Document pmbQJgO3oJm8nwdoRy7VgoYYw

-- APILOT REPRrOosD:SUTUCDYTWiITHOTHNE NORTHERN BOBWHITS FINALREPORT WILDLIFE INTERNATIONAL, LTD, PROTECT NUMBER: 454104 SMLABREQUEST NO, 223 FIERA Guideline 714 AUTHORS: SRoaauyopnndGLBt.iegVovacsovn STUDY INTTATION DATE: Petry 26,2000 STUDYCOMPLETION DATE: Dinter 18,2005 Saitedto ov53uBCumopALivaabemsy StPaul, Minnesota 55106 Wildlife International, Ltd. E5v9i8inCoMomahmyearancdenD2i1v60e1 Page arias * " C2016 _-- Ya Wildy life Ivnitoerrnnaattiioonndall,, Latkd., ProjctmNumebers454-104 2. GOOD LABORATORYPRACTICE COMPLIANCESTATEMENT SPONSOR: 3MCorporation TITLE: PFOS: APilotReproductionStudywiththe NortherBobwhite `WILDLIFE INTERNATIONAL, LTD. PROJECT NUMBER: 454-104 STUDY COMPLETION: December 18, 2003 Thestadywasconducted icompliancewithGoodLaboratoryPracticeStandardsaspublished by theU.S. EnviPrr oteco tionn Agem ncye ,40n CFt RPaa rt1l 60, 17 August 1989; OECDPrinciplesof Good Laboratory Practice (ENV/MC/CHEM (98) 17); and Japan MAFF, 59 NobiSan Notification No. 3850, Agricultural Production Bureau, 10 August 1984,withthefollowingexceptions: Thestudywasconductedunder lilprotocols.Thenif portionwascondcidunderane uS`ntprudodteyonctouwlmo(bWseielrpdai0ri2af3te-eI0np4tr1eowmtaaotsoilosni(alE,ixLytdgdew.insRttehusdyesanerupcamhrsbaedr Sy45y4n-u1mD0b4ee)rc,saon2rd3t-h0e4a1naalyti0c2a5l.p0o6r9ti)onEswxeorencoRnodsuacrtcehd. porteRdessepuataseloyf.aalyssconductedbyExygenResearch forstudymumbers023041and 023.06 are STUDYDIRECTOR: A, b ole SSeeaonrP.BGalilaoghelArvioangToxiiceolo,gy SPONSOR'S REPRESENTATIVE: TFL Newsnd . Er DAT B3ATaEvloy chon? _----mmm wi Le WLilAdlNifEe IntAeRrnRae tOioNnal, Ltd. nPs roTjectNRumbeI r454-N104 5. QUALITY ASSURANCESTATEMENT bGyotohde LUTaSbh.oirsaEtodrynyPwraavcsticcieoa(PmErriNontVdcoIifMooCrnu/cAoCgmeHpmnlEciMycea,(9480)nwCi1tF7hi)RGpionraodtds1Llp6ba0os,r1M7sAeAFyuYgP,uas5it9c1Ne9o8Sk%t,SaeOnnEd,aCrNDdosPa8ciapssloiinsnhNeod: 38t5e0s,aAygrfiicnudlitnugrsalwPerroeducptioorn eBu0reahu,S1t0udyAuDgiuvsetct1o9r84n.dTLheadartresyoMfaalnlaaguedimtesnatnwd iensrpaectiionosnasndthe AcTvry FTropnaSnutbience SerpePrpin Dibrgpuatin PArotiReDpes, DATECONDUCTED Retry20,2000 March 1,2000 Mah?,200 mfre16,17, 280 STUDDYDAITREECRETPOORRTMEADNTAo:GEMENT Fray Mark 1,2000 Mele Mahle Ma 7, 3000 Ma?2000 Py25,2000 may31,208 DBitsohgiealnDus, Jniam 16,1720, Sy31,200 Ferry 19,208 FSwoiisRse1p0td DNeocvcemabner2164,,2003 Deccnber2s0,03 Desmbe 18,2003 Ainpecsonswerestybasedness kbsne. SmaSuComleamann, BXLA. Coleman Senior Quality Assocs Represctive BATE 12-18-03 r2048 --_-- WWiillddlliiffeeIInntteerrnnaattiioonnaall,, LLttdd.. ePoroijeecsttNmumbbeerrs4s54e-i10n4 REPORTAPPROVAL SPONSOR: 3 Caporsion TLE BROS: A ilkRerotionSyvitbeNornBbc WILDLIFEINTERNATIONAL,LT, PROTECTNUMBER: 454.104 MLABREQUESTNO: 2733 STUDY DIRECTOR: SE eABlm ob g vi5T)soer E ds CHEMISTRY PRINCIPAL INVESTIGATOR: 4 SACLE aytbing | Van Hoven, PRD. DATE MANAGEMENT: Bra e wn oicioey f TA7mN1nt47oe 8 -- wnwoh nana --_--_-- LWilFdlife Imnitearrnnaatnioonnaall,, Ltd. 5 TAOFBCOLNTENETS PProejecttNumeber 454-104 AdultBody WeightdFood Compton. AdultNenrd iosoCpolyin. SHS ABIES... oe | AGU B0dyWeg... ------ | Offspring Body Weights... mms s C2020 _--_-- WYiolddlliyfee IInntteerrnnaattiioonnaall,,LLttdd.. 0 rProojeecteNNummbaers4s54e-i10s4 - TAOPFBACGEO?NLTENETS TABLES TableI. rom NorborhBOsPILREOAoci00 Sec Mean Measured Concentrations(ppma.i)ofPFOSinAvianDiet 21 Table2. MeanAdultBody Weigh()fom Norse Bobi Fx Table 3. BMoebabniFeedPilCootnRseupmprtoidon(biSrtyt)MfbroFmFONSo.rthen or 29 Table 4. BoSb6wuiWmiotyrekosPfilGortTRoeesptrPoaTdtuhctloioogncaoSlhOabdsyewrivtahtiPoFnOsSf,oAmde NoBrtsherBnutbanized Table 5. MNeoarntheirngBPoobwdhoictieoPnlo(tEgegpsrLoedidcHieonnanSdtudEygwgtuhenP/FODSy.)eomarrr 31 Table 6. SurmommaarNyorotfReerpsrBoduoctitvePPeoftorRmeapnrocdeuEcgigosnSSotfyowmihWePcFkOS vcr 52. Table 7. frMeosmaaBoNodrythWeerBgohbwh9)iotfeHPailtotiRnepgroadnudctSiuornvSiviyngwOfiflieing PFOS.......... 33 Table 5. MetaLiverWeights 2 orm a NebrBaie Pil Reproduction 2021 -- Wildlife Internationnaaln,TLeed, 7. `TOAPFACGBOENTLENETS APPENDICES PPiroejteNctaNmubmeberrd4s5t4-i1n0s4 Appendix I. Diet 0dSupplementFOMmUISHONS crn38 APPEDR IL DietPIOPRIUON...sssennn d Appendix IV. ThoAnalysis Of PFOSin AVShDit .cvrndl ApEn V.. | DIOFTB E AA YO 5 Appendix VL ARdiEtPBordyOWSeGiOgUYhWCti)ltfkroOmnaNoFrOS.t. hernBobwhitere Pilot 56. Appendix. VIL FBeobewdhCiteoPilontRse(ubpirrdmidoapSy)dturtduoymwcaiitNthooirtnoe n PFOS...cccvvrres nr 60 Appendix VII. NInodritvhiedrunaBloGbruowslsiPteaPiltothRoeOlbpseorrvgaotSiitoduncduyfarwocimltath ion PEOSA..............64 APpendix IX. Appendix X. Appendix XI. Appendix. XIL Appendix. XII Appendix XIV. Appendix. XV. Appendix XVL. HiStODURORIEOPOBY 68 EN gg Production(ogg nidheoE /A week)fromawhPEGS 109 RNeoprrtohdeurcnBtiovbewPheiftoerPmialnotcReebpryoPdeunctfiroonm SatudyWith PFOS rr 113 MPielaontROfEfprPinIgBOoSdGyLWYUeiWgCihthHP8)ROfOrSNo.m..a NorthernBobwhite 19 RAduEltLPivIerOWSeGiOgUhYtWH(gi)tifhrOomDa NoPRrOS.t.hernBobwhite Pilot 120 OPfiflsoptrRingeLipverrWoediSguuhdtc(yg)WtiftrihomoanNorthPOSe. .rnvBobwshitee: 122. CHANGES 0.5008 PIO0GDL..ccsres 123 PersonnelInvolved i 5eSOY... 125 cn2022 WildliLfeee Inten rnaa tion, al, iLtd,. 5. SUMMARY TPriojeecNtNeumibewr i454a-1m04 STUDY: PFOS: A Pilot Reproduction taywiththeNorthernBobwhite SPONSOR: 3MCorporation WILDLIFE INTERNATIONAL,LTD. PROJECTNUMBER: 454-104 TESTDATES:ASEdtuduxy ITpneieiromrnSiaintFa-_emFbAtrepuiebaerrolyan12nr18yt,&2290Ja,u02l00yl1030,2000 Biological Tenminatiuolny 21,2000 TESTANIMALS: Northenbobwhite (Colsvirginia) AGETESTANIMALS: Appr30oweekxsofiaeamtthaeintitieonoflheyest SOUTESRTANCIMAELS: T2r8i8cLeePvheensgsoaondyf,onndc. DUosugklasvillAe,. 19508 NOMINAL TEST CONCENTRATIONS: 0, 18,62, ad 176ppm RESULTS: mNPaoOirnMtthaieir.nnebfdooorbnwt6hiswteedewikeesrt.esTfeohxrpaeoncsodnttirooolPngFrOoSuo1p3twadeniedektasr.1y7c6oNpnocpeanmtraac.tionwasersoeuflneoca8ed,romp62,amaesndewn1e7oe6e.s oabvpeepratr1es8nitg3n0sedoamf6et2noxtpipciemtlyawt.ee.dreetocebststcseornovcneendbtaroadatyinoWnysE.oIft,hAeftoedsdt ccdoonnscuiemntpaeidtroonne.sow.oerrnTevhe5raa0wsewlipgrahytr,ea. || Pacrroaenmcaeemtnerrtesomnse.easduTerhfeefdrcdetuswreiornnefthenemoaslatpeubpaorLdefnytsweryiegosfheonftcvloenirceendwteriacgthiotoantstetohsnec1a7n.y6pporsodouscwtts ||! bWroehldeiyenwdcerioegmdhuptcatirinoentheoint17hf.ee6ceodpncptromonl8.gsrouiunmpc,upthtfeoirsgtohrwneoasvp1a.7s.Ti6hgpneiprfmicwaans1t.rewadSugecntiidoBncaiingntmmrsoeeueasptnmnmweaiatlte cEheheostmomern1ta.pltthHeaicasatlonrpistvhaleoglhrogeodiuc1pa7l.6eThpxermaem.waissnoaaifotnseitl8eSocteineaeddlscnaunettsaraeyidoubcvoiovenebleiodmpesssttceFodon cooe nfctentertl aotsiortneitt safsomurenecnfotor.rtl(hewBraoanasbdearudblwuthpmioatlneectsxhipenatsheeed1s{7s.06opPfRmtOSias.in teshutedsd,$it7th0efohrmko-mwsebyeakrshvweeadscph6cn3t pms. cn2023 SWiLldlife International, , Ltd. ieNebe Projecet Numsber 4e54-1s 04 5 This stdy was conducted by INTRODUCTION WildeItematonl Li. for 3MCorporation atthe Wide Iaotsercnatoionna, dLfudo.umvFicebnrtutaoreiyc2ld9o,gy20f0e0ulnttilinlEyxt2o1n,,20M0a0r.yRlaendwd21a60a1.genTehreatbeidcotgWiciallodreionnteorfmtahteiotnesat, sWLuids.lidainedItaceorpaytoifotnh,eLfii.nasltr.epoBritoalroegficialledpunedereProsajreectsNouremdbeatr34M54C-o1r0p4ionraartcihSoitv,.esPlaouc,atMeidooenstohtes Theoective oftisstudywas o omECTIVES valsth ffcsupon the adultnorthernbobohite (Collar 1v0i8r8gPiRnOsS)) oafvderiapreyrieoxdpoofsarpeprootxhiemaptoetlays6siwumkssloofrP1e9fwueoerkoso.cEifafneectSsolofnniaclAtcihdes(htehr,ebaoftderywreeifgehd, aonfdfeeggesdcniod,nfsorutwyme,rpeeetvmabilruyaootendv.iIanblaed,dibna,tcthheubeiftfyectsndo.f adouflptreixopgosusreu1vi0vePlFOwSeornethee ausmtbe,r 10HisvoapalhoslotghiceaflfeecxtasmwipnatiaodnuoltfsseexlpeoctseeddtiosPsuFeOssSnadaduloytsseooffbflporoidngn.d sue spl were ls sed Northen bobwhite (20 males EXPERIMENTAL DESIGN and 20 females) were randomly isibutd oto ane contol group and tr weamen upon te resusof garoLuCpSsD.Tshteudtyes(tWcionlcdenetrIattcioansstwieoarls,elLiedc.tePdroijeccotnsNuulmabteorn withthe Sponsor,bad 454-103) and adidoal to2x0ipcpimty aii. nFolflowoipnrgroevxipmdeerdiabmeyntttaelisSpaoon,sotnhre.tTehstemaotreirgiianlawlaesstrceanoalynzecdanedtsnehltefcintraeldpawuertrteyi0s,a2os,l7noawnsedr thanorigallyreported.Theor,theactual nomi)testcocenratweorne s, 1.8, 62snd176ppm Tm T le ma --_-- PROS Treatment Groups Group. `NominalComes Pens per rain 2 3 18 62 5 5 TR 1: --5 _us 176 s s r Lo coord --- WiT ldlf ife Intoemrantaitioonnaall,, JLetdd.. PPriojeetctNNmumbbeedr4s54u-i10n4 "10 pen. ETahcehetreaattmmeennttgarnoducposnwteorlegfroodupdiccotsnconnetadifnivngpetiherof idswith 15, 62,or one ae 17.6ppm ndoefreper ai.of PEOS, The coanbtaolng.roupwsfed ditcomparabletothetreatmentgroups,but withoutthe addition of thetet 17.6pApduml.t nfoorrtahpeerrniboodbowfhi6tweeweekrse.exApcoosnetdoltogProOupS,faetdnnoomni-arledtieedtadriyec,ownecsemnaatiitoinnseofc1o.8,n2veanyd Wwiitthhtohnetmeaalmeaenndtgonreoufpesm.aElsecphrtrpeeant.meAntttanedtnhdocofnWtreoelkg6r,oudpucolnbsiisdtseidofheGiv1e8psanisdo6f.2bpipds aho,vesctd concentrationswere euthanizedandsubjected 17.6ppm .. treatm groupweremaintained ou grosnecopey. Tes bis i thecontrol heappropri dictsun tebeginningof group and Weck20of tohedtyeswte,isgthwth,icahndtfimoesthceoynwseurmepailosnocwuetrhaenivzaedlaantdesduabj5ecwteeldta ogreofsfsctnsecurpoopsny.eg`Effpercotdsuocntiaodnu,ltehmebalrtyho, viability, Sicabilt and offpin survival forall st concertos. bodywTeihgehatdswaerbeimdesawseurreeobsaerevetddiaaltyifoo,rmoonrtWaelietkys,2a,bo4o,r6m,a8l,be1b0aavinodrs1a1d, asidgnsaaofuelcter.minaAtdiuolnt. FNeeecdrcposnissuwmpetrieopnefrofocramcehdponenalwlaaslmetabsiurrdseadonvderan as1e0vofefnsdpariynpgefrioomd ccaacchhweestctohnrsocuagrhaotuotnt.heLtievnetr. weights sample were wer recorded cllte for all necopsied bid. a the imeof ecropeyfo Live, bile and blood (when posibleaalysi. Adiconal avaiable samples of and fear ver, bri Kfiixdeadcyi,n g1o0n%adb,ufprfoevreendftoicrumlaulsi,nfaolbiblsatdodpert,boaldiopgocsaetesxaemi,naatnidon.bursa offbricus (ven available wre Duringthe test,the umberof eggs inWeeks1.3and Gof thtestwer conlildecitneedaacnhdpsnpwuarteesonrodsehdetlo,csvhlelultmeemcbgrpero,dyucotlikoann.dEaglgs id acnoldlsecttoerdedafnrdozseent foorrpinocusbasteioann.alyEsmibs.ryEoggvsaiildd,uraicnhgaWbeielskys,baatncdh6inDgabyset31faond37s)uovifvtahbeitletty wwrree. pu 62025 --- WildSlifLe TInmteArnTaotinonaalL,JLtdd. mm PPeriojectNNmubmebedrs45t4i-1n0s4 ThestudywasconductedaccMorAdTinEgRtIoAtLhSepAroNcDedMreEsTHuOdiDeSd n heprotocol, "PFOS: A Pilot ERvireonmpentr!StPdrooytewcdititontuhAegNeconrcytt'hserRiBegoibswothriattnieo"n.GTuihdelpirnoetso:coPlewsaiscbidaeseAdssaenspsrmoecnetduGrueisdoluitnleisn,edFiInFtRheA SSutbadnidvaisridoPnr5,aHcifzoarrCdonvdaubcatitnognR:epWodiolctfiavnSdadAgiiawticthOrAgvaniinsmSsp,eciSeusbse(c1t2i)o.n 71-4 wad the ASTM TestSubstance and InternalStandard assigTnehdeWtiesdtesubIstteamnacet,ioPnRaO,SL,udw.aisdernetcifeiicvaetdionrsoumb3erM4C6or7p5ourpaotnironeocnipOc.toTbheert2s9,s1b9s9a8aacaedwwasasa w9h8i.t9%paonwddehrasdaedxpwiarsedatethcetiimaedso:fFexpCri.Lnoo9t2l157s.taTrto.Atnesatssseyroif hebtaedsatnmoarteirgiianlfreepoerxtperairmeyntaolf esxtparitraitionn dadteoaipfurcAiutgyauostft391,0e2.040d9%6.(TAhpepfeinndailxa1s.sTayhoofetshtesutbesttmaantceerwiaalsinhdeilcdautnedderapmrbyiotfco8nd6i9ti%oan innd sTuobcskteadnscteoirnatgehaetdtiheetwWeirdeaedjnuestremdat0o1n0l0,% Lauct.if veingrei diineEntxboal sne,dMuaps roynathne.oCrgoancreepornterdopfaahrietoytoensft b9a8s.e9d%u. Dipetthaoeryfinncaolncreenptorratteidopnusrirteyeoxfpr8e6s.9s%e.dasparspermillionactive ing(rppem 1d)iintnhedtik assigTnehdeWiintdeemalIntarnmdtaiorn,l4,HLiPdF.OiSd,ewastireocneimvebdefrsom45236MuCpoornprraetciiopn. an Jy2,1998sad The infernal sand as was "Thgerainnutlearrnamlastearniadleddewnasiebdeldsus:nd1eHr,am1bHi,en2tH,co2nHdiPteiornfsuoirolcotcnkeedSsutfoorangce tActihde WCAiSldNeo.e2r7a61t9i.o97n.]2,, Lud fle in Exton, Maryland Test Organioms PheasanFcoryy,-Icnicg,ht26(82L4emveensgaoaoddRo2a4df,emDaoluegsl)aspveilnles,aPrA.no1r9t5h0e8r,n UbSobAw.hitAe tweersetaprct hoafssecldimfartoimonT,ratchee fiboobmwbthietsaapmpeehaartedchh,ealppiryoaacnhdingwetrhepihrefniortsytbpriceaeldliyngisneiassionngaunshdabhldfnoombweielndutsypeed.inTahneybpirrdesviwoeurse tuesstdingt.o rAatndtohmeiszteartpoenfsacslgimnamteinotn,faorreaancdhobmind,umbIemrmegdeinesrtaltyinpgrfiuoncttoioenstntatspiroena,dshaeletpportongrlamswtays C2076 _-- Es Wdilodlife Internai tional,XLstd.A mPc i rojectiNumba er454b-10o4 l -2- indweeexamined orphysicalfisandgralbeat.Bird a id notpesbest, terdo toinjuryorinabilityto acclimatetolaboratory`conditions,or wereoutsidetheweightrange for thetest, `xwepreoexscluodsedtfriomet)haensdtruadyn.gAeldilnbwierdisgwhetrreoamppr1o9x4im0a2t9e4lyg3r0awseeakscosft agenaottnes.tiSnietixaotfiotnhe(fibristrddaswyaosf determinedby avial examination ofthe pha. Ldenttation andgrAoudpistobfpiedaswweerreeddeenniieeddbbiynpdrijviduumablebraannd,dacocnhcepnetrawtisond. eDunriiengdtwihtthsa,utrheeemumbbeeorr,f cinacuba1tidoniwnecraecmhpareknewdawsirtehctoredpedetnonvumabesrewicnggparopdeucatsioen. iAnlklmoagrakcingopelnflofroeirescanmtptflcienagoodnr Hatclingswer deniedby le bands stht heycoldbetnd 0thepretpe of rg AvianFeedand Water testingA.TLIhseublasbaiddsieand2tdhteoibootfhfaidnigtsweareogfifviernifnegdwaansfdowremeulraatded toeWmiddureingnsecmlaiimaotailon,aLndd. specbiy AfgwiayIca.a(AptpenidioxI,nTabsle 2.52mo9reth4 an$5 ,fie. 1). Thebasa ron connedat est 27% proteinand Thebs diskcontainedapproximately 1.1%clu,derived fom foodstuffs andthe 09% lSirmoewsttohnaenudsmedaiinttehoesfnoerrmautliaotinosn,oafdtdhietbonaaslalcdailectibuym Aigweaqyui.Whilietthheislateivoenlooffcbarlceiduimnisbsuifdfsicfixentfogogr th`sehelblafsoarlmadtiiotnf.orTthheearlesanf.adodTirhtiieson,ail5se%dt(hweiwc)aolfleiummeIstvonee i(naptprhoexdimiateflyor3t8h.e5%bCeae)iwnagsbaidrddesdftoo | spproximatly 3%sigh Ofipringreceivedbasa dsibeovweitthheoumttieistsubscaoncmemeannddewdiftohoquutatle(2d.3i99o)snndmoafll5a%rdsu(pp0l7e5me%n)t,al ! | limestone. ! solubleWvaitaemrinwaansdsueplpelcitreodlybtyetmhiextinowtnheoif stteon(AppupbelincdiwxaIt,erTasbulpely2.).NAeltlhoefrftihenagdueltsinvorodfafswprieng raeccciovdeandcasnwyiotrhmWofmeedicIatteimoantiionntahl,Lsdd. dStranidatrdeOepesratiFnegePdarnocdewdauctse,were alyzedperiodical in coon? --- LWilE dlife Internationnaal,,LLdtd,. PPreojNcteNbumebesrs45t4-i10n4 5. DietPreparation thef`nesdtitdi.cCtosnwterroeldpreetpaarnedbeyacmhinriesntgedFdOiSe wnetreparperpairexdtwheaetwkleysbuesgadsfinrgoenlFyebrpuraerpya2ra,ti2o0n 0of0 tahnedtperstescuobtsdta1n0ctehaenbdidars apnreTsueenstdeadyoafpeaarcthspweeremki.lDlioentaacrtyciveoingnrecdicent(nwpeprtmeardaj5u)as.tetdDfioerptoaoarntflytosshfe Weekly preparstionoftestanctrl desareshowninAppendix I. DietSampling hereHsotmeodgdieentesi0tdyofetohseamtpelsessubfsrtoamntche iconthterodlidtiwetasoneDvalyuat0eodfbWyeceolkl1e.ctiSngsixasawmeprl leecsolflre eocmtecdas fcrhoomf tbetop,middle andbottom upditsampleswer ls ofthe left an collectedfrom rightsectionsofte mixing thefedtroughsonDay 7of vesel. Conantdtraotle Week Ito assesssaioflthe rfaettmseubnsttgarncoeuupnddiecrsadcurtiangWesetceond6iodfotnsh. tAedtditotmioeaaluyr,eesrafmypleewstacsonccoelnltercatteidofnsr.omTthheediceotnsarmlplaensd were stored frozen ac foranal lysis. or ttre immediately to the Wilde nematonal, Lu. sslyica chemistry AnalyticalMethod We"Thetmeerntahtoidonuasle,dLfido.rtahnedanealnyesidso"fAnPaOlyStiicanlaMveitnhdoidetVwaesbraiseodupforntmheetDheotdeorlmiongaytdieovneolfoPpeEdOaSt inAvisDie"(Wide nteratonl, Lid. PrNoj.45c4C-1t10). solutiSoanmcpolnetsaiwneirngee0xtr0act1medg0w1iH0t,hme1tHh,an2oH,la2nHddiPleuctfeudcionroaca5n0e% mSeutlfhoanniocl:Ac5i0d% (4NH.APNFOOSp; uinrteetmealr standard) and 0.05% methodology. Ametho formic acid flowchar i (v4) so hat they Tl within the providedinAppendixIV, Figure 1. cabibraton ange of the PFOS ConcetoafPEiOSoinntsh stcanhdarrdsoanmd eaxutstriancgotsogHfortwhaee.spPamahpclaeyrsdwMeoredede1t1e0rmHiingehd.bPyerrefvoerrsmea-pLhiaqsueihdiCghhrpoemrsfoogrrmaapnhc(eHPliLqCui)d wih 4 PerkinEiner SCIEX API 100LC TubolonSpray ion source. HPLC separations Mass Spectomeer were achive using equipped with a Keystone Betasi Perkin Elmer Co analytical column (50 mm x 2 mm LD, 3m parce size). AppendixIV, Table1. The instrument parameters are summarized in . Cnoopg -_-- Wildlife Internnaatinonaal,,LLtdE. - PPreojieecNtNeummbbeedrs44t-i1o0n4 conaiCnailnibgra0tio.n s0tan1d4a0rHdPs0FoO1fPFO(iSiperrmeaplarsedainndear5.0% smnedth0an0o5l%50fo%rmiNcANaOcpidur(ev)w,aterrosgoilnugtioinn (cWonececnktr1a,tDioanyf7r,oWme0e.0k0,04D3a9yf0oa0n.0t0h4e39smagmplae.r.e.-(exWtereakcio1n,sDte)y,w0e)roeran0a.l0yz0e3d1w1it0h0t.h0e0s4a3m9pmlgs, aTih.e same ndmostprominentpkrespons orPROSwaswilzedfomoniter PFOS all irc,galt ccoonmtproonle,natnsd.sLtuidnyessamrpeglreess.sNiooneaqtutaetmipontswwaesrmeagdeneetroatqeudaunstiinfgypPeFaOkSaoreutrheespboanssiesrofoisnd(ivPiRdOuaSlisoemremrailc. stsatnadnadarrdd).vAernsuesxatmhpel.eroesfpeactciavleibractoinocnecnutrrvatioinsrparteisoesnt(ePdFiOnSApp:enndteoaIVl,stFainudraerd2).oTfhtehceocnaclciobtrmattiioonn osfamtpelsetssiubtsotatnhceeaippnlitchaebslaemipnlceasrweagrsedsesitoenremqiunaetdibony.suTybpsiciaulinongcthhperakoarmeaaoeftsplooouwsagearadrthioisaghomfetsvheel calibration sandrdsaeshowninAppendixIV, aepreseinAnpptenedidxIV,Tule 2. Fi3gaodu4, rrespeectivsely. Examplesofcaleaions calculTahemsetthhopdrloidmuicttooffqtuhaeslioawieosnt caLliObQra)tiofnrtsthaendWaerdeakna,lDyazyed (a0n.a0l0y0s4i3s9waags s0.t1L5)1a047t9heoamvear diWleuetikon6,faDctaoyr0oafntahleymsetsaxndbtlhankssaammpplleere2-0c0xt0rLaIciCo)n.seTthweamsseteatLt1O4Q1 hpfoprmtohaeiWedceakl1e,lDaoda78aynhde productof he loweststandardanalyzed (0000351 mg ..1)an the veeldlnfactoroftemats blank samples (4000LIK).Examplesofcalculations represeatedin AppeadixIV,Tabl 2. i interAfelroenncegs.wiNthothientsearfmeprelneceasawleyrseso,bfsoeruvremdaatrioxrbalbaonvkesthweereLaOnQaldyhzreidngtotdheetsearmmpinleepaomsliybslne (Appendix IV, Table 3). Figur, A typical ion chromatogram ofa mtx blak is presented in Appendix IV, and2A2v0ipapnmdieatis. am(pWleeeskwe1r,Defaryie7;d Westek0367,9,Da7y9,0a1n2d2t2h.e0spamppmle.r-(cWxterakct1,ioDnasye0))axd1s7n6s,y8e7c9d cprooncceudrucraalllyrewciovtehritehse osfam1p0l5e%s,to10de4t%e,rm1i0ne7%thaeamde1a0n2%p.roceTdhuersael vraelcuoevseryc.omeTshepomdettohoadcyhiesladmedplmeeeatn analyzed or reamlyzed during he defisitive sody (Appendix IV, Table 3). Sample measured cna029 _-- a Wilcdclifei InteT rd natim onal, L. td. . Prsjc. tsNumbier45i4-104 is consenraonswere no pcan chromatogra coofmeamciaedtfiorfotrthifirceastpieonctiisvermeesaenepdrioaceAdpupreanldriexcIoVv,eriyguorfteh6at samplese. A HousingaadEnvironments Conditions the Housingaad hsbandeypracticeswereconducted50a Noionsl ResearchCouncil (4). The adultbirds were adhef0teguidelinescuablishdby housed.indoorsinbares of pens ampapnruofxaicmtautreeldy 2b5yX G1eocrmgi.aThQeupaeinls FaadmmslopMiannguflacotrurtihnagt r(eGsQteFMneMoidnel beNiog.ht r0a3n3g0i),ng fmreoamsu2r0in0g 26cm.Thepens weeconstructedof testlayoutispresented inAppendiVx. galvanizedwire mesh andgalvanized sheeting. A agrofahe period Eachpen was quippedwithfeedandweertroughs. wasplacedinthe rough forcachpenandpresented Weekly, sufifeedfo the footing to th bids.During the fingperiod addditeioanal eiceedswaaystwo epirgohveiddeapnotaabdldeedatetr(hgerneurgalslysesvpreys2d-c3 d.Wysa)t.e troughs werechangedsndwater excessOivneldyisbtiurrdbasancsesso.cTiahteedwviertshgtehitsesmtpuedryawteerientmaeiandtualitnendoirtnhterhnebsotubdyroostmuidynroorodmedrutroinagvtohied choanudslienogfstyhseifeemstinwtahs2e2s3h&yr1o1oCmw(aSsD)dweistihgannedavervaegnetruelpafti0ve1u5riootm aoifrv5o0lu+me1s4%ev(eSrDy).hoTurhasneid replacethemwith freshsie photopTehrieodphdoutroipnegraicocdilimatthieoanduanldttnohrethteersntbwoaswi1e7:hrooosm owfalsimghatlpsearidnaeyd by to atime clock. The indiceegg laying. Throughout he tes, the bids received laminationprovidedby orescea gts a mean of approximately 188 ux (~ 17.5. ht closelyspronimatod nonesulght. candle) of Observations Thetestbindswer celimate th inition ofthe test. Dung acclimation, ilies all bids and studypeas forspproximtely 6weekspriorto were observed dally. Binds citing aboormal bobseervedhodradialeyiflvoartsiiigongspoohfysx ircal ni jorrcssbuwi oerrmeanlotbeuhsaeviofr.rtAhditdeotn.alDliy,nogl tohfefsstpruidnyg,waelrlaeuoblsebrivdesdwdeirey 2030 -_-- RiI Wioldslisfe Iintiernational,RLetnd. Pr.sijvctiNiusmbbeiri45t4i-1o04d "16+ fcliionimcablacohbsienrgvatuinotnisl.approx1i2mweaektsoeflagye.A recordwasmaintainedofallmoralesand Adult BodyWelghtandFeed Consumption terminAadtiuolnt.Fbeoeddywceoingshutmspwseiroenmferasusrcehdpaenetwaisamienas,uroendWweeeekksl2y,th4r,o6u,gh,out10t,he1.1atesna,tadFduolotd adcditioonsndiewstaasduddeetdemdrumripinnegdbttyhewweiiegehoki,nagnntdewfeeisghliyngltohedffeeeddeeroanndDeryem0a,ireicaofdindgtaht athmeoeunntdoofftshaey mfeoeudnitnegpdefroidoedr(sDdensi7)g.nAednwiatthmp2 t"Tweaosdmaavdere"folmp.iniTmhiezeafmooudnwtasotf afgeeebdywahsetebdirbdybtyeibnigrdes xwearsanloyt feqeudacoins,umspintcieotnhiswparsetsendifeededawsaasnncoarimmaaltyesocfatrotealdfeaenddmcionsseudmpwtiitonw.ateArlslnrdeexcriet.nbiTirhdersnewfeogrree, euthanizedtwodays afer cleforWaeekt20, he beginningof Week 20. Theretore, no eed consumsptitmtiewone : AdBlooud Colllecttion Week 2A0tfhoertcointeroolfgrduolwatnerdmin1a7t.6iponpm(eadi.ofgWreuep)kb6looord1s.a8maplnedsw6e2rpepcmoll.e.ctgerdofuopsm;baelgisnunrivnivginogf bBienmda,ywtheelntplosesti,blea,ndprsior twu oacsubsm taonresdaf.rozeAnlalndbsoioppdesdatmoplCeesntrweeArnessleyptacraltLedboirnstoorsiecr,uam.snfdor possiblesays. AdultNecropey nd TisueColcton dislocaAtitont,hneeccornoclpussiieodn,oafntdhseteoxrpeodsfurroezpeenr.iodA,tatlhesurtviimveinogfadunlectrboiprsdys,twiemeeesuthwaenriezecdoblylceercvtifecoardl siasmtopplsetshoolfoggiaclalbelaxdadmeri,nalitviero,n0praonvden1t7r.i6cuplupsm, kai.dogeryosu,psbroil,y)agonndadpso,ssbiubrlseaanoaflyFsaebsr.iciWuhseanndavaadiiapbolsee, iHimsteopawtehroelofgiyx.ed Winhe0n%abvuafiflebrleed,fsoarmmaplliens. oHfibsitloeloagydslivaer wmewreeprstlohrieedpefdrsoz0eEnPaLnidnshHieprpneddont,o VCeAntfroer feAantalhyetriscaalmpLlaebosrwaetoerisetso,reInf.rfoorzpeosfsoirbploteeanltyiaslisan.aAlynsiysr. emaitnissiuenpgot fixed or hisopstbolaognyd n2031 ---_-- L Wildlife Into ernational,LLm tdd. a PPreoijeec, ttNNuammbbeer4e5s4t-i10o4n ne EgColeantdStoorange collectFeiddsailynidrdoumrientpaesesvaennddsaoyrpeedriiod bceoglidnriongm.uonntlhinsceucbaotnidodna.Ty hofcoWledcrkoo5mowfatshaeteitwoeree atamean temperatureof 13.1C +0.1C (SD) with ameanrelative humidityofapproximately 72% 4% (cSoD)n. Gsrioud1psesoorefeeldgogs wereidentifiedbyanalphabeticlotcode. Alleggslaid during theweekwere CaAnttahdnedelInndciuofbn tahteig woenekly interval,aleggswereremovedfromthecoldroom,countedandcadled wCirtahckaedSopressbdoKoirnmgal(MeogdgsewlNeor.re3c2o)redge.dcaanndldiinscgalrduemdp. Atolldegtgcstteogbeisnhcelulbcataecdkweoresbunogoartmeadewgigtns. fpoosrsmiablildiethyyodfegpaasthinoganenaicnoingthatmicnaabtiinoent wpirtihoraci0ciunlcauibantfiaonf.oraFpprooxirmamtelaygweloswdoausres,gehnreeyrdtuecddetbehey cboomwblinaitnhge2b6aseooffpthoetaistsiiguhmtpecarbmiannegt.anatead 25mlof37% commercialgradeformalin in porcelain the teAmpelraetgugrsewnaostdmisicanrdeeddweart enplavceerdigne37P.e5e4rs00CI(nScDub)awtoirt(hMaondaevleNraog.e wSeP2t0b)u.Ibttmhpeeirnsctuibaoofr fa3n0.a6:n0d.1blCa(dSesDt)halaptriovdeuhcuemdidiatmyoilfdspbrroesaitmhaitneglayc60m%o).veTmheenitncduebsaitogrnewdas0equcilipmpiendswtietinhrapcualbsioteotr temperature ndhumidityvariationduringincubation.In ordert preventadbesion oftheembryo tothe | srhoetlletmheembrgasnef,rtohme5in0cuobfaftoorfwvasearlasoienqouiepdpierdewctiitonhafno a0utoomfaftiocf veegrgtircoatlaitiotnhdeeavpipcoes,idteesdiigrneecdtitono (Ctlar of rotionwas 100)every wohousthroughDay21ofincubation. Eggs werecandiodn Day ofincubationtodetermineembryoviabilityan onDay 21 0determinecabryosurvive. | Hstehogaad Broading OnDay21ofincubation, tecgeswereplacedinaPetrsimeHotcher(ModelNo. S68)and | i alclolwiendgtsosheaptucrht.edPebdyigprreeebvaaskepts cooefnosrtirnguicnt.edoEfgggsalwvearniezendotstreoeslaweidrienmtheesbhawtechrees,usTehdetoavkeeregpe i wfaesmpiesrearde10i3n3.t3he B0a0chiCng(ScDo)mp(alrattimveenthuwmiisdi3t7y.o2fp0pr0oxCim(aStDe)l,ya7n7d%t)h.e average wet bulb teperstare "2032 -_-- Wilidllaiyfee Iinntteerrnnaattiioonnaall,,LLttdd.,===~~ `Proeject tNumbwer 5a4-10s4 "1s incubAatlioln.sTchienggrso,upbnobdycwegehtgo,ft0hedsugrtisvhienlglhs cwelrirnegmobvyepdenrowmshdeebtecrmisneda.nDHaatych2l5inogr2w6eoref lpaergtbiaanldecdofnocresidseinoinfircasiopnibnyipnebnrooofdirnig npeasndutnteilnaoprvoisicmyaehloyuse5wdeaeckcosrdoifnagge0.tAhelappcrloiprnigs fwoedruenmroavteeddd1iatgwiethloiugthtthpeeands,dwihenrofthe4ywseuprpelehmeonutsaeldslpimpersotsoniem.aeAltys7pweecekssi,aTelhye12atwchelinegosfwkaegrsee tehuetbsavneizaegdewbiotdhcyawrebiognhtdiboyxpidaeracnudtldpiseposoefdaolflbuyviinvciinneraotipoin.nTghwoessodfeftseprrmiinngesde,lenctded hfeorbbliododwenred suesamplingweesrefonfollowingncrpeyand te dispsedofbyincineration (ModeHaltBcTl3i5n0g)s.wBeacehpbeunsmeedaisnubraetdesrpiepsrooxfibmraotdliyn7g2peXn9s0maXn2uf3accnrehdibghy,BTehseccoxnStteenell Cwaolmlpsaannyd ealivngsnofiewxiczrhepmeeensdwhe.reThceonrsmtorsutctaesdinoftgheabvraoiozdeidnwgicormmpearsthmaenntgoafveaaiczhepdesnhweteiroeg,stFlfooorsnwearieoaf Otfeamgpee.rateBroofaadpinrgowxaimsadtilsyco3n8tinC uedomontcheetbaechoifnhgtscwienrge idetetrhmebinieddstwoebreeaoppfrsouxfifmicaiteenlty3si0zeda1y0s h1e0rmCor(sSuD)ltwei.th Theavaevreargaegerealamtbiivceahtumoiodimtytoefm39p%e&r8i%nt(eSrD)o.omAlhohuasitneglbigrsowaedrssvraesmo2v8e6dfr4om sbpropoodniingmpaeinlsy a1nd2mraXns1fe2r,dtwoifltihghtcpeensia bperiogxhiomaftselpypr5woexeiksmoa1ftla.y.EFxatcerhnialgwhaple,nlmeesrssendd celing of schpnwerconstructedof wirmes.The phooperiod atimeclockat 16bursofightper oy. or the clings wasmaintained by | | OpinBloodandTimeColton Pri to catboftaheaoffsprinsg, bood sawmerepcolllecteedfsom 10 offigirnciancgh | tr5e2adtsmiepnptgerdooupt.heAClltbrlooAdnssyatsmwLepraelserpearsatse,dosi.nftorspeorsusmibalnedahneamlyasceyst.esA/pdlaitenltas,,stosruedefsrofzoenm, atvhea1il0aboef,spsramipnlgesinofegaaclhlgbrloaudpdewr,erievcro,llpecrteod vforeins,topKaitdhoelyosg,iebraaienx,amgionnaadtsi,onb3unrdsoaflyFasbsri.ciuWshaennd aHdiisptoopsaetthoolomgye.weWrheenfaxvadibilne, 1s0%lebsufffieldefaonrdmavleirn sanudeswheirpepesdtotroefEPoLeiannHdesmhdipopned,foVCAentfroer Analytical Laboratories, o. forposible sys. . "2033 _--_-- L WildT lifeHIOntmeArniaotinoannal,,tLdtd.. 19- PPreoijecttNNeummbbeerd4s54t-i1s04s Static Ansyses statisticUalploynsciogmipfliectaitodniofffrtehnecteesbte,tawneeAnngarloyuspiss.ofDoVnanriea'nscem(uAlpNlOeVcAo)mpwaarsipseornfporromceeddutroed(e5t,e6r)wmiense usseid 1g0conmopfairheftahbeisrbcvreedeadtirfnefaertcemnecneets.meSaenmspwlietihttshweecroenttrhoolignrdiovuidpumalepaennsawnidtahsinsecsasctheoxstptiesrictal wuerpe,exeaxmcienptedbwoidynganDdulaivnerew'eimgehttshowdhfeorllotwheinsgaamrpclseinuenistqwuarsetohoitndtirveisdsutalombsitci,on,PeTrswootasgeesdoetfa souniyntliocolkeadnalaybseosdwyeweeicgohntdauncdtefdeewdictohntmhuembpoidoynwdeigthft oanmdeheeficrosats6wumepetkosnodfatte.sOtneysaenodefanvyes rlalitmrecnet-gersotumpesnat ngrdoeuxpasm.inTehdedsatcaofnodrtshee offlalndaalytsiiosonnloyfthveastludiyd, t2h0ewceoenktsr.olD3u2sdae1t7'.6spmuplmipal.e comparisonprocesswasnotconsideredspprpesietocompath controlgroupto singeream cgornoturpo.l`gTrhoeusptaundedntth'es 1T7-.t6epstpwmasaui.serdetsoemnatkgersotuaptiwsetirceaclcoommppaarreids.onsinthoseinstanceswhereonlythe L Adu1l0t,Bo1d1,yaWneidgahttad~uIlntdtievrimdiunaaltbioond.ywSeaitgihsttwiaalscommepaasruirseodanstwteesrteinmiatidateiboen,twWeeeenksth2,ec4,on6,to8,l adduitpio4n,ndeatcishitcraelcaotmmpenatrgirsoounpsawteeraecmhawediegbheitnwgeiennterhvealcobnytsroelx orro theafnids1t76.w6epepksm,aI.n reamsgroupforweeks8, 10, 1,124 20 2. AdulextFameiendeCdobnysupmepntwioenek~lFyedeudrciongnstuhmeptteiton,eSxtpartiesstsiceadlacsgroammsofpfeweaedrperemrbaiidredsbpeetrodweancyawtsahes | | wceorntermoaladnedbeeatcwheterneatthemecnotngtrooluapfdor17w.e6epkpsm1tah.roeuagmhe6.nItgnraodudpitioornw,seteatkisst7itchalrcooumgphar19i.sons | 3. EernepLraoidudct~iTvheepenrufomrbmearnocef,gdastatiakdepnferrofmewmealeekpergtgraesattm.entgroup.Fortheevaluatiofn 4. ViableEmbryos -The umberof ivecnbryosdetermined aDay 11bycandiing. S. EggbsyCtrhaeckneudmobfeErgogfscLgagidai~dT,pheernpeunm.ber ofeggs determined by candling tobecracked divided 6. ViableEmbryosofEggsSc ~The umberofcnbryos at nuofmeggbs sce,perrpen he Day 11 candingwas dividedby the - 72034 --- LWiLldlife Intemranattiioonnaal,, LLatdd.. PrsjctNNuembmere45s4-i10s4 "0. 7. LivWe3asWdeievkideEdnbbyrtyhoesonufmVbiearbolefEvmibbrlyeoesmbr-Tyohs,pneurmpbeenr.of iveembryo ftheDay21cndiing 8. Hutcdhiivnigdsedobfyt3h-eWeuemkbeEmrbofryvose3~-Twheekuemmbbreyorso,fpheirtpcehning removedfromthe batcherwas 9: 14:DayOdSurvivosofFtclings ~Themumbeeof numberofhatching perweek,bypea. 14-day odsurvivorswasdividedbyte 10. Hatchling of EggsSet weebykpe,n. ~The numberofhatchlings wasdivided bythenumberofeggs setper 11. 14:DayOldSurvivorsofEggs Set~Themumberof numgsbseteperwreeko,bypfe. 14-dayoldsurvivorswas dividedby the 12. OfsurfvivsorBp sowedrryei Wmeein agshugtre~' dTbys hpeacgersoaulpbpeodgyrowuepi.ghtsofsurvivinghatchlingsand 14-dayold 15.LivoerfWoeifghft -podrifvwiiedsunkalg5i.verSwteaidgshttcslwceormepmareiassouursedoaf taddualtttievierawteiognhtasnweartemeacdreibnaytsiooxn betweenthecontrolandtreatmentgroups Juvenile lveweightswerecomparedbyfest `group, witrehgarodtu osetx. Adultnothembobwhit RESANUD DILSCUTSSISON weeexposeto PEOSst nominaldiary conceatationsof 1.8, 62sod w1i7t6h pthmweait.mfeorntgperroiups.ofEa6cwheterke.atmAecnotnntdoltrh cvontreoclgnroouprceosntsedisdtiectd,ofwafsivmeiptaaiinoefdbcirodn,ahreenetdy | ith nemaleandone femaleperpen.Attheendof Week6,adultbirdsinthe 18and6.2ppma. est concentrationswere euthanizedandsubjected 1 gossnecropsy. Testbirdsin thecontrolgroupand i | 1h7e.6tepspt,mtaw.hiccahttmiemnttgheryowuerweerlesmacitnhtaaniinzeeddonntdhessubpjpercotepdrtiotgdrioesssnueaopteey.beginingof Week20of i | Analytical Results PresencNeonofecoo-fctlhuicnogntsruolbssatmapnlcaeestshheocwheardascoteyriisntdiiccarteitoennotifotn eimpereosfetnhceeteosftthsebtseastnscuebs(tTaabnle a1),ofDihce swaemrpelaensawlyezeedco1lleevctaeldufteotmhethhomo1g8,en6e2itaynodft17e.t6petmsu.bs.tatnestcoantcheentdriateionnsdon1 vWeeriefky1,eDstsuba0st,aaynacde concenrions. Meansand standarddevion foe he thretestconcentrationswere 18 0.13 pms, n20as SEEy LWUilAdlyifee TInntteerrnnaattiioonnaall,,LLetdd.. PProejiecetNNuembbeerd4s54t-1i04n a1. 604065ppm a. 0d 17.6 1.46pom .. respectively Thecoefofviaricatioinweeren7.2t%,1s% 1(0dA8p3%p,IeVr,ensTpacdilvieel4yx).. SaTmhpelseescvoalllueecsterdeprdeusreinntedWe1c0k0,6,9D7aysnd0o1f0t0he%tosf noovmeirnsytceostnscbestiaainocnes concenirion orthe 1.8, 62ad 17.6pn. dietsbdmeans an sandarddevinionsof 20. 0.092 PPM8.3, 6.0: 067ppm a. and 163 0.608ppm i.respectively.Thecocfiofcvriisctoonwtesre 46% 1%and3.6%,respectively. (AppeIV,nTadblie 5x).Ansys Thesevaluesrepresented 111,97and95%of ominal concentrations ofdictsamplescollected romfeedersaftebeing held a ambiat temperature for 7days averaged 100%, 103%aad 8% of heDay 0valuesfothe 1.8,62 3d 176pn test concerenspecttivrely(aAptpenidixoIV,nTabsle,6). is shownin AppeIVn, Fdigiurex. A typical ionchromsofogstrsaamplme: Mor and CtlsesaObslervatsions Noadultmortaiie occuredinthecontolgrouporinaayof he teament groups dinthe courseofthetest. SevernbindswernedwithBes orfotlesionsan feather os a eslofpen awsseoaciaatleodswiptehathmeaitraiggsre,ssiAolnldtureinrgbtihdescowuerrss oofrtahelteistp.eAarainncciedaentdalbcelhianivciaolrsfigonr,thlaedmeunreastsi,ownaosf ores AdultWBhoedyncWoemlpghatred thecontolgroup, therewerenospparettesmentreli effectsuponbody. | weightat he 1. and 62pm .. testconceptionssnsaydiffrencebetweentecontol groupand hose two resent groups were not saiically significant ot ay of he body weight nerves. However, thee were retment late reductions in mean body weight for malsa the 17.6 pom ai treatmentgroup. Witheextcepthion ofthe We2bodeyweikght intmeearnmvaal blo,dy weigaththte 17in.t6erpvaplsm(a.Wie.etkesst4c,o6n,ce8n,tr1a0t,io1n,waansdst2at0i,stFicoalrlfy(epm<a0l.05b)oddiyffweeriegnhttf,rnoomntehoefcotnhterdoilfgfreoreunpcaestaolblsoetrhveerd : between thetreagtroumpsennd the consotupowelr statistical signfoiranfyoiftcheaenratl monitored during the study. Mean body weight measurements are prescoted in Tobe 2 nd individual odyweightmeasaueprreseentmedienApnpentdixsVL. n20a6 _-- LWe ildlife Ientenrnaotinona,l, LLted., ieNePrbojecet Nusmbetr 45i4-1n04 2. FeedConsumption HoweveDr,uwh1e0necxocmepssairveedwa1stthaegceobnytsoolmgreobuipt,tsh,efroeodwecroennsuomtpatitomnewnats lavtaerdiabflefbestwuepeonnpfeeesd. consumption t the 18 or 62 ppm ferencesbetwenthe controladthe ai. test concentrations. While saisically 18pm .. testgroupwerecbsrvd ding significant Weck 82d (7<00%) 6of he strudy,etheseladtifhfieigeencssetsweedhrosnet.cAotnshiede6r2edpcna.n. ttertelcaotend tduaeinot,hehelraecwkoafs8csoanicscearltyosirgensifpiocnasnet Hroedwuecvteiorn,inhefseeeddifcfoenresnucmepstwieornedturoidnogsWereeskpo4ns1invdeaWnedctkhes6iwgnhiefinccaonmcepoafrtehdetoaptphaerecnotrnetdoucltgiroonuapt. coWneseukmp6tmiaonyibnathveecbeoeinlgcroonuspeqatueinsceiomfetihnetefrivcaltaactotmhpraerewaostatrelsateirvveleydltgWeicnckrease7i. nThfoaod, atWeek6, altetmentgrou ut wer actually highertan feed consumption rates servedst Weck . As weresignificantlyreducedfrom thecontrol res thereductions infeed consumption level 62 PP 8.3.werenotconsideredfobe reatment elated.Therewas eatenelated fstup feed ecaodcnosnusamtu1p7ma.t6p1pi7p.tmo6 pian.oio.tenis.tc testo concn entrc atwihoe newnan csocmot pnasriser tdetna ottthhrt eocuogni htoruoto ltghreon sutpu.dTyahnedreitdiuscictailoilyn smiegansiufirceamnetn(t7s<a0r0e5s)horwomnithnecToanbtlreo3l,garnodupfoatodWecoenkssum2p,t3i,on4,6m, e8ansd 1s5. buMyepaeennfmeaeedecproenosseunmttpetdisionn AppendixVIL Gross Necropsy wereeuthaniAzetdatncsoudbjoefctWeedek0 6r(oDsasyn4e2cr)o,paslyl.aAdduultlbtibtisdisnittehe1.c8oanntdrol6a.2npd1p7..6pptrmesatim.enttregartomuepnst agrnoduspswuerbemjationgetraoicsnsetdnoecnertohpdseya.ppWrohperinactoe dmipeatrsuendttioltthheebceognitnronligngroouf ,Wteheekre20waasnadnwienrcertehaesneediuntchiadneinzceed i irneatmheennt uelamtedob.fmAealllretshewriftihndsimnaglslobtessetresveidnwethreec1o7n.s6ipdpemredt..obgorionucpidehnattawlfso croentsmiednetr,edNpeocstsiobplyy fidingswereportedin Table nd AppendixVIL 10Stjuudvyenoiflfepbriirndgs wfoerrecaacphpreosxtigmraotueplywe1r2eswuebejkesctof taoggeraostnheecriopmsey.oNfeccurboapnsssyisr,eveaAledsuobgseatmoptlhereoef binds in cach treatment level with some feather los. Additonal, a single bird in the 6.2 ppm a. 2037 -_ Ly Wilde life mInetrenrnaattiioonnaal,,Ltd4.. PTroejeectNNuembbere45i4-s10m4 z. restmatgroupwas noidwithsbasionsonthe incidtoetrneattmaenlt. np. All findingsobservedwereconsidefroebde Histopathology Lightmicroscopicexaminationwasperformed onselectedtissuesbya bowrdcriedpathologistat pErxopveerirmiecnutlauls,PgaatlboblloagdyderL,abaodriaptoosreietsi,ssuInecs. aHnedrnbdonu,ofVFAas.bricsSieucsti(ovnsenofalivve,abriwaienl,ekcaiodlnlbeeyc,tledgefornoa)dm, adulttsbitsad rom 10ofspring (aproximatly 12weekslda chaps) romechts group for perxoavmeinntaitciuolnu.s,gNalolblleasdioenrs, coovnasriyd,erberdainpaosnsdibbly rueloafteFrdabtroiscitruesaotmfendt awtermeanloatenddfion allivser,,okritdnheiys, offpringat say ratmentrelated oftheconcentratiteosntesd. Additonal noteinadipose sscofadultmales o ther wernolesionsconsidered males sa offspringofboth sex,of obe i the testesofmaleoffspring. tubulTeesdteis omefrtwomodsutlcmoanlseissenat thwei17h.6pposptmeprio.dutcsttivceoncpehnatsreatiroengerxetsisliboint,eddencoermsasldspehmyisniilfoegrioenasl mPahyenboemeinncoind.enTthaletoocceuarmeencnet,obfuet treeartmreeagtreeslsaitoendfeorfatlkcmoladlsoitbehepre17c.l6updped,Tah.etfelsltepsholgrooguyp report proviinApdpeenddix X. Tisue Analysis Theanalysisoftheeg.bloodandtisuesamplescolceddingthestdywerecondcted by ExanydgevnrReasneaalyrtcihca(lfoermserslyakrnesowpnoarseCeinntr"EexAtnraalcyttiiocnaloLfaPbootraastosriiuemsP)aenrdaorreraeptoartnedsseapafroatfneloty.me BQluoaoid | | serum and O41". quail The liver cay for analysis using HPLC-E componcas ansyial lectrospray/Mass Spect ress ae reporid rom in e try. "Ext Centre ction Study Number of Potassium i BPleecclruoosrporaoyc/aMnaessslSopnescetomfetormy.CEegngtrMeeSatburdayoNeu,mbAelrbu2m3e.n0,65"a.nd Yolk for susysis wing HPLC. cro0a8 _--_-- P Wildlife Intee rnatinonaLl, Ll td. e Projecs t Number454-104 Em ReproductiveResults Ther were50apparent reament elstdfftsanogproduction tanyoftheconceptions tested. While egg produwcats hiigohlny variableamong bens, egg productaittohne 1.8, 6.2 or 17.6ppm co#n.c.etnesttrcaotnicoenntsrarteisoennstwedaisn Tcaobmlpear5.abIlneditvoidouraelxocgeepdreoddtuhceiocnondtrtolrgerorueps.eMnteeadinneAgpgppernodducXt.ionby viabiliWtyh,ebnchomipa,reb1attchhicnogntbreolhgronupd,strhieveawbeirltey0atstphaer1.e8, 6r2esoern1t7.lptpdmfi. tIveso,nemWbhriyloe chonecreenwtraastion,sigsneirfeicdaanctt(i<on0w.a09s)rdeedufoctfionrincthge esiunmeretoffoviiancbulbeaiobnryaosisattvheel,1P.8epnpPm 2a.o0fte7hte w1r.8epofmo.e.blaevtecl6hdinnogdl1y4-udraiy odhsewukrtavtegih 1v.w8eperpmcsao.lletfmrentcugrboautpi.oHno.wAesverr,ewahletnethree orbesperrodvuecdtiavaenyndopfotihtescowenrceenextprreasstteids.oenass.pTehrceerntawgaess,slnioghtsatuistticaolnlyinsicgnbirfiycoanvtidbiifffeyreantcetshewe6r2e rPesopmonasii.vetesatncdwasono nconswichdeernecdeormepatamernetttroeltahteoedc.onnRtoleHpowervdearto,atahidrssruuemdumcactrioinztewdaiisnnToavbtldeoe6se, Reproducivedtfo individualpensi presentedinApeadisXL. OffspriTnhgeBroedwyeWeei20gahpsparent remmentete fectsuponthbodyweights ofBatching insayof he tment Juvenile birds rope, Therewee lo nthe 1, 62or 17.6ppm 80spp a. eam reste group. relied fectsuponthebodyweighof Offspringbodyweightdt preset in Table 7 andAppendixXII. i Liver Weights dul Wivherewnecightomhept1o 8tahae6cr.o2upermlg. rethcoeorneowcueatrrptnonos,ppoaornenfer maleaedultlvsatredweeeifghtnsoananmtyaofe atdhuelctonicveenrtwreaitgihons etethde.17H.o6wpepvemr,i.beterstwcoanscesnatiraatiicolnl.ysAgdaulitfimcaalnst(ipn<t0h.e05c)onterodlgurcoutiphniaeodsnmmeasle vei.rtewsteicgohntcoefn3t.i4o0n2.grWamhsecocmomppaarree0ddtomtehacoinvteorlweglrgohutp,ofth2er.e52w7egrreamnso afporpamraelnetsreastehent17e6laptemd effects on juvenile liver weight at nyofthe concentrations ested. Mean adult and offiprng liver 72939 _--_-- Wirldaliefe IInntteerrnnaattiioonnaall,,LLtedP d.. ei Project Nums ber454-104 5. weights are presented in Table Individual offing vrweights 8. ae Individual presente s dot vr weights Append XIV. re resented in Appendix XII Norte bobwhite were exposed 1 concLusion PFOSatdicary concentrations of 18,62, ad 176peai. faod6ikoss.13Twheekcso.nNroolwgeroaumpesoatde1l7at6edpmmoria.lcaetomroevnertrsoipgnaswfesmcisswienreomsretwdictaoyrof tchoensuesmtpcioonnconrirliavdeorwne.igThhterteewe18ead06.p2ppaprmena. tettmeconntccenltrtaetidonfse.ctAsdondbiodoywtoehiragehwlti,ryefao,od scpopnacenrnttorne.atmTenhtersetweerfe5f0ssponrfeemaleebsodeytweeisgthetdoeflfiver awneainaygtrhehptreec1e7t.i6vpeopmraut.neosn meadduringtestudy orsnofhe concentrations std icn tohe`Wn1h7e6mnfcpoomprmmphpae.r.1e7id.tGeoposttrhmeencnoitn.tgrsorlmog.reoupT,ghtrehoreuerpewwwahasesaacsosiimggpnnaiiffriieccadannttorteeedaucmcteioonnttienlgmaretueapdn.mrTaedlhuecrbtiowodnyawineiifgeahedt siagvieficbaenntrreedluicedonfointmheeatnatmveern.eigHhitsfooprastuhllogclleeoxfamihneat1i7o.n6 pofoscal.cerd teisttslmelveoletrnonvemlteyd reepresie o0noefd atemsi.clrtBasseedfsoprnttohedetslloefsiinshe d1y7,.6phepmm oi.bteostgsroauoptthstommyeshvepeocn nonebobbi exposed o PROS itediet or 6wcks was 63ppma | n2040 _-- WildlifeT Into ernam tiona al,tLetd.. %- REFERENCES ProoijetctNNeummbbeerd4s5t4-i1o04s 1 USEunSbv.divrEionsuivmoienrnotnElm,PernoHttaeaczltairoPndroAtgEevecantlciuoyatn,iOoAnfg:feinccoyW.fiPledsi1t9fi8ec2i.daenPdPreosgAtrqiaucmaistd.iecWAesOsvrekgsosagmnieonontn,DGuehi.delsinems, FI3F1R0A 2 ARStmaenerdiarcpdasn.rSVooScolite1ted1y.s0fwu.oritTPchehAsivttiaiadnniegSiappevnchdPiieAes,M..at1e5ArpSaTpls. Sta1n98d6a.rd SE1t0n62d.r56d.PraA cticeuBfoocrks Coofcwhctotisng 3 Me&rCoc,Iknc. 1991.TheMarckVeterinaryMoria. Mer&cCko.Rab,NJ. 1832pp. 4 NaWtaisohnianlgRoens,eDaCrc.hNaCtoiuonncallA.cad1e99m6y.PrGeussi.de13f5orpp.theCareandUseofLaboratory Animals. S wDiumtmhettC,oCntWa.. J1o9u5r5.AmAerMuSltaitpsl.eAsCsoomcp.a5ri0so1n0s96Pr1o1c5e1dure for Comparing Several Troms Dournner C:W. 1964. NowTablefor Mille ComparwiitsCoonntrosl. Biome2t0r:4i8c2- | 2012 ; i Ei RE2 8s gs i i ol il1 = 1h ijil 3 i | PonsCl | ql IH 0 a | ma : 88f8 if 1 - . .a!i1k8i3 1 C202 ProectNoe 454.100 B1sASE1 Ne oe oa 00er id 44 ia ee maa1 ' 1 '' ITHEEEEen a i 0 ereeazn!a :' PI ASE TS Sx 0 iu a a ee aay' ' PI ES STORS 00 00 0 a R. e me ' '' oa '' Poirei=t az zmogs ssn keogs i3ld n2043 # 5 = a. ZK LE] "am "oss RA B38 ~8 ni 1 " noi=a ne vy "a se 0 1 1m 1 n n= ms ae a &* n nro un n LI or " 1 n noi=n - a a an I 1 Ta ' 1 n= Eh ne " gC n To 1} I LENE | - ~1 1 oa - .". Fa t. 0 [} nm I 1 EE . C20 Coos C206 C207 --- C2058 C2519 C2050 36. RWoiblldilinfelIontaerdnastional,TLrtdi. ProjctsNuimbtere45t4-104di ApTpeenzd] CartioffAincstyes cn a Centre.AnalyticalLaboratories. Inc. CoINTEtRIrM CLERnaTsGIOs AFROeIFes ACmNAA:LYT8SIEAS Dott Ai 310 [---- [RI ------ Xesme D316 Fe i oa oem -- evo SOR ToStyS tom O = 30 TP -- Dh PuritybyDSCi generallyno applicablefomaterialsoflowpurty.Noendotherrwas fr ie I T ed-- m t-- iihe g-- s L-- C -- ee, Bt oNTnmh H Nioeenesdy, Tn Tesi helobd 0ptfrm CESKOOH) vkvoxtce EPAGodbyPreSt(0CF 140 F---- ier n2051 -_-- 3. YvWiulddllijfee iInntteerrnnaattiioonnaall,,LLtedd..= 0 0 PPeroijeectNNeubmbeesr 4t5i4-s10n4 ApFpoeensdix1 CerinofAnalysis INTERIM a CERTIFICATE Cr OFANALYSIS ContrAntti LiberaCtOeA Reermes G23018A Lotnypoeste i s --esee ---- a ------i5---- ---- Cr----a------ be oc,t ry To ifeEa ue a wsCC dpC6 nti dohmtsc,h voit, ly 2 SE iE Lin ler everyG( p L ule]N.lb anon sus 0 C2052 38. LWiIldYlifEe nIontrenranattoinonaall,,LLdtd.. PPrrojiecstNNeumbbwere45t4i-1o04r Dict ndSupApplepFeonduil1xsions Wildife InternationaTl,abLild1.e Game BirdRation! INGREDIENTS FieCom Meat S`PShroeyoBunevBauniMseesal,48% Protein `DGANrgrewladdWyShLpeeeiychioal0n,6s0P%Porottein ENVxieatonntCnduPMrteisins +rLiundeebelow) SOaTLokulFoedmzeFdemme) PERCENT 0h) us 3i6065w50 G4S250o%00o a0a3si iTo0om VpinpmidntaoedEMlivoinnPrenis,ewhre ited 032%ofsin, nous SepPpeToon: VVRiiaaatninnaD, Nc 2To000000001001;0. rr FVPoiaeannhaeiBdce Acid wTogt woSnpgr PBTorhtiosnne e Vining 1S1i32rpear NZViiinanenginK(MendiosDimtypyitidoc isi) 201000251p3g8o,masn iCoonmtaer mS1Spgeanne So*nTahmutdausis fo inof 27 protein iimof 2.5 rPries retsd mas of5cde * Femotion ByProductsSuesofseni Groves Fc. n2053 3. Wildlife Intaernnatiaonall, Leted,, P Projete Numbei r 456-1s 04 Ditand SpApppeemnteinxF1ormlatons Vinsad lTicezs Conn _-- _-- TWermseea pov 0000 OARANTEEDANALYSIS VVViiinensnaoan HsSoionm ac 2PTa0ro1tTmoo0ono0 i] o"sBooemrmloo,ircyy oSontis NViiwmeon12 Fonda o1i23%s 100 iporfnohste "oti m aTPenornisceHtytade a f275o5 m 50j0Lo2oonstie soewg VYIiionlmRmiEmnDi)aIn.eESStNpK,TdlSSea:meieiCn-pliAprcoluterCs,dlAouifiVmtniCaaSoePrrFGoooelbgoeArf,ce,VNTisosmiSi)p,iipOta.vTV ioobeye Br A8 cth Geeof ion toe. po ie brid, | ThnJesGlaoinpRptodcrceDooURtpse:ai| pvlostpFeope iofposioly 2 gramsof at isin nd | 2054 _--_-- "a- Wildlife International, Ltd. Project Number 454-104 DAipcpePrnpdairxuIiloln 19,20P0r0.enNionmeinfaolrpPFrOeSwpearwrparase3ptsarfieodloolonnwsF:ebruary 28, 2000; Apel7, 2000;May12, 2000;andJune Control Noemi reuied. Lsppmais G2pmai: 6pmaii 03084 g PROS +60g9ri9n LOT gPROS +GISRD gration 10839 PROS +609i9on rnsBasaltoraoWnarwinag webilgenhdeedr.nToheacsetdsuHbotbaarctsmwiesnwgebigvh.ed nAop8 predrweoi1gi0hbogzaotafarntidolsnwnyals a`mdliodnereitandagrdwobeatoshnwtetab,khlTeenwnhtdeeeiorgcl.rheTubashodhseeatrbwnlwayeasaosrdreerairsicsoeofendciowronitselsohlwiiuednnraceteoisrnowtinia.emtTihdnhaaepttpiteroedonsrfxtisiomuoambtsnettlhaoyencasenwteiamnesgtbirobawoneslwf,leworwrideitdtlohsthethreeaWeeadrbfbienietgnhgge esphroutsoimtmb1eea5boimwdiclm.lesTy.heThbeopwrewas wplaascweedigohne8dinHtooba1rt0m0i00ne,a4l0dsG,eplcaocendeiswapepreoprmiaotteely labeled freezerbags, reweighed, and storedfrozen. Asode,teappropri prixwas incorporate toefal itsfollows, Oppmais 2375+k12g50kmgltimeostonne Lsppmai 1000 Premix +275 kg tion + 125 kglimestone S2pmai: 1000 Prem + 275 gration + 1250kg mesons 16ppmais 1000 premix+2275 gation + 1250kg esione hediswermixed oppositely20 iusin PattersonKellyTrinShellleer C2055 _--m--m---- La. Yi Wiildld ife Io nterk natioo nal, Jm Letdd.,a 0 ionFPra rojclt Nsul mbmere454n, -10m4 Appendix Iv "The Analysisof FOS in Avian Diet C2056 a. LaWilgdleife IInntteerrnnaattiioonnaall,,lLtdd.. 0 PProjeect Neumbwer 44e-10e4 ArpENDIX IY ANALYTICAL METHODS AND RESULTS Tae --_-- TypicalLC/MS OperationalParameters INSTRUMENT: HPF oerkviner lEeaimcreori TnSbCMoTolEdo XoeAp1Pr10y01fT0osi0gLrEh MePe.sfS rOmapcep eeLdigisesdsnoioprpcpeoesdmois nmttsogwih mirage (S. ANALYTICAL COLUMN: Keone Bea Coscoum (50mm x2 mn LD, imprice ie) OVEN TEMPERATURE: 30C stop TE: 500 mines FLOW RATE: 0220 mLrnine MOBILE PHASE: IUECTION VOLUME: 72.0% Methanol : 28.0% NANOpure Water containing 0.1% sop FormicAcid REpTrEosNTIONTIME: Jr---- | REITNETENRTNIAOLNSTTIAVNEDARD Avpeosimatly 26 mines ! MrOoNsITORED MASS: 49860 = IMNOTNEIRTNOARLESDTMAANSDSA:RD. 4267 ams " n2057 a. LWy ildle ifeIImneterrnnaattiioonnaal,,LLtdd., PPreojeNctaNubmbeesr 4t54i-104 AmrENDIXY Taste caLcuLaTions TheconentraonofPROS foundatth instrumentwasdetermined sin heflowingequation: PROS(ng ten =EL I) sr again - Theconcentration, equation: xprssd 8ppm.fox cachsample was detmined sing he following R05 grin te FOB tt de int `DeteofrLimmit i of Qnuanatitt atioin (oLOn O) `ThemethodLOQ,expressedasppm a.i,wasdeterminedusingthefollowingequation: LO ppm. owessandrconcetaion (mg 1) x over ditionfcorof atxbak "over tionfico ofabnspe-252 lameLcGiocr .} ("f Thepver lm, p.mi m.e.s.sTehdi nrcataicohtsimps1e00iivtihdepdebryttherescoomviernylcofotnhesmtertahiodn oatf ehxtchesvaelmpolfe fortification. %Recovery r=BEEAL mesnidsample n2058 -_-- kg 2 8 g |} i i' `2% 233 mss zs i I Pi li mi | NEE Hh{ J |||3 i sees eon sooo YYY : [ 330 i |fo I da a4ll ll) RfBfiEnl :i HEEP ER EEOR ,Fer 1 lil | -_-- oH] ; uo. Colle : 5 jj DEC o. Lf wow : SC } ji fi | Ei E asied guE ssd aun E5 I E-- 3 4 NR gh | . $ Ii | i al. e o 2 nl Ih sl --WildliPfCe ITnTtEeTrAnTaItioonnaanl,,TLtdd. PPeroejeNcteNmumbbeedr s45t4i-1o04s Cmbcommiti)a! APEDIXIV Taes Vertcadonof PFOSCancatriatAviaonnDist oIoDNmdimcba Gltelr CVoTowmomemits70e5 csoumVneu=tnaen,eN"moFter o 3\ \i p<ordm x } o .: <atda wa B in se ' - (tien " "8P `:. ii1a0gt0 Pixpsroimatetl m @ se : , Ce niien " o"% `. pPro xl-esoepass ed wom " ve 120 ' . (ite wo 23. `.: ihwrs fx=NiiolEtea us iC1o1mo2n0ne1nbNoeirsioceoeaocrttopcreonecdeemftrohonosgfoeidpiotehnhe0s0 tstytG3o7tsp3 tyoo1G .3 14pFee ac moreending "0061 a. T o [oI re IES i to oases c= x a yg Ho roe Ne ' 1 [I ' [a ' efa tsa oa sar! [|a = '' ' [ON TTETE "2 oe \ i 50 3 eal j253y } C2062 _--_--mmm--m-- -ZAWilYdliefe IInntteerrnnaattiioonnaall,, LLetdd.. PPrrioctvNmubmbeears4e54i-1o0s4 APPENDIXV METHOD OUTLINEFORTHEANALYSISOF PFOSIN AVIANDIET Preparematiforifaionsupe nthedesi avinfdstock inthedey i chine Wei gh 10g sa mp les fh e mats bak,mare i frist and cstamples ioweighboutsand trantsof8-e0zr. Frenchsquareglassbottles.Recordweights. Forcachsuaple,measure1007mLofmethanpolwrit+vaigradu lind snd raneinotheFrench 1 Copbodes 0dpac onshaker blep.Alploowtshiamm2pal0ecspeys.ake for iuof 30minis Vaca ierwithqaliaiv Gi 1 pepe ndrinerendfc 3 msswith methnatonloel, `Traethefile to 1 200mL. volumetricfa ndbrig volumewithmethanol , ' | cimebdont UsemOapnyet lteedios, uioe1F5o oPFtO oGce Prepareappropriatedilution(s)tobring finalconcentrationintothecalibration rangeoftheLCMS ! Fire T- ly 4 `Ampulateandsubmitsamplefor LCMSanalysis. med Tow Sh ForG5 ly ofFFOS i Gi C2083 a. -- L Wildlife International, Ltd, e PPreojlecettNuNmmbebre45s4t-1i0n4 APPENDIXV 120 Iw 0s oa ! Ii 2 : 02 | 0000% 00s re on om 02 0% 0% as os | L-- Concentration(Ratio) | Figure 2. Tisywpeiicgahltceadlib(r1a5t)ioncurve for PROS. Sl=o248p67e9, nerept = 007396; 1 = 09985, Carve tere -- -- 2064 Cn2065 Cronat C2087 C2658 ro069 -- cr2u70 - Cnoo71 roo _-------- OOOO 8 E mo 23 FZ "esa REBEE # TE FE =. aE & = FI I1 [I Te 1 1891 It ITR.1 "oa 189) wo ANB] TH " CIEFTH gv GIRL] ro TE wa igi 1 nencwlas 1 2588=152 I momaulon 1 BSHEZ IES 1 mcomumlaa I SSHSFIE= 1 comme laa ERERA 1 [AT FE 1 I1 oa ' Te I F391 1 1" IBol ' 1n I 189) oar 1 3Ngel roa 1 | FEETE PoBIv 1 S1Bal n nI I TEV n "eon | fei 1 aeacolen I EZWXIHN 1 cacwnolaw 1 EEE AED I ~aaw~lme I HWEHHE1AH=E I monaalon ARAFA i A" "a ir a rs Hel 18 Fel 12 131 sn EY] ise LEI n= 130 LR] 131 =n igi cha63 _--_--m--m--m i Is] Bf 1=| |FH I=| 1, bal Ele] i 59. zogne [zn sazsz|s- ooeen|-sessg|s" RCETE PH szsag|s veer on ssszn|e- Project Number 454-104 33) suunn on Is] 22888 as 12] anon |e 2=| s5a88 (8 $5] vernon =| snags a Jal een en 3-| ssags a Bat ih seggg|gn IIE mene | 5 iz [BN ELE5ERTE | = 3-| ssassassg|s5=: i 1 3 bs moqon en Ie 2ea-=low 1 3| szszg|s- I-| sress a= i i ba aeoe|an bf canes |e- 3 | 1-| zmgsz|e- 1] zaaza|ae |1 IE saws lg I-| sz838|8= IE nest oe | g-| ssesa|s= |] g| sszz8 ga HI IEEEERIFL ! oo CroG74 --_-- a. Project Number454-104 { iz 2% Bis By { Ii I = IFRAR| BR" = Kegs | 8'~ 2] 832ax x = xzgan Ea x anges an = anR'AR an =| snmes | a~ 3 =| sxgs| av E de R3R8A [an HIE ] "| ssass|a- > EEEER I" RBRRR | 8 "| 88=s3g x fe REIN I "| Rass ]~ TM RISNI | a~ ~| zrecn| an ) zzrzz is a | | 12075 reer a ProjectNumber 54-104 2 LEER a = IRRARR '" = RARFR an 2] s3naz| a" =| xzsan|s~ = EEE EA I ie 1 5i 1: = [RRER 8!" EI EEREEEN A 3 =| nasss| A" E i= EEEEEN EE HEIRS Sf i ud RERRR Ld I ~| assez a~ | 883858" 8" i MEE EEEES x" | * RRIIQ | I * RBS_RI | "'" =o RISA ae =| =az=8 an | sssiz is N2075 BESTCOPY AVAILABLE 2 Fri | 11 = I ielaorr.woo T EA a 00 1 1 n 1 1 n LI) "on LI] C2076 BEST COPY AVAILABLE 33 1 1 = | FEE i | 619077 BEST COPY AVAILABLE = ra 1 mH cn2078 C1079 o Pre) nonss oo croaaz C2083 Cn20534 - 06969696 .- EPL' ERNENTAL PATROLSRSGRATORES TE [A -- enor su . cum ASSFUHA AeRTGIOATEIN. SomARY NGoENGE ThBLESnow scree WotorTILoaT WoERCE Metts ConmGEROSLSMADMGTROOSCaNRGPOHONFG SUMMANGDENGETHBLoErSrsvam sacerce Project Number454-104 oePagoee CORRELATIONOFGR08S ANDMIROSCOPGFNONGS 62085 n ProjectNumber454-104 PATHOLOGY SUMMARY 12G36 - nnn \ EPL PEER PATHOLOGY(BOREOR rjcName 54104 WEOrSLRFoEOyIToNTvEeReNAnsTIsONidAL:oLTsD orTENT nT PATHOLOGY SUMMARY Lohmkroscopcxamiatonvas pada acosoelected h(tiPsocsrueuswofraroroomncaadanulsttsmtdaolnaecrawcnhdic,fhepmraaleescNsioreathvseearlntrb0sob3cwhoi)ntean(nCaohltionfunstovfifreogrinhifeanfuosa)1r5il wSheeeykasc. u0SbeolvewcatteitdeetvieshsrousefsaefkcrtomsauonmtinrneeastcedbyapbgprohoxtiimssastseClcoyorp12sn-.swTeseoke-ogaldbnoffisporofienfg soifs epetrairmyeentxsp!odseesifgnawfaesstsblsoavnceeovert sat soeprc Toe [A| di Ofspins g~ | p |Males |Females | Wales |Fomaies | 18ppmaiPFOS | 62ppmaiPFOS | 51 | 4 5 | 5 | 5 | 5[5 | 5 | * = GSB1rooo7uwu6iltpnegpomnninatfiahPrcFa5OonSnt| 8apdoe15 7cn.0p[ arse1 agreae| wee re 2 5 r tod| or110Sv5os:| C 20R7 - i. EPL' PERENTALPATHOLSEYLBGRATomES WE rj Namba 54104 nt mann 35S emt 510 tMhAanT A,nEeaAnR cdNomDnI pcMertEA oipToinHLeoOsfDStwSerevaprruosmsodcbytWaritt, amfearcmuaobnsiLs ware cSelaecrteid nfraingags,vearnedsaaumhpalreiszwodeartscporlcesctmoatfoery 1c2pwaotohaoefaatgevaogto cbyiWnis10%anmtalnu,feUri.d fSoormlaoasndssesnompeadriitmseanndtoPragnwre Laboratories, Inc. (EPL), where they were embedded in paraffin and made into of`hovelamoawttioanxg:ylsiunuaernsdgfelotsaiinaa-ddsutdla,tisnpendrdseopctvinoinssgoonwgKaliarsesrs`,rmaiscmrnion,sdcoGpooersgldihde(soi. rcyTrheoctyr3,0 rss ofFace, nddpe ase. Insomecase.noprtocsrons povaeleg, and icoscop fing were erie tissues were sectioned along with adjacent protocol-requ rable ired tissues; these were IncidncAetTabtlens. rMocurtoesdcobiycpirntgsoerspaecrstniahriaHmiidftomotne Stites eed nhHispaihioy incre Tans, Morosoares `were graded one tofive depending on severity. Nongradable findings.are listed as present (P) andtissueswithextensive autolysisarelistedas (A). Al findings 1 rSuomumafroAryihnicscihidnhnceetoTfaarbnolses,eoargeobtshsearewninehsthefta naamcbreorpoyfinth hle eae forallanimalsaresummaribyzseexd, agegroup, and treagtromupeinnthte | of GarndMoisesscop Findings ais Tha oni in rose `corresponding microscopic change, if appropriate, is presented iosmre in the Correlation 2. "2638 SEELL ae EPL PERERATFOLOaYLomo Project Number 454-104 Wheart 4 uyte510 ameactadl,fom theros Nosy ardrovdd byWi Als BESULTS and fing ive th arfte esc sy intervals. No effects considered possibly related to test article (PFOS) rss of Fabrics, provntic, `administration were noted in liver, and ovary af ml and kidney, adipose tissue, ore st gallbladder, pants brain, r1ore7ths.ee6icr5oTe3ffooasftpr.ouinmomgfr,s,oolrscissn ftmheaamttaeeslmtsessopeeifxmohafbftrsoipzeroiansgpmoammolaeascs.rseslmnydeirdsoccohsaerasmsciioedr.aaadrobnay heo (17h6ugohmspae.r.mattsoeg.enreseisiwgsnsiovaevndm)asteaerteo ohesthercsormnepeanttt to rosotsyoncshistoavnedwi1.t2a5raym phtostse.tTphsrtoecsteesfesnoerr we S00h1l7o.k6a5l ha1a.rdcemavnorn,pThmeyovcstabneenoafoohnestseertsarenmnry edo Tote of al fring wae eo a the small group sizes, but the possibilityof a test article effect cannot be entirely natsbcausary skoda cdaaoneamofesnp,oamnathgdargesr,ihla esmraalsn rihdrurouneowihpsoosm P(hacyoshmclploaorggeaidatllofIeadcnutlm.t taTehsyteeso)v.ueTrhsnisammaoarppdhroalomogenyswsoafsac1on3nsi-sgtvecnstkweitish ncorrmoealerr hon a | lomessof srs haar15mom secrntnocrspey.Sete foe -- a Co e-- e ---------- ee -- EPL' CERS-RE -- snr--E-- r n-- lh--sn----t--4--i--rri---- rweeerrod------------_------------------------r--ytr] Arorro--rs m--re-------- Io AI.--i--t--n-- ent ------------------ t--aen-- rnrer--r--tti Geoeer w------l-- `normal physiological immaturity in young (approximately 12-week-oid) birds | mFeoreotn mnre, eBter--re r--e n--e 1o0 bo `mean severity were similar when groups from each generational cohort were a mp--A----------------o ----S rdt inflammation`ofadiposetissuewerecharacterizedby infitratesconsisting i rettne mteee--n--v--s--e --rposm --ti s Shs Snlesisonnineavns| `exclusively or predominantly of macrophages, or mixed populations of I "2090 i" ProjectNumber454-104 EPL EARSREE SA. crodaoct.reSaaatoawnachcst anosffcoarianl arStosldiankebarsotphi.l tal daratconncionmseseireestsse eintegshe sro vatyn. dor,raends eli, ar nt apnetne. Cranston tame characterized by small mononuclear cells, macrophages, and occasional multinucleated giant cells was associated with foci of foreign material (deep c`emoaamgmelnotnatiglrnobcu0al1ecs0oaKnt)d.obnriCgu hot plinaka acmoprpshaaouis mgatoehriyarlesconsepiemsrtaeatnntotnweitt'hih ha own oongnamtepgoomnrtanocitosopsrsia kaopcooreyrrooagr,, d Kurcto s, anresm yvpreoe nesaist;es atotthe,ySfathogmimutweert partici ductwer tad av accorfro anton was eto nore 55m i fsa. Ta ofnadlpe omad 1.8 ppm a.i. offspring female. A small focusofheterophils (acute inflammation) , female exhibited amyloid deposition associated with secondary hepatoceliuiar hypertrophy and necrosis. Liver amyloid deposits consisted of amorphous, pale `bluish-violet matertal which filled and distended the hepatic sinusoids, and cone be `compressed adjacent srs hepatic nud cords. hep tychange and || vacuolization. Fattychangedenotedvariablysized,sharplydemarcated, clear | A Vecolzaton are mul, sua st conte, pony damarcatod vacuoles (consistent with fat accumulation) in the hepatocellular cytoplasm. rts. When presentnro veptotn oseconesredosrted . . EPL SERENA PRTOL03YORATORES Pict Nor sis Was Sotrt o"aGftsnWand han pnestet8yowcsnagtecdorresd,prryovomridortsos MacocOattohhae an essed ot vest, wasdogs on WfhillerhesHeppcvatacosocelclalourlnaitr cfrataetytocihboanngcewewaastssonnomtaeldnisn tmheeolirsvenrst.ofoadTuinotsranedetorfofasrprting, bog 2veamentatoct When cantesetrueofeens {c`chaoahtnorghteawenrgmeaclwoeomsapnacrdoeedn,mrciaomdbcictneosd aiandtcidfenrcescooof dvviafrfeusstei,mfvoacea.l,nHatn,dapeTritrpoertoawlafsatty A bt ceawe mt, arthry etewaettrydonate 30 sootmarlianris i ah ott att oad rat `CONCLAUNSDSIUMOMNARSY Sr---------------- T----------, No lesions considered possibly related to test article (PFOS) e`agualtlbnlmaaddleert, ovaorrfy, apniirdibenrgaeidon otfdsaedeu,let mTsaelsestaenaodfftemaaliegbhnobdwdohvietde(orat7hae8iro0ofatfm1spring, dS`crooennrsiorsmteenntewnyi.thTeheaerlycpoosnt-raepnrToodfucetRivesprhaTsce AregareEssiloRan,nyaannooremtallphveysiomolso8gi1cal i ier uteprayoe te ate rleit Too oe "2082 - OO Project Number454-104 EPL' PERENTAL PATHOLO0Y ASGRATORER I Waern Src [ cr eirt u TEI CIETS sottetod wile (PFS) aamiaraton. F17T7 GENUEBSELNCVJ, PAD, Dio AVP Veter Pathologist wor 1jrs/ol is u : n2693 - 00 rj Naber5104 EPL PERPHATHOELGGYNLABTORATOARIESLTe QUALITY ASSUFNRALACERNTIGCATIEON Sy Th: PROS: Ait RoScd winoNoi rhrsn Soe Clots: 454104 EPL rot mba 212026 EL roftConner Margaret GPLpags. Or. Hapa. Got eceonrspactesosSfPsesttyweeere sspSpeaccss bryacerQusutvyye SApsseoumrcstsf ou Area Inspected inspection --Reporing EPLrioasrons wi sco JR. Poms sar oan Howoorsws 10210 woe Coto ronson _ ounwot razon wna ra F-- oot 12am _ On an try ctr son Te -------------------- } e Boa d t b de sen w | sommes . "2094 _--mmmm-- -80- `Project Number454-104 `SUMMARY INCIDENCE TABLES ADULT SACRIFICE : C2095 -_ Ei . SE sarwee oie WETFOSEF550 (vo. xavmneny |(5) | -- -- -- Hear [Iafilteate. MononuclesrGell [inflamation, Chronte | | ------------| [nflemITatfoRn,GTraEnulommtows J |e [ rry | ee-- e--] ---- ----} | frbm F m earlere Erma] mo ba m o at = [forcesForeignMateclal [|-- 1 ----------| [eoOnRdE mTaRtoEnEyS----e7 ee--rtp[ --r --e pm--ermte--ete}f--orr --e r) ] He s e [IafiTerate, Mononuclear Gott| 12 Ff ----------| breemy C [Crubules, Vacwoli fastion 1 m ----a --------1--] --A----o| P Hi e e [Hepat Fatoeyc Chayngts,es| FF m re + re + {Ty F e fret. |-- m {Jatiltrace, Mononuclearcell[5 Her o IgDoenet position| 1-- -- ttf | 3{1 ----1---- P || --CSrearnocslso,mIsnftloanmsmation,f | I---- p beams [[IROaVfEi- NlTeReIaCtULe-- U,SMo(nWoo.mcEt XlAeMsIrNGEDo)t ll[ |3 (T 5) | |( |[ r [|1 ------ -- -- t RR C2096 _--_-- HAaasdluie-e1s0o0Sbuecneiseteica 8. `SUMMARY INCIDENCE TABLE Project Number454-104 [[Rlealnfiifeeaceousw.sWtounboamsleelso,mr Gott |opuemesd blamater [ 1 1----1 --7 -- 1---- ---- ------ ---- --] [em-- stogenests-- r 5 ps t --p --] ------] tr ----F r r r) r ---- T t TT F 1 f rt 1 r rr rr -- rrr rrr --f--fF--F--+ 1 ------Ff -------- r rr rr tty -- sees + | rr i r rr r t rr] | | tbr 7 1 r tt r t Hee rn 2 T---- . rena _-- FAredmieatlneSBacorimtbicee -. `SUMMARYINCIDENCE TABLE ProjectNumber454-104 pepe [[FaRiC fnoflsisTaeimcnnetWeat,coonW,rotnahorem--osnetT--eeme--co--rr 1 S { 7[E 1 7 T 5 ---- ---- ---- -- -------- ------ -- A ---------- ------ -- | JE B i y sm SS : -------- I bT eer oa s------ --+ --+ ---- + AE--] -- --{---- Eg [[Ilnefciolo eecssCeFso,rtN s ViomoW tmaerleossieerc--olc l-- 5 o x--t {----11--T------ ----------s --------------n 1 ---------- -- ] ----] [ee[rFsosermeoTrmms,oaIrtamfofnomsaclon, 1 -- r 5-- --p--------r --p-- ------f--pr -- --p--------]} [[FEasrbeslCetsseVT eancuaoTttlm oaartloen cr o--rr Eros ------|-- ---------------- ---------- Em ma e [fC-- "Eaaritsetroea vpetse. sX p--rT irFm-- s| --A1 ---- T-- ----1-- 1 ----1-- -- I F [opeem eresst wee-- s ampe=,f--o ---------------- [T T pbir e cun Z--er ----r ----r -- EF[[iFFoSr ttecproomsmste. fFmoap arfzelpiangmpnamt-- aiet etrne,essa-- ele l[ 1 --3 -- -- E1 --S ------ ------ --------------| -- Pb[St Y eaesrGer.FoB oreloymae-- asta-- r [--t 3 F |[ m ----t --T --| --1--------1----]-- A Ere -- _-- r Paesata-i1o e00Sowr niss "~ `SUMMARY INCIDENCE TABLE Project Number 454-104 E PbC rRYotveC oEeTeR,TTonffemme-- itpono ,m----1------y 1-- ------ ----] -- --1---- ------ --| [efileesce,RemomscloarGott | 3141 ----------F----] E-- -- F m -- r -- -- r -- r -- 7 -- r 1 -- --| ------ t E------ + ---- -- ] 1 1 -- F FF 7 1 f 1 1 r + ------ r t rr t r r t r r 1 t r r r -- r -- rr + t + e r f] 1 t Ee-- -- ---- -- rr + tr 1 + . r g --------f---- --F ---- -- t EF E --E r r ~ --+--Ft -- ] ----+-- f ] -- -- 1 -- 1 r r 1 ff t t 1 -- r --t] + t-- + 1-- I A Ere --= n2a09 "85. ProjectNumber 454-104 HISTOPATHOLOGY INCIDENCE TABLES ADULT SACRIFICE Cn2200 hEnn . ---- A p a ---- : p-- erm-- e ----pada ie p LL e Flomimtaertar------ atheros FE [iafiieests, WonomicTearGott 1 11 T1 TT 11P1 r111111 11 1H [le terms HE Inflammation,Seenlomtoss {11 TT TTT 11TH rrr PEE pu x EEE EH fE m R (SAOFaIes (ww i 5A www ww A A E eT S---- a 3 [affiesace, Wonomelens Gall 7x1 I [3 33 131 af ta | [feross. ForelgaMatectal [FResose. Inflammation, | | [1 [1 l [T1111 1 {TT T1111 f--eesmelomstons S 1 S 11 11H J ee {--Ifieeae, Mononuclear oT || [oar ETE T11H 1H 1 [Tubules,Wimerallastlon -- |Tubs-- les,Vaew-- olization |[ || [| 3 T1T3(|1 I 11 T5 T1 11 11 1 1 ES Tr rrrr 03 Fede bepoattton -- FH omme tdie e Co m {BileDucts, Byperplasts [1|1 |T [ T T T T 11T 11 p e {Eepetocrter, Fe Povey Change, O |T rTr TT TT T H 1111 1 Hepa7 cocyeas,S Favey Change, Y |TT TT TTT TTT [ [Ho spb atoicyttess,Bpererophy, T | 1T 1 TTT TT TT TT TA T1T TH [Hspatocytes, Wocrosts, Foal [Iafiieate, Mononuclear cett | | ITT TH [3[33] Jo ira 1 [Elmont Deposition __-- [Escous, ForeignMatwrtar "TT Tala | [TT Tart TTT TT TT | } [Seross, Inflammation. _oralomstons JT | T | T TT TTTT TT TTT TT T T 1T 11 T 1 i = TE EE S-- S ee . n2301 _-- EBnl:e in rss Heromsmi2 oLoaY ca oercaeTae ; I wan------ et-- ic-- Er reer E EE Hee (eae Rates WesmactonrGott I [ re TH [|roRpeimeisnrlefaeereodusSmhabmoalteesr, TTTTT TT r T1 H 11 H 1 |T [opemstopentsis He ---- (FRIESE {elle H rrrrrr rH rE rrr rrr rH rrr rrr HH frtS A -- -- -- --Ar S rr t rH eee -- S rrr rr rrr t| ES -------- Ot ---------- ef 1 ii ---- H rrS r rrrrArr A i ---- ---- r r rr rr rr rrrr rrr rr eH H rr rrr rr ' -- ------ --------------r rr rr rr rr rr r r r H r r H Et rrrrr r rrrrr rrrrrr rH oo C2402 En -88- Jo-- arT -- am ; SS Pro Em pLadp e Feetmbecernt [iaftisrsse,WososclarGott 1 roT rrr v HHH [iFeFfileatemmaattlioonn,, oGhesvseunliocmstons 1 ||v + mr H fmrorsme {belvethh pw e y L BY EA haats EH mt H eetel Se pee r SB ee -- e A Et [[iRoersoouns, FIonrfaltagmnmabtaitoanc,tar a T{T TTTprt HH S-- yr 3 0 A tm | i ---- 3 33 3 mm | F a e CE a fomwm LCE S-- TY rrr tm | Plsme e [akey Duets, BypesplietM s -- {Iv YB TT Fetter mmm ee 33 2.3 A tt EE Fae ee LT rw 0 THEE Fite [Eepacocrtes.Fpertrophy, SSSITar Ts IT 1 1 T H [ipstoLcCeeS r.-- Wec-- tort-- s,F-- oa-- l [1 Ix YB ofTar H [[RFelamfaiTneesdee,poBsointoimosnciost Got T[TT xf Tr ol--fats--r H+ EH H LTN-- 1A 24 Fe i AEtz RPEns "2103 E Fm n . re are04 WaTopATg aoLr00YWom ERCEanABLE ; pati eLd LL aacCIeTsYFCoItTgTaL taC teY rtaS r -- [TTror(Tr HH ET-- 3 ES 0 A | | eS mT ree corr IoTT EY NEE YEI EEH rr -- EE -- ---- ---------- rrr rH| tt | -- rrrrrrrrrrrr EH EE-- ee -- -- ---- ---- -- Tt A -- rr rr rr rr rr rrrr rr rr rrr rH rH -------------- SS rrr 0 rer rH re rrr HH E -- E -- S rrrrrrrrr ee F e ---------------- e -------------- rrr rrr H e re e en Pe ---- SH A rrr rH ee HS A ------ ---- ---- r r r rr rr rr rr rr r r r H r HH r -- rrr rrr rH t fe e------------ Rt A a RR ene n2i04 " Projct Number 454-104 `CORRELATION OF GROSS AND MICROSCOPIC FINDINGS ADULT SACRIFICE i-------- ras05 |i] NHl| i : } | 33 i i ACARI I oe---- i HE bi2 . BESTCOPY AVAILABLE no307 BEST COPY AVAILABLE EL rider 722.08 n2309 n2310 B cro22a " ProjectNumber454-104 HISTOPATHOLOGY INCIDENCE TABLES OFFSPRING SACRIFICE 6no3aR -_ Nala Boenite i. Projet8 HSTOPATEHa OILOGY WGIOENGETABLE arrp aamm 3 [OTRGRE FIER [Infilecate, Mononuclearcert Tere xXx[x] {x | [ [| [| af XXX[xX [XX] | [TTT 11] [Iofismation, Ghrontc |-Zofissmation, Chronic Active TTT] || | I { [TT | T Tar 11] [meralisstion pP ret E [reeests TTT TTT TTTTTT TT TTTIt TTT: TT pmm r E E Raw EX Ix ee fe Ire ax xa [bE rmreemee m m E e Ee Ex Eb am bebR e m ue eo EElr nr Ers LeH [Or RTELDDER e IT xl y [xe =trfIrx=ifra=ye=|x= ]~x*{i l =}xt=]] ~x~ ix"] ee jInfiitate, Wononacteaccori | | 130[IT TT[ IT 131 T 1] fay jnfilerste Wowonwclesc Gel fei || | walxx Te [xa]xx xx I [I [3] TT [T1111] [rC ebules,p Wineralissp tion p I| [l 3-- 13 t-- tt -- T {-- af 1t 1-- t 1y 1l ] pe fBile Ducts,Wpperptaeta rrrrrrrrrrrr |1 [ |[T1111 ([eupO sitotcytes, PattyChangs. T | | 1 I | [TTT TTTTT Ts11111 [Eepstocyeer. Faciy change, Fetewarms Perel | | | | TI Lr ITTTT T1111] rr re EFesstmm ee H HEeHe EHeE folie |--Iafileeats, MononuclearColl Erste er sr [31[11[1 Dx [aaa 11 O TTTPT SNSS S OO | provements |x rT x jAnfilerate, MononuclearCort fee [TT(7(2 | [x{atale( (ajaja aa] rrr rrrrrr fi] pom fImstuee -------- errer Ter --IFIF Flee (FF e(e][PF[FIEIEl [FIFI] f--Infiltrate, Wonoawelear (pigmentConcentration Gott || I | I |FIFIF Fe] 1 {af | | 1s7T1311 1 1 {vlvv]v][PlelP[F[pl 1FIFI] M on r i SEEemS , a. n2323 _-- OrpferaudpeleeminSgovesnuicsceifice Projct Number 454-104 HISTOPATHOLOGY INCIDENCE TABLE caoomo crpoSn aenzon s PF[iT FaElfaitElimtmrmesC ssfeEo,nW,GohmemomnetC teedseecomre |I | 11 [ C-- 1 Pr TCO e 1a PH PfC Ee sEeisscis ---- e A O e A A FOB OEEE OFmes-- -- i {x[www ee eew A xee w i A Ea a e EE e r C eT Cm TTr W t m ewer 1x 1y 1eH| [FE reC balesr ,bfsecats isstia os |[T 1 E r ei xa Ae er| [[tFS E ieepatemcepettesr,Fae cey htansgs, m r [ pe r 1 TTr T FF[rr leimetepeCTaFpesveeTreramvamscss,er| eP ns,s {rrE r P E H E [EP epsT iecytes,S Wi aet-- trC ae-- teT n,--t W[8 1 t T e 1 Hr h] r CT fo B ---- fw B EE P [e poem=me-- he t se rereeee [eit-- s me-- ereo rebeleea rT H Ere va opelFeoCoto ingress BERR i C7244 SN -100- Pro WsToPATHOL0aOoYnWoERCE TABLE Hi ; F Ee Hee be e fiatC iieTeaY tsC,YMAomeC nseles-- relt | O [110TT 111111 A | fPliefessrsoasltlse= sion F 1T T r T T11H 1111+H pe i5 Ix a (REAOrme aHS bel x EE Ew TH A me fe EE [afitesacs,WonomctoasGait {3 {37 [1 arHTT tS 0 A 111TH [laeiterate,Sonomactons Gax ta | e 31To CTP TTYCS S-- TH TTT 1H 1A EL (ieee pperptaete A |R TTTTCt [Bepateertes, yatty hangs. falta {TTTTT TT T T1H TT rT HH |epacocyees, Fatty Gangs, frat em |TTTa I TT rT rr T1111 [Fepatecyees, Pavey Ghangs, Fr arma tena I| [TT TT TT TTT 11+] TTTTTT T1H hemmr e EE foDiffuse -- TyrT5T7 Brrr rT EH [aflmstion pests 111T rH py mses A rrr rH| C S --O ETB RE eM PTT UT TTY EWEW 0 0 3 A| rrr 5 rrr rrr EE r ESrrrrr ne Hi EEE, seE m se n21a5 _------mmmm mnm "101+ ee Project Number 454-104 : CORRELATION OF GROSS AND MICROSCOPIC FINDINGS OFFSPRING SACRIFICE Cnossg I iN rot--i-- i Il : $ BE . 3 |8 La{reLn Lls p51i3EahEEsE) .: i 11880 Pi4[laleyJolala : [TTT cno3a7 [-- ns v EE 18 HAE SESE Li Tgoala|l| lda | HE dd dd : pi3]M2E]EiaRsEE |i 5 :, : i1 TTT 23a8 --- n2419 C2420 v cnosra [oe 72223 109 Project Number454-104 8] s2858| 22 g| ==288z | gz== J oa it SIE 5b-y3H1ogi Ti oo:men i Joi i 5] szzes| 5: 3 Z| nemea [gave | of ceeio] ant | Jen Af mene] E5 en|i | sess Ris 3 -- n2arg 0- Project Number 454-104 5] seszz| ss i EH IRAEELN 04 oHfl] ] LAER] eae R 8 "cee av HIELLEERS FEN 3 C airs _--mmm-----mpm-- Project Number454.104 2 3 LE zea 8% 5.23 BEE Brug is By ~g # 2 8 roa [a vo 1IG1 Ber Va 1 ISE va Tlel ra va An [NE EE 1 Imp Va Bdal | Ill a I ool I [I vo [I va [I] | va mez==1 wed a Coos -- gy | [ msmnn pan yo 1 a conmol mn 1 1 va Sa [I | [I 1 [I x[ | Vo emrne gaa g | "a camwnan n1l .31 | 1&1 wovmel oun 141 1 1s =amve mss isl wz gry [I [I [I C2106 3 PRE TEE Tad C Cra1og --- "21,9 _-- 72230 ---- 72231 610332 6792133 --- cno534 -10- ProjectNumber454-104 Adal LiverWeigAhptp(eg)nfdrioxmXaINIoIrthernBobwhite Pagel PilotReprodStuudcywtitihPoFOnS --_ Con(t0-- prpmoa.li) C --_--r_e-- n MLaiveer FUeiveere onmm 3260 2156 5210 a6 w PY suamm s2e5i0z8 0s 3081 a1 Men su02 et5 SD 0.446 1298 _-- --_-- --_-- L8ppmai --_P--e MLiever FeLinvesr Ue 006 37351601 78305m6 u9n 3s0n96 oS7m4 210 2887 4016 Mean EY as01 ost oLemss _-- --_--_-- 72135 2 Project Number454-104 Appendix XIII AdsitLPiivloetrRWeepirgohdtuc3t)iofnSrtouamdyNowritthhePrnFOBoSbwhite Page2 --_-- 62ppmai. --_--Pen dLiaveer Female Liver a 3552 sos2 wm 4308 a 4078 son sa04 2 2591 as 810 6246 sam Mean 3684 0686 se 0305 --_-- _-- --_ 176 pp-- mai. -- -- Pea --Le iver FemLiavleer 2 3056 880 a 2076 218 2505 4167 6768 219 2625 2 2378 6131 8329 Men --_------ 25m 6851 0359 1880 -- n2236 - "te ProjectNumber454.104 Js snes Je] zzrzzzazas ge 3 i susan je i2s% i | i i i "lel sSEzEaLsEpEEoEzEsLeEnN LN 8 #3]Pl =zsAg3s3z3sTs3s2s8g)| 8gs8 i3 z= 5 3 El %8%sssasss i i 4 J12 raszasssaales i|; Bel srzannnzas ie | ------------------ BN n2137 i LWEildY lifeIInntteerrnnaattiioonnaal,, LLutdd,, Pe rojece t Numbe er454-104 AppendixXV ChaoSntudgy Preotoscol thefol"lTohwiisnsgtuadymwaes cnondduocmdtededviinnssttcocnsas:dncewiththestdyprotolsgasdoaFebuary28, 2000and 1. sTahpelpirnogtoacnodlwlaisminaamteedntdeedstepoairnadtiiocnatoefehgegsshewloluldmbbeeshelrdormeftihgesstyedunlseparstedfor 2. cSTeaheipcrooltlsoecctoelopdfwdabuysroiimnnecgieWnneedraeetdkdiotsno.1,re3dauncedthofuthmebeert.ofEeggggssccoolllleecctteedddfeorisnlWeistfsro3m4ial gg, 0 3. CTophrieersppiroocntpodecioinlgawyda,tseatmeetncdoendcetnotrcathiaonnsgweetrheetcheantgseudbortoamce0p,u5ri7ty40fdo0m p9p8..91%f0o0,502.450%, 4. `TWabhemateeecnpkhdr5iomn)teg,o.nectgoglAlswdaowdisotudoaleamdlebllneyedtcehotdlehltaeeomccietonnendddddiimatceiilnotynttsfoaoifrntidcfnioccgruatb8ealsdtoivboarents,nc,hhdaiatoiycgnhspciuewnbroagituaoilndonbdd,ebrgeehaiswrniiinnqiognugogtfMsyaonfrdfcstphr3oi1nog.(Tnchroefy `weighed ahtch30dat 14daysof ag an isedreproductiveparmtes6bosKso.nia 5. bTehceonlolcercotpeadyfsreoctmiaolnlorfetmhaeipnriontgocsotluwdaysadaumletnsdaenddtofrionmdic1t0aoftfpsrtingiinnateiaocn,hstepstlgrowupouflodr s`thoisrteodpaftrhoozleongifcoalpetxeanmiinaaltsioonl. iA.nyremainingtissuenotfixed forhistopathologywouldbe 6. fPTohPruecppar0sco.thwpoiceleonllawbwetoacuetslnbadambgnereinorzudepeecaodtratdolehadceatcncfdadoeugtroawhfsWeaeewkloesrtk.lAdp6bad.reDtuudorinisobnpifgortdsthsehedenotfeh.dxiyAc1vafe5oirroantnh,dehcw6oeon4mtuprodoogrlahegrrvouo1pfeaoenosnded1e6rr.sy3 ocoWflWeleectek6kb. Ao6.ddusAladmtdpisltebosifndaoslm,ntthee c1ao.mn8eon0dldmger6n.o4tupprpeaqnudir1ie8.ds.3cpoolcead. nerooftuFrwaiebelrgrsoeuppiaebinsstaotsaBsnetfeeoorf oss necropsy 7.AsTAphadoderripatreniooctnoeacloUllynivtthae1sa2Smpdoenn3sdGoreo'dosdtoeiLpnaedbisoccraatiteoirtvhyewrParwscicactea.hcaonimd1prneapJonorg.tbfwsooaNulldrebeepwsouseiwtseodiktbsyApohbereaQrumamolinst,y 8. Tsheptearepartodetlyoe.colRweassaumoelfnotdges,dtloionddiacnatdetainsasluyesaensaolfyseegsg,abylovoedaamnedntdsed siamnplbesewilnlbehreoornid cno1as 14 -- Wildlife InternatP ionail,, e Lt,d.NamberPrss jctNe umberi 454-1s 04 Appoenedis3xXv Chato SntudgyPreocse 5: Tihffeepraocteocsoblwevaesemnenrdoesd.oad sais! lyse ofdata odeterminessisicallysignificant 10.oSasftpudeiaynogmfawnfediprsneoglrwmeiedsfeerseztnedonts.cppAurpborioemtdoact,ollyaw1mee2gnhdweemdeeknsstnowdfadisgsapeoopsprerideooprfatroaebtdeii14ndgtyicmsusobfewaesgee,,nwIonsteeatdse, 1.cPTroohntceoecnoteulsitaomsneusnbdsmtcaehnnactnegweapdsufrnotomy pc0rh,ia1nc5ge,edd64nfaaionmde91l80y34pn9o%rrtaoio8rI6oi9%0,.c1h.a5r,Co3reaspnotnd1i1ngloy,pthse tex 12.aAmdedniddmoennata(d0uletxtbeonddytweeitgehstt imneaadsveurrteemntelnytdsiwdenroettsapkeecni taWeiekos 6],8,bo1dy0waei1gh1tomf ehemteet.sThe 13.lEagtgesdli,dogsn aJiodloy n,l20y080,(2D0a0y0w4eorfWoeuenk1d9a)nwdecraellietend awithdevsnoeikcdroountteeedoalnnodcntoslnlglectyed. _ PANS Wildlife International, Led, 12s. Project Number454-104 PersonneAlpvpeanldivxeXidVIhe Study manageemaetntoofpiisngdyk,ey Vidi neroaicol, Lid. personnel wer involved in he condcto Avis Tosicology (0) Mark Jaber, WideToxicoogis @) ) JLionadnBRa.. MBietacvheerl,,DManaigeAovv fEicaoTto ooxxicpo, elroagiyons (9 SDeiasnn'a.TeGamlpllaeg,hLearb,oSraitorryBSiuopgerivsi,soArven Toxicology A0u)liWcaillClredB.miNsixroyn, Ph.D,DirectoofChemisty @ Raymond L. Van Hoven, PD, Scieatis, Analytical Chemistry || n2340