Remediation Group and URS Diamond. Exygen.Ex2y0g02e.n RPeesresaorncahl,CIoncm.maunndicMaitcihoanelbeDt.wAeuecnoiJno,hnPrFoljaehcetrtCyh,eOmpiesrta,tUioRnSs MDainaamgoenrd,. WiWniNngiCan,DoOtFa Summaroynfol Fe 5.03 -- 000083  oats Surmary pr References Menzie-Cura & Associstes, Inc. 2002. Final Report, C8 AssessmentofToxicity team (CATT) Report Addendum Aquatic Life Advisory Concentrationfor C8. PotestaM&VWA-s6s,ocMiWa-te1s0,,InMc.W-119909.AbaMonndiotnomreinngt RWeeplolrstM,WD-r1y,RMuWn-L1a4nd,fiMlWl,-4D,uPMoInVt-44, Washington Works. March 1999. Simard, C. M. 1989. Geological Historyof the Lower Terraces and Floodplainsof the Upper Olio River Valley, Open File Report, West Virginia Geological Survey, 160p. Schultz,RiRv.eAr., W1e9s8t4.ViGrrgoinuinad.water Hydrologyof the Minor Tributary Basinsofthe Ohio "Tetra Tech Richardson. 1990. Monitoring Well Installation Program at Letart Landfil-l Summary Report, August 1990. USEPA. 1994. Region 111 Modifications to National Functional Guidelinesfor Organic Data Review. WVDEP. 2002. Final Ammonium Perfluorooctanonate (C8) Assessment ofToxicity TPreoatmect(iCoAnTT) Report. August 2002. West Virginia Department of Environmental WWKCEDoaSumma --emfenlFb 5.03 sigrs.08 & 000084 2& 8 000055 || [] | | Table 3.0 SDuumPmoanrtyWaosfhOifnf-gstiotenSWaomrpklsinFgacPilriotgyraanmd (LCo-c8aSlaLmapnldifinlgl) Washington, WV RESIDENTIAL SAMPLING FOR{-MILERAD& +I7)UiS| Number Number of homes contacted of homes surveyed of | ar | 269| NNunmbbeerr offuweelllss isdeanmtipfoiedd 4 | __51__| Numba et sample rtare use forain ste] 0 | 2 Number of cisterns sampled EE o Numberofcisterns sampled that are used for drinking wae] 0 | he 2 & Numberof springs identified Nuofm sprb ingsse ampr led |@ 4 Number of springs sampled that are used for drinking water| 1 | Total number of collected samples used for drinking water] |] Note: Feld duplicates not considered in sample court, "Dcuornitnagctteidstoindveestteirgmaitinoen,rehsiodmeenotiwanlewrseiersiusdaegnet.s idUepntitfoitedwowictohnitnatchtesswaemrpeliantglermapdtiouds awlere reeascihdernecsei.denBceec.auAsefrnotthaelsheocmoenodvwcnoenrtsaicrteastildeemnpcle,sarveoslupnotnadreydstuorvheey wsuarsvelyo,ftathetnhuember of residences surveyed i less than the numofbhoemers contacted. 2Ssoammpelewda.teIrnsmoaunrcyecsas(ee.sg.. wsealmlsp,licnisgtoerfntsh,essperiwnagtse)risdoenutricfieesdwdaursinrgeftuhseedsubryvetyhewere not dhaommeaoguende.rsiArsesaidceonntsse.queInncoeth,etrhceanseusm,bethreowfawtaetrersosuorucrecsewsesraempellheedrwnats alecscsestshiabnlethoe.r number of water sources identified. 21412003 000086 Toft Tab 3.0 Consent Order T&F xis Table 3.1 Summary of C-8WaAsnahliyntgitcaolnRWeosrulktssFIanciGlritoyuanndwdaLtoecralanLdandSfuirlflace Water(ugh) (Off-site Wells, Springs, and Cisterns - One Mile Radius) `Washington, WV [------OSWILCO1X.72AlDunt kingmWatz e 002v] ier | |OSOBSLABNUKRECNHSAHRIDPARI 21/1/29/0200022]] 00741156]] UUnnuusseedd | WWeellll [O[ [S __ _ COCO HO RANSG]S C17A 2255C 2200N0022]A MI3Y 21_ 663331i IrUUUO nnn7 uuussseee2dddN | 0||W 08I v] wieielrllll [ [OOSSCCOORWBAINTITWG|I 32127022000022]] 01a4s3|] UUnnuusseedd || O [OSCREEWKIT iz7o002l 27] Unused | wWeellll Well | [osOSCDRAEVEISI iir/oo7i22000022]]--7ar36l] |OSEARINET thor2002] G60 UUnnuusseedd Mise. |__Wewalill | wer | [[--OS_ OHENSD_ RITCRAS_ AIKO 1E226W5220S 00A022]]SFH0OU 3154.7T702]7R i/WB aUtUiennruuassE Ceeaddlre E 2|||0C 02T WWwee]wllell [ [ [-- O OSM_ IS LLEO RL J S i1/iA 1va5iz/or2L 020000R 0222]]]AE3W 0089.6W 5a76]S ] A O UUMnniuS usssN cee.ddH D|||C H2 ] vviiieeerll] [ |OSORSIRCIHDALRDESDVI] 227/172000012] [OSWAYBRIGHTO 1/15/2002 25327a] 0252 UMniuses.ed || WWeellll Unused| Well |[----_I O 1/10S /2002W ] H2I 3]TA UnuK sed ER | KW|ell |OSSHOCKEYGI 1272002] 1.30] Unused| Spring] vases 425m Taz Tab31ConsentOrr TFs. 000087 Table 3.1 & `Summary of C-8WaAsnahliyntgitcaolnRWeosrulktssFIanciGlriotyunadnwdaLtoecralanLdandSfuirlflace Water (ug/l) (Off-site Wells, SprinWgass,hainngdtCoins,teWrVns - One MileRadius) IoSosCmamo er]e wSor T1a 56 re ew teisa e ns --o --Ccwer emn=) 1 oaaan1 osemn [iter= WJ e aetaiesonwaetstsmre eaomnocnto,nperrentr ------ rooaeRrutpetion--ro-- b or wa sonnei cl cs Ptr esd vesatns azsm 2a T0531 Comrie The 000058  Summary of Off-site Table 3.2 Sampling Program (C-8 Sampling) Washington WorksDuFPacoinltitWyaasnhdiLnogctaolnLWaondrfkilsl Two-mile Radius CT RESIDENTIAL SAMPLING FOR TN HE 2:MILT E RADR I&iUS +7 | 1 Numberof homes contacted `" Number of homes surveyed "|1__09| | -- Number of wells identified ?] 08 | Numberofwells in sampled |__52__| | :2 z Number of cisterns identified o Number of cisterns sampied| | 5| | d Number of cisterns sampled that are used for drinking wae] 0| Number o springs dented ]__7_| Humberof sprigs sami vtas uss ornrg a. |HE-- Toil numberof sample5d|] Note: ied duplicates not considered in sample count wDuerriengcohnitsaicnevdesttoigdaetitoenr,mihnoemeroeswindeerntsiiaelswiacteenrtussadgee.ntUepdtwo itwioctohnetascatmsplwienrgeradius awtaosmlpofttead tathearceshidreesnicdee.ncBe.ecaAuftseer nhoet asllechoonmdeocwonnetracstiraeesrimdpotn,c3evsoflounhtoarsyursvueryv,ey the number of residences surveyed is les than the numbar of homes coniaclod Snootmseamwpalleedr.soIunrmceasny(e.c9asewse,llss,acmipstienrgns,ofstphienseg)waKteenrisfoeudrcdeusriwnagsthreeussueedybywethree Homeownersiesident. In other cases, te wator sources were aiher not @ wacacseslseisbsltehoarndtahmeanguemdb.erAosfawactoenrsesqouuernccese,dethnetendu.mberofwater sources sampled 000059 2742003 Toft Tab 3.2 Consent Order TaF xis Table 3.3 (Offsite Wells, Springs, and Cisterns) `Summary of C-8 Analytical Results in Groundwater and Surface Water Washington Works Facility and Local Landfill Two-mile Radius Washington, WV F ostEe maci] rasw owtTwDnrw seare [OS-STEPHENSOS| 142002] 0625] DrinkingWater] wal] --oswowANGiEss[u No Gti] I OS BAKERE| R| 37ier2002]NQ Diskmewas al II OSOJSACMOELSVONNAALDl| OSFOUTTBL] 1 --3r3arro9 2006622]] 2 NO((<<0 000.0.015090))9][0 Dri8 nbDkbiirikin0 kiininnnggggWiWwaasa2 tttleeeer]] 02 wwweeelll] wel 'OS-BOSOEC| 3/28/2002] 1 OSTE`WOBSEHRERSYSPOKC]||| --37G2s62720000s2]] 0% Burra ---- el 1 1 N| G (<0.050) OrinkingWater] NO(<0.050)| Drinking Water] Well ell [oo Sw1 1 WT S eATrr CHrEC7RHC OYeL1L0T)S LIt--L 1 spLvTs-- 0nel|| Q| 005FIGOAvRANDEEcSSALWL]-- OSVOSTIF1az002 423952000s2]-- ] GTe1ea5l-- 1iTin oonrsnTivmireLWwataeE T C wpeeld (oSeOSTHIE L SCpN an 0061i ]T Tewar rmkmsw T aia aE ael osoisos msone TS tt e) (0a 010) drMip onnkil nWegal te erWe]ali] OS ARNOLOWGT-- diao0sl ol------pneeUdl --[ --oso woOw"OSaS-uDBrOARS TvKnESeROC]{lN||--Ta w--w es5rem22e00oa00om 22alo !lw m l 007t100s6o 7] r e ne bi UGenouussmoeD ee dst ]------) --e owwaeile]ln oOsS0CmC 5ANSoPABRnETLOoLRGLETT S53130s 20s02]o -- 00008071g -- ]{e e O boesa ed-- e u viael) | oGSw5ARnEEEDwERSHIIIlSS1aaz0s02s]o1.1g 7sage ------e oel -- oossTuToAENRTEoMEsSvaaooo-- opm -- oope ed-- n Vl oY e --c --1-- "OSMOREHEADV| Ee |E-- rT -- fr. yore Tab Const Order Tas 000050  Table 3.3 Summary of C-8 Analytical Results in Groundwater and Surface Water (Off-site Wells, Springs, and Cisterns) Washington Works Facility and Local Landfill Two-mile Radius Washington, WV [[ [ ------G-- SwimO caeItS io 5SSv 0wo2e0mm02oA e]l NU D o0e 0m1G e0) HN GUnen s uD sdedeE e| m vwieall [ [oosswsiwmiimHHwK] semoetoen0soll [osmonARDSC|eos 0t0o92l] ts2l UUnnuusseedd]] wwaallll Unused well [ [A [oI oO STsTAS RTEHURW NRS|Ha3A p2o2Oz2o0c0U L 0e]l--ST E021T 833E 056l]]aR rNNoovirardS nki6innUgnW2uM aastieeo0 rd] A 02S| GSpires]itunogm) [ [ OOSswWeIRUTSZITLLIIaapnsaBp0o0tesll 01:.7672]] NNoonnddrwnikiinnggWWeatre]r] GGiissttor] [ [------os--el--emoelswi-ec]onvO2a2m7rmi|sUUmnnuusseeeds|moaiGsitlsetr] [oosesnPoUvGMHwAzlwsewimeoonel NOG00t50el[Unu Unus sed edGli] estner) DWatiernugsesetinecrlugde Iavesitocknwatberoiings,eg)ardcenaingeanadmaanynociorsnuornphiun.manHann cNoDns=umNpottiDoentewcatteedr autsoes. above the miof detection (LOD). The sted LOD. NisQap=pNrootxiGmuaatneiainfdaov.ariDeestbeyctiendstartuamecnotncaenntdroavteirontaimbeove the LOD and below the fmt of quantification (LOG). 112012008 202 Tab 33 Consent Order TaF xis 000081 SH clare Sam)-S # wes SPA aeveo } aR OA qo To SankES - 19 B 000092 @ Table 3.4 Summaryof Off-site Sampling Program (C-8 Sampling) Ohio One-mile Radius Residential Sampling DuPont Washington Works [ RESIDENTIAL SAMPLING FOR OHIO 1-MILE RADIUS" - | Humbert ores contoa "|__| l Numberof homes surveyed |1__50| Number of wells identified? 78 | -- Number of wels sampled 2 Number of cisterns identified | | I -- | Number of cisterns sampled that are usedfordrinking water - S Number of springs identified EI Numofbsperinrgs sampled |__15_| Number of springs sampled that are used for drinking water HI To umber ofsampled]6] Total number of collected samples used for drinking water Note: Field duplicates not considered in sample count. 9Dwuerriengcohntsacitnevdesttoigdaetiloenr,mhionemeroewsnideernstiiarleswiadteenrtussaigdee.ntiUiepd lwoitthwionctohnetascatmsplwienrgeradius watatsemepftteadt atthearcehsidreenscied.encBe.ecaAufseer nhoet aslelchoonmdeocwonnetarcstiraettseimdpel,ncaevso{luntthaersyursvueryv.ey the number of residences surveyed i less than the number of homes contaced EE3) Snootmseamwpalteedr.soIunrcmeasny(e.cga.sewse,llssaimpsltienrg,ofstprhiensges)wadteernisoeudrcdeusriwnagshreefsuusrevdeybywetrhee, hacocmeesoswinbelresiorredsaimdeangtesd.. IAnshaecroncsaeseqsu,entchee,wattheernsouumrbceersowfewraotereistoheurrcneost samplec was less than the numberofwater sources identified. 000093 2142003 Tort Tab 3.4 Consent Order T&F xis Table 3.5 Summary of C-8 Analytical Results in Groundwater and Surface Water Ohio One-mile Radius Residential Sampling IOOsSwKAARNCTUZMKLPL|___sspoiz000o2l] WD(:00031000 DDiimnikninggWWaatteel| WWell ISHAONsTAIUNE(RGNu)[ si2/o2n0a0l0 0G.9o86i DDiinniknnggWWaatteer]] WWell IososSnwvaaNNPsHe_saiieoooal o0o2s00z DDiinnkiinnggWWaattee|| WWell [ [------o ossc--w soeieri 00sn]c sWO(o a00025l20x 6we aDDiinp nin dnngge WWaatw teo re]l nrs| WWlall I I osoe sPmA cERRL spoE olVR00820s 5 pDDup unnag0 WWaatteerro ]] al WWeell IoOsS(TFOoRLNeGmENCEKKL|Y__ #a1/722000000 _Wo(z000.12007 DDiinniinnggWWaatteerr]] WWeell OOSSMWAATTHHEENNVVAILL[__#wiigz00ooall 0008.0955 DDiinnigngWWaatteer WWeell [[ --------os-- toovo ee] smmaP moolan68.4s 5 o DDiinniN nggWWaatlS eer]] CHvviieell [ [---- ------oo sGs wvoc oelne sln 00.4l110s 62--se DDe iininR nzagWWaaetto eer]]oA osl WWleelll [o E sSwmHPwil--apoboosl r 1.55 Wondinkin7 gWater] --Well I ey [_ OShv_ ANSPIo Al_as pip0o0tA asl] R00M :27756 O NNoonnddiiiR nnkkiinnggWWaB atteerr]] S| WWelll [ [--S OSt #P 5200i 2]e ER 8.e 6 C eNoandmiE nker insgvWaL ateer] A s l wWelll [[ ------osO rucHS ssl|Ss#pH 7o1b72o0o0E a2]l NP D(<000P 9150]5 ANNoonn-R ddiinnkkiinnD ggWWaatteeR rr]] O] WWeillll -- [------o os ssio wie tq eooe r el setb 1s 2210l vwnwUUe nneuusseeo s dd] tAel WWliaelll -- [--OSRO PPETS OK| W @#gieoA eo0oo0eellTS4147O 52 NW UUnnuusseeP dd]] I[ WWiieell [[O----SosPcAoRlSNOsNShDLOZHl]----4RSgi0e0ooeell G2o0r0 UUnnuusseedd] wwiilll I --OsDoAsUGwHoEGReTEYTD[l ssooes]l oo1r6e0t UUnnuusseedd wweilll oosswwioALvANEDwS]_sapsomenoeoll tTairs UUnsuessed] wWeellll I IooocsHweMmEeRDr]| ssopooeoel 0afe3t UUsseedd] WWeallll I oSosc Franu sioom n]__m see0EoalVWI OOM T167ISiUUnnuue sseedd00l Wwiillll ooswsiSiTmAMMsPGAl SSEeeE0ol eoes UUnnuusseedd wViealll | oos sstaSiPRt sl asmpsaoR tel es61al 11 wrs UUnnuussm eesdl_o___d_Wvel ilell (__o_s smsew oelat osehen Unusv ed e] Wall B 11012000 Tolz Tab 3.5 Consent OrderTAFals 000094 Do Nor SEE FRAAToA + PRICE [dLAnD Pom W iL oma 000095 Table 3.5 & `Summary of C-8 Analytical Results in Groundwater and Surface Water Ohio One-mile Radius Residential Sampling [G OsoAsMo vBaAUrGeT HsN| r sssmvwaesRo osooessllMP 1546222S 0 ON UUUnnnuuusssA eeeaddl Mw] WVleiellll [oshema omwes See [OSRaA rri/20U 0el GH 5.56 S Non-aP nkingWaG ter] I| Spring [ [O OS SRRAAUUCGHHSSPRGSG|] aarrrii1//a2000088]] |OSWATSONWPz| arra00el 45.5776 NNoonn--oirnnkkiinnggWWaatteerr]] 1.1 NowdrungWate SSpprriinngg Spine |OSWATSONWPS ariar00el 236 NondrningWater] Spring [[ -- --osc_ sTosO i| sgwmc maisll is 5413TNNooo nnddiinnkkB nnaVgiWeatt teel eSSl ppruinngg] - [ [_ oO SS SwT iswT mzeoosA 0eelERP L 51..2461H E NoonndA diiV miinnggW WWaE atteer L DI | Giisainn]] OD [ = --O stS omB s A oirzoR 0al I m C6.7K 40 M o RoowdoiA ilningN WaterG g ] HcCi] ssto]n] cW* oaDnlrseiunrkmiupnstgeisoWnaitnwcealrtued(reiugIsheeiss.tgohcike wiantbeorlidngb,lGua)rdinedniicnagteasnhduamnaynoceonrsunmopniihoun.manNon-dinking NIiNsQDap==pNNrooottxiQDmueaattneeiciaftnadeabdtvla.orriDeaesbtbeoycvteneditrhaeutlmicmeoinnttcoafandniedrtaeotcvtieioronnmao(bL.oOvDe).thTehLeOlDisatenddLbOeDlow the limit of quantification (LOQ). 1302008 2012 Tab3.5 Consent Order T&F xls 000096 yo bw WELLS 000097  l Table 3.6 Summary of Off-site Sampling Program (C-8 Sampling) Ohio Two-mile Radius Residential Sampling DuPont Washington Works RESIDENTIAL SAMPLING FOR OHIO 2-MiLE RADIU+S 1" Number of homes contacted "1131 Number of homes surveyed | 733| Numberofwells identified |__12|3 Number of wells in survey sampled | __58 | {2 gz a -- Number of cisterns identified of, | Number of ciserms samples] _3| Number ofspringsidentified EI Number of springs sampled] 1__| Tote numberof sampl6e2s_]| 1 Le Total number of collected samplesused for drinking water] Note: Feld duplicates not considered in sample court. During this investigation, homeownersiresidents identified wilhin the sampling radius were sontacted to determine residential water usage. Up to two conlacis were watatsemlopftteadt attheearceshidreenscied.encBe.ecaAuftseer tnhoet lslechoonmdeocwonnetarcstiraelsteimdpeln,cesvo(loutnhtearsyursvueryv,ey he number of residences surveyed is less than the number of homes contacted. Somewatersources (e.g. wel, cisterns, springs) identiied during the survey were not sampled. In many cases, sampiing of these water sources was refused by the hacocmeesoswinbelresiorradsaimdeangtesd.. IAn osahecrocnasseeqsu,entchee,wathleernuSomubrecreosfwwearteereistoheurrcneots sampled was less than the number ofwater sources identified. 21412008 Tort Tab 3.6 Consent Order T&F xis 000098  Table 3.7 Summary of C-8 Analytical Results Zones A, B and C Ohio Two-Mile Radius C-8 Residential Sampling [ [ A O OS SBeAnownoWmCWAIl77 777202 08 00 1.7102 ] rDr0 ninkkinngg0 WWaattee5 rr]] 0] vViieell [ OSPommgAEl 6202000 1.150] DrinkingWater] Viel [O [S OHS amanGCH ] 75/22o 55/22000008]c NG(<o 00..6054)4]] m DDrriinnkkiib nngg WWaatteerrB ]] | Wweellll | [O--snonsClor2.59i 0 0Drin2 king W0 ater0 ] aW]ell | [OSMc72t 3200a 2 u0.g 064] h Dnnkii ngWatn er] ll Wet [ [-- --O_ SO B77u S 72255722c 000B 0288 ho a 002.70s 505n ]| DDa o rriinnkkiinnn ggr WWaatteea rr]]E FVl |lell [--[----oO SGmS ARlF7@3zi 0250000e 28 Nm O(<00..i 5005)1]] n DDrriinkkg iinnggWWaaW ttee]] vl Veilll [O [OS SHWieKoswnFLd| e7r247E200M8 |_04..w915703r]]NNoon1r-ririr7rkkiinng/g WWaa2tteerr]]002VWe]ellll [--_OS 9/23/e 2000]rm 0.943a ] Drir rking Wi ater] L| Well [ [oO SSS ordoS riepp0n0em ]blo30i .028%r8]] iDw r0inkinrUgnWua2w steerd]0] 0| 8We]ellll [[_GOS 5-WTehloomhausDJB|66]o8.358w0r0]]rNNroonn--rddr0iinnakkiirnnggrWWaa2ttaeerr0]]00022Vv]]iiel] [o [ Sow swei melloarmoen762.|69800o ]] mo UUnnuuss0eedd]]02vvii]eall [OSSemaAl 2000502Non-dnnkingViaier] ister [OSTunczoM| 9752002] 0.974]Non-drinkingWater] Gio [OSCestoHEl rer2002] 0.082] DrinkingWater] vie [ || O [[ --S _O _H_iS gnOellS] D e&/s115/72a 20t00022]]eNNrv DD0((<t080..1001v12i ))]]lDDDririninne nikkiinanngggWWWaaarttteeeJ rrr2]]] 0l 0vVV2iiieeel @_ [0 [O 5SJaKcaoubseCdAKl| 871262//22000028] NNDD((0<0,.0011))] DDrriinnkkiinnggWWaatteerr]] Wvieerr [_OS ori12w 008] e 0.001m ] inkp ing WateN r] | Weil |OSKeiesond|_oT1v2002 0092] DrinkingWater] Well 1102008 Torz Tab 37 Consent OrderTaFals 000059 Table 3.7 Summary of C-8 Analytical Results Zones A, B and C `Ohio Two-Mile Radius C-8 Residential Sampling OSKingCD| 0/16/2002] ND(<0.0n| DiningWater] weil [OSKaWE[ e1t6a/r2a0o0022]] NNDD((<<00.0011))] DDrriinnkkiinnggWWaatteerr]] WVieell | OGSSMSoohtyiDNv#el2y0JH7{2_N_0D0((0<<200.020215)2)] 0D0rDir0nink_kiinn_ggVWNiatteGer]]Weel | [ | OSOS0-StSSipSmiap.doreCltDaF|]E]8/162/2521/07220002002]8] NNNDGD(0.((0<<010..)0051)D]] riDDnrriiknnkkiiinnnggWgWaaWttateeerrr]]]WelWVeil ell [ | [----OSOTomS Wi|-wo/T oteero0a o0s2]lmNOs 506.10p 01]] o DDrrinikt innggWW] aatteerr]]WeWlel [[ O-- SOWohewataonboDAl --omss24e7o2t0s02l --oN.G1(02.050) ]DDrrinkiing WWnaatteekrr]] inWVgeiell W*aDlreinrkiunsgesWaitneclrud(eigIhviegshtotcekd winatbeorlidngb,eg)ardiendniicnagteasnhduamnaynoceonrsunmopntihoun.manNondinking @ cNoDnZsumplDonetwaalienr utoseas.bove the mitof detection (LOD). The lised LOD NisGap=pNrootxiGmuaatneiainadbev.ariDeestbeyctiendstartuamecnotncaenntdroavteirontiambe.ove the LOD and below the limit of quantification (LOQ). 102008 202 Tab 3.7 Consent OrderTaF xls 000100  HHHEEE: f3 || s Hel E5Eo a 2 2 gl @52 Ez 58 8 3535 [gse a 3Ig 2egs i eggss gy . 28 1 232% 5f5i82 i Ph|g2l]2]%|| 4 E Ei : H ! Ri | : li Hed 141 [rains I ; = 5 8 g 88 888833 9 AieH g Hl T 8. 2f H52 55 a8 slid s FaEiY gs 000101  ; 3 387 - Lr 1 88 |: HE CEE ERE HET 3 3%) |8822388 ; g ;i 2 385) 3 &8 3 28li|la 2852 8g VBE rend fa |EE - i. &i | 28is58 | [i|gh I LE]: I : F88g8i8i3s88cdl a2 faa iii iE Edd ] 5 |3] 8s 28 (858088: S3 Lly s o J 33 1I3g 2 12] 8 3 28 s 2 g : 14] KRRERRE lz g Ik | 52i4: 2 3 38d 35 P5h8ey, 00 |e RHE IRRREEE IH 2 000102 [.] @ _ 292003 Table 3.9 `SummaCr-y8ionf GAnraoluyntdicwaalteRersults: DuPont Washington Works Facility Washington, WV |___ Sample | Date TT Talugn | RET1-MWOT [--orep Traooz | [o[Cmommom0oeT T es|| [emo1o 22 0e| [omemo0z1282 | [omorm as o0| [zeo 9200z [ [n 2o 2 1 |r rooo e saorro ss s| | [----A1 wios rier00m 2__| M0w 13soz| I "AMOT-PWOT I [em | em oso s cz| I [7e 7nem 0i15o 0--os| [o[ zonT | aom or iee ss } [[iCuoznoo7m5zoooe| T0o2o5 r8y 7]| i |--ersiossToa [epnsss [os | ACOB-PWOT [[as[ gemo mooz eT T2 oorr oaru to s s e] z|| || [a[ moa r1 T noe oas orm eo ] | [ormamoToas [--dizo0r 4 o00 [i000@up) 026 | [[eermmaeorsT1 om ]| l [ros[os | [ AXT3-PWOT 717 rn -- [ [ es m | | em m oosoo sn o oz| | [ [ eo m| em zq2eo p e oz L --_znapoe10s --000103 Tors Tab 3 Consent Order T&F xis Table 3.9 `Summary of Analytical Results: C8 in Groundwater DuPont WWaasshhiinnggttoonn,WoWrVks Facility [Sep [ 'D08-MWO1 | Een 1 owe cour [onemooz Toi | [[oCmam7moo7ozTIor oar s-- 7} [mez02Tos, | 77I7A 77 I 77 I 7-- S-- | [omzoveT2301 [em| om 24o s ee| l |o Ce oTTp m516o e 2 e s|| | [[ma[ ezimson es| T2o 41 oo1 e mse s } I EE [Fm mmw meT [>e) @ | [memos T7452 [ [r ea w z 17e 52or n | I [eo ros} | f TorPwoT [z[ m a | r ofos s o t] [ozs a3 1 | [meow "T7506 | [arma to1--------| [m TT o a0 e [ammo ss) | [[[ra imsio azoon ez To5 m 500 | [ames se] [ (-- --o Nm o | ovw w mmeweoonere w |T--r w e7s-- o 1 ----7T s --] 1297000 000104 2014 Tab 39 Consent Order T&F xis @ Table 3.9 `SummaryofAnalytical Results: C-8in Groundwater DuPont Washington Works Facility Washington, WV I T0200 | Oyosampe | [8/2002"Dynosample | [52|3 " 2 Dry-0 nosam0 ple 2| [----a|r" sOr ry-n2 o sa0 mple02| [32 | 82 DOry0 nosam0 ple 2| |--2m |s "50 78 02| [rumor PO4-MWOZ [[sT[ ourimo eos ur s1 t|[ es z aseaes o 0o0 a o] z| || [ [e sa | osm se ssoaoo 0o0s r|| T sae sao] |2oTpas2 aa0000Ts | | 50 "2zt6ma8es0000 000 2| || [amt taoos| @ POB-MWOT [fSor5 0ie0Ro2o22 |[ D3 yOmn5 2 noossa0 mpal0 eg0e|| [42|92One0 nosa0 me 0| | [aeTrsesTwsae || "Q04-MWOZ oiremroe02 | [eam | mFtRu2s0 ||| [IaEso T -- o 3 ] [t7 omo [-- ia--m] l [[2ramieesse1 [0o0w4 || orer2002 |e400) i @ 7 [3| a --e sz a --s0 ] FomTramar0e0s Tao I 282003 sets Tab3.9 Consent Order TFs 000105  Table 3.9 Summary of Analytical Results: C-8 in Groundwater DuPont Washington Works Facility Washington, WV Vos POT II ETF F SR [e002 348} |--Sziz "350 8 02| [--3T2 T i a0poe| [moo T2517 [--ans2m 6 eoz 7 [am 1 ip "5eo 8 oi| | [amo or] Y14-MWO1 [ tonezoo2 [782 [[--Csommzomooz TTiegs a || IT YIT |_o| me 55oz| A 1 [--2z22 v0 0027} viewwo: |[ oesoo re | |nnae wosss| [ West Well Field (1) | i l [--s| ne 66z 0 o2| { [--n 1 se 6so 2 cz| { [mo 23o 1 r| |_e1 niip ssoor| == epsoimsaitdoawubnas(elsolw a(bloartt0qGuAGaEn)ta nt) 8 compound deaiod OO Sark Npotro:otAnaatca mths change 3 of Kovamer 200 (500 Secon 20f DuPont 20035) zsr200 ota ab 30 Consent Order TaF As 000106 Table 3.10 `Summary of Analytical Results: C-8 in Surface Water DuPont WaWasshhiinnggttoonnW,oWrVks Facility [SampSUlTLEe T oOT T ETDEate TI ~~ CaT(ZuSgOh || [--spaooz 170s [eeraooz1204 7} [--7p 17s"p eesoo2| [em| sm1o 70 rz| [--s 1 moao 0s 02 [anemoo Tier [2mm Teas] [mmo Tee SOTFRICOE |_ia |no3p7 oot [tin|soz 528@u)| [om| am oo re az ] [B |eam st a [73002 1220 I [_e 1 smso ee oz [Tepsozup) [381 | INET 77J YX oO [anezooz p45 | i [--o1 nom opo s oz [aTTmam 66 o| |--rr 1za o soz |zzomoorTres [s 1 o ase r [oesm2o 8 ot| SOTETo 7577 I~ TO [namo Tose | [smuzoorToa | [gmzor[xs [pio Tess) [zramoor[ia [oparoozT0317 1 [e300 T0201 | 1 | {I [sooo T0503 | |--anemo02Tre [--3mom 20o 1 oz1 112012003 000107 Tors Tab 3.10 Consent Onder T&F xis Table 3.10 SummaryofAnalytical Results: C-8 in Surface Water DuPont WWasahsihngitnogntWooWnrV,ks Facility [SwSUp TLETe 003 (CoT ny |_o _|TW T a ocsw 0 oe uens] l[oureAos [tute[er | || [o[ neeC ony| { o2m a1 otoe|| || [[ emoo [1 o s2 e4 n ]| | [o[mCsoamoens[ [1072 0 || [ [s Cm | | oomm es7m eoo z|| | [ [o am m|e ea ae5o o zs o os s|| [a7 sm 11Z 0-- 1 [o[oCtrz | zo sa12mor| [[ Crr omeor [ ms omenso r or|| [ [eCm| o om r 3258o 66oot r|| D [Com0mo| || [om |wtoeor| | [ [C ao m mam iwmmo o| [oureror |[ dumz mera [sm sisoo o 1202003 [overs || L I [ [T Ce r | |s oooo v ssourr mo o|| [ [C s| |o poom o zms a r|| [ [o arr| | teozm o osoo euo e sz s }| [o[om2s 1 |oooz mmeen| [mo oer e [wCmron o e5z s 45oo } z| 000108 2003 Tab 3.10 Consent Order TaF xs Table 3.10 `Summary of Analytical Results: C-8 in Surface Water DuPont WWaasshhiinnggttoonnW,oWrVks Facility | ouTLET10s (Cont) | emsi2002 I ses [[ST0op0o2z0oepT |5 76 5 27 ] } 1 [TanezozT7459 1} 1 | fooredotrs.ays [smo T7146} od700783[ oNove_ mber 2a 0| 0 00o Socbonon 70s of Duo --Pon_t (r 0_00}) 112802003 000109 3013 Tab3.10 Consent Order TAFxis ERIE o [H uE i IEEi TTR ps i WEARS Leel Te Ce 5il Wilh BW REE Bo daheby rb o [ELif | I i iii BY li SHH @ Hi Hi | 1 |: Co  Outfall 005 CT-a8bcloen3c.e1n2tration (ug/l) DuPont Washington Works [__[OU_TFAS LL00a 5 m T|T p D7a24tl 12e00Je 2]ceiugd n] [[OOUUTTFFAALLLL 000055 || 672572002] o/2672002] [OUTFALL 005 |6/27/20709.23] |WWK[-OUTZ FAL- L0000[55 O| U7/T1/2F002A] L13L6] [wwe[[oOuUTTFFAALLLL0000s5 || 777711127722000022]]127359]0] [OUTFALL 005 | Torior2002] Tato] [OUTFALL 005 |07177200128.]0] 112912003 Tort Tab3.12 Consent Order T&Fxis 060112 Table 3.13 `Summaryof C-8 in Groundwater DupPounbltiWcaWsahtienrgStuopnplWioersk,sWeFasctilVlitry,giWnaisahainndgtOohnioWY [ol[Fmee m T ----erserose onrtl sesuoaeoontle ] occ ocmomsoor ]] n se elresrre esaemst) sre] [ -- m --o smeoul--n r oompn ----] pe--cienrsed [ [1 ee rss aavtar ellowEom oouoo Trios-- ]]me ] rreomrl eenuaald ! [ [e pr rs ss seeemo ao l u onoou rono oi]o]s vm s oprcal l srened Ec[se[ [ rms os nee wt amatooooous ]llps s ov0vois]st]]o o smAvna waerrrrvmesw] nmet nsssaaarnmoapd] [ [e se 7s r 7 Sessnr amas a]l s omwm oio n] ww Ta pooPsl sccl oTnuel [seeomr s7 77 TYET -- I----r T asad or] eseieaued [onrsoaresaonl]vaeal0ve oci] enned oS { [ [ss s eesoe me sl u ssr ssamaar l]lsso oo0o 1rn0dd]r om m nrrrosoud scl osanuoedd] | [ [s se ee Sr saasrs oelmoo ooo rim ]n ws rs reosi] ml ennueed Servet sons WY | osotuemnaol] sgpmeal] nWobvTmoomiool] soma] prom ost feeaevae] ereed | EE -- [e 7 Tw saT ulE --r e Y owlE -- sbr T ] usvel { [ [7 u o wme emae ll s 3s solo -- l rrl aaT ssccaall I ues 7s-- o)mII --T Tsel-- r rePsr sTenT | [owoeswssolv wmmaa ala ] l w so o erer od mseenuaad IT uso used 7sm)a ET]solECseT n asa 5d ouceowed | ueessol sesaall uso mem osu heesacceeaouueedd encionvd L ves eo oral pracicoun] 000113 292008 Tors Tab 3.13 Consent Orr Taxis Summary oTfaCb-l8eI3n.1G3roundwater DupPounbltiWcaWsahtienrgStuopnplWioersk,sWeFasctilViityr,giWnaisahainndgtOohnioWV | Teem,eONT Y e swrea]n cee le ea) n vane] Ps vl usesool eummol ooroml rpaaacceenvrie]d uesol wiemel ou roncunvid || FF ueessool avwawml reeall ppseeravae}l wweessad ommmmel esadl ronmle] | wesol 7w]mlI oi rosceYevTal [w werssos ooTM oo seaaavmomaer assesooll]oo vpompsos usl ecmoa rnovne] || [ee spero]s saevp aall eoor lll o ioawtess] yysamm rroonn | I tueo somal l emmealET T aouwllIT vemed @ [ ----weseosv nouila e vmamlmr vs va o ol ] vi veordwdd | weso7 rwnl 7 ema SY) fF uweessoonmeiaall eramea oaoml vveionedd | --v-- erseosomnele uwoaae vam aml s a oosmo al i ml l veinoneaddl | es7ol 7 melEY)IT vied | fF weessomoull ----upsomul eaammmo]anel al arr] enal ones renal | es7oE l eT mvamlEE) eal voTT | ------weressoomnl eeavvaomlalrge uiern une wesomel aval ase run | --7 --usesoamweml neCeTvraE loeT romomadlsmmTwTaoTsysvseumlpon} [ome | [ws vmegle ael eval mm al waemspeenrlon] oe] a bed c --c o e oamw owa e al n d rpool rueawl esa] ameanor] oes] wrTaintsami ee esoul wal sol oeresinsane 112012003 000114 2015 Tab3.13 Consent Order TaF xis Summary oTfaCb-l8ei3n.4G3roundwater a Public Water Supplies, West Virginia and Ohio Dupont Washington Works Facility, Washington WV R m E mweaT T l-- r Tr e er sowereur Sr7-- -- I -- -- Ey -- rrr T { ----wwerrssooovweewuieellmnsaaeslea]o l or omoed lppeed scaccoueed =r vr -- -- | r ----E esorwe ol russ]-- -- r , oul-- --rprcecrcorusd | [ei -- FTswo e eoowe a eel e mva] am]]-- aani]]--pepfr=nscnared | F ----rsowe cl w nual oom d reamed |l --estoewseao]l --rsoweuol mmaolllondorealccrupesaacodued wma] wes pesacoued [----ems moloumiol oO [----trsowerwows]7 --T oassie--reppresr cecroue | wowedaloo pened -- sowed wml sows mel olrsead rw reveeued | wwssoowwaerdeTM --usouand oe wraam llaml arodeerpeee] cee d FF wssevsoeownwadl ssmmmaallooon oald dpe] sa5cc0ue]d l -- --sow ware r s nnaummo aa]] vooe aaddur pel nd [[reeseem r rso on 1 senewiTeYn]-- ween] pvem7ollI Toornnl]pT e mee] e]| | Fr F eeprssoonntl smetlall T b6s3o! CsuTumertreeumrmmeenrsesonna]d @l FT FF emesoenll mwd at] eesonl spatial oassee] psuerrmremeeasnonae] woe] nerrumenenna] LL I erpessoonn| N v ] SoE ma me momo e s narrrvmim7 me] ennosoonnaid]| 000115 "ramon aus Tab3.13 ConsentOrderT8Fas Summary oTfaCb-l8ei3n.1G3roundwater Public Water Supplies, West Virginia and Ohio Dupont Washington Works Facility, Washington WV [Fe emmee sPo0.0n coT r)| Tomsorun] eeasem o e or a p] | [ [ ere sr oe me womraas lmtaem ]--] o soe ooorsuo vallam m oopeo] srsl leeacnas]wuaeeldd I [ --emse o--mswmam m-- alsoom uwmll-- ama oppeealcsiccolnae|l ! e -- [ersten--m mal --oonmdla resenemaed ! [[ [ Te ee pe sosss r amsvedam]o ]as rnhlam ocoooosoinnlu t ]saa mop] psrrocoael euceaeanwlmueaell] E reeso7emd7 mamO ]EO T T] ool-- IT TesT T ecawel pree rsoowel e malle ao d] serene | rwoerseoesweel ]wmeall one| oom revsorul swam] weal T roseT auel ppeacsseoavel o| E reeemssoowoemll mY caatal] ovweld--rregaer cmnmuad I weesoCrTwl w7m7l) TEToa --saved | [co[ -- n--v-- -- e csc oo sooro rn naaallsmm wai oiamoloe nv n]]h--noe co ieoppaa revel raotrcsee] cnlnreneesd] --[ rrcoc rwre-- do sv7 mearlan l--] ew0o0rcw 0aomn]-- | eppoes sarsitomovmeall| | WassCorty Poo. | [ [i ss sonces so o]--vo szt wavmran a]ae ]]c wwnaaarr ccoaoe oosmno]]s ]--ps rwo so srpocisac] el evsnemaad]l | [7 r mso ouceer s-- -- odT T osm a-- -- raT r oposT uT menlvel | { [-- re sIovin val-- ce oor s --od moscil oama 2) 7 77 [e{ stVeisnwogoenoni || ovmeoior]] I Swaomnal] 7 WTooEoooT]I im meT eaommeescsreumn]] @y [ --townwseoo n] srvaoinosw am]]a]0ww0oocc0aove oi]too]] Fon aoonmesrmtaeavrie]a]] 000116 wan sats Tab 3.13 Consent Order TaF ris Table 3.13 Public WSautmemraSruyppolfieCs-,8WiensGtroViurngdiwniaatearnd Ohio Dupont Washington Works Facility, Washington WV [reVionncSyseupn,oOFv|| wpsvoorsuant]] aumnaas]] accoommoo]] ie msesesenrg]e] [T voF s c7au)s] T(EcoT010] er msnsano] [v[ovsosousr ran] osammmme] zloowawnla] umopprraassaccttoolaameell Vigorore on |[v voewo ] ssas uwmmmeoalsowo ossoeo]lmmm epseseml ennsero]d [ [o vr wo nmuolw ] o ocoa oosmolu u ava psl al eanasocnoe] | [ [v vo ovsasar m o a]w w ooosa e om]] u apprral l acaciiceaaeeld v7 owel 7u)mlOTo]o-- l pescveunvel| 01Toht1D9e0t4ciLODo|aonmett evrtdofvacrlcboynn(u10m0)e.ransre re N=OHnottoaf arnbt.onD10l0). trvls LOrabth Aa.Caroncs wee otraasnnuit lidrek & 1292003 000117 sols Tab3.13 Consent Order TAF xis @ Table 3.14 Synoptic Groundwater Elevations February 2002 and Well Screen Locations DuPont Washington Works Facility Washington, West Virginia {gn{SE or Loemee]SEE|ore] | Froorean [[croaowmeeesro| |T eesmes| | wwaessTe |rewwwse s| | |se en roro I[soilleoppprriimanaeryysaaaqauuiietre]r]] [[asmooosasmor[|eswsaae [oeamor Tessa TTwwaass| rooomr TwTae | ssseoss | sera oitoeppriimmaarryysaacuuiieerr]] sto primary aquier] [[oonsems Towewa0s T|wwao| Teew | wsneis [[saiteepprriimmarayrssoouurr]] [r[oeuamme T Tee re| Tuwsw [amo Tomer | ws TToesws |ssewamss Toews | seem [poetrechemdauaytseqruiiaeire] [atepimary our] [[rrooscawoummsoTTTeeemmeeanT | Tvws aw rTerm ie se | |sse seeou0srs i[[aaiteen pppriiimmmaaanrynysosaqouuuteerrr]]] [G5JJ [Tromes reiw| wee| v omn|r sors oE toprimaryaquier|] [woooomoT|oemnee| | wwewseTweoae | | sseenisse [sstteepummaarnyycoqaueierr]] [Cosimo Toms wr Ton soser [atepimanysar} [[Cheeiwmor| Teemsea [ovoTews || wwrseTTe eas se |ssee0r5o Twn ns Tse sottoeprmmaarnyyoaquiierr]] swepinayaquier] [[o wouoeensT | 1 wssoeesesT |wwaaes T|awwmaw|sssemseomrJpeppreecrrhcchheeedddwwaaattlaorrrtttabbalevle [ [[rrroooommoT| Tsoiemvma [| |wewweesssT Te orm mu| T| rieosner0wrJpaJrpiecerhcphereidmswawaratylaeqreutllaaebreil] [soe nnoeeTt ower wwer s Tiensw Ti ssoe sptoorphreismwaireyorqiuoiebri]] [[voosstomoT|emeewseT| wawsas [|ioosw| | sseseems sotteepprrnmaarryyaaqquuiieerr]] [[oarmeoorTemeessa gin eam Tees | 1 1 wwee two | Tesseser1 | sssauoor Taw sens [[ssttoopprrimmaarryy sauqiutee]] sto primaryoar) (BD eerome omerrro os TS 65 1292003 Tor Tab 3.14 Consent Order T8F xis 000118 3 | 1E 3 2] 8 i193 i H52 l| :3 3 55 BC s [FI it EH 13 33 s eis 52 3H oe HH, || 2872 3 (3) + | 44 | |3 i [33 [g3f8 oO 3 2NE8sR%r H l[eBd :E1CH0R | El i) 3deeRdg || 8YE3 fe[9o3e[[Ei[EE31i| 7- FEH i 3E8 E H [J8ESIT EEENP2EPlR,| sIE |:LS 88TfEnspih: $i aPH ET PLE Ha8l3l8 FRM oo oo 1 TT isedd i1 i o gq | R gas: Hols 3] PEE] Higgs | 2 iElesl i| 8 285 fSeilzI a R fiE de E1os8E% 8s I 28 H | gl HH BsSa(EsE[EcEie5l8|3|| | sdieElBeEts 8i23t8s 3SBEE S5REE iE fez 555 5s2 TTT | @ Hi 000119 e i 14] oi 1 3 TTT HEHE gassl I[IEz] & 85 gSl| ogo2E8 ] 3 R f5 --_-- 2 [08 {3 ll...5 |I I HIE 2 {g 23 q: g5 |g a I : || 88 ssll 9 ogf 93l3esg | iF 52 O{ EHigll E2 gl 2"3g38a2ll 33g e888=5%: |e|0I3 |2 So ES 5 .3 oO 253% f 2 3g 22|d 552835 5] 3 Fs: |2 3) 5 SE|EIREERRRY - EH i | Z HEE 5 || 3| Foe > i 5g 5 | { 3g s = { [+] {l 3Ho3 o . { irlBlezzczng RR) [RRERREY . | 22| [zzesary RE [REIFREY | 228%| [|2paegezeaznegyl | F1 3 | | lz l.le285 % g 5 $8, ssf | 4% I fag @ l gic also flEclonlsl38l 3z8La8 [8582228 g ] 000120 Table 4.1 `Summary of Analytical Results: @ C-8 in Groundwater Local Landfill Washington, WV [s T owm | ce omm Tow I oArzsa --75-- [[miseeee| [sesa02 || [zm |eso es ot| 7 I- -- -- -- -- l [[asroimmoosse| Tg o || TOS [orsaoez es] | [om |mo7ee| [ [3pa ep0m 0| e [ s1 a jor1 o5 e| | || 2-- | [e[amo esr[ mo5 ts s s ] e |I WS [orsaoez oom] i [o[mo a a | |omnNoaoz|| [eJ mma -- a-- | [m[ eei r| T ew e No e| [s2 omo[E ooY m | [ames[ow] @ 20200 Tor Tab 4.1 Consent Order TaF xis 000121 Table 4.1 Summaryof Analytical Results: @ C-8 in Groundwater Local Landfill WashingtoWnV,. f Two S--Samplee --7 | TDoaneos |-- cCaugn | |oss| | [ emem oz| |ooom sssr o|| i| 3/28/2002 0.698 zoe |over| [ [si e eare m s | |i o o s io0m sz s 16so s] r e|| I TWW-125 Toe I TL2 W136S I Tomas |I eel | tows | omeore |ome] @ Fos O4rsttOmt vivat oawrroanrhcflnocts i00) MoNoGae oAkrautncflamathhhCnat23ancfocnvnaidimeoss 2s0h1ovesn LOD and ok eof Sc2t0foordeanls) nian 292003 2012 Tab 4.1 Consent Order Taf xis 000122 [ O Table 4.2 Summary of Analytical Results: C-8 in Surface Water Local Landfill `Washington, WV mmo wp) OUTFALL004 (New) | 71/30/2002| No-flowconditions | { [103172002 1 No-flowconditions | [9730/2002 | No-flowconditions | [8/2|6/ No-fl2 owco0 nditi0 ons 2|| [eap 92o 0 o| I [ [o ap p | TT e o"m p taa5so oe o|| OUTFALL 004 (Od) [ [1 11075| 3107 7 RNoo--f2 fi2oowwcc0 oo0nnda0 itti6 ioon2 nss 21 || [nmooe "Tis | [ [s ep m | Ti s --E Te ioTdo0 o 0weo-- ndo ie ionse e | [ [o am m | TT e or i m 35so o ie e ] [2pOROC T1080 | [papoose| tia | { [eeTr T e4o 75 co| l [ [Te erm on 7 si 7 oee s s|| [ep[ raisms sss[ e 5 7m 25i ] s [zoo 11 s "OUTFALL 005 (New) | [7/1/Mi2 olow0 condit0ions 2| [amo "mar z e| -- _ [_o | me1R 6 oe| @ e000 Tor Tab 4.2 Consent Order TAFxis 060123 Table 4.2 Summary of Analytical Results: C-8 in Surface Water Local Landfill `Washington, WV |Foa uTem ALLe o0s (GaysT 1T Dawe 1 Coemgn7] || [ap6 uz000 |2Nor0 lowcon0 ditions2| | [ [oC m |se m w2riso e r|| [21 |2ol0 owcon0 dition2 s | C[ omoCmow rT Tm T o w wm o or|| C iimoz so im ar ]| I [r|Io r n -- s l [e[ rose 1s w es w|| [eaomwo n or [amesTm | D QUTET Tor |[ [__ oni e_iso | e| d ni 37e 5 86z re ]|| "0200 7 roeT I o -- | c sae me 0] 0 0 -- -- x---- [ EcsAS rse ia-- e| [emC ow o T--n ----m 5 --o ___0 _--|| CorCeasraaymeroo[|o--vmzimeoeT Ts w]| Note: Anayical mato chnged 3 of November2001 (500Sectn 20 f uP (2003b)for details). 192000 2d2 Tab 4.2 Consent OrderTaF xis 000124 iri ! gg 2 |lg issi 2828 52 EY 5 22 i i 5f $ iI CE 5 33 | Ei sglb-i-roo- | P35 fo| Ezes g: I EE CE Lg2% z 53g ; is gs E d2 Ed=. 2oi] 2 os i3f3 329255 [HEWBE5: ov8i8 yrogdlo 8oy 3Lo | i5d : fSjEE[i nTlhE Bsr : tT [d5 85 3% B [83 2FH 2 d|efrgE1leN-asded- l , 0 ofoF y! g "Ei I i if |e BI 05 1 Hg CoE LEE leg! Ch HEE Bal PEE E33 o0f 1 g 50 Bipoiad E85 Sa_ 3 S87 000125  Table 5.0 Summary of Off-site Sampling Program (C-8 Sampling) Letart Landfill Letart, WV RESIDENTIAL SAMPLING FOR 1-MILE RADIUS ~~ "7/7! Number of homes contacted oe | Number of homes surveyed | ___46 | -- Number of wells identified ] 42 | Number of wells sampled ]30| I -- | NHuummbbeerrooffcsitstoerrmnssisdaemntpilfeide?d of 4 0 | | 8w Number of springs identified| o | & Number of springs sampll ed o |i Number of springs sampled that are used for drinking water, "Total rum of sarge | & | _Total number of collected sampl drinking Note: Field duplicates not considered in sample count. During his investigation, homeownersiresidents identified within the sampling radius were contacted to determine residential water usage. Up to two contacts were watatsemepftteadt tathearcehsidreanscied.encBe.ecaAufseer ntohte aslelchoonmdeocwonnetarcstiraelsiadmo,ncaevsolfounhtearsyursvueryv,ey the number of residences surveyed is less than the number of homes contacted. CII I I Some water sources (2.0. wells, cisterns, springs) identified during the survey were, hnootmesoawmnpelresdi.resIindmeantnsy.caIsneso,thsearmcpaisiensg,otfhethweasteerwastoeurrcseosurwceersoweaistherrefnuosted by the. was less than the number of water sources identified. 21412003 Toft Tab 5.0 Consent Order T&F xis 000126 @ ETI { { le , ie BE EE SEN a le li [H, s& [ME HH EEEEEEEEEEE 5353| Relea | i Oo isi] ALLL 2&7 Bm il | Ix 3 fs FRER [TE oh | i Ii meg i Jej2eoylil t HP [Fee ah ) INELHER EI aE ee HE EEE 215203 ses elele ape dic @ | 8 [hil] (MESSERRERERNNRNEEIH ; i 3 : ) 2 :T g 8 000127 | 12 i : TT TTT TE ]2 [$15 fgl 58 4J Ba i [F|ecczszezzisse B3E Tle - i 1H5E] 3 Eg REs LellgLI $ | I 1 +" z 4Eg gl 8of 8 sgal eldaf ml i | 5 ill f5 g2 5g 3 rEiEdE 3928 3 33i8 | aiE|El 4: 2sHE5sE3sS | g EHl | HHEa1E78 {4 i . --: I1 #salds) pl5F8d8s8i8i8s 282s28 |'|S82555233255338888 3< 2 1 35 ol eg 223838 3 2 =F 5 22 3 z | LTT TT = | HE 9 5] g o se 5 3 88 oy | 33 5 {3 2 E Lisle5 HEEREE8sIt HLFIagIRIE2 R 2283) 8 5g333)BslsiB8g|| |[dE2225282%2258) = & 000128 _ 2 FREE cell gE a ; E 8 8 88 8 2s + dT ole)8K gfo | off 1of z3 8i) |[pssrsszsEssasg8ay8s8| @i 3 LH 420] 9 33 |2zeaazy AE gl 58 [88288g8 [es 2 aE g 5 |e call enanasl se|8lzezzzeg 5 | Eg_z ls 39 NO Ee | 352 [11g] o 2 alllrei] OQ B8s::f 2 El gd gEllsgEgEsg = PU | 5 I:E g1e91 | itpHl R(EeEsEsEeEdE i | | gE || 2 2 1x1 3g 11 | J z238|] ||2sgdse8reegeys | H:|EEol 2co2l ||3sgs8sse5neeys | g gpl [EBEEERpR bl]| zHHe 2 i4 5a JF: @ 18 i24 % 4g%g E3E%E.iyE8E3:Lo 2 L181 8 HIB HERIEEIEIE Ea 000129  292003 `Summary of AnalyticaTlaRbelseul5t.3s: C-8 In Groundwater Lotart Landi Lotart, WV. [S T owww wToome ey | 7vrc -- -- >-- -- 7 vr -- -- -- -- 7 [o --m zorio0-- e1} [[mraemza T Tu e oo }1} 7rrc -- ---- -- [[ornezveoT Ti em oo ----} --} [ir sm v >-- [Ir-- c ies oe-- o} [rzwsie c--r --} [[CCroirsoeT Ta w| [ow77e7 -- 0 -- [Como7m7oor -- m----------| I[T7 Co-- mo-- re| 7 E17 -- -- -- -- [im[ aaoo oeT man r] 7 [a-- ma--n [2 Come T --e -- | [c Cranes T-- e r s-- | [ [Ca rm am e 55ses r| TE [[onrze e T [or s | [o[ zweC o T om i am 0o o [ 7 a -- m se -- o [om7e1a0orT-- so --] 2 -- TE I -- -- -- [[orziaonT Te oo m} [[oanmsaaosT Ti i|| [ 0 Cro|-- zonooeo--ss| I 7 -- -- -- -- [r7 eer T --w--] 000130 tote Table 5.3ConOsdeerTnafxts  Oo 2; vaon003 `SumofmAnaalyrticyaTlaRbelseul5t3s: C= in Groundwater LoLtoatratrtL,aWnVdi w S m T --] 1 -- [or res c Too=-- n] [e7 am -- 0 -- I [Cz --1a m0 -- r TR I 7TR -- ---- -- [om ----] [s[ ats e aBm eyeroo m1] [e-- [ am z w ee ] [rI ime -- a x-- [i oom 1 -- s w-- --mT--wkn T 7 ow TT--coun | [om 0e ----1 [am[oe n a T Ise Da yowe rse| 72 7 -- -- -- -- [rzermroeeTe-- es-- [m2 mo -- 0 -- ww [agr7ee7TIwo-- [e[ am e Tm w0o o| 1r7y -- ---- -- 7 Tr -- -- -- -- 7 -- -- sT--ms--ee [[orgmwoo Towoo T owLS1-- com-- m | [Hor7ow7er[ E ar -- a [Em27er[-- ts-- i] [C EmeS r [ --1 0--] [-- Eermm[-- 0 | I--1-- Tr ---- -- [77ravase s n [net |] 000131 2014 Table 53ConseOrdr TF is  = wasz0es Summary ofAnalyticaTlaRbelseul5t.3s: C-8 In Groundwater Lotart Landi Letart, WV ewan ET-- -- [[oCassoa Two 70s] [[ Cameo me0a0e [ozTow] [[C0 Crommoe Tas---- i [Ca --ne --s [C7 omeTrI T -- w-- --1 w ow a n r e e r s os s o n] ] sm7 T ow --c--om--m -- [CCo7r7 eT Eo e-- ] 7 [m -- iz r-- [[soamzoe T 0n 1 [[rm [ azeH orraa rm a} s s] ] I z -- -- m -- -- -- [er emi-- s [r[ooCmsoT zus e 50ss [mI eer -- 0-- } [ [ 2 Cm o-- s sm se --] ] [mCeiT izo zm] es I I ---- -- ---- C Y-- T-- -- -- 7 1 -- -- [e[ mmee Ta s 0;e ----] 7 7 -- -- -- -- 2 7 I -- -- -- x-- -- -- [r7 z ---- [omen 5%] ome | em | [1 eoe zs sae Table 5:3Conse Ont 8 xs 000132 Table 5.3 `SummaryofAnalytiLcoatlarRtesLualntdsf:ilC-8 in Groundwater Lotart, WV EE sme--1bY w E-- came--| [r[ aoCT oo nos v m s o|| Tw [oEn7i2 E om S S] -- 7 -- -- 7 [e --a ores -- [ [r o |e o ooe vem0o r|| rrowe 1 rooaw:s is | [C[ eemeT z om ooear--o n----}] [T aa --moem m --e 7 Tr -- --c r-- -- [i[ znomeo r| To m m 02s e ] 0 i yctdchess. over2e0y0(snSecon a) 20.1unt (200%) of co plc hasws revs ebony cn um ais 000133 vasr03 ots Tabi 5.3ConsentOrde T45 ts & Table 5.4 `Summary of Analytical Results: C-8 in Surface Water Letart Landfill Letart, WW [sample TT Dae[counJ 002(LEACHATE BASIN) | Ti | so oss nz [omeTees} 1 |_oz |rz uo me } [--ssomooz100 7} [7s 1 omwo a0_o __z [eo | e2 Not0 Anshz0 es 2| ["sm TT ozvee s ez| [ammo Tass [omemooz Tw [oremooz 156s [msmooz Tsoi} 7 -- -- [er m2 o [--7mozootTvs 7} I [7mszoo0 Taso} [am 1 eo ve oo0 } G) [oes ww] | [namoooT7020 [83 | 02 NotFi0 owCond0 itions2 __| | [ez TzN0 otAna0 yzer 2| |{ i [am-- aozemrar e-- s| 3 = asz003 |STORMWATERRUNOFF | oraz | sos RT 33 STREAM [o[sCuoam0m0ezT Toes a | I -- -- | [amozooz oss} [mez 12 7} [mez 15a7} [ones Tam | [mo2o 01 n| | [rmieooe Toss [--aTw T ne--er [emmees 18 | (_BR | NonK amooE z__| RR dosU e N Taz Table5.4 Consent Order Taf xs 000134 Table 5.4 `Summary of Analytical Results: C-8in Surface Water Letart Landfill Letart, WV [samCrp eRuNoR | | toasmee | | ecsnwn |J | [om1 wzvo 2 oa| [e2Tm T 2 Not0 Anahy0 zes 2| [smomozTam [ [-- se z| Tm so eW2om c r7sampo 0 es s z} [29 TTM2NoF0 iowCon0 ditions2| " [e 1 svp e e| oortd:otAnaa)l.ytical mathod changed aofNovembor 2001 (560 Section 2.0 of DuPont (2003) o`Sramopblyeshwecorotakuenahro stamh,plersesapevcdsuratfahcee waabtwearomcaiaionndsw.erHeoowstver, due tanyzed an 4 12912003 202 Table 5.4 Consent Order T&F is 600135 gs 3B00.800. H2f 3 Clk hEcf Es 5 dl 35 i5%f :2 s z Ii ! i EH M H11 2 fs oo- Po gs | EE JizsB o ff8 fF as i= H 2 ES i2 fS2egEeEl8i2Zn[8.ME =5 oar Bgno3 idgxdl2l s7 ong2g fii|tses ld : i535 Sl 37 aHeri 28 B8e 5 lfB,ep25/2i2 gQ `3Bf[F[l5i2iu:g4 - Colm rE a 85 35 | 5 S = Fics &2 gliei. 3 5Es i TT i MHEEE 58 d5ii.ggerLsE issgd o o =o HHii i ||Ee8 FE oo g22i4s5 Bi 5, ie | i JE EEEp E 588 CPa5h8 FEoleldalife Bide Raine |i | 3#52134j836 [| 93.825355323368 i1i0i1% i [|eF2:ef : 000136 @ Table 6.0 Summary of Off-site Sampling Program (C-8 Sampling) Dry Run Landfill Lubeck, WV l ErrEE * RE ESIDENTIAL SAMPLING FOR 1-MILE RADIUSeT ("0 | Number of homes contacted Number of homes surveyed | 64 | Number of wells identified ?]___41___| Number of wells sampled @| 37__| 2 Number of cisterns identified | | z5 Number of toms sampled ]_8__| [ Number of springs cenutes] 0 | 8 a Number of springs sampled that are used for drinking water| Tota numberorsamp5l3es]| Note: Field duplicates not considered in sample count During this investigation, homeawnersiesidents identified within the sampiing radius were contacted to determine residential water usage. Up fotwo contacts were awtatsemlepftteadt ahteearacshidraenscied.encBe.ecaAufseer ntohte salelcoomnedowcnonetrascitraelstiemdpeln,c@esvo[l0utnhtearsyusrvueryv,ey the number of residences surveyed i less than the number of homes contacted. Some water sources (e.g. wells, cisterns, springs) identified during the survey were not sampled. In many cases, sampling of hese water sourceswas refused by the homeownersiresidents. In other cases, the water sources were either not was loss than the number of water sources identified. 000137 20472003 Toit "Tab 6.0 Consent Order TF xis TABLE 6.1 Summary of C-8 Analytical Results In Groundwater and Surface Water (ug/l) Dry Run Landfill (Off-site Wells, Springs, and Cisterns - One Mile Radius) Lubeck, WV samo] waco] Goeod Duwmgviee| wad oocssssssoorrss]| wweadol oozss oowwwnvieere| | wwaedd [oo vaess ocolsrm awweaool]uom oovois]]sooo wwwimmgvgiun sae ||al wweald --r ----ce samI aisoulw-- izoawmarT|s-- o| n-- on] [ [----o--ssmoems| rioorms]mweooorcmseoe]] loouvvmwnmaggvwaarws a||oowlveiedd [ [ ososwownoominsosnoownl] raprvuasool o00s0o1s0]] oowwkmnnggvvaawe || wvieeld [ [o cs seoermenoul ppuoanood] oooosiol] oowmmemgmvgwaeer| | vveiedl [osowsessctaeroomooumnl] Trmae0moosl] poooonr] ooiwnwkmmgawvaime || owmelg -- [csw --o owasr r]r oGu oze] sommo gwan w |el Coen [ [osoo memmal s mawoau]la Twoowoooowm ]] wUna ese[ r| w] e v l [ I oscomeal r7 ovaoolIT boss _ se T | wel [ososocmovmsmnal owseen Wa0c0o0c1s0o]l [GoonerTse] ocoml ommseeess |[vv iel ise vd [ I [o cowme nsnels i oo vaeonn]]-- rbou o1 ose]-- am mmssee--sso--|--e [vi] veilel| [ [oo oss vs u on] r ews aeo ovosr nWFoo0loe00rte 0--0]]] rw Taewmwersese eswan |oos vvvliiiaaal}} Ee -------- NDrnOm=esotWDwaottaoeclai d,1Gudaebe o a5n3d 3dHan)ooftcGreeoisnhFLaOaDn)r.cosneompanonovRalae kes ng Wat os Pos NtOTlNhoctoeGnuiaecntiLaoOlnDe:(i 0sB0pa)oadntetaanod raeas byhnesrLuOmBoannadnSdoover ne, CDWaaS.nrcahatergr arwmeotpwsoarerteeg.sleitewnatfsioours cole inhoni Gas twer sied Gagmia as sp ove \oz0as 16m ru Tab. Comers OrTat] 000138 TABLE 6.1 @ `SDurmymaRruyn oLfanCd-f8ilAln(aOlfyft-isciatle RWeelslusl,tsSpIrniGngrso,unadnwdaCtiesrtearnnds S-uOrnfeacMeilWeatReardi(uusg/)l) Lubeck, WV oGsssvemrommeenroarl] [oossvumnomieomnil] os ieee] awiaaeoo] vniaaos pavewal nWoowooooo]] wruesees wwaeld 00o0o1n0]] Uoswieeasn [wiwadd atmo] uses| wad Gooswwioennnonlles vm m roroo os] ul smeesrs| ol vviiell ooswsmomeelv umea T moo re es s vviiel I ------soomvorwourroomnldmamee ] s owl uee nses s vie -- re [ I oscwal 7s) ms]SYo:oo] wTamc=ame |IC spd osmoves ouzoor] coral as.awcame | spd --oEweCs]----wa7e--om wTeS| -- cud OC cobuormoneonraell vvaevwaawemll ooEwrT llTmm_ aess| | T: cceuteedn| I CTos GmenEror] 7 TsmTmodO ] X oCao7olI wee --|--corTud INDDanreNisnegto Wwaaangio. dprhaaowsooildtery)nottc7tanonn40n0)Ccornsuemptuion.mNtsovonn. -Wraekeiscnge 0r CaTTohennt 51pb08a10r,0isscoBpoorooasdueiprst.a e nd arsbys n8to anosn vee re fragilis cic SO 1/29/2003 4:18 PM Tao CorenrerTai 202 0:1 Consent der 3 000139 Moniaing Wall ConstructiTonaaond6a2reundatrElvation Da DryiRuwnLaindfil beemree |orn[ornodore ora aoa meeran re] a| Born|rece|ne |ress|rma | ree|ross|sve|oom| eTTo | c 72024 | P TToee | rr oe | ms | 72261- | 71424.| 607.83.| a| 751.37. er| T46AT ; oe74382 re fferoobsreuasry-02 | en| mn | mn] | mnee2ms||| mm727ee90||| mm728en70|| | pm71ee40ee6|| - : S:lo :So ons | mn] ma | mn| me] Lwin| roar ovine [Parameters | so150 | ors| sso: | mes| ssn | er | som GRW-10BRW-208|DRW-12|DRMV-13|GRMW.1S|DrRnw 218]DRMWTE] rowoupistoo| 15170|1301| w100| il IO PR EPR wise|ao |smo|omer| PR PO PO Bitumses |000 |ono| sow|oon|ove|ooo|wn| fer I | w ons |oon || 75023| 752.38| v6m|| 710.28-| m5n || 700.14. | msoo || 705.68- | ewro550.47 | | wn| we] 1 GroundwaterElevation (feet) | efem, {[pecomber-01 -Co mmEe724.40 || em711n.e81|| eess 716.10 + em75t4e0d0 | imlBaeugnusetsoz: a [I o | re. s | f7a23s8e5|| T7h1i0e6s5|| 77i1s5e8s2| owo. r | r75e31s|s 00140 [] |{ | I | @ 1292003 sme TRA RITA RWS Table 6.3 Summaryof Analytical Results: C-8 in Groundwater Dry Run Landfill Lubeck, WV 1 bw |cen] ovetwden | [s7 mmoee[-- ta --a-- ----| [m[ omoo p| [ oo moo ms e es e|| [i[ m7rmz 0ze00i 1 [a o 0m m 0 toi o ir ]|| [rioe o s| [mea reso T no os ts s s s|| [--omaoeeTower [ [ es s | |om oom oomso e e|| [mo7m7oJTIoms-- [me[mr ooe0 r T |iozm oa is00t| 1 [rma -- r0o 1-- wr [ o-- eomooa zrs oe [[eommmaGop| [no a o| [m7 mr -- n-- a] [[SCoemooen[ [Nn a a]| [saToe Er T-- oon-- [remrieseTo5:r] 000141 tora Tab 6:3 Consent Order Ta is  Table 6.3 `Summary of Analytical Results: C-8 in Groundwater Dry Run Landfill Lubeck, WV TT---- TT-- esEeEneeeeemr A1 EUm r IGHp YaTa = s p -- -- E-- ---- -- e -- ----r-------- | -- 7 ---- -- -- -- [[memsoeaocee[ [5 s7 o5 r] ] |l mI 7 ormio es]50 S-- -- --] il [mw[ iowm rTe sas 7 s| 1 [a[ rorosea sop)| mao 7i s|| [ orwwain |Coseoe| ox | ) --m [sA me J T o 1n m wee e --Tw o woe w ml s m s ]| [----omowrwwewriese T| ornomoeoee|WoWoo eomo n ] CC ome Towo Avonw| m as e ams ] 7 7I -- T -- | E7r7 ---- --a---- 0 -- -- [i[ mmr o m [ |eNo noa o] t [[mmoieso0s0T [os i | -- _ [ [miw mesee o [cr o 01 r e ]| BRATZ [m7 oms[-- or -- 000142 202008 2013 Tab 6:3 Consent Order T&F is Table 6.3 `Summaryof Analytical Results: C-8 in Groundwater Dry Run Landfill Lubeck, WV [sm ee [ w b | ] Gw een | [razmsom r[o oomre1 | [[ommoiimesosT Tootie | [[soowmeossTo or | I | RTS [ro y m-- ao m5--ee1 Poms wr |[oR 7 some[--ps -- ] [zum is] [[irme saaoeteT [e es s || [[rommoimeo0s0s1 Te 3s 6 1 oO [ 1 ea -- m 5-- 0es CC RTS Ezioorwsawoen s_T--35---------- [[esmmomaoooez 1 [ 55 00 1 [eEmzaen [a ast s| [immmeoe oa w s] [[irzormeoao0o0tT[ oa mse] [ro2w. sTos] om ome e: m] ame [NmDe=lsNtoetd DLeOtDectiedapaptroorxiambaotveeatnhde vliamriiteosfbdyetiencsttirounm(enLtODa)n.d over lime, lI es INo=Qtee:=stANinomataltyQuetadinctvaiaflmiuaebetlhe(.obdeDlceohtweaacnbtgoeerddaalasrqyoufaqnuNtaoinfviteciamatbtieoinrn(2mL0iO0)Q1,).(see Section 2.0 of DuPont (20035) | Analytical cuplstes'values worepreviously inadvertent omited rom _ 000143 129200 303 Tab 6:3 Consent Order T8F xis  { | | @ || || | || | @ 1252003 Table 6.4 Summary of Analytical Results: C-8 in Surface Water Dry Run Landfill Lubeck, WV UTLEY oo 0 [m 6sz -- [ [7 71 7 I I2 2NNoo0 0 ffiioowwccoo0 0 nnaatoonnss2 2 [[moemmaerTs wo] [[o o7 oz m --TT-- --s --; so 1-- 6-------- [ [72 i 7 1 o 1 I-- 2 mWo2 e sfoiwsco0 o ndions0 m1| UTLEY 05 [e[--[ miia0o2o0r o02T |o w Tifn owcondors : | [0I 20 Nofow 0 conaion2 s [C1 om 255me| [ 2 oo 01 r [m 7 mr[67 ------| COMET oF [T[ [ 021300225 T _|1 0 i2 2 oNNoofff0 lol2 oowwwcccooo0nnnda0 aitoiaon2nnsss0 1||| [95302002 conNod-fliowtions} meee -- Tor| [sz| e2 Norfo0 wcon0 tons --2| I [ [72 2 27 28|5 -- 22 VRoi0 rofo0 ow-- wccaonn0 da0 itiioonnss2 2|| 000144 tors Tob 6.4 Consent Order T8F xs  Summary ofTaAbnlaely6t.4ica Result: C-8 in Surface Water Dry Run Landfill Lubeck, WV PROPERTY BOUNDARY| Tomomes 35] [smeo oar ez| [emamo0zTeo | |_am | sp22o 8 ezJ |--2msmoezTsar | [imemooz|i [zmep meo e or [ izoomoss | oo | [m| an ossce| [STRERSAPLNG PORTH | Tosazos res] (88-1) | [smeooeT7163 | [am | az oe ooz| [mse | 106 | O [2@sm002Toss | [_t | ee oso es oz| Sho] 120011965 | oss | STREAM SAMPLING POINTAZ (882) [smam 51 oe| |_am | ap2o 8s oz| 1 212512002 [as | mepooz | a24 | | darmzmoor 205 | {_ [shares 4s] @ eonons 000145 2s SN, & Table 6.4 `Summary of Analytical Results: C-8 in Surface Water Dry Run Landfill Lubeck, WV Sample DR LEACHATE T Date T--Cougn1} [se 150 o| [--oeseoo 1534} [psp 1286} . [impos 138 | [armamoot1100 [G] [ameraaess| |--snensssTse | [ares |e] POND UNDERORAIN | 00/2002 | 368 | |[ome"m 67ao0z| [ize[ms] [--emsmo02Teer | [--2mseooz157 [emo T72651 _ |__zmepoor 1 354 fo dette) Note: Analytical method changed as of November 2001 (see Section 2.0 of DuPont (2003b) 1asiz00s sors Tab .4 ConOrsdeorTtar xis 000146 oe e : fl] El [il = z i@ 52:' i Ii |i g: E: ! l2g 832 | 55 : Hf[i, e8s 3 2gpmlol i i ; ii : i ! | |Eit | 1 goes | i So. :efe_ fd fl J 3 E7 ds ilh i |B I: i (:fi t o B2M3aEiliRkiIee iZg LaI[HE57P BoE g lIEs 22 8 i B 3 30$f 8f S2i : Po il srT fBg85 lo | JE :iss | lHiot 2: [[iEhs]ToTnt iE233 ---- iiHl isstl El E5111 a | SE H pind |i zg | Rit Z B4E A 33 N |= | 3q42:5i3essleos A| i20Ee0 2ERgtEs : 823 M 28 g| |22 dae HELE d2 - S3i: ssgialeis5s2 i EiEeE LL EAL z 2 | 3 5$i: g3 000147 g 8 000148  FSEuTgEg dIe CTR g ls | J Eran gi 5 RpEeEwEYg EEES5.5%EE 2BET iaEE ier gin ER Rg eBy FTaaf-A || 3&3:0 sf VEFTIEE g: "Eider 2) Y, :Wy A RTEUB(E2? PT oF2007= &2 Ng NN E ho =O CI52) 8 ENN "EEN E EF QiAEEel NGToi ms PL2L ria 0g 7dsS |eaE dF2E7S4|I| uH1: idoo"ff g 33, e [a SIS ENR NERLTl i eye E&E T5ExR F:Y Tero3n A sb& gh 4z p iiwt SN p N The 83 oS El EWrEiia C] Te E +83g Z a 93 T in r SaEgl is5.8ey 5ni ATs8;. eOHoNE E2))oAw A S& h 58s0 PLES 0 OX .- L.23i f Eo F5 il. BSeEhYT Fie foB8R wBxEf2 N Fie z Toad siBREE = CE BINGg sSiizgeAgT aF Sm2 oe3), 2 o5R 8s7 DEE Sh 58,5 / S B gtRBENEEEOLF3 JSR SE 5s Ooad E 8FREsEy 2R2 aEEa = { Sc8a HYr50NF=2 e L5 0 ) i) ke&\g | 2 3 g 4" 2B)L8iE ELiABLarEg ad Eh esl 2FH37B 2386iZ5 I8E E% Es Ey S B38y 1 ET EE EI lii og 000149 = Cd 3X | iLy B BE LCP e EIRN N.-E- * w WASHINGTON WORKS = | Jo oui 577 FACILITY | irom A752 eam : ii <7 gchupgbeheRaIVETe RaSnase Blen,, Li Boesite 7 an 7 / Pao-- t A --a mermooidTo lo Pov rey" TW SMORMARE se ON. Mg/a / peEEi AO YE S w RE es oa 8 = CY Ee : Ss NE or ZN : S AL pE ncen SM Ee IELR ol 7 Se Q pn WCE ONS DRL Fot < on HR. Cu we Ne L U B \E C.K: Be dPHe Nm mr . : ET 2 A TR : ES ol Now i . . amt A, ~~ AA 3 " Lo WaskinTgaitn or Fr0 eyen ,Se wy, hs BD am SITE LOCATION MAP rJ igh ------ er Corporate Remediation Group omington, west vie |OuPont Washington Works Facility Sagtre inPPgo,, SSna7 [E FormFe ue e a| 30 000150 ees %. ize :" 2gget z ! J i :nL. Zo !| 8 "N, m 5 g3) 5 | 1B NGE\ | 2 $. S i # ln Ba \ | i!: EN A Tee AU=. / iEg E2 ANE IH A . id Ty Lo Id "2 . : iit [A Cle ZN (i 3 cl. ii} L3H: --_---- 000151 RLY Rea itH i i + = NE . 3 %. 3 % w- Es2\y | '4 CL ir ) I ie [TTT iil iil io il ni : : CN } whan _ i i NAY i iLtiAE; 2BLC) lieendg,OR n foil SH Nags : ef 3 eye TNdar , gi WET eet BE cit SE AR i bob rE [F;H [i : mL Co i CER i if Hild Ii 5 Gl & po HE CAGE Siler | eg oh wifey 3 5 WU Lp 2 A 1 Hf Bl FC Ape Ag fr m$y77 ey. NS : = 000153 ig gil nef | | Im !} Ii ii iML A]ly 3 miti C#l 5i2i ] 8 oo gc amg) ow a 5 NN 0, Lae 8 bor Tr ond A ) Ho | i a15 a TR E Ay Lod Ni . Ch\ E oy Pe . 4 1]pHodoo Je : i iy7 ) ho ; "X{ e3 : 000154 hk silt fl] gif 3 | er, | Ju fl ny all] FIx [H8E fJo| l Hhl bly ' )| 0 rT BNPOT,irhe E er Lr CIR Ba) pr Ife] 7 E arae te a ae Ni | Hh "|ih ili| Hi a aS pi y ELd ASa been Ze BCAy3R N NNeENdey |a 2EE LC aeSR Ad A ? BOGEN. : TR S =e J Fon Heli nm i 000455 FTE ga, SL zl of Ee 1 NES EV EE E RR E $s fi roo omAY hb Ss Xx sk J h Bn aT Jeeafl NA Ree] Rl | 720 fg ko i W RE dNY qn PSEaRNlA ShePE J -- RroN oe =egd LCa eeWE 4 ly Ji EEA [FRE 8 i vi n"iii ill wlll ell SeeUl BseeNd sAcTeA FUSECifeea : r" u > 000156 mo dob id Lriop : i 8 ETe] h / TE : i ik" i b LE 8 dhiil g gE 8 i ii i g er | Bz koa i of] =< oeg lf > i l LA paar yb i lil 4i Fo > nua BE : 1 pp A | gi .pr $f g ~N\ Fk 8 zg - } ! 000158 -- ae [BE rl i RRA CNY ii SHEE ere [ 0 Ba NO Pa BY 5) par 9 Np Ee lt Ca SM 7 CH DAE | alSa i A Sid7r da A eIT Gita 5 i EE CAEN 4 EY ol RmEit NG [ii I FE FN 0 _ Telefe [alate] Ie a A SN SE iia] | wee We EGER I lis eae] | hey DEERC NRG 9 Flue] HL Se Berane acloite lFl l fnll i BAA\NNNRTEA Bo Ns gE HedNG Ee BE ng de TeReL]lEET RN Cn Ee | bly IAC x ER TER Bm Tre rd SER Ea mone J : . oN ;iB etG l i NE poi a aE ne ne EE Ne ! elTd] elle ; iw UH es a AE AER HER | EEE ; 3) : ony o --T= | Ea ZL | 1m. [TTY } Cop19 f [ORE C| o i - [mea ' HEHE thie Be BCaloee Ss )in eEdR.,SN 000160 : (77 kl NR 8 18 N 2iEEa Hs $ 1 ialveg os ghfe -AlNe ill | El sel By FE el op og Ki TH |= A) hall | gt i f, io ' i :N . a Cl -J 8 bel | Bii 2 bi Sw 117 =< 7 4| Dok i "TY 9 bf al al ho i i ce | 7 Ji \ a me LN Vg, i) EON oh th TSE dato] AN Paefa) | ` ROLY ger ! LA pS E el | T L WR p vopy | IL* EEd ! | wy ! FLALL : sHBehliiti 238 A fey Jd Iiel il| gliaf, | iThH ; gg Wiiat - Jd RerrToe | # Bd 5re =2 Hohloceenne T AgeForE eneSiestvoca eenneSSsV ------m Sl "wd |> Ge N ARE e ot es toBpoeson29E3 SNE at EA Me om SRE Te ; Nety5 am2h a2eh6. 000 FCog 3 iNSH SR oF 3 Eo pelts TR RAET LE M2 CoE mfiam i NEE Pot PN Et TIN 2fre nn El Er, og [s5 tihhog:i iii <. M3 iifdio 1 Ltuad d] 5 iit i HHHE iii wif tye os I[a CS2 e NEEATRO ERSBAmRCE|8 NG \NNoe LYof cpe o &B 3-- AER = SK 500d 3 gag i we $3s1 Hil3.3 si< i 8 3883 NervN 8 : mer Fg i ml em 5 Lhe ENA N NG m 2yesye i Neorg NTT RN ;N NE aa N I ii a Sean Ror E A Ff rinnf pbaN he eg agEPitee n NER S #1maF iiomeN 2HkHT14 i 3 [1 | 3 or gfild || Hie gl THiTlT had Hil hhiy woiylt i 0a0ll8 1 jo BG o = TE 8 ALE FE HN i 0 Nene] rm HoloceneAge n Eo Pleistocene lacial Outwash Age Deposits - ; [Fesngte<n Fn. Le THEN bod BH =BoosteocoggBh ok " fhleoessog Sey 1562 oy G0o0l E 0R % 4 RN: 1 P5 AiE; ! 4 |8 S : i gl ETT] | S[R2E Z 3 EN NN iih El She Sortgoeatt IN Rb 17 2% SEITE RI Hi Noa "rR SN o NR" id 1h : ye Noa Le NA ? TEA IRN VEEN2 A ENRSN . nl li 3 1 Cor)soAuE s EE E08 ER=e No = i fo IY i 1% Sooo wl hSEEN " | | . a 2 ye one E goloet Se Ep i Nite EN noalr i \ i fe N RN oe 5 :Ak7 rr BN El erat, hls RN TiifIEP pe e olasMi ZN ! I 5G: osE o oaeR d 242Ey i fot | 0 _o--S -- 2 Ee : Ey ii | i | : i | i i : ol | i i ji hfil i 5a = 8) Lmi=n: BhN ip ;l f o 31 E- .wgAoR N mE+ e|] 8by iiidhi | ) : -- 808 i i yeetocen ge E HYH | Bly aremisee | i2 i0 Hf i (|L3Bgg 8 : Ee ook, oad LAEMLSE T! EE 5 E=fAflepe enneonfof e oly S| LER ahd EEfE i T tes 2 82 1 mak -8 5 00. 083 Pa 3 FHfeRtoYe teeon0y S7 8e03gorc eLE z Hl 5 2g--t=am fod 07 5 fiil glpil or Ly1 i pag Nr FBRP oSee oSMLesI, RveRe NE : i= =~ ob 5%) qm <0 o 037 AN Rion ILEBPS re veSeespge yflTe 800d0Z8 LIN 33d ay BH Beles" Mo ai2h 2N ii pall 0g Ppa' Sg 3588 N = E\ N\ N Fboo. mah 23 Cii: s i oS Bi2 oo i } 2 a g = NN 2 o o 08 iz eid z F Eo AN\ BfoaeS'iN Eenei i MoceEwo ensIT TTL i RH | 800 | eI i is 18 fl bt i 1.1.3 'woop5 |IE dD aaa AND 5 mM Nig .i8 Ne A at dh Nts NR a MRESN Birrrrr oor So 33 Ag_ ustin A gdTT T -- =4. - SCALE G 20I 0 0 200" of , GC H ae JaanT 630 ss -5) ono RIVER =sg 33 NORMAL POOL Lr, % GE = /, 7 8: 82 7 v, aii E] Ei 614 508 s82 566 z= LEGEND 777)J) SiUsiaNnD cooAtyson ososts BE CPLoEnInSoTrOCsEhNEinGLaAnCoIAGLraQvUeTlWASH DEPOSITS -- VERTICAL SALE! 1=20' a Corporate Remediation Group DuPont Woshington Works 000169 = J ;tiAr1 ) fg J Ll 5 Jii linfl] | |E N #& h Fill A LE E Rid math) Te i I l of 1 HH I pr i oJ i) i. oe X i A % A X i i) 1h) | F{ W Ns l ol 8 HE= 2 3, wil TENS gl Bel HT 5 Lomi = i CIEE i Cok id a Rs :2 i | L CN Ts Holl | ---- -- A-------------------- =Ta SS py : To=v SC -epplae sy1 fr T N, NE oy (0 BB (Lap rhe. "i Slaeg TH boner iy LAT 2 et FTI ol aE a SER ~y : AE ee CY :k DC2BT Re o ,S +ne PROPERTY ~~ Ggsi Y DE o RIV ER LINE. a 8c--y , Dfietw,to CoTT R whe A wL ha eT Won lfae[saRa seee . FF&pol A Bp OUD e NTeA 2eS e EEe ANe ER n.S vie" ASREENGi A MN E A IE E JSEEter,evn ORNaed NvH i S SLAAEGNEENT NIR EA & & nx8 Qos NE Ea 2 wef A SEANDFILL fe LANDF| SOREL ci o[fF oi gecon PEMRINEISETERS Hr 0 AF (PERMBIERRE iv Ss Sa hy ii vo i. hy a Gt"7 fe enSE dl S5ETCRAETE GFNa,y,8 pafrd am 2 E5agis tei, 0 -vn -on i POELE Washington Wot Virgie E =sl y 0ceL7L i HETae a i | : AE el rl J --_ Vv > SN L I rldkfv4 Eo ETH 7 : ; TT eldTNEa i or \ \ : i \NEfd = 8 jIii IN ' .iW r A wY{JW >Lo1 o 33 f < nt b " 3 = .\ 5\ 5 GQ fmooYseaa i i i NT) Nei He C0 [= i t ;' bene i \ XY De / ws oh 1 CR) NS Cg ! .i 2 yi CA ig N } oi i en Poff rose Dg Sei AT wd 1if TTT \ NRT eh 1\ \ (iE TE a TP Joes 3 \ ad [70 AI | \ \l - 1. YX iy . = | Pe : BY LA pi p tl = IL @-- Det Li --@ uuerid-- i= [| J | S08 so: os o@ 3 tos 08 3 i |b i : 8 ; ii 1i ] af {1 g's | i ~4 i TT] i SL : | Po: i 9 } z o:f i; Ezg Sw | ` aT i 4 | ! | NT :H B iye ErdHiia } RE 4 < TA [0 : 2 8 8 #8 8 2 8 8 8 ! -- @& (1334 NI NOWLVAZT3) goor7E t I | (iihh i| g 2g 88 83g &r R 8 E & E8 L8 8eG8 ii 8g sc1a IL fii i o1t no oltd i AwiElEl iA ito 2 IAN \ | a1 !| ss LL AHSL NEEB NHi EFpll el cgBi8 a28 : : wsxg i PEER edt EEE 0 000175 @ CET r[otTor T) + + i = | g a. L Cpl |b : Wo | z oo! CVE@ | Wolf! I - 3: rn Hofil!! i 9 ly Bj 15 ie) i 2.| ao ; ioe | qi | | a8bo iHE L ! i] ia ai id! ; .gh| ar SF Bdoal) 1WE [G CI oh15 FE Hl : 5 FF 5 8 ik 7[iMeQ 5i ii iil 43 TofIT Al 55 i!JE S:U. 1i g EEE]N [A hEiias HNe ~ = i p 3y agd 2 ooo i ! b Po Ns. FT avorIEft ce if i Fo pT Lo H Pe w oh hi i 3 rr fi | Cf on Pa ol ll V|o\ 4EE PRAIE TN)AT =E \ : TUL Wo i Ho ; \ \ We fo Sem } ! Ls De. Bi ro : -- : hi lee DfEE & oo0x7T - - !ar Le . vd Fg ETH IY i OX A aryfli e i 4.8 nf Nt iu [Eo co TOE NNOTR hi Co AN pe hi i| "EB W ABYNh Ipe we ESE mE LS PN NE LE whNESeE Loy | CONNSEE NuTlEANEaS | " : NE Ch Be : AN ee Wi ee Ne i i NAS Lolgh le gS k No Vi i Sgr, J BF oo 00017 RTSZ TLel.e T el STHRo FT Flu AUR Loe' D AF7L7 dbeAr], J ant Vo ( 7H Cd Ea, Pony" 7 AINE SE eR A bo| LETARY LANDAgFeIsLaLon Y <l O \ NA77 1 -PERMETER----_/J( } 78 07 Jord LT SE bl aes gen, TN SSN Sol |m [St wf `. Las ow Ton Lael CA i Pek shade Or) & ooh eee if / ERISA " { 7, id Co SR EE li Sg NE Ia NA N JE 7 lSaEP5A5 rSEeNnOdS !EA T CiYl fog oF] : vd DNS 5 SRE Cd 5X SE rel ae 3 7 SL Bos Sar Nui 5 cen @ 1; 5 ' Gd gba Newt NL ~ ONNGS A LE ATT uly ga OF NSeeE RE NA Sa aN ONWL OLNme Ne Tr ENT No ae NOS a NLT NETL R5 SDyeSLPFAORNN RE er, Celange TEeot SJ Ui N TN oN/sT scate 2000 -- o 2000" @@ FN -r= m rvs E ty wiE more, uE tc 37 Ltt, Ww E = eTp e e| aot RX$F LETART PROPERTY . PERIMETER . 7 y // $ . * * J J) . PP NY \ &NNoO & S&S LANDFILL AREA .NX o. o. LETART .| OHIO LEGEND: 0.05-1.0ugl Tn 0.05 L ne ---- 000180 ES =HH amse |LSEe Va pe Vs f= ) o Jf --= k Co" i 000181 CEAarea 7 A aa N ~a=' o tR = iN = 5 =n fF I Aly 7 & N=)N Junevan NY -- i PERIMETER NEL YZ >'0 A NY 7 a )/) IK CE / i Nr) " D EH rp pS r rf E. s O7ZRZ N2JeXr/asd B) Lwornh sa conn [lfii to oo os amea a no 2 scat cihraSimh s FeTTr ee T aTe p E C9 Ra A TET) ETART CNNCTT JA PLEARNIDMFEILTLERSSoN l, N77(" | =y Py \ PL? eg) \ UN /) Ss ELT iVeL2 i)A l(lae > 7 AN INL $417) NT E Te eoma cTererwl v some ofa]l JJN)VJ Se ee haa iZ QO & SNS [| EAE gy Zid ToT mer os n[oi Tosar om o5 ] JI) Fr/ fRoEley TS 27.at&M/i// =ONCY) J IC ~N ~ SaNg T) AY ty AN 2M IN NT 2) & of iJ. 4 +> / iy JE / i379 A | = las ) +Ernemamsg [0 [ERE LL : O SEETHE| 6C50A 650" wows coorsre nr FETE CemT= TT = s. 7 / A Aer | | LAly of ) i i. HY: ! 8 fF % fT BR EB 8 3 3 8 8% 8 33 shh : vg eh ; " i iEh / | =/py i UE pl' Nal iT UT ii Cal i J 0 no Fy <8 H ay <i | @ Ff fF RE 8% FB % 8% & 3% i : -- o --- s 0001585 AirL | ft hPlh | hi) i la | 6; EEE EEEEEEEEEEEE edIl] TRI z EP ee: - FY !; - oeSa "ii | ->---=---- gee00201587 ) un Er / 4 ; AT a | NE1 _ I J voosss @ | Fae ] 7 A Lg Vag | $\e i] | 4A OC \ Yo = 000188 Fe Tr e Ne : & a |} H 23 AT 1H y= NE SL EdZl WH w a irAaNel r Ia|C5ldJ f A=Im S s py. Wy N oie i oEe A g S 1 ! a Loes TS As RS I L2 DAa A == = fFil a NWie -- Re a il TEITeTreryr wiv) a N < <io (I ) e EaN le fsas NB7r7r E Rieei d 2R ih DeR1|Baf Es = y, A NXP Ni n EoTR 2 ] A W 4 - C | LaNSNa= iSivit(Aal is 2 d ii LE Pie) eh SE"itN K 2 er a ewe i dD B . > ys ap < 3 . N, < ogy . . . oo, SO ony mn . Hen. * "oe de . Se . N oe = ost * N %) `e - SE . . . LEGEND: 0.051.0ugll <0.05ugl ce.serie ES000191 Faw [ooo crowns ee eR er ;: . q] 3; 1T Ei1 4 ---- di Hl |i ! filt! i } . Ii i _t . =f szzzzes i i - Noah PY 4H | pv |Ch SLL/ 18 hgA LA | no tl 77) al RY / Boro vs yi fe : LE te N =: NN ]A - wil ARN J ii Nd rere i i of Sg 7, "8 RL EE | X Xl | gee BN i oily pI Rte l JT Cy ARITA ok | 7 ! Nom mm 7 8 ~o i 14 - i Pel LN [a |vi LL Ifret,aa f| i p Co ene} RNC| e uzg ; }- } ty elt i | fi i . So ! } i id il Hi 1 Hy p i - i! forego J Nit i bg NECi. S | N Jqu CL "no CTT E 4 RX7] ld N Nag oh et x7 7 o| 72 fal| %/ 1 i SVror i i i = wl Sly | A } BA a = & a NGL | ih i I oh ; / 4 Nom mim? % I ir ri o~0 = Sia <4 a. " fon gine] . ~rE ith | JS lt : z 2 000193 Mm: Hill pletettttos g.l J othr t TT fi } bl old ! HN : 5 ! -| | OE | Gh hi | Gb g | GA af :; &NE| | Hat| irvCo l, EHFGir : a T 4 T i bvvv oe 0001354 f 3 oT r IpE 31D1 . 50 a diy Gob BRE Bo bon \ dling S NlBHi hE 3 El 3 1% op fi ; Np gl | | Nb | lH ki Cl bh ANNE i oGli LlLr 5BH | ! Peel oo PREV ps A. ig IRIE : | 0) 2{E uh Ll Nil i: Cu b i1 jlPoeITH 2 _ ' gioi, EH8 . & i Boy Ed {Ra[ be SPaiyigtdiiite brin-4y ER : (00195 7 oi fi | q uid] | Jo g 8 & & 3 8 3 ns i . TRE | a VU | NU b | i odd | NM i | a. i \ ! {aL | Ll iB 8 : 51 uh ber 000196 Lih | Iitl 1 | i1 | i ill [il] 5 8 g g 8 8 8 ietr - 19 + | ort i 41 | Ni A " 0 i = 2 8 g 2 Bg 8 ioai =f ---T 000197 : SDEE ---- : EETE] ; 7 Ea ht : 3% ! ! oiiy4 4 i Ji a 5 Ni = i } | bv . Nh' wt Jy 1 BL Ny / fT "2 J] 8i TR. Ai NJ Lad| X Nf ls I |! i 4 id y mead | | / wrNi a i350 enAF ag "i |. i .~ 7 or . Cw T VTeIX "ANHR4rB A SE8 EN LSos p oi8 i 14 : 4 i eh ple er ut : free ) i Nw ool, 3 ITt - Se SL : olg No] TR Hi i SENN - Je } I 7 TV, 1 [------ | | HY i [HEAD ah i 1 A a -- |i \ | fT Sd AR~~ Lh/ pnp0 "8 I ASReI 7 os gl sans boy" 7 Zo } A| i 7: = CG EAN CL Soe TT FE Dawa oc i ioe Efh = Ho 4 Sa ik | Cals sd El yo OR Te I< A Romie y | = oH by } . "oSLi hrs J ee . I SY : / ~i- i Hit ~ : Ye _ il on o TT 5 - : 2 | # 066159 x => 000200 APPENDIX A BORING LOGS AND WELL CONSTRUCTION DIAGRAMS -- \ WASHINGTON WORKS FACILITY @ 000201 `AJOB-MW02 @ eaT | iFisoeme., DBLoarEm (page 1 of 6) T ESCanEa SR, Compan Bonser omar Lonmaty Toon. Dorsve fi oescrprion ot re 7 EE i ma 379 iof a Welk: AJOB-MW-02 * | 7 Tannishbrownsiltyfine15mediumSAND wfsomefine1omedium. . | TEoEoR i" 7 Fann sityfineto meSd ANDi witu hsom meclay and iti fine. " "a EE Tannish brown fine10coarse SAND with some fine toCoarse wel = & [ES mmE me----1 `Brownfine10 coarseSANDwith some fine 10coarsewellrounded Er -- 000202  T CTopae eT nn |E a mn E B e AJOB-MWt02 n[Co--s fm am, hs Th Smee Sosy Seis Notes Lossedy L ThGo. Donna,te fled. i= 8 oescaron wt goanesz i w - i. Go "- Lo TannishSANDwithfine 10 coarse gravel, ary 1omoist. w Ea ow co ove ST ft I e y CR r-- 000203  SoretCopra RemediGosw | Dora fn AJOB-MW02 RoE Se Goren eorSesrionSnoo" | -- bCusrcoemesss os on han rTTreeotmmsa Caronmns Como aon: Coy Ton 0 cane i " g 3 [3 DESCRIPTION g| Bwenenessi2 2 }| = TarralooseSANGwin 06ine ocoarse gravel, 1amre E 55 1 : & oe me oo oa wah `TannishSANDwithsomefinetocoarsegravel, grainsizeofsand. wo con o n s ] 000204 URS|__| IE Tr ell fe J Em @ 000205  AJOB-MWO2 ors) DuWpoantiChoreipotrhatonetaRseCamoenrdeaetnonOGrr"oup Nant || e oSveoSuonems Dares ms hows NSCereranesra Ciaorsson Savery Veron cong Somerton tomeaty Ton oe wl o.e cor 2 DESCRIPTION 5 Bwetos vAiss a i y= [LTT Comarmy ame acre ov vas mcs F =o = ] Uo gray medtio cuoarmse.`sity SANDSTONE, micaceous, moist o. Eee Light aCGH ?grGaycylayeay vSAeND3STONcEa,reymeSdTiSumTtOoNcEoa wel Fad rse, micaceous, most ne. FFEE AR Pcm CLoiogrhmtteaegrrgayyrsssaiihltvtyyyye SSSAoAANpNNDtGDSSgSTTrTOaOOyNNCNEEE,.Yo md,ry. svveoeryycmmFicw iaiceocs so s] in] = = EE wl E -- =e=e {oor SANDSTONE medi cove. soGs7 6oor HIT EE [nLiCghotargraayyymsoanddyoSgaIineLd STKlDaSSyeTrT OeNdiEOg,hN t3a.nE dda.rk gray beds, on i Senora iff i ii ffHfii H-ssen ; < = Toh ra cee rama SANDSTONE, iese3na0is femme] A Tight gray, ine Io mediumgrained SHALE `Gry. somedark graycolor, i gf Hi 000206  J S iT m i | Gimie, Conv AJ0B-MWO02 BE Soman: fConme Coma oa 2Sea, Cn ore 2Sunt oescrprion spElov.: 636.55 | :) - Emenee | TTT oresmsc mame PHL ee CEoe esStrsron msesay.someon | Lt gray finegrainedSILTSTONE, micaceous,dry.somebrownish gray ElEeE Tr ARrr : ee EcEos EE I , [|Jwaee EiEhHS |ha . &Bal - 000207 @ NO04-MW03 sia) E ae R |T Ses, T nes wan _m--e-- saien foe Ee CGelras, es Sampling Method: Contos Logged By `SteveOpp? i -- i DESCRPTION iZ| Eev:sosas | = [R Lri oA eeT-- T Rea . io 7 "SILTYCLAY, brown,somefine grained SAND, micaceous. wet. r0e con - eT a }i = 000208  NO4-MWO3 Gaza Cope e Con SotaaenRag ineoCnmoei end"y || Sveocronossers Spr 3S30 Eon tne CEeromasa ar vary So en SingingMoos Caneous Loedny Seve07 9 DESCRIPTION = 7 8 -- COVEY SAG Som. Ton wk a | wdeonsoetes : = mes Tero, `sity.clayey SAND.fine10coarse grain, wel,with some fine to. pki w Lo =E o a SAO, io 575 Go sos re w [T\ CCa arboryoa own,ownen,to oSmeAdiu,mSn ANrDa,niet,ei e clayandss f it.ewesi__h 5__7__| w Wo] wao ol | V[B EEZEE REZ TCaromwayE yercoum rsewelrm ounded GRAVELwet] FHEI i EasEseRssEeEs) : BentoniteSeal 000209 @ NO04-MW03 esa SoC roCaA po eEReol pes | EGSEoiEegrrLe TEE ene Snm--m----EC-- Sinegnos Coron Coty Seon ii DESCRIPTION off weattouesns EE e E - [| SANDSTONE. wet, greywithcou sanr d&s grae vel mix. == 3 = Eee gE i D . e orowwwe e mas re a ora mom RE AE wl vHEEEEE aT ii Sonne sen vc sme A toon I. @ ) Lo] CO. a a So Te ead 2) PEE 000510 LMW-12 @ OpeensCoeootrssnRaeamCoanssaterOGvro"s || BueeetCaiesms aocm 5me0 Nryps(pagcSe 1hr15si) Crags ssa Loan coat Sroartloigrieirses Cvoenovoan frteey eanm ran fi l] ffllaa oe. 33 DESCRIPTION [== ==--=---] Casingsetal 14'.Reddishbrown clayeySHALE ai ~ 1 wEeis uraezr | ole [FEE HE pvc 10 agsosacass: Si Grout { Er - " Pp: 3: } [oY Too {a Greenraiyasnhderesa orsowSaHALE. Faced, angemote EEeremTraoee gVoersetdaSINGSTwiON0E 527 Poms E E LiEs nEn Ee Gree radone oro s SNGSTONE, esos375 |motting, dark gray thin layering, itl shale, dry. a FE]|orDawnagermoting.omsicaoceoaus.mSoAsOtSoTweOlN.E commena H a] 1 ee mme a cots STONE mses ose || 000211 8 LMW-12 pmozan CupaontmCoeneontr ReGmoeseersGoernp || OSonvvesas Lea nets Spent a4i mt e EE ves CoENrermres otSmirasre Sr PR EET Sogn on fro oowroe DESCRIPTION we a E --e mtormeh ay Ee , SNOSTONE. b E E| ee e e ree ne e SSOormi sa wf E E Ee ee ] e Ee i| wEoerviurniwz.errz = me a EfE ea wl a b F Be ee y ] LE r eEe E rr Sou [ [E =E =] ] Re Ty snmom m Greeinischora vaeyrmcymeoettdio etdioorcuaounagrsemsler. uSsAtNcDolSoTrOedN,E.mmoictiaocweesotu.s, wil Face Na y i wJCago ed oa dSnOSaTyoOo NE nSr OSCE 55ST Gar road brown SHALE avdsame gry SHALE, ican v 38 #sqes [ [IIITIm ITII ye men SEweg oGremen yEoyooynd oSTaTSTOpNEyrhiaorno 75 0 rnin a7 3 so 000212 @ Suero gCapgfoteseslemSasmoionaG"o|| oTDooncenomsens onorninn pri] Snes Secon [e TT 9Pr3 oean03200|0 sorp1 ingi8 aros _: Contaumus LMW-12 mmwaa(pagae 30fs5) frolic Looe LucindaTan i |1s3u 32 DESCRIPTION wor iw-12 Elev. 74262 } ` 2y [ [fosee| == 22722~|Greenishgrayfendsandy SILTSTONE.micaceous,wil in Garkgray wo [EE SIIIIIIIIID ce pe SAE 5 PVC 222222020] wom te2-164' EEE _- ood C [ii o ty CE wn | ana ! tes [I i [E rssesE isiti &} i 3 1s. man 4 000213  Comm Remon Go| SR LMW-12 --_ TT atrotaamy " | Srcornelsll mri oy f SCopr orn: PETE] Soe _ orn fo A DESCRIPTION Teen EE ig| wBere-anweerz Broa Ed ou E[EEEE sent JJ cE on SLTSTONE ["GreSerieEh Grsay ine 1 medumsandySILTSTONE. micaceous. arkGay. ! g i 3 3H =Hi Ee 0d uo f=]Greenish gray. ine 10 mem SANDSTONE, micaceous, Gark bin ray. - han 05 gortee FEEoEe G(rCooem aymad corse SANDSTONE, mics5, [[ EE =| Gb reenishgre ay ne 1medium SANDSTONE. micaceous, in dark ay =e] [Fm] Grenishgraymedium tccoarse SANDSTONEwilh race greene E-- EE ll f Hfi i HiF Sgen Hi Hfffi ii Hi ; i 000214 LMW-12 DuWpontGeopp opn nslReCeiormaag OiGvoirsr" || SeGomovSmaeesns nAam oe CNoaygai(pagsre a5.ir15s) Errata gore Ler taal SOrionregneesn CAvoionns Sooyy tVioor van DESCRIPTION 5 wBeervurwa.e1r2 3 00 we -- E Eoy em omeEro HSE = eorrE rn im sccm Hfifii |-sana Le Es=e =--= Eow coo omy Ese n m, ] | fHt [i a F2EE RmesotnngownnSHbAioLElodssGn wyesvry oyhoSTeAsLsErvemnsesrnveesr--] | a54] 222222122] yolowbrownand epimotteabundant,sickensides wet. fr reeead node FEE fran eS ooSseEeas: [IIEIIIIE =RJfeEa I SUE Rafe a2] 115d gas ffde 3 2 fEaA ii | ! EEE 3El: 3| ten @1iod | 12s. 000215 Y14-MW-02 SupernCeaopne reGmoneorso"n || SCaostwasnea e oo oen rCoom --_ ea Dubs on S Smar neemn & o E 8 DESCRIPTION Wer vis waz i fear 7 Rea SCOR W530 3 7 shyCORY mo e------] 5 SO, Farsbom iySA0G% rnd vl ro 000216 @ Y14-MW-02 se2e0) pe onGae egsamtFn aoCtmoeosdnaats onvGoon"p || DevawvCaoarrpnaes ARopatm .000078 vCoomeymast TsieRasOrT San Pant rtrd Siprpierss _ Crooimeonoen. coms SCotetyty Vuonns een sawt 8g 5 DESCRIPTION wot vianviaz Ev: 643.12 & | ) ' x 5 `Brown, finge grained SA wisoN megrD avel,moist. : ER Lorou 3 |" |E 000217 S ue ponCaepm eoknRsoCaamrai sionn Gsoe,v Sn || VuGsocomoemnasss Sarees [Per sadoo n n |seoee ovares_ Y14-MW-02 8p o] eeon Croommeenncom SNreymes(ovteo3r0si6o) n ESosns enen sty iain i< i . = DESCRIPTION ig| wfeevcveisoimmeion s| F oSnoes mei oy GeSB Tg rT | | i. cou o @ = r fe E ee 000218 Y14-MW-02 @ DuWponatCsarWpheoWrloaisrekaRnsoCtmogaendsnaeilntooOndGrneorvp ||OWOveowvCaeanosrnpre +AA7uan2128,.22000027 ain Pant Drnegiionos Reon Swpiguiencs CotonCores (age 4016) NGoemmoray SIFY 1G6o3r50t3o5n: ESemrGovs zVaarnny Loma toon Tan 2 WSoevl: Y6i4d3M1W2.02 i DESCRIPTION | : | } 5 FLITE] Grey brown SITSTONE vith mica flocs. mDRaaervkebmbrroogwwrnnaifvneeedrSffoAamNeDgdrwamiinheSdsoSAmANNeDDG.ravaAeIcl.0e39.g46r-4a5ve4eSe,imogowrlevyseAhyLbGilZonewenst " rSainAWSNsAoNSmDe.mvielt. 9most5fe-t. r1eyi0hbro3wn,mediumaroned pvc rout PS 0 dy 0 j 000219 Y14-MW-02 (pagesol) DuPWoanhtnCgoiropWnoerllatonedsFssoamCteoordsnaotnoOnrGdreorup || OCwovimeCdanreosnwes g2upn.1.2300087 GNomooryes Egos otorwehd r save anpant Dts snc SanplogMebos__Corious Carn LSoveonny LVieornansTan sEtY oo DESCRIPTION Greer gry GRAVEL wi row gaia sand a, mat g| eWekmveieraw.az : ceric reycarey SToWS Gy ok Ged 9 105 = wo Ee] Goann roieo=nesSANDSTONE = pe= e (r ZZZZ {T sm ity Gori wesieres maanges oan os {=--------------1 Grgereeyn iinegsraihned SANDSTONE. ws Ee Ee Ee E Eer ] " Ev7 e Fiano CLAY 590.7>av 3ndweanroeehdls " @ EE~E Gon goer -- Eee medion paned SANDSTONEvaymcscsoss rout we Berkiolssaan i Swapack f{i+il we Screen 000220 Y14-MW-02 DuWPonat CasporhWaolreikRseCnmoendsgaetniotoOnrGndreorup ||OOwwee CSaosmepdtes AAvaug2120..020022 WeMlannsplaantton WOerOgwamners Rone Sampigiabot _ CortaConrs (age so16) Gooramn ni cSasoosr.o ESuovaeCroyos. V2e0rn7 TY tommy LesaTan HiaErS mw --_-- DESCRIPTION i| s[ eve-- n be: = | i wl Eee| Groyon groan medium grained SANDSTONE. sighty micaceaus Boom ---- ii |-- H wen screen Bee Lee #5 G`Garyelyeinseh,grWeEceTn SILTSTONE. highly eahered wit 3" single reaiiown Fo {Gey voy ie rained SANDSTONE. gyweaieradwi gyn rit [= areen cay lenses. OG 40 H i fi Hi fLsitd oo 145 @ & 150 000221 33 g2a 0vozz2 APPENDIX B BORING LOGS AND WELL CONSTRUCTION DIAGRAMS -- LOCAL LANDFILL 000223 "e UHRnC ReS || |mSmwiEB | TProe scis om |swra oeatencs ITE aSaEannn eSnE Conus Lesa Lis Ton of me . 7 EEee E C Ee E Re i oD o (Et aaa ne. = & a] b "Grey ity GLAYwihfine 0Course gravel, mol, orange momng. A i 0Saeen3 i 000224 U W onCR ape vaiaRS seCmeodg ai nG| er"p ||OBvoewcsoemrpsra Jdoya7e.2n00 a Cmarey t sSororter oLloc staattasn o[mrnsesengcaEnNs SCrgotats nsorn s Prone # ROOT Sonpngranes Cones Com me en .2 z =7 DESCRIPTION [Gror: 605.115 v f EoEtE] GorhayL dsayeay e SILnTwito sh some fhiee(0scoarasergerasvelaasndosannsd,pmooeims10to tH = ifi w| EEEEH | I I iidanJ =i FETs Gro Gorey STwthsome fre cous veso sn sp E7 EE Saye CU Toe ce A | 7 Gro i CLAY radvested SALE WRT mou bowvere STE Fe.Gyeee Cebe Saag, -- fsa H 1f --- i fiii i Ee SEECEELED _ vo f reFa ran s goon, SABSTONE miseaos Tse I| B 000225 ""DuU PontCorpR orateRemeS diation Group |OveSard Sez ee Company Duncans WasWheWtoiirnknistCiognosnlentoOrnder LocalLanai |DWueitCGoanmpaiatres Ontog Method +t@.177.2W002 AvCarny CoHimnogCoWnVrsS.HY 420200451810805857. SoveyBy Vemen Suughog Mewoy _sComin, Loggedty Lucinda Thon DESCRIPTION EWleelvk: L6u65W.-11518 55 ooaJ Rees F aI ] " 5ooS32EEEE Eos csanat - aSGroermaer,iischaarcaeyrasnsac.nad,iycSkIradiengLnTsSTiinOee1Ns9Emmfoioane"muUeatndedv5Tgiccouaepnseddfsmoaalmlr6td3kia.rnk1g2r Puc esofshale i tema. ud os 75 p TTTi ] lGayierinnge ,gmiacacooouns,ysSi-- vcksenTsodense, mraestmes arr | 000226 "U DuepomCoomR oWreasReCmS eocastoenrGr"os || BOowwassesroos Wl nsatsion [ree om NCaympa Croat raserorene [F Lomceisea s a |sOars raiteiireisous__Certoos Stoomeyrs anroenrn i o $ w= DESCRIPTION g| wEereLvoewe118 3 i] w @-- 8s- TTT][-Emenee rsrone vesmo asses moar HHH eT d SEO E oLeoyE SAGLE7cGaBn3907"FGo ov7 Tok nl COR (arc araG5. PT] ------_--__ Coe gE yTooryd iy SANG TONEToans est | Gow ew mean a SROSTONE ion37 EE wl E E [o ee m e SANDSTOwitNh Esm,allbands of oom SOE soow darkgreya er race fractur Toss ro ETETE Croom guycre SONLEicondGoaare Toe EoCm ros mado eTSBSTONE Fees Tea mi. | EE i E Ee r oa bee 100. SR cou pe % soe es Sonapace fHi fsa fl| 000227 Ui ReHES eE ||EE|ESe BmWIIWEE Seughog eves _:Cortruous --oSaemweeen BT Loggedty Aucinds Ton 00 wo] Foti: - TM =EE E= E--E_eE--ee =] & E F E cn pr oy meson anasmSHSETm Oe NE mosses mi = EEF ee - = Ee] E [ Ee--m | -- m SANDSTi ONE. grains coarfrosm meedinumitocnourgse,55me1ghT16 Ee 1 = Ee [TTTT TIT TTTI] Greenish gray sendy SILTSTONE, micaceous. moi te wer L118 |mi i H |ifl |i fHT Scree8n) H f H i f - 000228  S SREEse F|mie, [ProsaF sse33000s |Senoiog eros LLMW-12B Camissop i rfmaeel (paga e 1of4) Lonesty Soon =: z nese ; Elev. 764.280 | ETE a &. - g R re aT Ee n & "0- L eL T GaronoCneianntsmgray esityscSHsAkLoEon,svu.earsy weathered.`becomesmorecompetent E3EEEiatis RsiiosgoEe: Pvc 15. SEER . - vr | = 000229 o Cure eCornoetesRceodnosGer"y || iBbeoeniwameneens ont Tern [ 18P9ioec6iE 353005Sa7rin8aa]od LLMW-128 2a nt eTCmoopaty sStoaorttm from vi Cornssami toma SiwOr oESCRIPTION wet tuwiz0 fZ| Elev.764280 2 @ Fo eG oy SALE FaseAe A EE E e E Eer e co Smet iy eT aemescamea RSRLCTON Frans eyo sen es E pEhrr om es E ==e=e oo Eee vo ol E E [SA E m K e SANDSTr ONEbecomes nsto medumgang 153. Err b Ly a Ere wl @ o] EEE aa] [Re ao iy Ae E i Ti eR~ WE EEE lt 000230  LLMW-12B -- erraDoi ertoiseG"o|| SomEoereOes non ene m-- nan r oS, evre | Cet ry oom 15: 8 S pr-- wfoioe rizs a ey wl of [EEE Ee [EEE EE [EEEE - | love | Eire Greenish-grey, silty. finegrained SANDSTONE, competent, micaceous. n EE Cm hmn aa lB id r ea || nd competent win whiquartz vems throughcoouretbetween70.5 Sutonritee doSeal @| Be E Fe e fan 000231 [) LLMW-12B [---- uponeCorEproa rlmseGoommoerra"y || --SSeocmn--osues eer ot io CT oorr a syr rm Stmping Mens Contossarpiny eerd Sieve 0 wl o8.f 8 = oEEs E BE= E] Ey Ee bee EBEe EEreey wl Ee ) ---- EE DESCRIPTION i| [Beren--e 2 fh [] [Hrve H H H HH LU Hfi H H f-sona pace i e[22e 7277-2e 722-2] 22] MSiAxNeDdSbTeOsNEo,frraeraycsobmropwentSeHdnArLtyE. and 0greenishgorey find Ograined. Hf-screen Hi EEE wy IEEE fil [EE] Orosnansrey fe grained SANOSTONE H 222222] RebdrowndsityaSHAhLE. Recpooor (8v.25 eof r#16y5). i sR f T0@955 = Le 000232 DuWpontCaorpoerntHatooeRsstgeCamoiarosandae Ondreon || oBveorcrocnssaues [Per aeranmesso 0007 e|a sOucreogns taunmses LLMW-138 yayeeose cans Coons CNEoermmoygotnmsvsim orSoveseerns rCoomesysy tVuonna on i 3 3 woeots.138 DESCRIPTION 3 s|f C [TT ero encT omiend SHAE NOT a] bo on rn Cd siiit:ss of [EEE| RedanSALE, snes eiow ing SEHEEEER foGrmout I Cre merSALES 22222222222 molting,moist owel. sty ee Sirens ye TSI 15 EE is TTI GrenSALE ce sng moe 2 SE Green fie 10medium SANDSTONE. micaceous. moat 5] [E=r] r FT eeeennSsmAoLsETwoiN:rangeeotmegs owimn ovpayaso] 000233 LLMW-13B ] rCome at eSmaatGony || Bboesacause Fo areir -- SSnaoreorer _ Toaiye I oErmmn"ia(agaSe2a0p1t6)e yein wet 158 iSut. DESCRIPTION 5f Elev. Y E E EEe m r o r e es a ] Ee SorSSO Toa To een STS a STS RE @ a ErToT Je Wn co EEE R LS SegE SE Soren ro wf [EEE wo &@ o] EEE Ee a EEE . 000234 LLMW-138 poses) CuepoornCsaWreplWeonriRseamCteoednnasteonOrGdreoup ||DoOwCwaeosnmedyiy 1502,020028 CoENnroegrmo esGairisnsens FroEaLRocEaLoRnaIN OCirripoivgeirinonscs MCoGmsms Stovneens YCornT DESCRIPTION WJeuknLw-133 FEREITIRNEE z )' ing dy tomos 22 2275 2] SeedSmHeAnLE. moinsetswi re SANDSTONE, voc micaceous, wf [IE in os EE Rese reer aoe noni raok gre EE Fn omato green rey SANDSTONE, micacoows, 10 rey eo B Ee ee e Ee ReqSAwiLsomeEre,ekenies mae0watl 0 IE[Too] RGeodrSiHnAgLErwyiSnAsNoDmSeTorOeNEshee,omomsetdowew,i cskoemnseiodedssha4l.e7.5m5:it " hd yO B raEnE e [&] 000235  SpWoratCsoWpontaonirRsestmCanetodoinangttaimoonGsrnoeu"p || VBvoaeecrorromsunns Corian Ouovnes [P mese esoo0ta a |srs olgnens saoy 12o00t ecm Cooma LLMW-138 Gagedors) NCCoaaroymspa sLSiensrerorscses LSovony ftroieon [rr-- iomo DESCRIPTION f Elev. as: e TT eRGeroryaeSaHtAnLiE.w mosiayn SAVGSe TONE oe rand vas TTT Rea SALEwhe rySANGSTONESiren mort DETTE EEE as] [TT Predominanaty aomdoSsALEmodi ey SASTONE ow aie| ne con Ee Fe ae me ad n reo s reySANSFSeTWiOrN37E07 1 ud = Ee L E = re e roy SHALE soodmrel o. SAVOSTONE i D wo] EERE h Ta sln ree ray SHALE. od elo in Sera [EEE 000236 LLMW-13B @ Spm on Coers tkensFaemtGedaen aotonroGiraours"| | GvOwoaecwaotrpa"ens ame omosn Co tani OSimreinasns CauoGwnenn (age 5016) SrCa rooatso aGemrrasrs SCotyy etormntom g wceot. uaw-138 DESCRIPTION ' TTT Cro oy SALE yew ed hin, 0 4 os SSsi5saisi TT Craay nlySeIE Saar gea es | el Hew 110- re esisasaty vol EE Weacmove rena SANDSTONE scan 7amost " bes (TET EEGro oy i SHALE,motel Saree 120- @. ) wo] EEEILIEEE BentoniteSeal [Som | RFeodeSoHmALeEc,uwmihsgarnedysrhayler,sinckeSnsTiSoeTs,OmNoEstiowet | Fre par SRIGSTONE scan oie557 I[} sanapack 000237 LLMW-13B Dueponmt Ciopeostrta:eRoeCmnaadetnoroGtraas || Gv-- oeeisns irye5o7e oats SSorrtctgitreenscs eCcroenu Cmoeryats(pagsSe 6o01en6) CSerraetros sro ty tan 3 < i g8 DESCRIPTION z| Ewemt Lwers8 i us B E y e a [| Fine sitySANDSTONE, greyigreen. micaceous, dark grey layeriingn if[i pve = Ee | Er Ee 5Hi bra @2- bomen [==] Finegreenish greysity SANDSTONE, micaceous, d1r omoy ist i fi [II]FFine gerey saendy SmUTSTOeNE.ardotormy sost.tsroe || i igspack wl E F E EeE E e e ronetpwenisn;haslreyyRSaaAcGhrSceTdONseEsssgraovescorSscmaodriion3, iHiH E Shaay a. fifii be i WO] bL SE ehe erre eenSEr anessenoe avere | fffiii LH Tons 6 Ha: 1s > ww 000238  CREE SFmeirm POTLLMW-1nN T E4BeTn R [S Eoama |S ee, ERTS i2 Z| Ewleevr. L6m72w.-014048 ; =a UE-- re ----oesca-- prion ---- % "Reddishbrownsity CLAY,withsomefine grainedsandstone gravel, ._ | ' E7a 1s iiiiiiiein. A |;R --" = Eee TTT SonmoderatelywearteddhishebrorwnSeHAdLE 28.35% 8 oe - moses. 000239  LLMW-14B page20r) SponeCapserarareGnmnaoiGsreon" ae || aobeewvcosmaaes pion so CaCoorrnsy --so--mo oxat [Projects1888363500014]SompiogMaros_Shspuncomis___Loopotty Lunia Tan DESCRIPTION 8z|| wenasrs & wl EEE Sh RSaekmrr einey7eoeoe ry GayoTnTrSnON.Ebknoseke = w =Groe=n =Gey STTSTONE icompen ie Hr | Pvc senor se ps " w EEE oo T [==] Greenishgraysity ine grained SANDSTONE, ace mica, sandstones Ga reen royedoeor SLTSTONEsm ir oa res. fHi fi een fH Hf+i screen Hi 7A1 RE1f8 000240  SieronCeapohaetsmCaonvaeGten"eo|| oDmocaerssees [Pou rSiionEm T aswSerts pameesres LLMW-14B J say wet oComanogeavsoorns)r `eshcies tEgomryeteys alanoenrso 3: .2 DESCRIPTION 7 py Sn Ton ) mero msea pe Ee EE E Feee e] EEeE e yaD E Eme s Tew 82p | wer rusms i saeen o n _ 000241 >3 a 82 000242 APPENDIX C BORING LOGS AND WELL CONSTRUCTION DIAGRAMS -- LETART LANDFILL @ 000243 @ TI Ra io LMW-12 || | FEatEe La ETTo SmiE EnLaenE n(pagSeEL1EE01S5E) wxoz -- jg| wo Oro frm [Casseitaln1g4" Reddishbrownclayey SHALE at = 1 Stas [ZIIIIEEEE Peat, ve tod [FIIIIIIIE0 SESEsaes Grout a er SST Grooniah grayand reenih brownSHALE,fractured, angemot =r Se Greenish gay fine rained SANDSTONE. wis dark gy thi yering. = Ee La BT E{ e mGr| eienishdgraoyayndoranBgrebrownifinesSANh DaSTONE,micaceous, e .11{1 .| E E = ----meE m mmmS m em w e -- I Tg EEE 000244  orre ere mee | S ee E LMW-12 pein [i bree Pi Tie] [SYadEtiTay STeetwe rEeneel Ae i& oescrron jZ| welt wz eev:rez62 = E E =m me r re eo = E EE mR mT :,: a = = E Ee e @ EE E = =e = E = e - wm e= ee LEoe erm _ om FE e Eem a]] r| mCe oanmdoavermyameidse eara pehnt SHeaStTeOstem,oDsmtooomywswT f3 EE o Im aEre r g Esser | =~ - === 222]DarkreddishbrownSHALE andsomegraySHALE, siickensides, very i 22222122222] wacturedwet 3 d5fess [Siioooooot _ | a[tEEweosspyeSnSTBErsRGEa Wo ki `Greenishgray SHALE,verybiered SHALE, itll sickensides, very S, Eso: 000245  pen LMw-12 Supee CpoenpsoReConomnieeseGr"y || obfSraeesrSripeneuseliiRre5 a Sogons Con ESFgrre ET vtnre ty on g g| WeflloLhWe-12 DESCRIPTION 3 1 a a [22 oy SLE dy vr e e @ = EEE GRroeen ,gray ond any SILTSTONE, micasooss,wi i Go gor Esrsesscsl PVC Spe o [Io I Grenhgayana veda brownSALE,By. Brshoe nwans [ESSHisErEy Grout : Fr esd [TiTEI GreroaysnandiySaHALnE, siakensioaeys. | Toe [E2IIEIIIIEIID id LE 31 ] EiEiE 000246 @ LMW-12 jo Sue p Goopi tMiomnaRseaGnaocrdnn saetonOGarrp" ||oSeonevctaasmnps &age 120% GSCrmyageog SFsierrse Learnt SOvmrppgnieenses_ Caorncioon SiCetgeyn tVeintan i: g DESCRIPTION To Fre eee GEsissssses :| wseet vtaenwr-12 Brow gre iii 80-tem |-oItIIIITT Bentonite Tre SHALE Sande, Tr Go ele TF I E Croonersay STSTORE 3. Soenoay.ner any SYSTONE, mines G3 37] 3 solE o Eoe Gorrin gayh.foraetoonion SANGSTONE,maseoows.G07 Fi =7 3 FRESE] il ifi f f[fFgs i 1 WL. EE rr---- f3 es EI EeEe ]a Gre egorauy nmenToriadinum SANDSTONE, micaesous, tn=dark gay. ) E E loiR ory motu cours SAVORTOoNsE iThvcs ronoimy 3 EE 3 no EI |iii Hi i fl 000247  mesa CotCoo rpWorealWtleamsRh seCmoansdseinan tiOornder |OfoonCotounnnoeiesiad Lot Lane aSermviargriieancs LMW-12 -AAqumt132n002 ACocnous TCoeromnp sim sosoe5n1 ESmvsus V7o6ra4n706 Loogeaty Linas Tan 32 g| WSoevk: LrMeWz-e1z2 DESCRIPTION 0 w#o0 -- E -- Groom T raySANGSTONE con) T. - scoen EB ne fi f| [sens B= ay AR:fi tos gas er] S| Hi awv [E =Fo=r=m RGeregw eennbgroawynS.HbAiLgE1l0e9sse andaygyr,eevneirnyfraaycSiHeALss EcveernyeFsa.hwde.t ||| 22 Siow own ahdpremonn aoundan shkensides, wel k[i1a7Hl] 4 Geiiiraisit kal [opm|| Moen EEHStIEETY |RTEIIEIIIIIIIC "Groarah gay ne rainedsandySILTSTONE, micaceous, a. a eas hal haa 5 ad b2a) i 3 g3 fai t ft 2 } Tora 1 3] ote 8 = 3 us 000248 LMW-13B/A S DuWpaosnhtiCrgaionpHaorRsoCmodrastaonOGdreow || ovewCeorstes Aopmm15.R00e20 Gmoereg?)(pagooe 1n.0r1y8) pLoeitnrtaess Oarriptmaes xaucama SvCeratos vsoirmon sonsigtonns Con Lowey pe su g| wetostaw-138 on DESCRIPTION 3 6 `Casing installed 0 14' Tao0Srha1lo5l0mo,w 1C5ob5n1er5as5n.oatsbeeswne3olr3LiHn1Wm0. 13218B)5o.s513r53, r5s2dfoS 0m8E13T0OL-h 160e,ms 5 @ ave ou wn] FE GAonrn omy Itm oran dSANc DSTOa NE meaoeanMvi Esor i E = e on TE ms oneoo oon es ot EE `Lightbrtooowrannge medium IofineSANDSTwitOh NfleEda,rk_ EE Ey E Ea oon ay oo di SAOSTONEWi5074 Gar 33 " layering,micaceous,Litedarkorangemotting, dry. EER n rra mtn. mn I Fl 000249 LMW-13B/A DuWPonta CoWepnlaonndRag seiCmaeotdosaantsonOnnGdoe"p || aDvveRocsoneonsuted regoon0 15208 0 LeanLan Outre Arcovs Sinpiguncs _ Cotovns (page 2018) NoCmotegsSeamTvaranas40ma9 LSmoaormtsy vaen en og g DESCRIPTION e 2-2T]T Rr CoedsaorsaihrToCmanraconve7yadySsHAhLeaaE..ervseserSiHrAcsLhsbrEievdaws.ryatnadcarrey,iSnonn wEootstw-138 [T2T2T22TT2T]GGrreeoninnggfarnedssoomneySI6STHSATLOENEs,cwoivrseomse.caay.tmoomsot Greaermongraysana SUTSTONE,Vacs ices acs Berdes me - 4 [=] GSreoenioshngrayfine tomedaanmsity SrAeNDSTONmE.emiccacaeoums, ace. E TIom reer ray To say SLTSTONE,Foc 16dionsioc 9. SCTeSvTrOaNEwihiomseweh errriss 7 rind sion e |i I 000250  puesan LMW-13B/A GuPWontaCoptorWiaoikRsneCmoangdsaetnootnOrGndreourp ||ODweesCiroemspt Austg112.250002264) WLaoltnsLtanaation oCnirvoriaapos uCormy SampiagMotos__ Cortovons NCootroy SIFY ea5n0o2 SoEvaengrCyoos| VTe2r1n6506 Loomsty Luca Toon = * . DESCRIPTION [II [IE [222222222Jroonsn gray SHALE, ace races. ay. <ReldoiwarnobwrnowasnadnpdurraeymSoTtAiLnEg,. vSeircykeancsoheesd,.msosmta1o0nwett. [Erma Jaman oy SC veosa ae i 8. CGraeneinnroayraTonegsaendCyhSaTrSesTtONaEy,e6rs.mcacaons, vac acres WEevl.l LWW.138. oo [||sGoemeninocyaneTrowgroaymeydeurm.itySANDSTONE. micaceous, 6, win oe E Eee ] Crean gray STALE i Fc ic. vaca Gkrey aye, 6 Gout " m 2S =T SnHiALnEg,wiLnieabcunedra,ntFaayci0emso.ta.bundant yellow and edenbom hs @. 7 Fri EE GrrremeaninsEhggrrayyfSHeAsLlEywiSAiNDSrTONdE. bmircoawcneosuhsa,t.iseiassdh yrom] Ex 000251  T ESe I " L | miemne LMW-13B/A --_-- AN Smwnan SS0m0 ie HO De Feral Surglogiveest_: Cotngtun, LoggedBy Lucie Toon i we L138 iiHT E feeE s--s DESCRIPTION = frig`Greenish gray sandy SHA verL y frE actu. red, slickensides, ary10moist. Ee E [ e |s`Garneeeniasnhgbroaytofimne>sitySANDSTONE, micaceous, dry. Very fine. - Ee Ee . ] J Er [rey`Grgerae ysanndiySHsALhE, slickensides, dryfomoist 7222772227 Reddishbrown andgreenish gray SHALE. sandy. slickensiddersy,. ve HE i " ET i M EE e RT ms ee @ Cs m= 000252 LMW-138/A @ OuW pontCopeee rtWaoekmRsaeCmnoaordg asiaonOGrorw" || anvreederodrs aAmpaosn) Lemans Smtr Arco Spiers Cones NcoemmeopS)(pogsSeo5oorft8y) SCoroyma a asm omer, Loo Tn . oescrPTioN 5 hs SHALEwith some yellow motting, moisttowet. wJot iw-138 [omy wy SE vie 5 eon ve od nO `Greenish graysandySILTSTONE, with some reddish ststone. o STTnSTONdEegainsgsHrvr To od SR vey ve cou hg CL--=== 2-2 Greenish grayandreddish brownSHALE,ilesandy,sickensides, 120- @ we] ILL reer rn SHALE. ny. ses 3 SS I e Robn mroa wntclaat y. tseyoSrHh aAiLtE.swi oWnoiognrevenigraysnawleomvery [iii 000253 LMW-138/A @ So CoeplaonsnrsoeCmnoesnmtneo"ws || OT smecasuy s Aneey ea rats my out Sagres Corton Geeyae(pagSse i60nr8i) C Spoo r rsvmi press eT ii 8 ee DESCRIPTION iz| wBenr unwise 0. oyD - [32222 SREvay tedwi yaow and pie EE SHE 2222SReedanmobrrionwgn..sckaeyerysSeHsAL.E.rveryaawcettleGdiOwNiE oOsIomeyelow and or: STONE So ao Fase Eo noent eraednSd HoyCDeSntoTSreOEweNEay FE o m ioughout. mcaceous, dy. (Zone DE) Bolo3m have le crangish le ae I" H i ii if i ft Grout Hfi sa ii fi ffii we ba e rr @@ bb baeeey vo Hn ii f iif i 00054  LMW-13B/A -- TpI PeAtET e "I | ftpreerns eaL ,iEn Si Soae n rs mT] ones ton EY Ee : a i [rm 5 DESCRIPTION 5 Sa 2SHALE with tereddish shale, siickensides, fracturing, E EEE E eeEr wl [EEE ot wf [EEE we SSEEFemaSTSk Sa I i @ 175. ee SR Ee] Ee SEE rose GEE ee REE eee femme]Green gaySALE competenioy pad - Hom | |i H 000255 LMW-13B/A @ Sue ro Con ip aayCenondoa nCrGey" || a SD wecimoene s aS pisea mCeramnn erGag: oa essoarms)a FHo TrTts] tferseimeeses Sonn Sy lvenn DESCRIPTION Tt { E=e| non a dn 8 SANDSTOgrNaiEns ftoce oarse,wihniermitnt in 3767s oF Eotouw138 7 i| 180: ;) Esemn e] E= Eea Coe ow rs ee Som SE foe oe 9 wd E R [EEEE oom gT io oe DSTOREvaeymenmo aVe Fem fE e y \ = Groenah cay sandy (== SITSTONE, companay. " easedmies =F=on ==== e =~ { T BrorodwSHAnLEi.y wishsohmegreegray Shae, Facies. wl @ 0 esss SSE p Emrre SE 22227-2722=]variagated motting andslickensides,moist to wet, (ZONE-Fconfining E EeEe E E Reto SEwlwe wh SOT TRE -= 222222222 slickensides,abundantyellow and darkredioraymete, dry 10 most Tors ii iifi i i ome |ii i ii afi Ealy i ffa t sumsr rsd I iA i 000256 LMW-14B/A @ rr etl e] E Tet [EroveG19r19 RNe s Sae ium ESIn, ven Samples eos Contos Loamaty Luss Tan ww =| fo3og ree DESCRIPTION BJ Tomrte 0 1e4mbyBioewasmern. sCoengeSnars 1a 114.9508, Sess Jworirtss . . con | ve E e Ee f mTee DSaTOREoa r TONE ene == o E= Em e e m re STONE a WT aE . ER RE Dom EE Ee] 2 {E\E= icacoBroownuandsign grcong eemnoisthtgore(yhmeeadviyuamrIoouncdouarscergreaisnwS)eA.NlDSTONE, [] 000257 @ Se nGae p rr em" eGmos || booesosms a ear o ----o [roman10e3200015 |Sewwlaganas LMW-14B/A zon sR ap mor m CToew owsammn acrs a vn Contras Lospedy Luc Tan i: 2o 2& DESCRIPTION |8El & EE lw EE Ee a]Greenish grey SHA veryLfraE ctur, ed, race brown shale, moist towet, oF mSR eerevna nte avsoveDivw oR GkoryoSyTOERw.eyPrreeede| EE Greenish grey and reddish brown SHALE, slightlyclayey and fractured, weneve oa Fi EEEEE L omcorySe AEva a ylyo wf [EEEEE mo BE So AESeeG SLEo . ou of [EEE E i E e eroe w STACsEe ywonea,s yl Har, on EE Cror e mSr aeoyrTtSoFsoSneSaToornEHsiAEe vcosmcSsWaEi cFoYErw | @ Ee Sn RENEE o C EErE he [TTTTTT ZT]Reddishbrown andgreenish graySHALE,with traceyellowmotting. 000258 LMW-14B/A DuWpontoGoWpmeolrlshanteakRasenimaeCtdogionansteionotOnrGndreorvp || WODoveCeSoiarrbeedusmon&Agtu212.g2200022 Loan anata SCroimcggnrgerinrsos CeoGoonvs (geal) CoCNrororonrsa) cGshruesnormeaerst LSovoemis Vperrn s ii 2 3 E DESCRIPTION |g%| eweervrwowrrisos } go] SRaemdeaancbrriodw.SvTAcLsEawndyi. eoygweeeln (vgtr@ayFroecS)irens. a [ETE IT Gcoon eyoyn STAcLoEa mwpitesf osmaermea ysaan1b0n omwobthae Seeing Ee 0: ou [EEIEEIEEEE wo TIT Reel eoywwncSeHApL.EabundsaonmteycognapyeshweovwerymeFaasc,emdost ot aq [EEE hn Grn gaySUTST5O330N0,competent.3. E 0. ETTT GCRONreFroa elSTaAnnLdEwiiemsomwienrge.dwdenbSohwasrra.evr acre [ e EE GR own go iyow EanEesRSAENDSTONE. csesous.compen. 3 000259 LMW-14B/A @ DuPWontaCosrWpoWlhraotirienRseeaCntmoaetndogsanetoonOGrnrdoerup || DDavteSCoumptes WorGame AAvgg 122..27000072 FroeeLLsot1a0GLaRnTcLiaGOOTS SOpuingghneiraorsos GArocraniaa (page df) CNompeor WrY o 6r8e58n0 ESwvgerotys Vaesrsn et Loomis LiensToon s=or TM DESCRIPTION E| wceverornieo g E BE e - |E---- o EE {Green graysity oe rained SANDSTONE. cacao. competent. - | Ee hs E= e pve Ee = - wl E Eee e oo Duk reenoh ray and ownsSHALE.sherry compare, E Co mm---- D= ar dainbrown3% da ray SHALE. vacayelow'mot oo igh reaashbrowSHALE,Faced, vacayelowming. " Sov r97y aan row STALE, scherade, He Fackrng. +o Elie 000260 LMW-14B/A De uo Cd oropotraai mltaRsetCmeog odrinaatmioa On dGreu"p ||oDVwonwecSaocmrpesoans pAutga1r750077 PoELFeTnEaRnEaOTS OSimrpigiantos__ CAwoawraen (age sors) GSErraygmop| Strioossneiorsrs CSeoetry Lvovaneen n st to wl DESCRIPTION Ewvoit w76w7-.110e0 ; 0s. [s] ST RRRe bTomhSHAdLaEre vmoasc greect eySrl,ans TTT [emeree mesommes sersrore vas messes a TT RemmirnowieavydeshoomweDroewenran rpaoypSAL3E2.7SaogHamcmaetowet. fie To E F2EE3E S SRehanwiocwkeSnAseLsE.swoimevyaeslognmohngamyohs lwveotr Focred. re i Goa 1s EooseSIRIES 0 @ = 125 TTTTTTTT TTT eens oe same samy STSTONE os mceovs a FM TTTTTTH TTTTT RGedrdeieshnbrgorawynfanndsgraenednyiSsIhLgTrSaTyOSNHEA,LEmi,cfarcaecoiuusr,ed.dsyl.ickensides,wet | Es Setsaroadm es aygo hom ot ayoy SALE es. [TTTTTTITIIT] Groonn rye sony SLTSTONE, mcaceo. 35. 000261 LMW-14B/A @ re onCtoroeRenCr eoiaeinos nvsGero" || bGoeaecasmeaes rApsEwn e Lon rn --C--r ucts Sorpogiures__ Gino (page sore) TfComnrrano Cre rman GSogmr"i leortnion DESCRIPTION x8|| awenmw-148 = - ~ k= EE E e E mrS m r eyR e csESGSTTOaNEmraiSioeToegmoeoaosen r Le e E yy = Ee Es -- = Len o = . oHy A--o"o Ere Ee or edn SIDiScesoTw WOi oNm rEloa,rs ew orem ese Ey Sn own Br GroenishgraymediumIocoarseSANDSTONE, micaceous, somequartz] WR) === -- -- ov l eH e'. H i sco iHii H i f ii i ii 000262 @ ST tSE eT ma |Fii, LMW-14B/A pom7ar) na me o E dare a Gham pe BEE Cr SunpiogMobos Contin Lopes Loon Toon 2: 2 -- 3 -- 8 ee Er] = == = Ee] == == 155: Ly = FEE= T] "Greenish gray sandy SHALE. sickensides, ary. &E|| waeerrumowiee #i f{3-seeen i :H| ! i wo EEE a gay UE amo5n a I 165 AE a $89 [=== |Reddishbrown SHALEwilh ile greenishgrayshale.veryfractured, ah 7: - @ "Greenish grayfine grained sandy SILTSTONE and some sandy SHALE. tracemicaceous, with tracereddishbrownshalealso, dry. sons 000263  J-- LMW-14B/A oaa i n CaseC"r | SoC vemcomgoats T sep 8 Tanne acura Sororynren Conon TT iomR oe men rteyt rtunn en 9 oescrpTon 8 ws E[ E = a oo ao so esl Grege raynfiniegrsainhed silty SANDSTONE, withsomegreenish gray -- Sov Tero Er PIC - " p Behe b. [] ee Baee] Fp T rem) wl bE e H A. E ERam]amom ems s e ce E em ove. wo] E E EC ee e ]a S GeyE erwime eaeme SSOSEn TvOoe NnEcW e roonm Fe a S Ee e n TT m NI ASE wl Eee Essas @ mEEoo] GrownahAgayaandrreadtinbrr ownSHAe LE.some, facies, wo] i fii Hi i ||, I| HI LI ows Hi iHii ii H HHi fii Hi 000264 LMW-14B/A DuWPaoinhtiCgoiroWpenolrWlaotlertkRaselmCaeioodnnasetnonOdGreorup || ODaweeCSaendad Ganon AAsvgugt2120..22000037 Lon Landia Frees TET0OETE SOimieggevnioesvos Cacocmoems (age 9019) GoNaomeayWVSIFY SGoarenn SEagvoys. Vsermn a Coomeoy LnTan B | sm | om & [me fe 205 7 2F2H2I222222] FFEEIETTsLiiLeeY DESCRIPTION Se oiunnadnraaone gcwerneaSnsHn dAaLrbeEoenwndiaannbssoomiwesmraaotboiunmndga.nmrteayyetlatonoawwtpenutrhe,lrd Tore aE &z|| wseevenren E# 3iE]aR [3 REaE sum BD 20 215 20 22s 000265 3 3 g= 000266 APPENDIX D BORING LOGS AND WELL CONSTRUCTION DIAGRAMS -- DRY RUN LANDFILL I) 000267 @ URS Sr aCoBpa eoarnGmooiaosnna" || bGSVmosceoonnsgews | tePo raeaes ssk00|S0unwzgues ros rpontinprs wCorarenprSrersm con r Erioe leagen Comeutus Loma Lose Toon ii oEscRIPTION :| Eons & `Cainsholie tno3g2" . 6 Pvc EE LE Conn 3 Gs wl [i @ ol [EERE Ee iain 000268  DRMW-16B J-- Sa ore Cabro aae RaaComa mamtoGser" || b--Seanc--ons sap CC[oeemr ome an ree] fSomios CAo.rn TCtyy oman a DESCRIPTION {| P we 1i68 EE I Grout Ea EE Pvc & I TE I E Em eems sm es EE Poy o =E=E SL Ltoea es Ee ol LE eH y @: Wo [Er Eeae fl i ifhIl rFsos, III fI fIiIi 000269  DRMW-168 J Ba BrEEe ||mE eE =E LL E TiS .aEd |ProcisTose 0002 | sunianares Canons Lovedty Luci Toon 3 . i= 3 oescrpTON f = = (soso eon B Ee = = EE Ee a ETE [Grgre ay SHALEe Gayey. mn acemica.i most sh| wet own saeen - | -- E E FE 0 E r ---- . -- , IEE : 000270 URS rm SroCno eksaFneCneossteeorvGio"p || eaoensoaenns nano vio Orn acta Grates wry Sirpegires Coos -- CTCooommmreasaosrierore pCroottay Vmenear n .g DESCRIPTION | wEeesvoomwss163 w] o EE Essai wl EEE " [o 77772222 | Ge reenishgraySHALE,withasomee readin brow shale, Gace SH Beata w T|] Sokeerrgyrarysearn.yio.red STORE, sess Some i Hi | Iii h!i : 95. Ei ElG HHiH Groom E HALE wisneGR Bo SR ee wo poi 3 000271  Sue pa CoogiorRa s CeommaaOGvdaose"s || bDenoturneso Oreytososniaain VSteiros -- a r DRMW-16B pose) n2Rope1p2:01 Cmmoeoartpeesas r rsoemaarinse wong SCoormoats, anomretan EASur. 3 DESCRIPTION f wesc Elev. 769.965" @ ; EiRow SALE esoere a ayaa nt Fa ac we f[eIsEtEs E 3 [S35 TET2222 = SRa SHALE,most io wet Giainbyoteiomy&-. wi [Emmm Eee sennie I 120 =. as o ss e T EE m Fr ary SUTSTONE Gh a7 Toe3s oo || IH 000232 @ T a RBHEEe EET |E |ESeE r OL | Ea EoER DRMW-168 fo [Prosartoommai0n0zs |swnpraencs Corns Loomdty erosTan Ha S-- J wet: 0Ruw-160 3 i [Ee [Iar me emme a 15 ines TTTTTTTTTT Greenish oray ne grained sandy SILTSTONE. vace micaceous. ary. ws ei 1 [TTTTITTIIII] Groen graysondy SIUTSTONE and she. ace sikensies. a. 000273 @ DoteCaopa aRnesCmeodaatvGnsoenp" || DwieeCsoerpsues Oerytonaannan eSeratn | e Proea0 s 0|s0 wegerms DRMW-16B panera) Aosp a1200820 CC[ raogsr rrb seomoo Caovrotnon rCooomayty tvianra en N wer oRaw160 Ig DESCRIPTION : Elev. 789.965' 8 @ 150- j H Co mr Satewi iory va acres, sires FREE 155. posse @ E I E MGRiNGiEmotessomee keleoninnd cpeool.emoosogtFares rae is FREEEELIEES Bentonte 160- 3 Sasa we [i Tore no se 000274 DRMW-178 @ oteCaorptaantFsssonCtooodnva OrGgeorp ||OtOvveeSaCoernosmes AArto3n83 FrOcrRToEmRLEaSnAi DSerpngtatnes__ ACowmainn fCareee(pageyD1r0yfa1m) SCCoeoormtyyes Covroooraren iHEEo DESCRIPTION wEoont:w0520-271070 a: s hs 2= Pe o{ y 3|e5]- ewsf sd wi oJs7s wwid ow] wp]y wd wmli wl no omen 0 "DATA FOR BORING IS FROMDRILLER'S LOG" 2ooo sooo] BranodredwSHAnLE tessscsaaas, FE Redonda SRE [EEE CC F1 === oz 222 Redand greenigreySHALE. E fr EE REBREEEESSS [IEEE [TEED Se {[RGadmsnageoSaTyOSNREE El [[EEDEIEE AECL EE E Eese e e|owmmosoR = Eee Cboean E or ErTwor geieEgmee--|%] oBvSo Bertone fil ome fi fireee f ps 1s. 0 000275 @ SCrTcesEe || SSir. hTaEkE DRMW-1e r8Brran_2 -- Te BR Log Se [Pioarmons |seoeotenos _ Cotunin Leos {Then Oonave ii: sescrprion sS r E 2) I - SE Coin iii 2 Grout Pvc pe F EE o] ]Ga reenish gray fine1ormedoiuemSaAWNocDuSreTwiOwtNiatEphunddaarmkeGrgraeynthginelasyers, EE SEE 000276 DRMW-18B e Se FT Can pmenFo seCnoodamr vmtGeow || bDoosseosns 0B5I0 pose zetn C[oEreowa eSaknrtoosn a --Sr--a cows Steornres riensnets SempingMatd Continous. Logged By L Ton Donahue 3 DESCRIPTION f wer orn anw-168 = n Ee Eee] L s Cr o s e Reoecare RCE To oe "Greenishgray Glayey SHALE, fractured, ite red motting. Less clayey. Ee ame STO mon ma EERE] * E = e ou _~-o the - [=== [HHH G"SS rGereeeenninisshhge agrraaoyySofHinsAesLSaEen,adTryreSdIOmLoTwSNiwTnOygNEdE,ytrolemmioecas,ortaan_rge_sm_oeftidng about e ww] E[EEEEE rer `Reddish brown SHwiA lh soL megE reen, ish gray shale, fractured B 000277 @ DRMW-188 [er prooncCaapWeetaanneFsioCamtorodnateoOnanGdmaesp || o DviaeCsa oerses uaym30m.2a02 CCNrreimmea cemsssieen ProOpnaEn50t5a6ndO00 CErpapreys cCoonses prCeoty vToooar oon om DESCRIPTION WBeel.s O2RaM115060 ; 5 D x " es "8 2s. = Gree gayvay SALE me ed ing Gy et EERE ES STESETIE TTT Rodd bhoowoySnHtsAnLdEp,a1an9s6Tsgetrsigaerzeaeyooasnshnaonwl,.ytfsaacehdg,reens ay - EEE ne aires roariah gay SHALE. wihsomeedshbrown she, ace ok $0510 Hiswcoeyfuomsol,at Ml s&ero sandy STSTONE, risen. re med 59d. CGRangRaat eagocoars 5797odSANDSTONE. meacoos, . EE Grounan gray ine grained sy SANDSTONE. Vace mica. orangn 000278  eCaremeRemiator Gs | Sess DRMW-188 mesa awym m0o2r rmyeas rssds Betrrnaaot iar" | o O-- uacarrpors cong [m ve gie zs |s soromeoms__convo ptarrs Coty mminsses (Toeoo swat. DESCRIPTION wpetromuy188 % F= E ceheoySoAewh tevboino yaeewFareoswnd &' Ce 5 EEE F GR E We grereaynshaeke. PA =Er=i=e cou Fissiati ad ol EERE op I) ol S[EESEE EGoRorRingR ay SHAE LE, ace micaceovaucessa,nSdy. 0e . Sauesaak EE [EEE 000279  Spr onCoo ponaiesRs oCmoeaaia onreG"p || Oevesconspees Sreyk onnactoonnr retees cr -- DRMW-188 wa2o08 wRoncg Gases01) Cmraarormyopns saSrsmsenas pCroovtey vLot oman . tg oEscRPTION wGoevt aont 1m 50 "1 ETETECar mpaaynSAE some al, Va mo [] wf EEE wo ESE EH - TT SR h Rre r wa ae sR r TE Sh ---- vc I wl oa | "S wl | [EEE |Ee ------ rr rcnrESo e ewr m ve meaot | 22222 2=== J Reddish brown SHALE. sick, iacured, race gray shale, wet. EEE 000280 DRMW-18B @ Cernooree nsSmoasuer niGsno"w || bBeactorsans saay mon T Ettey onn | --VSee--yman: _ wsuonm ws(pagoSe 6m0e19a) SfCoeitnlya vCemmson 2 oescrpTON ig| wEoneomuenw158 8 ee er wo wy @ wl py HO wl a 150 EEE Co C Emns nn Ee "Graenish graysi fine 1 medwm SANDSTONE, micaceous, ary { [EE] dGa| rrekeenrisghragyrtaiynmlayeers.d tocuoarmse SANDSTONE, micaceous,dry,with | Ea Ee Ee]sme menes Ea Eye re r aromSLs EiTee=, ---- TE Ee Go me 000281 DRMW-188 @ rW onCope oniiesRe emCeodaniar onnvGoosss" || DBowocoermend m2013E0208 eOrty ctenncon -- Cra--tes wong ioc HSE OEE Soreness Coun (ge 7019) GCSarroogosn| sSrreroisinsa pCroovtey LvTaroman 3 H |EsIu 2 wl fm DESCRIPTION --_-- g| eviszaso 155- oo : ~@ f EErEe EE cou 160: FECEIIIII TTT] GSmisng orysmoysfo raedSTSTONE, meaencs. ie e ove ws no a us TTT Cam mrreeshaTa ysoomhm GoeioannerdySTSSHATLOEN.Esereesaoassaedsatin -- = 000ZE2 DRMW-18B @ Tro GoroerrnRoeCmaeondaniotnaG"o| | OD--ows--ieng IsRoEy Sion nit Sane cory Stnpicouencs conus (age 8019) Co[Crrrarygoe Sr rats Sr Looming L Teas oonawe 3< .2 g 3 5 DESCRIPTION 3| wEeetvsoawi1n6s8 i Es is HOTT [==] Greengriayfsinhe to medwm SANDSTONE, micaceous, dark gray thin i Bentonite: Bien Er HHH `Greenish graysandySILTSTONE. fine grained,dry. 0 a FE E e] Ga reenish gra ay medium grvaimned SANGSSiTONEe,vdery mnigcacveoonss, 135616d Le | | E53 . Eee EEE wl EEeee] Ee r e = a. fi PVC H fii ifi Hi ifi HH seen fl fos | = : = f Eee wl @a w] .downsiemems EEE rh od SHALE Tae = = ====~] Greenish gray and brownishred SHALE. | `micaceous, fractured fi i H i | Sonor en 000283  DuWponteCorprhortaotrnoessRsteesCptooodnmatmonOvnGearp ||DOeavemvcoomrnpesend [--OF rytoai nmsteasraa a00mec|sDi wuinpesess aoy 10030. Cuounron DRMW-18B CNoreymes(pagerese9s01ee9s)r SEoryma vraarnest Losey Tos coon i DESCRIPTION g| Gweevt:osmanren153 i NE =T E=e E= rea bo SHALEwi ae aE ySh ra iyr eerare EEEREEETEEJen mom sein 45. os: mg Greenishgray fine grained sandy SILTSTONE, micaceous, race fed. O& EE moijoCmamnaaemmossyicoemns SAGSTONE vey mises . EEm---- ze Rr 2222227277] e Gire n gyrae B ylSSHn Ig A:LEEi .Tfre s oactruh reewde,OsFis icsv kensBidwaeo esnlo ,.adnAsrr ef2m-s tboehecneeo.mer hsy. SandorBent. 216: es erorss, 2 @ as EH ait Tor 000284 DRMW-198 @ Soe p Cape ge RTeSme an ow || DSenaiemrssavreas pose 101 Esn)r oaiee Snloen Frat RE --Seer--ne--ss cSoanse fCresrtougaiis tlieeimmee a= o- V DESCRIPTION 8| en | wen DRMW-198 ) _ cases E l | a eed SE n [os83o5azzz: Grout es Fri o eo T emaSn AEaa eeh na oa oBo |WVeede10aCoarsee greenmishgruaySsAraNengDemsoSwtiTi,h,OoaratNnogiEsohstton layers. = E=---- E FERe RE: ee ay Coarse greenigray SANDSTONE, with thin darker gray layering, orange 000285 DRMW-198 SuW per CooeptHm eoonFssotmGa eeomaoatroiOnn raGsra"s || -- OSvwmecSorregsend 13m0,2a5.3w08 T Do un Loe ni Du) bna arcwen (page 20(7) CoCmrreooymaen reareiaaensire iSttyy Vieroan n ast DESCRIPTION = e = e = 222222] n Groove raysain SHAnLEi,neac1s ot Fras ir ri od wFaovtssso3u0w2-71050 wf EEE [=== 222222 {Rebrod wn,d dayieys SHAh LE. tracearayshamol st1e0w,et. EE 3s EEeEE me FE ou w SEES Poor recoveryabove isinterval norecovery in Ts mierval, NG ps @ - ES E C E E min `race greegnrayisshalhe, slickensides, moist l] 000256 DRMW-19B, @ (age 3017) OuWPonat CsorWpeholrWlaoitrnekoRsanelmaCegvodnoisanletnitooOnrGdnreorup ||OwDaee CSaomnepdted era Ory Ron Landi Ontoghebos uuyy2250..2200020 &AeComg CNoommpeannWy S GoimoGoos | Oaurranoaor 1arsar Toe Si, Veron Saigobos Contos Lomesty Lunt Ton DESCRIPTION 8E|| weewrvsosrsuowz-iose = EFre rrrrEREe Greraey3n7d1633 ownSALE, shards | Er 5 ranooms gray, ace sandy SHALE. wih vaca rod hae, Skanes. Groen gry, foe gramed andy SLTSTONE, mcaceous. - [= ===GRreededni brgroawynSSHHAALLEE.wiwthssoommeereedsdinsihshshgarrae aand row 73. -22o2sEiEiEaEsEelEy kansasdrytomot IasnnnaL ve [Eooycoy SALE san om S [i| n Goaao yrenmedsion sly SANBSTONE ricscsoun a Sot p E Eea r ] 6s Ee] Fe] | [oo oan som nooo pay SHALE sirrsies yom [FEoE]S aanrveeddadsehd rovuenrs pre aofnrdegraeernsigoraySHTAoLEt.o Rh mSaandciaiSohynd &SAmNaDcSeTOsN.E E Ee e ' Say 75: [==]Reddshbrownand greenishgraySHALE.sickensiGes.mast 15] V00Z87 DRMW-198 DuWPonatCsorphorWaoitrekRnesmCeogdnisalteinotonOGrrdnoeurp ||OOwooSCaamtietses `Wotlnsilaton WerOamaer +vby25.o2002 1 OryRun Lanatl Project #1898363400026 SOungg eares CACoonruos (page 4of7) CNoommpeegr VSI D25u62c1a25n1e2 SeEvnemrrBayCos | V1earanv7ae ery Luin Toon DESCRIPTION * [22222252222222 Ricekganasincberso.wrnadcaeyyeelyloSwHMAoLEriwni,nhvaacckegerda.ymsohatle1.wabeundant x8|| weeervoimoumwz.r108 hs Sisstsass * = 22=25=2 |VSeArpwoiorrsroomveeyo.lowmating, 3ndsome gayshale,veyFaced HEE Puc SHE Grout ps EEsrassiie os ieee em rm ry Cr`ioGdreemeeonnitisihhggrraayy csiaanydeyySSHILATLSET.OsNiEc,kenfsiniedegsra.inferda,ciumriecda,cmeoouts,todrwy,etac_e_| 100. 000ZES DRMW-198 @ DuWPonteGoWpmeotoermsRsteCmoioerdnsaeigonOnrGrras"p || NSwoeeecovsnsapos Orn on oararas aWy2A.0T00 accom Sorpmgeres Coins ENremo sm(pagSSe eSonif7s) SCrryon aamaatree ty enontan 3: DESCRIPTION %8|| awesoomuveeron g g 105: Cre roy SHALE va odi. 0 | ELT T o-- o SALE WARS SS pI E SSSIE EElY RR ea vni SaApLEidt eyrinn.amo ons sawrea oii eae ve Fade 10. FeESEsisaases SHH A Ro a dW a G wel [IEEE eea aro SLE rr a oN, ear SIE kanes Ga oR ww EE Prev madun geays SAGSt TONE wo Tesoens9 | EE ----] ps ns] [El A Seusarceore ean ay SANDSTON-- ETREES 537| Ey - Grout Semenneset 00029 DRMW-198 ogeson) SpaormmCaaepkoeinsreCsmeoaimoreGsow || -- Bwoesaanerss woya0n2 G-- Cryate Sarerne ye] Sarr cor Som an Sonplogevos Comes Lomeaty Ln Toon . oescrprion 8] e8y Tonto ofgn ay SALE Fare. ayomt Fine greenish gray SILTSTONE, micaceous, dry. f= Fine lo medium greenish gray SANDSTONE, micaceous, dry. &| wSeosv oamamree # p--ve -- wy ey 135- EE f Ee][emma ne iH a f i H nn 50 | fi Fo] Greenish gray medium io coarse SANDSTONE. micaceous, some in | H Sin 140F - r] ---- Se | Ho H i f H " E= a Ee 3 cs 150- |ii f i 000230  U I E { R NEE S L TREmeopr T ER T Ea prise (page70l7) g E|| cwoevrioammamrwros * ee r8r mr ms & [3] A EEa , emo m | La [ a Ti EE = a TOhoalt 16e0 " - ED 000291 @ S T beeT | es |qSrttrore m Be e DRMWm -2mm0Bmnbesrathe ew mem SerplegMatos _: Continous LoggedBy Lucinda Toon i: $ 3 3 Te oescrerion S---------- %:||"wwer ormaew-208 & on ces o Eee Ee me EE - EE rrem------ @ CE 000292 DRMW-208 @ DeoaCmoBpeeokiesnRemCinaednaatoreG"as || oDvoonecSoarm--epdes Ormatired isarm som wont Sorgieres Corns oowP)(pagSae 2meif ,6e) TSroye an po DESCRIPTION &g|| wereomowsae EE leyedn SALESn Grea moO | - Shas awss @3 E E bee e d esommroeyay SOTOSNE sr ee = EE e e .- LEees e E, E - Sou wl ps @ = EEE P THTT[FoeenSLTSSTaonnes wmeons3 ay sirewoesFacog svara] Cry.rvisce onbeacnoyfScrUaTnTe.O@Nb.oSome. niesaoe F[or EreE SRSTONE ee 53 Some PeSe erear aSTOSNhoE ASEesEoon apyo g Ee 000293  DuW pontCae peodHtoenRe stemCaeordnioaamtn iOorngGero"s || owDoewnceoamsmnued Oran Orgnet [Pr ravssese e00008c|i sampls agemos DRMW-20B ioyw53.0200 suey _Coniouous Gage ste) NCComoosga TsraarTyer Srey" am toma, Lucida Ton EwlI DESCRIPTION TT _ EE Eee w Ftomw aecse usmosipaennaiheyrneotiySSIACNSDTSOTROENEswomiesdmas rriean E Pe E ene aySST SgGa oR SLE Gore ow 0 ro e R 5 PR &| wEeasr:s D2R0M7W0-10208 @ - FEE RedSTALE we ro he op Shunde ries we andet. Foc elon ai mses i 0. EoggnEigaBinas Pv finan ou of [CIEE Err Wo] EEE EES 000294 DRMW-208 SepeoreekwonmFsaetmCeoodnnaainorvGsep || -- BOevs--eo Toy1e8.n10 rhe Orns ucavy Sompogumes Coron Gage of) TCmargatmmoasesarsrey frCoettttey _Veemranvran .2 wCearv osroar.T2008 DESCRIPTION ' EE FE EE ] CFreoonmerany SiAyEaviesorey SRNhOSeTOsNEi, mtiscewe.t 27 a FE o me oatraint mn cater yanwig vs o wl EEE Err @ TT | Greenishoray SHALE.Fachured,sickenswe,t os ErEissa: - Ear TT RnoyoinmSeAriLoEswTityeakow oyRnOdsRhdoSkperovs vt. ou wf [CIEE ss SEESSELEIL TTT SE RRwniesmating,GreenishgraE ysaleBfoomyG9r5e.09v5. Gorenen a] ii 000295 DRMW-208 DuWpontCaoWepnlHaolrnRsgslCeootmosaanainngGreow"s || tbvoneoCrornspuod a53E.2T3o1T Doyen Lone Ortinet Aung Sorping aed Contes (page sof6) TNCroootnsg eSasvtrsaarryr Siar veer Looedty Lucinda Toon g: 2 g g DESCRIPTION | wGoevr: o26m7w027008 2 105: @ RSsSEEERIEE EEECECITIE = Fin o medium greenish gray sity SANDSTONE,micaceous,ayo 110. [5E E 5 Em ]Wia ed 1ca oarsegreenr ish rey SANDSTONE, abundantymicacoous, re | Grout Pvc | Sectiedel wl pE me EERE = S FBEeee 125- Erna] Eee ffi | rofi H- screen i tz 000296 r) J DRMW-208 DuWPonat CosrepolrWhaotnreikRisaemCteodgonisnaotoriotOnrnGdreorup || OcWeeaksomarpreeessd +a1+ay222.0200707 Dyin tanh Dargionas Aro Simeg nos Contos CNCorrogryops e sDsurscaneirr rer Stover Looms Lveonnone oon i 5FEfom $ & 125 EEEEE EE e Eee e Ee DESCRIPTION &| wor omc 8| aevanron # Screen Ee 3 sana = / wl SEE E E fr--E e--e] : ee fe] [= S{mAotAtwinigh tin layers of groeniah gray SHALE. sickensides, reddish | e= e HE MFe ineegdriab onceudourmrsoesgpeer37egSrLeaTySSmTAON-- iNDESTaONnE. micaceous, hn Ga 2 | Geen oy 3nd own egSTALE Sekaryom and = 2221222171] "eddishmong.moist. 27] Fanbow SHALE, sheaonm 570aeasg RT 140. CREE ws @ 0. T)o3l1 4e3,seinsee a TOF || B 0002po97 DRMW-21A/8 S (age 1018) S T fiPeS se ] || eMm maeeme h vmem EEemTnamn STGa [Projects1890363400026 |SonpiogMetd Comins LoopedBy Lucinda Taton Ifl .2 |e i DESCRIPTION g| w Bon oera 2r1s g 1 Err emrene n || Bl ne i a Sr a 7 /Fea 10- | | H iE I. : Z Hoon i ea er aa wa] | f = [] BE Feil Redanbow aod een rySHALE, Siena [22222 2222 moist wet, Mleyaliowmotting. ace PVC 218) 000238 DRMW-21A/8 @ De onCom oros sRi eCmeodsatas onOGvoip" || DDooeeCromsps Ar5o 0a201 CNroman(agsSea2rs01s8i)y Oreytonaatn Pec HABE OTE pePabesmrelieiiely itbaryoyley eSCoetnyygo rvrasanent DESCRIPTION g| wdeotvorRo2ss1o 4 i ol |Eimmem-- ' | wl Reaboam SLEniSn onevvaoswomigengSob ocr EEE EE rom oe rion SOTTO on 3 Ere PS E ...e -. oo Ee reer any SALE ok Gy GT E2E 22 cRroan sgaeycanavoeoSHALoEwwnihSsTAoLmEea roc osas y ] w|l o EEEEr B 00029 DRMW-21A/8 DupoohntoCarpootHrotnRsetmaeCdioinnatsieoOnGdeorp" ||OeOveiCSgooremespns JTepaoy7r2en0020 OrRun tanh Oricgunes army sonsingeres Conn ToNermrpytwvSimGagrGeroaires)r ESrreiyca vrearasan Coat pr i o DESCRIPTION 8 TTT aEwe yeiow andremating mover ig| T Bev: r05E 500 Wo [EEHEE @ i wo] [FT RRedesnvomessSAEwiwhiGesonyelroowond Saynsh eSgi.armo TT = SAEveyacre ca, abyaennoiL,iL ag Hoek rca a TELE Gat rans rey SHALE. schemes, mst. ie Fig cou nl @ 2s T EETE CAEvom cha nd Seu yea ow ALE vat yellooww eG I 000300 DRMW-21A/B R I DSenn " E r | tnrlssl oenran ey eb Sons FwTDosIaennlGaglSe noefr) i: oescrprion gi| wwerocrnmamn wy @ wl ha fe SEaARR TS E C [Er E EE re CEWR RARE Ea [EEE im fe [E TLILLTITTTy T greenish graymsanydyfinae tSItTSsTaONmEe, micaceous. avy.a Lean os WEEE EE EEE | 000301 DRMW-21A/8 E] uPWonatCosrWpoherWlaotilrenkRsoesaCmloegadnoasnlteiooOnrGdrneorup || WOOwweeeaCSOouurnmepsend AdTapy yt317.e22000022 8) [P OyReusnbaLer asntd00035 o | SOrss arrbggiiipeopsor aeComy Com (page 50f 8) CNoomnog WSR) C2Soria8ne SEnaeCroyrs vromaonms Looms tase oon is DESCRIPTION w Ev: o7e R05.602r 01a | 10 fe == CGire.e orish graayacnrderso.admobtroowwneSrHALE,wi yellowming. 0s. Z p=r= iI s= ms{ dSTeAnLE,wih ipurlahrod ming.BecomesmreGayeywi wo Fifi [ 522522E 272222m 272 mrooe\lownih inshbgrrraoaywynsaomnondtyrien0SgdPAsChiEbyrtwooiwmnosmt,yesykeSvceHeAnLsrEf,etsveith dak rey 3nd 222222222 Grooms graySHALE,sickensids, ace medryslo ,ast po ary pupeinemhotgria,yarFdacruet0e0,anoSyonmSoTAtLsEi,Scuknednas elon 34 Creer graysandy SHALE. cacao 4. Pvc en) Grout 2 D . Grrayoointygraeyrr,ofolcoisnbyoSdAsNfDoSrTeOaNmEs,hioecy SaHALcE.siomodsoasr = =`Groen graymed TscoarseSANDSTONE. cacao vaca Ti [ 060302  To"TE| miseeManDRMW-21ToA/oBvaposoensten RSRe-- n STmeeR, as Sx Somne re ee == DESCRIPTION 5 wmnoman 130- EE &a ww ----] r -- e E BE ae e e mo RATE EV = EE rouN Ee reoer ow ree wo = - 000303  DRMW-21A/B Gears) SW PoiCe oeolwaortrosn RseCanoneadg nadiGeorr"y || OGeveotcmomoasues Da and Ca SmTooyant ry CCToeroayrmas rrSiatnn Sra rn SunpingMapos__ Garris Lees tron Toa aEnr 5 |] DESCRIPTION g| w Heiore res2sr14m $ a er] EEEE Ce r aR ycorns SBSTONE eeneoantTain Soaye i oO ber e ee EB -.e a == gHH fHi fi EpCr er arve oeSABTONEwba ryBere Er meme gm er oe Py Es a i Ee ee omg woo me Ee raytn ayering,dry fomost. E-E -e--e es. " wd Eee] IH iWe fi HfH screen cre HH fil ifii fi BE f 175. [EEEE Groerih gray SHALE. sigh clayey sickensidos, Faciared, mosto- | i 000303  esas DRMW-21A/8 DuWPonat CsorphorWaoitrekRnsoCmogendtaiatnitooOnrGdnreorup || OOvvCSaemdpos OWreylRuInnsaLalnadtion OWtreDganoanesr Snglog Mores; +ASuvgust1z20o02 8) AZsYCom4g) Contvanes, NCoonrrgyWySten SuEvegryCones Logged ty C2o5r7e8n657 V1e3r7on0855 Lucinda Taon BE [sn 5 [em 8 7s res Tore alr DESCRIPTION g| EWeele DrR0MsWc-002148 8 2 i[J 180. 185. 190. 195, 20. __ 000305 000306 B `Bariey Mil Plaza, Buiding27 . Lancaster Pike& Route 141 . Wimington, DE 19805