Document 1Qb9QYmmgmMyz055dJ6rvV22X
56785694 Nucleic Acids Research, 2008, Vol. 36, No. 17 doi:10.1093/nar/gkn550
SURVEY AND SUMMARY
Published online 4 September 2008
c-H2AX in recognition and signaling of DNA double-strand breaks in the context of chromatin
Andrea Kinner, Wenqi Wu, Christian Staudt and George Iliakis*
Institute of Medical Radiation Biology, University of Duisburg-Essen Medical School, Hufelandstrasse 55, 45122 Essen, Germany
Received June 27, 2008; Revised August 11, 2008; Accepted August 12, 2008
ABSTRACT
DNA double-strand breaks (DSBs) are extremely dangerous lesions with severe consequences for cell survival and the maintenance of genomic stability. In higher eukaryotic cells, DSBs in chromatin promptly initiate the phosphorylation of the histone H2A variant, H2AX, at Serine 139 to generate c-H2AX. This phosphorylation event requires the activation of the phosphatidylinositol-3-OH-kinase-like family of protein kinases, DNA-PKcs, ATM, and ATR, and serves as a landing pad for the accumulation and retention of the central components of the signaling cascade initiated by DNA damage. Regions in chromatin with c-H2AX are conveniently detected by immunofluorescence microscopy and serve as beacons of DSBs. This has allowed the development of an assay that has proved particularly useful in the molecular analysis of the processing of DSBs. Here, we first review the role of c-H2AX in DNA damage response in the context of chromatin and discuss subsequently the use of this modification as a surrogate marker for mechanistic studies of DSB induction and processing. We conclude with a critical analysis of the strengths and weaknesses of the approach and present some interesting applications of the resulting methodology.
INTRODUCTION
DNA organization and histones
The accommodation of $2 m of DNA in the $10 mm nucleus of a human cell is made possible through its organization into chromatin. The basic unit of chromatin, the nucleosome, consists of 147 base pairs of DNA wrapped in nearly two (1.7) left-handed superhelical turns around a $100 kDa octamer of histone proteins, each separated from the next one by a linker section of variable
length (2080 bp) (Figure 1A). As a result, the 6.4 109 bp of a human diploid cell are organized into over 30 million nucleosomes. Four small (100135 aa), highly conserved histone proteins, H2A, H2B, H3 and H4, each sharing the histone-fold motif and present in two copies (Figure 1B), form the histone octamer and compact the DNA through the mediated wrapping by approximately 3-fold (1). For nucleosome assembly, DNA is first wrapped around the H3H4 tetramer before the addition of two H2AH2B dimers completes the core (2).
Higher levels of chromatin condensation and nuclear organization (3) are mediated by nonhistone proteins, as well as by interactions between the N-terminal regions of core-histones in adjacent nucleosomes, and lead to the formation of the 30 nm fiber (Figure 1A), which achieves a 100-fold compaction of the DNA (4). The further condensation of the 30 nm fiber as well as higher levels of chromatin condensation, which culminate with the 10 000-fold compaction of the stretched DNA fiber in the $700 nm metaphase chromosomes, are less well understood (5), but are facilitated by the linker histone H1 and condensins (6).
The organization of DNA into chromatin is not only important for resolving problems of spatial accommodation and organization, but it is also essential for the functional utilization of the DNA and the proper coordination of its metabolic activities (7,8). By organizing DNA, histones and nonhistone proteins generate a structural barrier to thousands of DNA-binding factors and DNA enzymes, whose uncontrolled access would compromise any meaningful activity and function of the DNA molecule. Therefore, it comes as no surprise that organization of DNA into chromatin is instrumental for the multitude of gene expression patterns observed in the different cell lineages of multicellular organisms.
The highly dynamic (0.25 s average residence time of histone core octamer on DNA) stability of chromatin (9) is ensured by 142 hydrogen bonds at the interface between DNA and the histone core. In addition, numerous hydrophobic interactions and salt linkages allow the wrapping around the nucleosome core of nearly any DNA
*To whom correspondence should be addressed. Tel: +49 201 7234152; Fax: +49 201 7235966; Email: georg.lliakis@uk-essen.de
2008 The Author(s) This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/ by-nc/2.0/uk/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
Nucleic Acids Research, 2008, Vol. 36, No. 17 5679
A 11 nm
147 bp per nucleosome
B H2A
H2B
H3 N
H4
2080 bp linker-section
N N
N
C C
N-terminal tail
histone fold
C Entry and exit point of DNA from nucleosome core particle
H3
H2A(X) C-term P - S139
H2A C-term
30 nm fibre C C
H3
DNA
Histonefolds
H4 H4
H2B
H2A(X)
H2B
Figure 1. H2AX in the context of chromatin. (A) Organization of DNA in chromatin. One hundred and forty-seven base pairs of DNA (red) are wrapped around a nucleosome (yellow) consisting of eight histone proteins (two H2A/H2B dimers and two H3/H4 dimers), thus forming the 11 nm nucleosome. The histones dimerize via the histone fold motif and four histone dimers form the nucleosome core. Nucleosomes are separated by linker DNA sections of 2080 bp in length. The DNA wraps in 1.7 turns around the nucleosome forming 142 hydrogen bonds at the DNA histone interface. The histone tails protrude from the nucleosome core and can be modified, for instance by acetylation, phosphorylation or ubiquitinylation. Further condensation of chromatin, as in the 30 nm fiber, allows a 100-fold compaction of DNA (schematic representation; the actual organization of the nucleosomes in the 30 nm fiber is still under investigation). (B) All histone proteins share the highly conserved histone fold motif (displayed in color) containing the three alpha helices involved in nucleosome core organization. Alpha helical domains outside the histone fold domain are shown in gray. The structure on the right illustrates how two histone fold domains interact for dimer formation. (C) A model of the nucleosome core particle showing DNA interactions with core histones (redrawn in a modified form from Ref. (148)).The DNA entry and exit points are localized at the H2A/H2B dimer. The H2AX C-terminus, which is 14 amino acids longer than that of H2A, is drawn here (there are no structural data available and the schematic drawing is only for demonstration purposes) in black with a red arrow marking the phosphorylation site within the SQEY motif.
sequence (1). To ensure accessibility and chromatin structure facilitating the different functions of the DNA, interactions with core histones are regulated by numerous covalent modifications, many of which are localized at the amino terminal histone tails protruding from the nucleosome core (Figure 1B and C), as well as by specialized variant core histones (10). These modifications reduce the affinity of histone tails for adjacent nucleosomes, thereby affecting chromatin structure. However, the most
profound effect of histone modifications is their ability to attract specific proteins to a stretch of chromatin that has been appropriately modified (10,11). These recruited proteins define and initiate biological functions in a manner intimately coordinated with local chromatin structure.
DNA DSB repair in the context of chromatin
Modification of chromatin structure has been extensively studied in the context of transcriptional regulation.
5680 Nucleic Acids Research, 2008, Vol. 36, No. 17
error free repair potential
Chromatin destabilizing DSBs
A
processing of DNA ends
Search for homology
DSB ATM; MRN complex, nucleases Mre11, CtIP
RPA BRCA2 Rad51 and paralogs
Rad52
Rad54
Strand inversion Formation of Holiday junction
DNA synthesis Branch migration Final resolution
HRR
B
Recognition
DSB Ku Tdp1; PNKP
C
Recognition
Ligation
DNA-PKcs LigIV, XRCC4, XLF
P P
Ligation
DSB PARP-1 H1
LigIII, XRCC1
error prone
D-NHEJ
D DSB
Search for homology
Rad52 RPA
End processing
ERCC1, XPF
ATM; MRN complex, nucleases
B-NHEJ
SSA
Figure 2. DSB repair pathways. (A) Homologous recombination repair (HRR). After the initial sensing of the DSB by MRN and the activation of ATM, H2AX is phosphorylated, which in turn elicits a sequence of signaling events thought to ultimately cause the activation of nucleases such as Mre11 and CtIP to process the DNA ends and generate ssDNA with 30 overhangs. ssDNA is bound by RPA, which is subsequently exchanged by Rad51 and Rad51 paralogs. This exchange is facilitated by Rad52, Rad54 and BRCA2. The Rad51-decorated DNA fiber initiates strand invasion into an intact homologous DNA molecule that leads to the formation of a Holiday junction. The DNA sequence around the DSB is copied by DNA synthesis associated with branch migration, and the process is completed by resolution of the Holiday junction. HRR is a templated repair process and is therefore error free (1517). (B) DNA-PK-dependent nonhomologous end joining (D-NHEJ). DNA ends are recognized by Ku, which recruits, after processing by Tdp1 or PNKP, DNA-PKcs. Upon end-binding, DNA-PKcs is activated and phosphorylates itself and possibly also other proteins (like H2AX on an adjacent nucleosome). Phosphorylated DNA-PKcs is thought to be released from the DNA end, which allows the DNA
Nucleic Acids Research, 2008, Vol. 36, No. 17 5681
However, there is now ample evidence that modification of chromatin structure also plays a central role in the regulation of DNA repair (12). Broadly speaking, DNA lesions can be classified in two categories on the basis of their effect on chromatin integrity. The first category, which includes base and nucleotide damages as well as single interruptions of the sugar phosphate backbone, does not overly risk chromatin integrity or function, and error-free repair can be accommodated with limited, local modification of the chromatin structure using the complementary DNA strand as a template. The second category, however, which is mainly comprised of DNA doublestrand breaks (DSBs), but may also include some types of DNA-protein crosslinks, can bring chromatin to a state severely undermining its integrity and function. This type of DNA lesion may be partly recognized by the resulting destabilization of chromatin with the resulting signaling and repair coordinated by associated modifications in chromatin structure. In comparison with other types of DNA lesions, DSBs generate the additional complication that error-free restoration is possible only through copying of lost sequence information from a different DNA molecule (or a different part of the same molecule), as the complementary strand is also damaged. In view of the specific requirements for error-free DSB repair, as well as the immediate risks a DSB generates to chromatin stability, it is not surprising that the DSB is among the most severe DNA lesions. Unrepaired or misrepaired DSBs induced by physical agents such as ionizing radiation, chemical agents such as topoisomerase inhibitors, oxidative stress, aberrant DNA replication, aberrant V(D)J or class switch recombination, etc., can cause genomic instability and cancer if the cell escapes death altogether (13,14).
Modification of chromatin structure will be important for all pathways utilized by the cell to repair DSBs. Particularly, homologous recombination repair (HRR), the only error-free pathway, will require extensive chromatin modification to facilitate its essential steps: initial processing of DNA ends, search for homology, invasion into the intact homologous double helix, formation of a Holiday junction, DNA synthesis with the associated branch migration and final resolution of the Holiday junction (Figure 2A) (1517). Also, error-prone pathways utilized in the repair of DSBs have obvious requirements for chromatin modification. Thus, the search of homology required during single strand annealing (SSA) (Figure 2D) (17), as well as the end processing step, will be facilitated by chromatin modifications. Finally, the homologyindependent removal of DSBs by nonhomologous end joining (NHEJ) (18) may require chromatin modification
for efficient recognition and ligation (Figure 2B), although this modification will be more limited than that required for the other repair pathways and may depend upon the actual structure of chromatin in the vicinity of the break.
Despite their fundamental conceptual differences, the unifying characteristic of all pathways of DSB repair is that they restore the structural integrity of the DNA, which ensures the preservation of chromatin organization. This must have been a central consideration in the evolution of this constellation of DSB repair pathways, because two of them, NHEJ and SSA (Figure 2), fail to ensure sequence preservation, which is the fundamental characteristic of other repair pathways. The fact that error-prone repair pathways, particularly NHEJ, are predominantly used for the removal of the majority of DSBs in higher eukaryotes (19), allows the speculation that structural DNA integrity and the associated preservation of chromatin organization has taken priority over preservation of local DNA sequence in multicellular organisms.
Eukaryotic cells react to DNA damage with the socalled DNA damage response (DDR), a sophisticated molecular circuitry developed to detect, signal and repair DNA damage (2022). Integral parts of the DDR are signaling cascades (checkpoints) that regulate key aspects of the cellular metabolism by interacting with the cell cycle engine. Chromatin modification is directly implicated in the development of these signaling cascades (23).
DNA damage recognition and processing in the context of chromatin will require chromatin modification and will elicit events aiming at the coordination of checkpoint signaling with DNA repair or apoptosis. The ultimate goal is the preservation of genomic integrity through the coupling of repair to other essential cellular metabolic activities such as gene expression, DNA replication, cell cycle progression and life or death decisions (2022). It comes as no surprise, therefore, that efforts to describe and understand the mechanistic significance of DNA damage-associated histone modifications have been particularly intensified recently (23).
The histone variant H2AX is at the center of cellular responses to DSBs
Although several DNA damage-associated histone modifications have been described, here we focus on the most conspicuous one that has been at the center of research activities during the last several years: the modification of the H2A variant, H2AX. H2AX is one of the most conserved H2A-variants (Table 1 and Figure 3), and is present in chromatin at levels that vary between 2 and 25% of the H2A pool, depending on the cell line and tissue examined. H2AX moved to the center of cellular responses to DNA
ligase IV/XRCC4/XLF complex to mediate end-ligation possibly with the help of a DNA polymerase that catalyzes gap filling (19,149,150). (C) Back up pathway of nonhomologous end joining (B-NHEJ). There is evidence that cells of higher eukaryotes with defects in D-NHEJ rejoin the majority of DSBs using an alternative repair pathway that is not utilizing any of the HRR-associated activities (19). This pathway is therefore termed backup NHEJ (B-NHEJ). Although details of this pathway remain to be elucidated, there is evidence that it utilizes the PARP-1/DNA Ligase III/XRCC1 repair module known to be involved in the repair of SSB and base damages (151155), and that its function is facilitated by the linker histone H1 (156). (D) Single strand annealing (SSA). This repair pathway shares features of HRR and NHEJ, and is best described in yeast (17). After the initial sensing of the DSBs and processing of the ends by an exonuclease, possibly the MRN complex, the generated ssDNA tails are loaded with RPA. Ends are resected until homologous regions are exposed on the two DNA strands and pairing of these regions is facilitated by Rad52. After appropriate gap filling and removal of the overhangs by the ERCC1/XPF nuclease, a ligation step restores DNA integrity. The repair pathways described in B, C and D are associated with loss (and sometimes gain) of DNA material and are by nature error prone.
5682 Nucleic Acids Research, 2008, Vol. 36, No. 17
Table 1. H2A Variants and Properties (147)
Major variantssingle band on SDS gel (no difference in function detected)
H2A1
10 genes
H2A2
1 gene (H2AO)
Minor variantspeptide sequence differs considerably from bulk H2A
H2AX
1 gene
H2AZ
1 gene
macroH2A1
1 gene
macroH2A2
1 gene
H2A-Bbd
1 gene
Six genes identical in sequence; four vary in up to four positions Peptides are not resolvable in Triton X 100 gel electrophoresis Leucin residue 51 is replaced by methionine Altered electrophoretic mobility
Highly conserved Varies primarily in the C-terminus Highly conserved Varies in many positions throughout the C-terminus Recent in evolution X-Chromosome silencing Recent in evolution X-Chromosome silencing Distantly related to H2A Largely excluded from inactive X-Chromosome
HUMAN MOUSE XENLA DANRE
1 72 (1) MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAAR (1) MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAAR (1) MSGRGKAVSKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYLAAVLEYLTAEILELAGNAAR (1) MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAAR
Consensus (1) MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAAR
HUMAN MOUSE XENLA DANRE
73 143 (73) DNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY (73) DNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSATVGPKAPAVGKKASQASQEY (73) DNKKSRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSGGVSTSG----KKSSQQSQEY (73) DNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTGQAAASSGKS-GKKGSSQSQEY
Consensus(73) DNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSATVGPSAPS GKKASQQSQEY
Figure 3. Conserved H2AX variants. H2AX is highly conserved through evolution. Shown here is an amino acid sequence comparison between human, mouse, Xenopus and Drosophila. Identical amino acids are shown in dark boxes, and light boxes display blocks of similar amino acids. Light grey letters indicate nonsimilar amino acids, grey letters conserved and black letters weakly similar amino acids. The SQEY motif is underlined, and Serine 139, the residue that becomes phosphorylated upon induction of DSBs, is displayed in red. H2AX protein sequences were obtained from Swiss-Prot/TrEMBL and aligned using the VectorNTI software.
damage after the discovery that it becomes locally phosphorylated, to generate g-H2AX, in the vicinity of DSBs (2426). The combination of phosphospecific antibodies that recognize the phosphorylated S-139 residue of g-H2AX with immunofluorescence microscopy documented the local phosphorylation through the formation of distinct foci in the vicinity of DSBs and allowed monitoring of their induction and repair (Figure 5C). Thus, a wide spectrum of applications could be developed ranging from mechanistic studies in biology to useful applications in oncology and radiation protection (see below).
An important recognition from the above studies with far-reaching mechanistic consequences is that DSB sensing and processing are associated with a characteristic local modification and/or specific relocalization of the DDR proteins to distinct subnuclear structures observable by immunofluorescence microscopy that are commonly referred to as `foci'. When such foci are induced by ionizing radiation, they are referred to as IR-induced nuclear foci (IRIF) (27,28), and their analysis has provided important information on the molecular processes underlying the DDR. H2AX phosphorylation and g-H2AX foci formation are now generally accepted as consistent and quantitative markers of DSBs, applicable even under conditions where only a few DSBs are present (29). In the
following sections, we will review the mechanistic significance of H2AX phosphorylation in the cellular responses to DSBs and will analyze correlations between g-H2AX foci formation and the processing of DSBs.
The significance of S-139 phosphorylation of H2AX
As outlined in Figure 3, the phosphorylation of H2AX occurs in the SQ motif that occupies a position of four residues from the carboxy terminus of the protein. SQ is followed by an acidic residue and the carboxy-terminus is hydrophobic. These characteristics are strictly evolutionarily conserved and are utilized for highly specific protein protein interactions during DDR (see below). Notable also is that phosphorylation of S-139 in H2AX is one of the few modifications that occurs at the carboxy terminus of a histone, instead of the more frequently modified amino terminus (Figure 1B and C). It may be relevant that by virtue of the localization and orientation of H2A in the nucleosome, the S-139 phosphorylation will modify the nucleosome at a position right at the entry/exit points of the DNA (Figure 1C).
Phosphorylated H2AX is detected after only a few minutes in cells exposed to IR, and phosphorylation reaches a maximum $30 min later. There is convincing evidence
Nucleic Acids Research, 2008, Vol. 36, No. 17 5683
that the DNA lesion initiating this response is the DSB (both accidental and programmed) (26), and as a result the number of g-H2AX foci scored approximates the number of DSBs induced (29). This tenant finds support in experiments where DSBs are induced by a 365 nm UVA laser in cells that have incorporated BrdU and are treated with Hoechst 33258 (24,30,31), as well as in experiments where DSBs are induced enzymatically (32).
One particularly relevant aspect of H2AX phosphorylation is that it is not limited to the immediate vicinity, but spreads instead to a large chromatin region surrounding the DSB. It has been estimated that in mammals 0.03% of H2AX is phosphorylated per DSB. From this value and the $10% representation among H2A variants of H2AX in chromatin, it can be estimated that the modification spreads to a 2 Mbp region of chromatin and comprises $2000 g-H2AX molecules (25). However, immunofluorescence analyses indicate that regions fifteen times larger (up to 30 Mbp) can be modified, implying that not every contiguous H2AX molecule is phosphorylated (24,33). It is not clear how H2AX phosphorylation is spatially confined, but 4 Pi microscopy suggests that H2AX is not distributed randomly throughout bulk chromatin but exists in distinct clusters that define the boundaries of g-H2AX spreading (34). Through extensive but still spatially restricted modification of H2AX, the presence of a dangerous DNA lesion that destabilizes chromatin is `translated' and `communicated' to the chromatin domain(s) at risk. The nearly 30 Mbp broad modification of chromatin through H2AX phosphorylation represents a major amplification when compared to the few damaged base pairs that constitute the initial DSB. Such a signal `amplifying' chromatin modification is indicative of the gravity attached to DSBs by the cell, and may be considered as part of the preparatory platform the cell generates for mounting the associated signaling and repair processes (30).
The H2AX phosphorylation motif, SQ, is a common recognition site for the phosphatidylinositol-3-OHkinase-like family of protein kinases (PIKKs), and the broad PI-3 kinase inhibitor wortmannin is effective in preventing formation of the corresponding foci (35). In principle, all three major PIKK members, ATM, ATR and DNA-PKcs, have the potential of phosphorylating H2AX, and there is evidence that each of them actually carries out this phosphorylation when others are genetically compromised (3639). This flexibility among the kinases raises the question of actual contribution under physiological conditions. Among these PIKK kinases, ATM seems best suited for H2AX phosphorylation by virtue of its ability to become activated by immediate, local chromatin modifications associated with DNA breakage (40). Since chromatin modification encompasses entire chromatin domains, ATM will be able to phosphorylate several H2AX molecules within this domain. DNAPKcs on the other hand, which become activated through its interaction with Ku, after Ku has directly bound to the DNA ends, is likely to have a reduced phosphorylation range requiring longer times for H2AX phosphorylation at longer distances (38,39). Indeed, ATM seems to be the main kinase associated with H2AX
phosphorylation under normal physiological conditions (30,4143), although it appears to require NBS1 for optimal activity (44). Furthermore, formation of g-H2AX triggered by uncapped telomeres, as well as meiotic recombination-associated DSBs are largely dependent on ATM (4547). Several aspects and details regarding ATM and DNA-PK activation, as well as their interplay in the phosphorylation of H2AX, remain unknown and are a fruitful area of future investigations (48).
In contrast to directly induced random breaks, DSBs associated with replication stress or UV damage are likely to be detected by ATR (4951), which upon activation also phosphorylates H2AX. It should, however, be pointed out that ATR is activated through interaction with ATRIP, which recognizes single-stranded regions in the DNA. Such single-stranded regions can arise at stalled replication forks and also following repair of bulky DNA lesions (52). As such H2AX phosphorylation mediated by ATR does not necessarily reflect the presence of a DSB in the genome. This is important to keep in mind when g-H2AX is scored as an indicator of DSBs, particularly in S-phase cells (see below for more discussion on this issue), and may partly explain the high number of g-H2AX normally seen in S-phase cells in the absence of DNA-damage-inducing treatments.
The importance of PIKKs for H2AX phosphorylation is also supported by work in yeast. Thus, while S. cerevisiae does not have an H2AX variant, both major H2A isoforms, H2A1 and H2A2, have SQ motifs and are phosphorylated after the induction of DSBs in a Mec1and Tel1-dependent (the homologs of ATR and ATM, respectively) manner (53). Since yeast mainly utilizes HRR for the removal of DSBs from the genome, it is intriguing that the SQ motif has been sequestered from the major isoforms to a histone variant, H2AX, after NHEJ became the predominant pathway for DSB repair in higher eukaryotes.
Dephosphorylation of c-H2AX
If phosphorylation of H2AX signals chromatin destabilization through a DSB, it should be reverted to H2A after repair restores chromatin integrity and structure. Such resetting of chromatin could in principle be done either by replacing g-H2AX in the nucleosome with H2AX, or by dephosphorylating g-H2AX directly at the nucleosome. In mammalian cells, phosphatase 2A (PP2A) appears to be involved in the dephosphorylation of g-H2AX (54). It is not clear whether the dephosphorylation takes place in situ, or whether it requires removal of g-H2AX from chromatin. In this regard, the partial colocalization after DNA damage of g-H2AX with PP2A is compatible with an in situ dephosphorylation. In yeast, on the other hand, the g-H2AX homolog is first removed from chromatin and is subsequently dephosphorylated by the histone H2A phosphatase complex (HTP-C), the active subunit of which, Pph3, is 60% identical to PP2A (55), although it is not a direct homolog. As a result of this mode of action, foci loss is observed even in phosphatasedeficient yeast strains. Additional work shows that PP2Cg likewise mediates g-H2AX dephosphorylation
5684 Nucleic Acids Research, 2008, Vol. 36, No. 17
and may act at the same time as a histone chaperone to deposit dephosphorylated H2AH2B or H2AXH2B dimers to incomplete nucleosomes (56). The exchange of H2AX with H2A has recently been shown to be mediated by FACT (for `FAcilitates Chromatin Transcription'), a heterodimer of Spt16 and SSRP1, and to be regulated by phosphorylation of H2AX and ADP-ribosylation of Spt16 (57). Notably, for g-H2AX generated through phosphorylation by ATR during DNA replication, recent results implicate a PP4-phosphatase complex containing PP4C (the homolog of the yeast Pph3), PP4R2 and PP4R3b, in its dephosphorylation, which can occur within nucleosomes (58). More work is needed to better understand aspects of chromatin resetting after completion of DNA repair.
c-H2AX is a specific and efficient coordinator of DDR signaling
Why does the cell initiate a spatially restricted modification of chromatin in the form of H2AX phosphorylation in response to DSBs? Which aspects of the DDR are facilitated through this modification? Is phosphorylation itself mediating local, nonspecific chromatin conformation changes, or is it instrumental in orchestrating the specific molecular interactions required for DNA damage signal generation and transmission? In this section, we address these questions with emphasis on signaling. In the following section, we then cover the possible role of H2AX in DSB repair.
One could reason that even the simple marking of chromatin with g-H2AX at sites where DSBs have been induced could be sufficient for the initiation of the response required for their effective processing. Recent results also point to intriguing, highly specific molecular interactions that place g-H2AX at the early stages of the signaling response.
As noted above, the most profound effect of histone tail modifications is their ability to attract specific proteins (10,11). Precisely, this function may be one of the most relevant contributions of g-H2AX to DDR. Although g-H2AX was shown to attract a number of proteins including NuA4, Ino80 and Swr1 of budding yeast (5961), and the Tip60 chromatin remodeling complex of Drosophila (62), NBS1 (63), 53BP1 (64) and MDC1 (65), the specificity of several of these interactions remains uncertain. Specific recognition of g-H2AX would require the presence of domains recognizing the carboxy terminus of g-H2AX in a phosphor-specific manner in the candidate proteins. Two protein domains that are frequently found in proteins involved in DDR have been found to specifically recognize phosphorylated amino acid residues. The forkhead-associated (FHA) domain recognizes phosphorylated threonine residues in a specific sequence context (66). In addition, it has been observed that two consecutive BRCT domains (BRCA1 C-terminal domain) can create a structural element with phosphorpeptide binding capacity (6770).
Several lines of evidence have recently converged to demonstrate that the BRCT repeats of MDC1 build the predominant recognition module of g-H2AX in
higher eukaryotes, binding with a relatively low Kd of 2.2 106 M (65,7173). Crystallography data nicely reveal how this tandem BRCT domain is precisely tailored to recognize the g-H2AX motif and demonstrate why the proximity of the phosphoserine to the C-terminus of H2AX remains invariable. Overall, these results explain the extremely low tolerance for mutations, as well as the high degree of evolutionary conservation observed in this region of the protein and provide a mechanism for regulating g-H2AX dephosphorylation (72).
With the interaction between MDC1 and g-H2AX, the site of the DSB is prepared for signaling and repair (Figure 4). This is because there is evidence that MDC1 also directly interacts in a highly dynamic manner (71) with NBS1 (74), which in the form of MRN complex is required for the activation of ATM (44,75). This interaction is mediated through phosphorylation of MDC1 by casein kinase 2 (CK2) that promotes phosphorylationdependent interactions with NBS1 through its closely apposed FHA and twin BRCA domains (76). In this way, a positive feed-back loop is generated that extends H2AX phosphorylation to the Mbp regions described above, but how is the initial H2AX phosphorylation event induced? Based on the extremely high affinity of Ku for DNA ends, a likely scenario is phosphorylation through DNA-PK (Figure 4). However, if ATM can also be directly activated by DSBs, it could also function as the initial H2AX kinase--if mechanisms are in place to facilitate accessibility of the kinase to the DSB. In agreement with the model of a positive feedback loop, loss of MDC1 expression, or reduction of its cellular levels by siRNA treatment, reduces H2AX phosphorylation in response to IR probably as a result of a defect in recruiting ATM (65,72,77).
Can extensive phosphorylation of H2AX be mediated by other kinases of the PIKK family, such as DNA-PK? Although DNA-PK efficiently phosphorylates H2AX in the absence of ATM, it has been reported that it fails to do so when ATM is inhibited with the help of a specific inhibitor (42). This suggests a dominant negative effect of inhibited ATM on DNA-PK and is reminiscent to the dominant negative inhibition observed with inhibited DNA-PK in in vitro and possibly also in in vivo repair reactions (78). Notably, in NBS1-deficient cells, DNAPK contributes significantly to H2AX phosphorylation even after inhibiting ATM (44), suggesting that the dominant negative action of ATM requires the MRN complex. These results and the presumed recruitment of ATM by NBS1 to the sites of DNA damage raise the interesting question of possible crosstalk between ATM/NBS1, on the one hand, and DNA-PKcs/Ku, on the other hand (Figure 4). Since free ends are likely to be initially recruited preferentially by Ku, some mechanism must exist to either block the interaction between DNA ends and Ku, or to facilitate their transition from Ku to the MRN complex. It is also notable that ATM and DNAPKcs can be recruited to sites of DSBs by direct binding to MDC1 (77,79) providing thus an additional level of interaction and regulation. The transition of DNA ends from Ku to MRN may also be crucial for the regulation of
Nucleic Acids Research, 2008, Vol. 36, No. 17 5685
ATM ATM
P ATM
P
P
53BP1
DNA-PK
P ATM
P
NBS1 P MRE11 MDC1 Rad50 PP
P
P
NBS1
RNF8
P P MRE11
P
53BP1
MDC1 P
Ubc13P
MDC1 P
Rad50
P
53BP1
BRCA1 BARD1
Nucleosome (with H2AX)
P Phosphate residue
Ubiquitin
Figure 4. g-H2AX is a specific and efficient coordinator of DDR signaling. Following the initial phosphorylation of H2AX by ATM, or DNA-PK, a nucleation reaction is initiated starting with the recruitment of MDC1 and continuing with that of the MRN complex to further activate ATM. This generates a feedback loop that leads to further phosphorylation of H2AX and the chromatin modifications required for the recruitment of 53BP1. The activation cascade culminates with the recruitment of RNF8 to phosphorylated MDC1 and the polyubiquitinylation of H2AX to recruit BRCA1/BARD1 (see text for details).
repair pathway selection in cells of higher eukaryotes and requires further investigation.
The above outline provides an intriguing mechanism as to how an initial modification in a core histone is utilized to recruit DDR proteins to the sites of DSBs and to generate a platform for signaling and repair. In addition to MDC1, 53BP1 also has the ability to detect changes in chromatin upon the induction of DSBs. This protein also forms foci in cells exposed to IR with kinetics similar to those of g-H2AX (80) and appears to detect DNA damage-induced changes in chromatin conformation. Recruitment of 53BP1 to sites of DSBs depends on a region of the protein that contains two consecutive Tudor domains that can bind directly to methylated
histone H3 (64,81,82). Because this methylation is constitutive under physiological conditions, only structural modifications will be required to reveal it for a 53BP1 molecule to anchor on it (Figure 4).
While 53BP1 can be targeted to damaged chromatin by the above mechanism, its efficient accumulation and sustained retention within DSB-containing chromatin requires g-H2AX and MDC1 (64,65,72,77,83). On the basis of these results and the fact that accumulation of MDC1 (and NBS1) at sites of DSBs proceeds faster than that of 53BP1 (71,84), it is possible that g-H2AX-binding by MDC1 triggers changes in chromatin structure that lead to the exposure of the interaction-epitope for 53BP1. Recent genetic data support this view of sequential activation (85).
5686 Nucleic Acids Research, 2008, Vol. 36, No. 17
Importantly, although NBS1 and 53BP1 are recruited to sites of DSBs in the absence of MDC1, they fail to accumulate and prematurely dissociate from damaged chromatin (71,84). Also, laser-aided generation of DSBs in defined subnuclear volumes indicate that the initial distribution of NBS1, BRCA1 and 53BP1 to sites of DSBs does not require H2AX (86). This indicates that initiation and propagation stages may be mechanistically distinct processes. Work in yeast and Drosophila further indicates that the above events of protein accumulation and modification in response to DSBs may be further enhanced or facilitated by g-H2AX-mediated recruitment of chromatin remodeling complexes (5962,87,88).
The above outline mainly focuses on H2AX phosphorylation as a modification of chromatin involved in the coordination of DDR events. However, recent results point to yet another modification that contributes essentially to IRIF formation and the coordination of signaling/repair events: ubiquitinylation (89). While conjugation of ubiquitin chains via K48 generates a degradation signal, K63-linked polyubiquitin chains seem to be involved in DDR signaling (90,91). Recent publications identify the E3 ubiquitin ligase RNF8 as a key enzyme for this modification at the sites of DSBs (9295) and place it in the chain of events initiated with the phosphorylation of H2AX (Figure 4). Thus, the recruitment of MDC1 to g-H2AX and the associated consequential activation of ATM are thought to phosphorylate TQXF motifs in MDC1 that act as recruitment sites of the FHA domain of RNF8. This interaction anchors the E3 ligase to the site of the DSB, which then transfers with the help of the E2 conjugating enzyme Ubc13, ubiquitin residues to H2A and to H2AX (92,94,96). This modification is thought to reinforce, through as of yet uncharacterized mechanisms, the recruitment to chromatin of 53BP1, as well as the association of BRCA1BARD1 complex on IRIF through the proteins Rap80 and Abraxas.
All the above-described events in aggregate place g-H2AX at the center of a signaling cascade initiated by a DSB, and it may, therefore, come as a surprise that it is largely dispensable for checkpoint responses after exposure to relatively high radiation doses (30,53,83,97) (Figure 4). It has been, therefore, suggested that g-H2AX is involved in the amplification step required for optimal checkpoint response at relatively low levels of DNA damage (30,98,99). It is evident that a network of interactions is initiated around g-H2AX, which orchestrates the retention of many DDR proteins at sites of DSBs. While one could speculate that IRIF help to concentrate repair proteins to the sites of DNA damage, it is not clear how this accumulation will support DNA-PK-dependent NHEJ, the main pathway of DSB repair in higher eukaryotes, as the main players of the pathway are not detectable in such IRIF. It is precisely at this point that there is need for further information and additional work. Amplification of the checkpoint signal may be important for a small number of DSBs that require longer repair times and may help reduce checkpoint evasion in the presence of DNA damage (100,101).
Is the contribution of c-H2AX to DSB repair direct?
The physiological role of H2AX phosphorylation in DNA repair is still a matter of intensive investigation. The first report that suggested a role for H2AX in DNA repair was a genetic study in yeast (53). This study showed that elimination of the C-terminal H2A residue led to an impairment in NHEJ. No clear effect was observed in HRR, which actually appeared increased in the absence of H2A. Further studies in this organism showed that H2A Ser-129 (the equivalent residue of S-139 in humans) is necessary for efficient repair of DSBs during DNA replication (97).
The analysis of H2AX-deficient embryonic stem (ES) cells in mice showed that although H2AX is not essential for NHEJ or HRR, it does somehow modulate the efficiency of these repair pathways (86,102105). As a result, mouse cells lacking H2AX are radiosensitive and display deficits in DNA damage repair (106). Additionally, H2AX knock out mice show male-specific infertility and reduced levels of secondary immunoglobulin isotypes suggesting defects in class switch recombination (CSR) (83). Indeed, efficient resolution of DSBs induced during CSR in lymphocytes requires H2AX (102,104), and its absence is associated with chromosome abnormalities involving the immunoglobulin locus (107,108). More recent results in DT40 suggest an involvement (probably indirect) of g-H2AX in HRR and a collaborative function with the Rad51 paralog, XRCC3 (109). Particularly intriguing is also the observation that H2AX is involved in the repair of a subset of DSBs, the repair of which requires, due to some as of yet unidentified reasons, the ATM kinase and the Artemis nuclease (110).
But how is g-H2AX facilitating DSB repair? The results presented in the previous section suggest that this may be mediated by the contribution of g-H2AX to signaling and the associated efficient activation of the checkpoint response. Alternatively, it has been suggested that DSB repair may be assisted directly by facilitating the synapsis of DNA ends (104,111). Chromatin reorganization mediated by g-H2AX could prevent the separation of broken ends and thus facilitate rejoining. Notably, H2AX phosphorylation has been identified over the condensed XY chromosome in male meiotic prophase I (112). This pattern of phosphorylation is independent of meiotic recombination-associated DSBs (112,113), and it is also independent of ATM and DNA-PK (113). The observation that DSBs induce rapid local decreases in the density of chromatin (31), and that nucleosomes in the vicinity of the DSB are repositioned (114), points to the importance of appropriate changes in chromatin structure, which will facilitate the synapsis of broken DNA ends in preparation for rejoining.
Despite the above possible scenarios, the fact that direct effects of H2AX deficiency on DNA repair are subtle suggests that g-H2AX supports repair of selected DSBs and/or that it specifically assists specific repair pathways (110). If the presumed function of concentrating DNA repair factors and tethering DNA ends together is of no consequence for the repair of the majority of DSBs, one can speculate a role in the repair of DSB
Nucleic Acids Research, 2008, Vol. 36, No. 17 5687
clusters similar to those generated during CSR. More work is certainly required to clarify these important aspects of DDR.
Associations between c-H2AX foci and DSBs: facts and caveats
The DSB-dependent formation of g-H2AX not only opened the way to the intriguing mechanistic studies on DDR described above, but it also provided powerful means for indirectly visualizing DSBs in eukaryotic cells. The rational framework for the application of g-H2AX foci formation to the quantification of DSBs was generated by a series of studies showing that lesions other than DSBs have no detectable foci formation potential, and by correlative studies suggesting that the numbers of DSBs estimated by scoring g-H2AX foci is in agreement with extrapolations from other methods (29,110,115) (see below). Further support was also provided by experiments in which DSBs were specifically and rather exclusively induced in cellular DNA via the disintegration of 125I, incorporated into the DNA in the form of IdU (116). Under these conditions, a nearly one-to-one correlation was found between the calculated number of 125I disintegrations per cell, which closely approximates the number of DSBs, and the number of g-H2AX foci scored (26). As a result of these studies, and together with the relative simplicity and sensitivity of the method, scoring of g-H2AX foci became the most popular approach that is presently being used for measuring induction and repair of DSBs in cells exposed to various genotoxic agents under widely different experimental conditions and has allowed mathematical formulations of the repair kinetics (117).
When contrasted with other methods used in the past to measure DSBs, scoring of g-H2AX foci comes with some distinctive advantages, but it is also associated with shortcomings that should be carefully considered in highly quantitative or purely mechanistic studies. Traditionally, the quantification of DSBs in cells is based on the associated size reduction of the DNA molecules, and is achieved by physical methods encompassing neutral sucrose density gradient centrifugation, neutral filter elution, as well as gel electrophoresis approaches including single-cell gel electrophoresis and pulsed-field gel electrophoresis (PFGE). Physical methods of DSB quantification typically have sensitivities that require the use of doses above 5 Gy for a reliable assessment of the rejoining kinetics. Since doses in this range largely compromise the reproductive integrity of the majority of human or rodent cells, it is considered a great advantage that scoring of g-H2AX foci allows the measurement of DSBs at doses well below 5 Gy and, therefore, in a physiologically and therapeutically relevant range (29). In addition, physical methods of DSB detection require DNA free of histones and other DNA associated proteins which is usually achieved by lysis at high temperatures. It has been suggested that lysis at high temperatures transforms to DSBs heat labile lesions, which can confound the assessment of the rejoining kinetics (118). Scoring of g-H2AX foci eliminates this potential source of error, which can also be
reduced by running lysis in the physical methods of detection at low temperatures (118).
Despite these advantages of g-H2AX as a marker of DSBs, the method has limitations mainly because it does not follow the actual fate of the physical DSB, but rather registers cellular metabolic activities initiated to facilitate and optimize DSB repair. This is implicit in the mechanism of g-H2AX production described above and is also clearly reflected in the kinetics of appearance of g-H2AX foci after exposure to IR. Figure 5 shows, in a typical experiment carried out in our laboratory using for plateau-phase A549 cells exposed to 1 Gy of X-rays, that full development of g-H2AX foci requires 30 min and that there are no real signs of reduction before 1 h. PFGE, on the other hand, carried out with the same batch of cells, shows an immediate reduction in the DSB burden,
A 100
80
-H2AX PFGE
Percent of Maximum
60
40
20
0 0 30 60 90 120 150 180
Repair Time [min]
B
C 0 min
15 min
30 min
0 min 15 min 30 min 60 min 120 min 180 min
60 min
120 min
180 min
Figure 5. Comparison of DSB repair kinetics as measured by pulsed-field gel electrophoresis (PFGE) with the development of g-H2AX foci. (A) Plateau-phase A549 cells were exposed to 20 Gy or 1 Gy X-rays and analyzed by PFGE (157) or g-H2AX immunofluorescence (158), respectively, at the indicated time points. PFGE results (squares) have been normalized to the signal measured at 0 h, while the g-H2AX results (circles) have been normalized to the maximum number of foci scored. The number of foci per cell was quantified using the Leica Q-Win software with the help of a special routine developed for foci counting. Foci were counted on 3D picture stacks generated on a Leica SP5 confocal microscope. g-H2AX results were normalized to the maximum number of foci scored per cell--typically reached between 30 min and 1 h after IR. (B) Typical gel used to generate the PFGE results shown in A. DNA is stained with ethidium bromide. (C) Examples of g-H2AX immunofluorescence at different times after exposure to IR (1 Gy). Cells were fixed with 2% paraformaldehyde, permeabilized with 0.2% Triton X-100 and stained with a phosphospecific primary anti-g-H2AX antibody and an Alexa 568-labeled secondary antibody. Red shows g-H2AX foci, blue nuclei stained with DAPI.
5688 Nucleic Acids Research, 2008, Vol. 36, No. 17
proceeding with half times of $20 min despite the higher radiation dose used (20 Gy). As a result of this rapid kinetics, DSBs cannot be detected by PFGE 1 h after irradiation when the levels of g-H2AX foci are still at the maximum.
Since the higher dose used in PFGE is more likely to have slowed down, rather than to have sped up DSB rejoining, the above results indicate obvious disparities in the measurements of DSB repair kinetics with the two methods, particularly at a time resolution of the order of 1 h, and although the delayed kinetics of g-H2AX foci development can be rationally explained by the time required to initiate and to sustain the precisely coordinated biochemical events leading to the development of a mature focus (see previous sections), it is evident that this fact compromises nevertheless the timely resolution of the repair kinetics obtained by scoring g-H2AX foci. Furthermore, Figure 5 also shows that the kinetics of g-H2AX decay, although prompt after 1 h, never approaches the initial speed of the DSB repair measured by PFGE (t50 $100 versus 20 min--or 5-fold slower). Thus, in addition to the $1 h uncertainty regarding the actual fate of the physical DSBs, there is also uncertainty with the kinetics of their removal.
The above limitations, which with variations have been observed in several cell systems (33,119) and have been reported to show a DSB-dose dependence (120), have no grave or immediate consequences for several applications that do not require fine resolution in the repair kinetics, or when emphasis is placed on the level of residual DSBs. However, as the DDR mechanism becomes better defined and an increasing amount of detail is added to its constituent steps, increased resolution in the kinetics will become important. In such cases, the above-discussed limitations should be carefully considered in the interpretation of the results obtained, and the means to overcome them should be developed.
The disparity between the actual removal of DSBs, as measured by physical methods of DSB detection, and the removal of g-H2AX foci may increase when chemical or genetic manipulations that affect the phosphorylation cascade of H2AX are employed as tools, and may further depend on the severity of the DSB (121). Thus, use of PIKK or phosphatase inhibitors, or genetic manipulation of their activity, may alter foci formation and decay in a way that further uncouples it from the physical removal of the DSBs. This is experimentally illustrated in Figure 6, where we exposed A549 cells to 50 nM Calyculin A, a nonspecific inhibitor of PP2A, a phosphatase involved in the dephosphorylation of g-H2AX (54). Although under the experimental conditions employed treatment with Calyculin A leads to a complete stop in g-H2AX foci decay (122), it only has a small effect on the physical removal of DSBs as measured by PFGE. Experiments with elutriated HeLa, G1 cells show similar trends, suggesting that the effect is not cell line specific, although others have arrived to different conclusions (123). It would be inaccurate to conclude on the basis of g-H2AX foci data shown in Figure 6 that DSB rejoining is completely inhibited by Calyculin A. Notably, delayed and
Percent of Maximum
A 100
80
60
-H2AX PFGE
40
20
0 0 30 60 90 120 150 180 210
Repair Time [min]
0 min 15 min 30 min 60 min 120 min 180min
BD
60 min
180 min
0 nM Calyculin A CE
0 min 15 min 30 min 60 min 120 min 180min
60 min
180 min
50 nM CalyculinA
Figure 6. Effect of the phosphatase inhibitor Calyculin A on DSB repair kinetics and g-H2AX foci development and decay. (A) Plateauphase A549 cells were incubated with 0 or 50 nM Calyculin A 15 min prior to exposure to 20 or 1 Gy X-rays for PFGE or g-H2AX immunofluorescence, respectively, and allowed to repair at 378C for the indicated periods of time (other details of experimental design as in Figure 5). Results are shown normalized as described in Figure 5. (B, C) Typical PFGE gels used to generate the results shown in A for cells treated with 0 or 50 nM Calyculin A. DNA is stained with ethidium bromide. (D, E) g-H2AX immunofluorescence at different times after irradiation and incubation with 0 or 50 nM Calyculin A. Other details as in Figure 5.
stage-specific phosphorylation of H2AX was also observed in irradiated mouse embryos (124).
Discrepancies between g-H2AX foci decay and DSB removal have also been reported in some cell systems in the absence of treatment. Thus, in one study, 30% of the initial g-H2AX signal was present 8 h after IR, although no DSBs could be detected at that time (125). Therefore, when interpretating g-H2AX results, the
Nucleic Acids Research, 2008, Vol. 36, No. 17 5689
possibility should be considered that physical DSBs are removed from areas of chromatin that remain marked with g-H2AX. It can be hypothesized that g-H2AX continues marking the sites of some DSBs after resealing by NHEJ to facilitate additional processing by HRR (126,127).
Interesting results pointing to a divergence between physical repair of a DSB and development and decay of H2A foci have been recently reported in yeast. In this organism, the kinetics of g-H2A loss (equivalent to g-H2AX in higher eukaryotes) correlated with the appearance of early gene conversion intermediates rather than with the ultimate repair of the DSB (55). This indicates that the signal triggering g-H2A loss might not be the completion of DSB repair but rather the completion of certain repair steps before the final sealing of the DSB. In this case, loss of foci will not immediately signify removal of the discontinuity in the DNA. As a result, HRR-defective strains of yeast have normal g-H2A response despite their DSB repair defect. These observations, although opposite from those made in higher eukaryotes, further emphasize that high resolution analysis of DSB repair may be compromised when based exclusively on g-H2AX analysis.
An additional confounding factor in the analysis of induction and repair of DSBs via g-H2AX foci quantification comes from the observation that H2AX phosphorylation is diminished in areas of heterochromatin (128,129). We have also noted similar trends that are particularly striking in LIG4/-deficient MEFs exposed to high doses of IR. Figure 7 shows a representative example of a cell exposed to 16 Gy and analyzed 3 h later. Because of the DSB repair defect in these cells, g-H2AX foci formation is still at a maximum at this time. It is evident that very few g-H2AX foci are detected in the darkly stained areas of heterochromatin--despite the fact that the increased amount of DNA in these areas will lead to increased presence of DSBs after IR. Differential
AB C
15m
DAPI
-H2AX
DAPI/-H2AX
LIG4-/- MEF 16 Gy, 3 h repair
Figure 7. g-H2AX foci are preferentially formed in regions of euchromatin. Elutriated G2 cells of DSB repair-deficient LIG4/ MEFs were exposed to 16 Gy X-rays and analyzed for g-H2AX immunofluorescence 3 h later. The picture on the left shows a DAPI-stained nucleus. Bright areas correspond to nuclear regions with increased DNA presence, thought to reflect densely packaged heterochromatin. The picture at the center shows g-H2AX immunofluorescence obtained as described in Figure 5. The picture on the right shows an overlay of the two images with DNA displayed in blue and g-H2AX foci in red. Note the nearly complete absence of g-H2AX foci from heterochromatic areas, as well as from areas in the nucleus with reduced amounts of DNA.
formation, or detection, of g-H2AX in regions of chromatin with different organization will bias DSB analysis based on g-H2AX foci formation. Weak H2AX phosphorylation in heterochromatin is also found in yeast, and in mouse fibroblasts, an increase of g-H2AX foci size is observed after chromatin becomes more accessible (130). Notably, recent results indicate eviction of heterochromatin protein 1b (HP1 b) bound to lysine-9-methylated histone H3 after DNA damage through phosphorylation on Thr51 possibly by CK2 (131). This modification promotes H2AX phosphorylation and suggests a mechanism for gH2AX generation in areas of heterochromatin. Notably, a recent report postulates that ATM signaling temporarily perturbs heterochromatin via KAP-1 to facilitate DSB repair in these rather inaccessible regions of chromatin (132). However, H2AX phosphorylation is significantly slower in mitotic as compared to G1 CHO cells (119), in agreement with reduced g-H2AX formation under conditions of condensed chromatin.
Whether or not unrejoined DSBs always underlie visible g-H2AX foci, it is clear that foci presence signifies a detectable, DSB-related modification of chromatin. If areas of heterochromatin have diminished levels of g-H2AX, one can speculate that g-H2AX is not required for DSB repair in condensed chromatin; in fact, g-H2AX may facilitate DSB repair in euchromatin by conferring heterochromatin-like organization (discussed above), which may also explain the observed inhibition of transcription at the foci sites (133). Such a mechanism of g-H2AX action will favor NHEJ but will act inhibitory on HRR. Further insight is required to address this important aspect of g-H2AX function.
The afore-outlined potential confounding factors will need to be carefully considered when g-H2AX is used to analyze DSB repair within short time intervals--for example, in experiments designed to investigate responses in specific phases of the cell cycle. Under these circumstances, it will be important to employ alternative methods to support any conclusions drawn on the basis of g-H2AX foci formation. An interesting twist to the role of g-H2AX foci is the recent observation that the immobilization of signaling molecules such as NBS1, MRE11, MDC1 or ATM on chromatin can generate DDR as measured by the generation of g-H2AX in the absence of DNA damage (134). Similar results were also obtained in yeast when Mec1Ddc2 and the PCNA-like 9-1-1 complex were immobilized (135). These observations point to hierarchical structures in DDR, which are likely to have important mechanistic ramifications.
APPLICATIONS OF c-H2AX DETECTION
Analysis of g-H2AX foci has found numerous applications. One of them is analysis and prediction of cell radiosensitivity to killing. A correlation was reported between the half-times of loss of g-H2AX as measured by flow cytometry and clonogenic survival in cell lines of differing radiosensitivity to killing (136,137). It was also shown for 18 human tumor cell lines that a number of <3 g-H2AX foci 24 h after irradiation was predictive for clonogenic
5690 Nucleic Acids Research, 2008, Vol. 36, No. 17
survival (138). Similar results were obtained for cells from xenograft tumors of irradiated mice (139). On the other hand, g-H2AX was unable to predict the efficacy of antioxidant radioprotective compounds (140). Thus, g-H2AX has the potential of developing to a useful predictor of cellular radiosensitivity to killing and may find application in the clinic during treatment of human tumors with ionizing radiation, in the evaluation of interindividual variations in radiosensitivity (141,142), in the analysis of the endogenous DSB load (143) and even in the prediction of dose in nuclear accidents or terrorist attacks involving radioactive materials. In line with this expectation, g-H2AX fluorescence intensity is taken as a sensitive test for the diagnosis of AT syndrome (144,145), and g-H2AX foci formation has been used as a measure for whole body dose after radiotherapy (146).
ACKNOWLEDGEMENTS
Special thanks go to Dr Dennis Leeper and Nancy Mott for comments on the manuscript.
FUNDING
Deutsche Forschungsgemeinschaft (DFG), Bundes Ministerium fuer Bildung und Forschung (BMBF), European Union (EU). Funding for open access charge: DFG.
REFERENCES
1. Luger,K., Ma der,A.W., Richmond,R.K., Sargent,D.F., Richmond,S. and Richmond,T.J. (1997) Crystal structure of the nucleosome core particle at 2.8 A resolution. Nature, 389, 251260.
2. Loyola,A. and Almouzni,G. (2004) Histone chaperones, a supporting role in the limelight. Biochim. Biophys. Acta, 1677, 311.
3. Cremer,T. and Cremer,C. (2001) Chromosome territories, nuclear architecture and gene regulation in mammalian cells. Nat. Rev. Genet., 2, 292301.
4. Misteli,T. (2007) Beyond the sequence: cellular organization of genome function. Cell, 128, 787800.
5. Tremethick,D.J. (2007) Higher-order structures of chromatin: the elusive 30 nm fiber. Cell, 128, 651668.
6. Misteli,T., Gunjan,A., Hocks,R., Bustin,M. and Brown,D.T. (2000) Dynamic binding of histone H1 to chromatin in living cells. Nature, 408, 877881.
7. Groth,A., Rocha,W., Verreault,A. and Almouzni,G. (2007) Chromatin challenges during DNA replication and repair. Cell, 128, 721733.
8. Li,B., Carey,M. and Workman,J.L. (2007) The role of chromatin during transcription. Cell, 128, 707719.
9. Li,G. and Widom,J. (2004) Nucleosomes facilitate their own invasion. Nat. Struct. Mol. Biol., 11, 763769.
10. Kouzarides,T. (2007) Chromatin modifications and their function. Cell, 128, 693705.
11. Taverna,S.D., Li,H., Ruthenburg,A.J., Allis,C.D. and Patel,D.J. (2007) How chromatin-binding modules interpret histone modifications: lessons from professional pocket pickers. Nat. Struct. Mol. Biol., 14, 10251040.
12. Groth,A., Corpet,A., Cook,A.J.L., Roche,D., Bartek,J., Lukas,J. and Almouzni,G. (2007) Regulation of replication fork progression through histone supply and demand. Science, 318, 19281931.
13. Khanna,K.K. and Jackson,S.P. (2001) DNA double-strand breaks: signaling, repair and the cancer connection. Nat. Genet., 27, 247254.
14. Rooney,S., Chaudhuri,J. and Alt,F.W. (2004) The role of nonhomologous end-joining pathway in lymphocyte development. Immunol. Rev., 200, 115131.
15. Symington,L.S. (2002) Role of Rad52 epistasis group genes in homologous recombination and double-strand break repair. Microbiol. Mol. Biol. Rev., 66, 630670.
16. West,S.C. (2003) Molecular views of recombination proteins and their control. Nat. Rev. Mol. Cell Biol., 4, 111.
17. Paques,F. and Haber,J.E. (1999) Multiple pathways of recombination induced by double-strand breaks in Saccharomyces cerevisiae. Microbiol. Mol. Biol. Rev., 63, 349404.
18. Burma,S., Chen,B.P.C. and Chen,D.J. (2006) Role of nonhomologous end joining (NHEJ) in maintaining genomic integrity. DNA Repair (Amst.), 5, 10421048.
19. Iliakis,G., Wang,H., Perrault,A.R., Boecker,W., Rosidi,B., Windhofer,F., Wu,W., Guan,J., Terzoudi,G. and Pantelias,G. (2004) Mechanisms of DNA double strand break repair and chromosome aberration formation. Cytogenet. Genome Res., 104, 1420.
20. Iliakis,G., Wang,Y., Guan,J. and Wang,H. (2003) DNA damage checkpoint control in cells exposed to ionizing radiation. Oncogene, 22, 58345847.
21. Rouse,J. and Jackson,S.P. (2002) Interfaces between the detection, signaling, and repair of DNA damage. Science, 297, 547551.
22. Zhou,B.B. and Elledge,S.J. (2000) The DNA damage response: putting checkpoints in perspective. Nature, 408, 433439.
23. Downs,J.A., Nussenzweig,M.C. and Nussenzweig,A. (2007) Chromatin dynamics and the preservation of genetic information. Nature, 447, 951958.
24. Rogakou,E.P., Boon,C., Redon,C. and Bonner,W.M. (1999) Megabase chromatin domains involved in DNA double-strand breaks in vivo. J. Cell Biol., 146, 905915.
25. Rogakou,E.P., Pilch,D.R., Orr,A.H., Ivanova,V.S. and Bonner,W.M. (1998) DNA double-stranded breaks induce histone H2AX phosphorylation on serine 139. J. Biol. Chem., 273, 58585868.
26. Sedelnikova,O.A., Rogakou,E.P., Panyutin,I.G. and Bonner,W.M. (2002) Quantitative detection of 125IdU-induced DNA doublestrand breaks with g-H2AX antibody. Radiat. Res., 158, 486492.
27. Fernandez-Capetillo,O., Celeste,A. and Nussenzweig,A. (2003) Focusing on foci: H2AX and the recruitment of DNA-damage response factors. Cell Cycle, 2, 426427.
28. Fernandez-Capetillo,O., Lee,A., Nussenzweig,M. and Nussenzweig,A. (2004) H2AX: the histone guardian of the genome. DNA Repair (Amst.), 3, 959967.
29. Rothkamm,K. and Lo brich,M. (2003) Evidence of a lack of DNA double-strand break repair in human cells exposed to very low X-ray doses. Proc. Natl Acad. Sci. USA, 100, 50575062.
30. Fernandez-Capetillo,O., Chen,H.-T., Celeste,A., Ward,I., Romanienko,P.J., Morales,J.C., Naka,K., Xia,Z., CameriniOtero,R.D., Motoyama,N. et al. (2002) DNA damage-induced G2-M checkpoint activation by histone H2Ax and 53BP1. Nat. Cell Biol., 4, 993997.
31. Kruhlak,M.J., Celeste,A., Dellaire,G., Fernandez-Capetillo,O., Muller,W.G., McNally,J.G., Bazett-Jones,D.P. and Nussenzweig,A. (2006) Changes in chromatin structure and mobility in living cells at sites of DNA double-strand breaks. J. Cell Biol., 172, 823834.
32. Soutoglou,E., Dorn,J.F., Sengupta,K., Jasin,M., Nussenzweig,A., Ried,T., Danuser,G. and Misteli,T. (2007) Positional stability of single double-strand breaks in mammalian cells. Nat. Cell Biol., 9, 675682.
33. Pilch,D.R., Sedelnikova,O., Redon,C., Celeste,A., Nussenzweig,A. and Bonner,W.M. (2003) Characteristics of g-H2AX foci at DNA double-strand breaks sites. Biochem. Cell Biol., 81, 123129.
34. Bewersdorf,J., Bennett,B.T. and Knight,K.L. (2006) H2AX chromatin structures and their response to DNA damage revealed by 4Pi microscopy. Proc. Natl Acad. Sci. USA, 103, 1813718142.
35. Paull,T.T., Rogakou,E.P., Yamazaki,V., Kirchgessner,C.U., Gellert,M. and Bonner,W.M. (2000) A critical role for histone H2AX in recruitment of repair factors to nuclear foci after DNA damage. Curr. Biol., 10, 886895.
36. Burma,S., Chen,B.P., Murphy,M., Kurimasa,A. and Chen,D.J. (2001) ATM phosphorylates histone H2AX in response to DNA double-strand breaks. J. Biol. Chem., 276, 4246242467.
Nucleic Acids Research, 2008, Vol. 36, No. 17 5691
37. Andegeko,Y., Moyal,L., Mittelman,L., Tsarfaty,I., Shiloh,Y. and Rotman,G. (2001) Nuclear retention of ATM at sites of DNA double strand breaks. J. Biol. Chem., 276, 3822438230.
38. Wang,H., Wang,M., Wang,H., Bo cker,W. and Iliakis,G. (2005) Complex H2AX phosphorylation patterns by multiple kinases including ATM and DNA-PK in human cells exposed to ionizing radiation and treated with kinase inhibitors. J. Cell. Physiol., 202, 492502.
39. Stiff,T., O'Driscoll,M., Rief,N., Iwabuchi,K., Lo brich,M. and Jeggo,P.A. (2004) ATM and DNA-PK function redundantly to phosphorylate H2AX after exposure to ionizing radiation. Cancer Res., 64, 23902396.
40. Bakkenist,C.J. and Kastan,M.B. (2003) DNA damage activates ATM through intermolecular autophosphorylation and dimer dissociation. Nature, 421, 499506.
41. Veuger,S.J., Curtin,N.J., Smith,G.C.M. and Durkacz,B.W. (2004) Effects of novel inhibitors of poly(ADP-ribose) polymerase-1 and the DNA-dependent protein kinase on enzyme activities and DNA repair. Oncogene, 23, 73227329.
42. Hickson,I., Zhao,Y., Richardson,C.J., Green,S.J., Martin,N.M.B., Orr,A.I., Reaper,P.M., Jackson,S.P., Curtin,N.J. and Smith,G.C.M. (2004) Identification and characterization of a novel and specific inhibitor of the ataxia-telangiectasia mutated kinase ATM. Cancer Res., 64, 91529159.
43. Friesner,J.D., Liu,B., Culligan,K. and Britt,A.B. (2005) Ionizing radiation-dependent g-H2AX focus formation requires ataxia telangiectasia mutated and ataxia telangiectasia mutated and Rad3related. Mol. Biol. Cell, 16, 25662576.
44. Falck,J., Coates,J. and Jackson,S.P. (2005) Conserved modes of recruitment of ATM, ATR and DNA-PKcs to sites of DNA damage. Nature, 434, 605611.
45. d'Adda di Fagagna,F., Reaper,P.M., Clay-Farrace,L., Fiegler,H., Carr,P., von Zglinicki,T., Saretzki,G., Carter,N.P. and Jackson,S.P. (2003) A DNA damage checkpoint response in telomere-initiated senescence. Nature, 426, 194198.
46. Fernandez-Capetillo,O., Liebe,B., Scherthan,H. and Nussenzweig,A. (2003) H2AX regulates meiotic telomere clustering. J. Cell Biol., 163, 1520.
47. Takai,H., Smogorzewska,A. and de Lange,T. (2003) DNA damage foci at dysfunctional telomeres. Curr. Biol., 13, 15491556.
48. Stucki,M. and Jackson,S.P. (2006) gH2AX and MDC1: anchoring the DNA-damage-response machinery to broken chromosomes. DNA Repair (Amst.), 5, 534543.
49. Ward,I.M. and Chen,J. (2001) Histone H2AX is phosphorylated in an ATR-dependent manner in response to replicational stress. J. Biol. Chem., 276, 4775947762.
50. Limoli,C.L., Giedzinski,E., Bonner,W.M. and Cleaver,J.E. (2002) UV-induced replication arrest in the xeroderma pigmentosum variant leads to DNA double-strand breaks, g-H2AX formation, and Mre11 relocalization. Proc. Natl Acad. Sci. USA, 99, 233238.
51. Hanasoge,S. and Ljungman,M. (2007) H2AX phosphorylation after UV irradiation is triggered by DNA repair intermediates and is mediated by the ATR kinase. Carcinogenesis, 28, 22982304.
52. Paulsen,R.D. and Cimprich,K.A. (2007) The ATR pathway: finetuning the fork. DNA Repair (Amst.), 6, 953966.
53. Downs,J.A., Lowndes,N.F. and Jackson,S.P. (2000) A role for Saccharomyces cerevisiae histone H2A in DNA repair. Nature, 408, 10011004.
54. Chowdhury,D., Keogh,M.-C., Ishii,H., Peterson,C.L., Buratowski,S. and Lieberman,J. (2005) g-H2AX dephosphorylation by protein phosphatase 2A facilitates DNA double-strand break repair. Mol. Cell, 20, 801809.
55. Keogh,M.-C., Kim,J.-A., Downey,M., Fillingham,J., Chowdhury,D., Harrison,J.C., Onishi,M., Datta,N., Galicia,S., Emili,A. et al. (2006) A phosphatase complex that dephosphorylates gH2AX regulates DNA damage checkpoint recovery. Nature, 439, 497501.
56. Kimura,H., Takizawa,N., Allemand,E., Hori,T., Iborra,F.J., Nozaki,N., Muraki,M., Hagiwara,M., Krainer,A.R., Fukagawa,T. et al. (2006) A novel histone exchange factor, protein phosphatase 2C{gamma}, mediates the exchange and dephosphorylation of H2A-H2B. J. Cell Biol., 175, 389400.
57. Heo,K., Kim,H., Choi,S.H., Choi,J., Kim,K., Gu,J., Lieber,M.R., Yang,A.S. and An,W. (2008) FACT-mediated exchange of histone
variant H2AX regulated by phosphorylation of H2AX and ADPribosylation of Spt16. Mol. Cell, 30, 8697. 58. Chowdhury,D., Xu,X., Zhong,X., Ahmed,F., Zhong,J., Liao,J., Dykxhoorn,D.M., Weinstock,D.M., Pfeifer,G.P. and Lieberman,J. (2008) A PP4-phosphatase complex dephosphorylates g-H2AX generated during DNA replication. Mol. Cell, 31, 3346. 59. van Attikum,H., Fritsch,O., Hohn,B. and Gasser,S.M. (2004) Recruitment of the INO80 complex by H2A phosphorylation links ATP-dependent chromatin remodeling with DNA double-strand break repair. Cell, 119, 777788. 60. Morrison,A.J., Highland,J., Krogan,N.J., Arbel-Eden,A., Greenblatt,J.F., Haber,J.E. and Shen,X. (2004) INO80 and g-H2AX Interaction Links ATP-Dependent Chromatin Remodeling to DNA Damage Repair. Cell, 119, 767775. 61. Downs,J.A., Allard,S., Jobin-Robitaille,O., Javaheri,A., Auger,A., Bouchard,N., Kron,S.J., Jackson,S.P. and Cote,J. (2004) Binding of chromatin-modifying activities to phosphorylated histone H2A at DNA damage sites. Mol. Cell, 16, 979990. 62. Kusch,T., Florens,L., MacDonald,W.H., Swanson,S.K., Glaser,R.L., Ill,J.R.Y., Abmayr,S.M., Wasburn,M.P. and Workman,J.L. (2004) Acetylation by Tip60 is required for selective histone variant exchange at DNA lesions. Science, 306, 20842087. 63. Kobayashi,J., Tauchi,H., Sakamoto,S., Nakamura,A., Morishima,K., Matsuura,S., Kobayashi,T., Tamai,K., Tanimoto,K. and Komatsu,K. (2002) NBS1 localizes to g-H2AX foci through interaction with the FHA/BRCT domain. Curr. Biol., 12, 18461851. 64. Ward,I.M., Minn,K., Jorda,K.G. and Chen,J. (2003) Accumulation of checkpoint protein 53BP1 at DNA breaks involves its binding to phosphorylated histone H2AX. J. Biol. Chem., 278, 1957919582. 65. Stewart,G.S., Wang,B., Rignell,C.R., Taylor,A.M.R. and Elledge,S.J. (2003) MDC1 is a mediator of the mammalian DNA damage checkpoint. Nature, 421, 961966. 66. Durocher,D., Henckel,J., Fersht,A.R. and Jackson,S.P. (1999) The FHA domain is a modular phosphopeptide recognition motif. Mol. Cell, 4, 387394. 67. Manke,I.A., Lowery,D.M., Nguyen,A. and Yaffe,M.B. (2003) BRCT repeats as phosphopeptide-binding modules involved in protein targeting. Science, 302, 636639. 68. Yu,X., Chini,C.C.S., He,M., Mer,G. and Chen,J. (2003) The BRCT domain is a phospho-protein binding domain. Science, 302, 639646. 69. Clapperton,J.A., Manke,I.A., Lowery,D.M., Ho,T., Haire,L.F., Yaffe,M.B. and Smerdon,S.J. (2004) Structure and mechanism of BRCA1 BRCT domain recognition of phosphorylated BACH1 with implications for cancer. Nat. Struct. Mol. Biol., 11, 512518. 70. Williams,R.S., Lee,M.S., Hau,D.D. and Glover,J.N.M. (2004) Structural basis of phosphopeptide recognition by the BRCT domain of BRCA1. Nat. Struct. Mol. Biol., 11, 519525. 71. Lukas,C., Melander,F., Stucki,M., Falck,J., Bekker-Jensen,S., Goldberg,M., Lerenthal,Y., Jackson,S.P., Bartek,J. and Lukas,J. (2004) Mdc1 couples DNA double-strand break recognition by Nbs1 with its H2AX-dependent chromatin retention. EMBO J., 23, 26742683. 72. Stucki,M., Clapperton,J.A., Mohammad,D., Yaffe,M.B., Smerdon,S.J. and Jackson,S.P. (2005) MDC1 directly binds phosphorylated histone H2AX to regulate cellular responses to DNA double-strand breaks. Cell, 123, 12131226. 73. Rodriguez,M., Yu,X., Chen,J. and Songyang,Z. (2003) Phosphopeptide binding specificities of BRCA1 COOH-terminal (BRCT) domains. J. Biol. Chem., 278, 5291452918. 74. Goldberg,M., Stucki,M., Falck,J., D'Amours,D., Rahman,D., Pappin,D., Bartek,J. and Jackson,S.P. (2003) MDC1 is required for the intra-S-phase DNA damage checkpoint. Nature, 421, 952956. 75. You,Z., Chahwan,C., Bailis,J., Hunter,T. and Russell,P. (2005) ATM activation and its recruitment to damaged DNA require binding to the C terminus of Nbs1. Mol. Cell. Biol., 25, 53635379. 76. Chapman,J.R. and Jackson,S.P. (2008) Phospho-dependent interactions between NBS1 and MDC1 mediate chromatin retention of the MRN complex at sites of DNA damage. EMBO Rep., 9, 795801. 77. Lou,Z., Minter-Dykhouse,K., Franco,S., Gostissa,M., Rivera,M.A., Celeste,A., Manis,J.P., van Deursen,J., Nussenzweig,A. and Paull,T.T. (2006) MDC1 maintains genomic stability by
5692 Nucleic Acids Research, 2008, Vol. 36, No. 17
participating in the amplification of ATM-dependent DNA damage signals. Mol. Cell, 21, 187200. 78. Calsou,P., Frit,P., Humbert,O., Muller,C., Chen,D.J. and Salles,B. (1999) The DNA-dependent protein kinase catalytic activity regulates DNA end processing by means of Ku entry into DNA. J. Biol. Chem., 274, 78487856. 79. Lou,Z., Ping-Chi Chen,B., Asaithamby,A., Minter-Dykhouse,K., Chen,D.J. and Chen,J. (2004) MDC1 regulates DNA-PK autophosphorylation in response to DNA damage. J. Biol. Chem., 279, 4635946362. 80. Schultz,L.B., Chehab,N.H., Malikzay,A. and Halazonetis,T.D. (2000) p53 binding protein 1 (53BP1) is an early participant in the cellular response to DNA double-strand breaks. J. Cell Biol., 151, 13811390. 81. Iwabuchi,K., Basu,B.P., Kysela,B., Kurihara,T., Shibata,M., Guan,D., Cao,Y., Hamada,T., Imamura,K., Jeggo,P.A. et al. (2003) Potential role for 53BP1 in DNA end-joining repair through direct interaction with DNA. J. Biol. Chem., 278, 3648736495. 82. Huyen,Y., Zgheib,O., DiTullio,R.A.Jr, Gorgoulis,V.G., Zacharatos,P., Petty,T.J., Sheston,E.A., Mellert,H.S., Stavridi,E.S. and Halazonetis,T.D. (2004) Methylated lysine 79 of histone H3 targets 53BP1 to DNA double-strand breaks. Nature, 432, 406411. 83. Celeste,A., Petersen,S., Romanienko,P.J., Fernandez-Capetillo,O., Chen,H.T., Sedelnikova,O.A., Reina-San-Martin,B., Coppola,V., Meffre,E., Difilippantonio,M.J. et al. (2002) Genomic instability in mice lacking histone H2AX. Science, 296, 922927. 84. Bekker-Jensen,S., Lukas,C., Melander,F., Bartek,J. and Lukas,J. (2005) Dynamic assembly and sustained retention of 53BP1 at the sites of DNA damage are controlled by Mdc1/NFBD1. J. Cell Biol., 170, 201211. 85. Minter-Dykhouse,K., Ward,I., Huen,M.S.Y., Chen,J. and Lou,Z. (2008) Distinct versus overlapping functions of MDC1 and 53BP1 in DNA damage response and tumorigenesis. J. Cell Biol., 181, 727735. 86. Celeste,A., Fernandez-Capetillo,O., Kruhlak,M.J., Pilch,D.R., Staudt,D.W., Lee,A., Bonner,R.F., Bonner,W.M. and Nussenzweig,A. (2003) Histone H2AX phosphorylation is dispensable for the initial recognition of DNA breaks. Nat. Cell Biol., 5, 675679. 87. Jha,S., Shibata,E. and Dutta,A. (2008) Human Rvb1/Tip49 is required for the histone acetyltransferase activity of Tip60/NuA4 and for the downregulation of phosphorylation on H2AX after DNA damage. Mol. Cell. Biol., 28, 26902700. 88. Park,J.-H., Park,E.-J., Lee,H.-S., Kim,S.J., Hur,S.-K., Imbalzano,A.N. and Kwon,J. (2006) Mammalian SWI/SNF complexes facilitate DNA double-strand break repair by promoting g-H2AX induction. EMBO J., 25, 39863997. 89. Bennett,E.J. and Harper,J.W. (2008) DNA damage: ubiquitin marks the spot. Nat. Struct. Mol. Biol., 15, 2022. 90. Sobhian,B., Shao,G., Lilli,D.R., Culhane,A.C., Moreau,L.A., Xia,B., Livingston,D.M. and Greenberg,R.A. (2007) RAP80 targets BRCA1 to specific ubiquitin structures at DNA damage sites. Science, 316, 11981202. 91. Pickart,C.M. and Fushman,D. (2004) Polyubiquitin chains: polymeric protein signals. Curr. Opin. Chem. Biol., 8, 610616. 92. Huen,M.S.Y., Grant,R., Manke,I., Minn,K., Yu,X., Yaffe,M.B. and Chen,J. (2007) RNF8 transduces the DNA-damage signal via histone ubiquitylation and checkpoint protein assembly. Cell, 131, 901914. 93. Kolas,N.K., Chapman,J.R., Nakada,S., Ylanko,J., Chalwan,R., Sweeney,F.D., Panier,S., Mendez,M., Wildenhain,J., Thomson,T.M. et al. (2007) Orchestration of the DNA-damage response by the RNF8 ubiquitin ligase. Science, 318, 16371640. 94. Mailand,N., Bekker-Jensen,S., Faustrup,H., Melander,F., Bartek,J., Lukas,C. and Lukas,J. (2007) RNF8 ubiquitylates histones at DNA double-strand breaks and promotes assembly of repair proteins. Cell, 131, 887900. 95. Wang,B. and Elledge,S.J. (2007) Ubc13/Rnf8 ubiquitin ligases
control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage. Proc. Natl Acad. Sci. USA, 104, 2075920763. 96. Ikura,T., Tashiro,S., Kakino,A., Shima,H., Jacob,N., Amunugama,R., Yoder,K., Izumi,S., Kuraoka,I., Tanaka,K. et al. (2007) DNA damage-dependent acetylation and ubiquitination of
H2AX enhances chromatin dynamics. Mol. Cell. Biol., 27, 70287040. 97. Redon,C., Pilch,D.R., Rogakou,E.P., Orr,A.H., Lowndes,N.F. and Bonner,W.M. (2003) Yeast histone 2A serine 129 is essential for the efficient repair of checkpoint-blind DNA damage. EMBO Rep., 4, 678684. 98. DiTullio,R.A.Jr, Mochan,T.A., Venere,M., Bartkova,J., Sehested,M., Bartek,J. and Halazonetis,T.D. (2002) 53BP1 functions in an ATM-dependent checkpoint pathway that is constitutively activated in human cancer. Nat. Cell Biol., 4, 9981002. 99. Wang,B., Matsuoka,S., Carpenter,P.B. and Elledge,S.J. (2002) 53BP1, a mediator of the DNA damage checkpoint. Science, 298, 14351438. 100. Lo brich,M. and Jeggo,P.A. (2007) The impact of a negligent G2/M checkpoint on genomic instability and cancer induction. Nat. Rev. Cancer, 7, 861869. 101. Deckbar,D., Birraux,J., Krempler,A., Tchouandong,L., Beucher,A., Walker,S., Stiff,T., Jeggo,P. and Lo brich,M. (2007) Chromosome breakage after G2 checkpoint release. J. Cell Biol., 176, 749755. 102. Petersen,S., Casellas,R., Reina-San-Martin,B., Chen,H.T., Difilippantonio,M.J., Wilson,P.C., Hanitsch,L., Celeste,A., Muramatsu,M., Pilch,D.R. et al. (2001) AID is required to initiate Nbs1/g-H2AX focus formation and mutations at sites of class switching. Nature, 414, 660665. 103. Bassing,C.H., Chua,K.F., Sekiguchi,J., Suh,H., Whitlow,S.R., Fleming,J.C., Ferguson,D.O., Scully,R. and Alt,F.W. (2002) Increased ionizing radiation sensitivity and genomic instability in the absence of histone H2AX. Proc. Natl Acad. Sci. USA, 99, 81738178. 104. Reina-San-Martin,B., Difilippantonio,S., Hanitsch,L., Masilamani,R., Nussenzweig,A. and Nussenzweig,M.C. (2003) H2AX is required for recombination between immunoglobulin switch regions but not for intra-switch region recombination or somatic hypermutation. J. Exp. Med., 197, 17671778. 105. Xie,A., Puget,N., Shim,I., Odate,S., Jarzyna,I., Bassing,C.H., Alt,F.W. and Scully,R. (2004) Control of sister chromatid recombination by histone H2AX. Mol. Cell, 16, 10171025. 106. Kao,J., Milano,M.T., Javaheri,A., Garofalo,M.C., Chmura,S.J., Weichselbaum,R.R. and Kron,S.J. (2006) g-H2AX as a therapeutic target for improving the efficacy of radiation therapy. Curr. Cancer Drug Targets, 6, 197205. 107. Franco,S., Gostissa,M., Zha,S., Lombard,D.B., Murphy,M.M., Zarrin,A.A., Yan,C., Tepsuporn,S., Morales,J.C. and Adams,M.M. (2006) H2AX prevents DNA breaks from progressing to chromosome breaks and translocations. Mol. Cell, 21, 201214. 108. Ramiro,A.R., Jankovic,M., Callen,E., Difilippantonio,S., Chen,H.-T., McBride,K.M., Eisenreich,T.R., Chen,J., Dickins,R.A., Lowe,S.W. et al. (2006) Role of genomic instability and p53 in AID-induced c-myc-Igh translocations. Nature, 440, 105109. 109. Sonoda,E., Zhao,G.Y., Kohzaki,M., Dhar,P.K., Kikuchi,K., Redon,C., Pilch,D.R., Bonner,W.M., Nakano,A., Watanabe,M. et al. (2007) Collaborative roles of g-H2AX and the Rad51 paralog Xrcc3 in homologous recombinational repair. DNA Repair (Amst.), 6, 280292. 110. Riballo,E., Ku hne,M., Rief,N., Doherty,A., Smith,G.C.M., Recio,M.-J., Reis,C., Dahm,K., Fricke,A., Krempler,A. et al. (2004) A pathway of double-strand break rejoining dependent upon ATM, artemis, and proteins locating to g-H2AX foci. Mol. Cell, 16, 715724. 111. Ferguson,D.O. and Alt,F.W. (2001) DNA double strand break repair and chromosomal translocation: lessons from animal models. Oncogene, 20, 55725579. 112. Mahadevaiah,S.K., Turner,J.M.A., Baudat,F., Rogakou,E., de Boer,P., Blanco-Rodriguez,J., Jasin,M., Keeney,S., Bonner,W.M. and Burgoyne,P.S. (2001) Recombinational DNA double-strand breaks in mice precede synapsis. Nat. Genet., 27, 271276. 113. Fernandez-Capetillo,O., Mahadevaiah,S.K., Celeste,A., Romanienko,P.J., Camerini-Otero,R.D., Bonner,W.M., Manova,K., Burgoyne,P. and Nussenzweig,A. (2003) H2AX is
Nucleic Acids Research, 2008, Vol. 36, No. 17 5693
required for chromatin remodeling and inactivation of sex chromosomes in male mouse meiosis. Dev. Cell, 4, 497508. 114. Shim,E.Y., Hong,S.J., Oum,J.-H., Yanez,Y., Zhang,Y. and Lee,S.E. (2007) RSC mobilizes nucleosomes to improve accessibility of repair machinery to the damaged chromatin. Mol. Cell. Biol., 27, 16021613. 115. Leatherbarrow,E.L., Harper,J.V., Cucinotta,F.A. and O'Neill,P. (2006) Induction and quantification of g-H2AX foci following low and high LET-irradiation. Int. J. Radiat. Biol., 82, 111118. 116. Krisch,R.E., Krasin,F. and Sauri,C.J. (1977) DNA breakage, repair, and lethality accompanying 125I decay in microorganisms. Curr. Top. Radiat. Res. Q., 12, 355368. 117. Cucinotta,F.A., Pluth,J.M., Anderson,J.A., Harper,J.V. and O'Neill,P. (2008) Biochemical kinetics model of DSB repair and induction of g-H2AX foci by non-homologous end joining. Radiat. Res., 169, 214222. 118. Stenerlo w,B., Karlsson,K.H., Cooper,B. and Rydberg,B. (2003) Measurement of prompt DNA double-strand breaks in mammalian cells without including heat-labile sites: results for cells deficient in nonhomologous end joining. Radiat. Res., 159, 502510. 119. Kato,T.A., Okayasu,R. and Bedford,J.S. (2008) Comparison of the induction and disappearance of DNA double strand breaks and g-H2AX foci after irradiation of chromosomes in G1-phase or in condensed metaphase cells. Mutat. Res., 639, 108112. 120. Bouquet,F., Muller,C. and Salles,B. (2006) The loss of gH2AX signal is a marker of DNA double strand breaks repair only at low levels of DNA damage. Cell Cycle, 5, 11161122. 121. Han,J., Hendzel,M.J. and Allalunis-Turner,J. (2006) Quantitative analysis reveals asynchronous and more than DSB-associated histone H2AX phosphorylation after exposure to ionizing radiation. Radiat. Res., 165, 283292. 122. Antonelli,F., Belli,M., Cuttone,G., Dini,V., Esposito,G., Simone,G., Sorrentino,E. and Tabocchini,M.A. (2005) Induction and repair of DNA double-strand breaks in human cells: dephosphorylation of histone H2AX and its inhibition by calyculin A. Radiat. Res., 164, 514517. 123. Nazarov,I.B., Smirnova,A.N., Krutilina,R.I., Svetlova,M.P., Solovjeva,L.V., Nikiforov,A.A., Oei,S.-L., Zalenskaya,I.A., Yau,P.M., Bradbury,E.M. et al. (2003) Dephosphorylation of histone g-H2AX during repair of DNA double-strand breaks in mammalian cells and its inhibition by calyculin A. Radiat. Res., 160, 309317. 124. Adiga,S.K., Toyoshima,M., Shimura,T., Takeda,J., Uematsu,N. and Niwa,O. (2007) Delayed and stage specific phosphorylation of H2AX during preimplantation development of g-irradiated mouse embryos. Reproduction, 133, 415422. 125. Banath,J.P., MacPhail,S.H. and Olive,P.L. (2004) Radiation sensitivity, H2AX phosphorylation, and kinetics of repair of DNA strand breaks in irradiated cervical cancer cell lines. Cancer Res., 64, 71447149. 126. Asaad,N.A., Zeng,Z.-C., Guan,J., Thacker,J. and Iliakis,G. (2000) Homologous recombination as a potential target for caffeine radiosensitization in mammalian cells: reduced caffeine radiosensitization in XRCC2 and XRCC3 mutants. Oncogene, 19, 57885800. 127. Wang,H., Zeng,Z.-C., Bui,T.-A., Sonoda,E., Takata,M., Takeda,S. and Iliakis,G. (2001) Efficient rejoining of radiationinduced DNA double-strand breaks in vertebrate cells deficient in genes of the RAD52 epistasis group. Oncogene, 20, 22122224. 128. Karagiannis,T.C., KN,H. and El-Osta,A. (2007) Disparity of histone deacetylase inhibition on repair of radiation-induced DNA damage on euchromatin and constitutive heterochromatin compartments. Oncogene, 26, 39633971. 129. Cowell,I.G., Sunter,N.J., Singh,P.B., Austin,C.A., Durkacz,B.W. and Tilby,M.J. (2007) gH2AX foci form preferentially in euchromatin after ionising-radiation. PLoS ONE, 2, e1057. 130. Kim,J.-A., Kruhlak,M., Dotiwala,F., Nussenzweig,A. and Haber,J.E. (2007) Heterochromatin is refractory to g-H2AX modification in yeast and mammals. J. Cell Biol., 178, 209218.
131. Ayoub,N., Jeyasekharan,A.D., Bernal,J.A. and Venkitaraman,A.R. (2008) HP1- mobilization promotes chromatin changes that initiate the DNA damage response. Nature, 453, 682686.
132. Goodarzi,A.A., Noon,A.T., Deckbar,D., Ziv,Y., Shiloh,Y., Lo brich,M. and Jeggo,P.A. (2008) ATM signaling facilitates repair of DNA double-strand breaks associated with heterochromatin. Mol. Cell, 31, 167177.
133. Solovjeva,L., Svetlova,M., Chagin,V. and Tomilin,N. (2007) Inhibition of transcription at radiation-induced nuclear foci of phosphorylated histone H2AX in mammalian cells. Chromosome Res., 15, 787797.
134. Soutoglou,E. and Misteli,T. (2008) Activation of the cellular DNA damage response in the absence of DNA lesions. Science, 320, 15071510.
135. Bonilla,C.Y., Melo,J.A. and Toczyski,D.P. (2008) Colocalization of sensors is sufficient to activate the DNA damage checkpoint in the absence of damage. Mol. Cell, 30, 267276.
136. Olive,P.L. and Banath,J.P. (2004) Phosphorylation of histone H2AX as a measure of radiosensitivity. Int. J. Radiat. Oncol. Biol. Phys., 58, 331335.
137. Taneja,N., Davis,M.A., Choy,J.S., Beckett,M.A., Singh,R., Kron,S.J. and Weichselbaum,R.R. (2004) Histone H2AX phosphorylation as a predictor of radiosensitivity and target for radiotherapy. J. Biol. Chem., 279, 22732280.
138. MacPhail,S.H., Banath,J.P., Yu,T.Y., Chu,E.H.M., Lambur,H. and Olive,P.L. (2003) Expression of phosphorylated histone H2AX in cultured cell lines following exposure to X-rays. Int. J. Radiat. Biol., 79, 351358.
139. Klokov,D., MacPhail,S.M., Banath,J.P., Byrne,J.P. and Olive,P.L. (2006) Phosphorylated histone H2AX in relation to cell survival in tumor cells and xenografts exposed to single and fractionated doses of X-rays. Radiother. Oncol., 80, 223229.
140. Kataoka,Y., Murley,J.S., Baker,K.L. and Grdina,D.J. (2007) Relationship between phosphorylated histone H2AX formation and cell survival in human microvascular endothelial cells (HMEC) as a function of ionizing radiation exposure in the presence or absence of thiol-containing drugs. Radiat. Res., 168, 106114.
141. Ismail,I.H. and Hendzel,M.J. (2008) The g-H2AX: is it just a surrogate marker of double-strand breaks or much more? Environ. Mol. Mutagen., 49, 7382.
142. Hamasaki,K., Imai,K., Nakachi,K., Takahashi,N., Kodama,Y. and Kusunoki,Y. (2007) Short-term culture and gH2AX flow cytometry determine differences in individual radiosensitivity in human peripheral T lymphocytes. Environ. Mol. Mutagen., 48, 3847.
143. Vilenchik,M.M. and Knudson,A.G. (2003) Endogenous DNA double-strand breaks: production, fidelity of repair, and induction of cancer. Proc. Natl Acad. Sci. USA, 100, 1287112876.
144. Porcedda,P., Turinetto,V., Brusco,A., Cavalieri,S., Lantelme,E., Orlando,L., Ricardi,U., Amoroso,A., Gregori,D. and Giachino,C. (2008) A rapid flow cytometry test based on histone H2AX phosphorylation for the sensitive and specific diagnosis of ataxia telangiectasia. Cytrometry A, 73, 508516.
145. Kato,T.A., Nagasawa,H., Weil,M.M., Little,J.B. and Bedford,J.S. (2006) Levels of g-H2AX foci after low-dose-rate irradiation reveal a DNA DSB rejoining defect in cells from human ATM heterozygotes in two AT families and in another apparently normal individual. Radiat. Res., 166, 443453.
146. Sak,A., Grehl,S., Erichsen,P., Engelhard,M., Grannass,A., Levegru n,S., Po ttgen,C., Groneberg,M. and Stuschke,M. (2007) g-H2AX foci formation in peripheral blood lymphocytes of tumor patients after local radiotherapy to different sites of the body: dependence on the dose-distribution, irradiated site and time from start of treatment. Int. J. Radiat. Biol., 83, 639652.
147. Redon,C., Pilch,D., Rogakou,E., Sedelnikova,O., Newrock,K. and Bonner,W. (2002) Histone H2A variants H2AX and H2AZ. Curr. Opin. Genet. Dev., 12, 162169.
148. Wolffe,A.P. and Hayes,J.J. (1999) Chromatin disruption and modification. Nucleic Acids Res., 27, 711720.
149. Valerie,K. and Povirk,L.F. (2003) Regulation and mechanisms of mammalian double-strand break repair. Oncogene, 22, 57925812.
5694 Nucleic Acids Research, 2008, Vol. 36, No. 17
150. Lieber,M.R., Ma,Y., Pannicke,U. and Schwarz,K. (2003) Mechanism and regulation of human non-homologous DNA end-joining. Nat. Rev. Mol. Cell Biol., 4, 712720.
151. Audebert,M., Salles,B. and Calsou,P. (2004) Involvement of poly(ADP-ribose) polymerase-1 and XRCC1/DNA ligase III in an alternative route for DNA double-strand breaks rejoining. J. Biol. Chem., 279, 5511755126.
152. Wang,M., Wu,W., Wu,W., Rosidi,B., Zhang,L., Wang,H. and Iliakis,G. (2006) PARP-1 and Ku compete for repair of DNA double strand breaks by distinct NHEJ pathways. Nucleic Acids Res., 34, 61706182.
153. Perrault,R., Wang,H., Wang,M., Rosidi,B. and Iliakis,G. (2004) Backup pathways of NHEJ are suppressed by DNA-PK. J. Cell. Biochem., 92, 781794.
154. Wang,H., Rosidi,B., Perrault,R., Wang,M., Zhang,L., Windhofer,F. and Iliakis,G. (2005) DNA ligase III
as a candidate component of backup pathways of nonhomologous end joining. Cancer Res., 65, 40204030. 155. Windhofer,F., Wu,W., Wang,M., Singh,S.K., Saha,J., Rosidi,B. and Iliakis,G. (2007) Marked dependence on growth state of backup pathways of NHEJ. Int. J. Radiat. Oncol. Biol. Phys., 68, 14621470. 156. Rosidi,B., Wang,M., Wu,W., Sharma,A., Wang,H. and Iliakis,G. (2008) Histone H1 functions as a stimulatory factor in backup pathways of NHEJ. Nucleic Acids Res., 36, 16101623. 157. DiBiase,S.J., Zeng,Z.-C., Chen,R., Hyslop,T., Curran,W.J.Jr and Iliakis,G. (2000) DNA-dependent protein kinase stimulates an independently active, nonhomologous, end-joining apparatus. Cancer Res., 60, 12451253. 158. Bo cker,W. and Iliakis,G. (2006) Computational methods for analysis of foci: validation for radiation-induced g-H2AX foci in human cells. Radiat. Res., 165, 113124.