Document Ya8E3qjyq7YZQqL7VvLek9n8

Taft/ 425 Wau Set, SteC18n00cCinCinval,naONC4o52e0n23s95/7DaTgooln51n3.a3n81a.p28o3l8/FNx:or513.e381.0TK20e5tntSuctkyotrutoweHaollstSecreUogP SRooigageuArsaBnmcoorne 4226-3928 February 4, 2010 VIA ELECTRONIC AND U.S. MAIL SUcSoEttPSAheHrelaodcqkuarters Ariel Rois Building 1Ma2i0l0CPoeden:nsy7lv4a0n8iMa Avenue, NW Washington, DC 20460 28 23 zu . = 5z un " Re: AR226-3820: May 29, 2008, Letter To USEPA And ATSDR : Dear Mr. Sherlock: Pursuant to your request, we are writing to confirm the non-confidential status of the documents attached as "Exhibit C" to our referenced letter of May 29, 2008. - At the time we submitted the letter and its attachments to USEPA and ATSDR, 13 we noted in Footnote 11 to the letter that the excerpts from the deposition of Michael McCabe included in Exhibit C were all "non-confidential" and that "although several of tcohnefiedxehnitbiiatlsittyo ctlhaeitmrsanosvcerriptthaeroenmeasraktetdac`hceodn.f"ideOntniaJl,u'lyD2u2P,on20t0h8a,spsuirnscueanwtittohdyroauwrn its request for additional confirmation that DuPont had, in fact, withdrawn its confidentiality claims over the exhibits to Mr. McCabe's deposition transcript that were attached in our EcxohuinbsietlCe,xwpreesfsolrywacrodnefdirtmoinygouthaatcDoupyPoonftthneo Jlaonnugaerrym2a8d,e20a0n8y,cloentftiedrefntrioamliDtyuPcolnati'msover any of the exhibits at issue (extra copy attached). We also explained in that July 22, 2008, e-mail that we had actually `received from DuPont copies of the documents without the confidentiality stamps." On January 26, 2010, in response to your e-mail noting EPA's remaining. questions with respect to the whether DuPont asserts any confidentiality claim over the documents included in Exhibit C to our May 29, 2008, letter, we sent to you an additional copy of Exhibit C that included versions of documents previously marked "confidential" by DuPont, which we had since received from DuPont without any such confidentiality designations. We also requested that EPA replace the original version of Exhibit C with this new version. --_-- Asoes" CONTAINS NO CBI ef ReJas/o Scott Sherlock February 4, 2010 Page 2 After reviewing the revised version of Exhibit C that we sent on January 26, 2010, you noted that one or more of the documents still contain references to allegedly confidential information and requested written confirmation that, despite such references, the materials were produced to us without any confidentiality claims and without any restrictions on our ability to use or distribute the information. In response, we have discussed the matter again with counsel for DuPont and Mr. McCabe and can hereby reaffirm that neither DuPont nor Mr. McCabe (or any other party that produced any of the documents to us that are included in Exhibit C, including The Weinberg Group)), are asserting any confidentiality claim over any of those documents, and are not asserting that any of them are subject to any restrictions on their use or distribution under any Protective Order entered by any Court overseeing the discovery process in which they were produced to us. `We hope that this letter clarifies the non-confidential status of the documents at issue and permits EPA to move forward with processing the materials as appropriate. RAB:mdm Attachment Robert A. Bilott . ; 2L0i2b4e2r9a3.09S9cones Inemmesasepioccom STEPTOE &JOHNSONur ATTORNEYS AT (AW pa FEB 01 7008 1W53a0sChoninnecgttiDcouCnt A0v0e3n6,17N9W5 Tfero2002e2.422e90.310e00020 January 28, 2008 VIA EMAIL Debra A. Donnelly RC2oe3rg0biesNt.tteMr&eadrWkPierltocfSeotsxrseieotnal Reporter and Notary Public Wilmington, DE 19801 Re: RicharAd.Rowe, etal. v. E. I du Pont de Nemours and Company Civil Action No. 06-1810-RMB-AMD Misty Scott,etal. v. E. I. duPontde Nemours and Company Civil Action No. 06-3080-RMB-AMD Dear Ms. Donnelly: McCabe`,ThwehpoasretideespaogsrieteidonthwaatsDutaPkoenntownoDuelcdermebveirewt7,h2e0d0r7a,ftantdraRnsocbreirpttsWa.ndRiecxkhairbidt,s,whfoorseW.deMpiocshiatieoln `was taken pCroomtpecatniyv,e ooCrindveiDlrescAiecntmibtoheenrfN1oo2l.,l6o2w:0i00n67g-,0c5tao3s0eds;e:sRiigWnciahltaelrtide4a.sRmt.RiomRwoheno,yd and exhibits eest,ael.tavl..E.v. I.E as confidential `subject to the .duI. PdounPtodnetNdeemNoeumrosuarnsd.and aCnodmpCaonmyp,anCiyv,ilCiAvcitliAocntNioo.n N0o6.-0168-1300-8R0M-BR-MABM-DA;MaDn.d Misty Scott, etal. v. E. I. du Pont de Nemours DuPont has reviewed the drat transcripts and makes the following designations: MMccCCaabbee texehsitbiimtosn:y: NExohidbeistigNnoa.ti3o3ns(Bates no. 087-0164-0001748 through 753) Exhibit No. 57 (Bates no. 006-0133-0135635 through 652) Rickard testimony (30(b)(6)): No designations nt DJaenburaaryA.28D,on2n0e0l8ly * Page? STEPTOE &JOHNSONw Rickard Exhibits: EEExxxhhhiiibbbiiittt NNNooo... 87(9B((aBBaattteeesss nNNooo...000000443---000222133966---000000000664534068050ttthhhrrrooouuuggghhh5970016))) Exhibit Exhibit No. No. 14 (Bates No. 15(BatesNo. 000022--00223355--00000000165280 through through 71) 27) Exhibit No. Exhibit No. 18 19 (Bates (Bates No. No. 000063--00123336--00100003764789 through through 83) 56) EExxhhiibbiitt NNoo.. 4312((BBaatteessNNoo.. 002126--00223336--00001000162765 tthhrroouugghh 615474)) rsheeceetisp.t oBfotfhinawlittnreanssscersihpta,vewerewviilelwreedvtiheewtprranosmcprtipltys,foarntdhIsheacvoerreencctlioosnesdodfraefxtcceurrtaetanosthaeertisz.edUcpaotna "Thank you Sincerely, min De LibrettPa. Stennes Jf cot Enclosures cVeI:A E-RMobAeIrLt AA.NBDiloUtS,.EsMqAuiIrLe Joseph A. Osefchen, Esquire VIA E-S7.MhSaAtrIievLMe.n Blecher Justice, , Esquire Esquire Philip Stephen Fuoco, Esquire David B. Byme, Ill, Esquire RL.arErdyiAs.onWiHniltle,r,EsEqsuqiuriere `RSotyephAelnanP.CoDehNeint,tiEss,qEusiqrueire Lf mr January 26, 2010 Scott M. Sherlock USEPA Environmental Assistance Division Office of Pollution Prevention and Toxics 1200 Pennsylvania Avenue, NW Washington, D.C. 20460 Re: Taft, Stettinius & Hollister May 29, 2008 Submittal Dear Mr. Sherlock: In response to your e-mail to Rob Bilott, and as we discussed, | have enclosed a revised version of Exhibit C to our May 29, 2008 submittal (without the confidential labels that appeared on some of the McCabe deposition exhibits in the version of Exhibit C that we originally sent to you on May 29, 2008). Please replace the version of Exhibit C that we previously sent to you with the enclosed version. Thank you very much. Sincerely yours, KIW:jl Kathleen J. Welch Paralegal es CONTAINS NO CBI rlnf FA RICHARD A. ROWE, NICHOLAS R. ) Page 1 ! i ;: 5. v0 vans coe, :| and all others similarly situated, ) i ten--E ; T ne | v. ) Civil action | LLP, Hercules Plaza, 6th Floor, 1313 N. Market Street, | ELrr -- i 1 APPEARANCES: 2 3 TRAORBTERTSC1i2Tn5EA.cTiTWnIaBnNlIaInLtUuOiTSt,T,SOtrhEHeiOSeoLQtLU,IISR4TES5Eu2R0i,2te LL1P800 ` "and Ss ` WLIANRTRYER50A.0JOHWVNIiSNrTOgENiRn,i&a EWSIStLQrLUeIeRPtEL,LC East ' 0 UCPFhn.o0air.rtleRedoBswotxeCoenn2P,t1l8ea7WriensttiffVsirginia 25328 5 10 PHILIPR2F4aogrSdWToiSEnlcPfkoHitiEetnNlsdFP,UlPOalCiaNOnce,tewifEJfeSsrQsUeIyRE 08033 un 12 LSTIEBPRTEOT1ET3A30&2.JCOoHSnNTnSEeONcNNt,EiSc,uLtLPEASvQ_ eUnIuReE, NH 13 Washington, D.C. 20036 u - 15 16 10 19 20 a 2 2 21 ? Page 2 ! |} |1 i{ || || || 1 | || [[ !| !| 2 record. ns rage 3 } | 7 Richard A. Rowe, et al. versus E.I. du Pont & Company, | w Come ox the Flasncice 1 | 15 the stenogsephic corona. 16 Friday, ecenser Teh. 2007. i" 20 vides specialise ty mane eon Forte ice Video Becges, and in Claymont, 1 am the Detsuase, n 22 Corbett witcon The couse reporter in Wiimington, nd 3 bs domly from she will mow svenr tn i" -- ~ | | ps esa ---- 1 uw. MrcHAgL HechsE, 2 having been first sworn on oath, was 3 examined and testified as follows: . I T | | | . [Er 7 8 we. itor: 8 Q. Good morning. 5 A Good morning. 10 0. Hy name is Rob Bilott, and as indiceted, I am 11 one of the attorneys representing the Plaintiffs in a 12 Lawsuit styled Rowe, et al. versus Dupont pending in 13 Federal Court in New Jersey. | 1s A. I'm Michael McCabe. 16 0. And what is your date of birth, sir? | 1 a ase. 18 0. Aad your current residential address? 19 A. Chadds Ford, Pennsylvania. 20 0. The street address? 21 A 4 Nomandy orive. 22 0. 1s that your home address? 2 A mats 20 0 Are you currently employed? 1 A. 1am. 2 Q. Who are youemployed by? 3 A. Self-employed. 5 which you operate? rl | i | i - - p11 , vr a erPage 35 }: 7 core | 2 particular area of the country that you were focusing on | 3 as far as developing? | 45 mitoriAc. proIptervtaisest.he Mid-Atlantic region. It was i | 6 Q Mid-Atlantic region of the United States. | sa ves 5 0. While working for Senator Joe Biden you were a 10 senior adviser on Delaware issues? na ves 12 0. Ts that correct? 13 What was encompassed within "Delaware 14 sssuesTM? Anything in particular? 15 A Everything you can imagine. 16 0. In 19 -- excuse me. In 1995 you became 17 Regional Adainisteator for U.S. Enviromental Protection 168 Agency, Region 37 19 a correct. 20 0. 1s that correct? 2 And you remained in that position J 22 through August 3rd of 2000. Is that correct? t 23 A. hat may have been the actual date that the, || 1 position. : 3 referring to. Correct? i 4 A. It -- it might have been. I don't recall. | 6 Adninistrator and was no longer the Regional | 12 be the Deputy Administrator. Before that I was Acting i 13 Mdniniserator. | 18 A. I believe --- was it January in 2001 or - - pis --_-- rage 31 || 2Lo.ne boidmeyoru foermmainy business entity at that tine? || 3 Q. Did you begin -- | 1 A. 1 started my own firm. | 5 6 Q. A And what was the name of that firm? Hcabe Aesoctates. + | | TQ and have you remained involved with Hecabe Associates continuously since that tise? sa mats correct. 10 QT vould Like to back up a moment and go back 11 to 1995, when you becane Regional Aduiniscrator fox 0.5. 12 5h Region 3. Okay. Gust verbalize. Okay? BA es 1 0. okay. What led you to the 7A ac that pein 15 in tine? 16 A ac ied me to che sma? a ve 10 A My background in envicommental Sasves. 19 0. nd that backsround involved ~ included sous 20 ork with Senator Biden in the Delavase --- a a comet. 2 a. tssues. Ts that correct? Boa ve 2 0. had ere you asked by anybody to seek that | 1 that included Dupont. Correct? | 2 A. I may have been. I don't recall specifically. i B Q. And why did that lead to you leaving? | 7 administration comes in, they generally move out the old { ------ 2a oie vo eo te isos brs sh scam A. 24 A. Through various contacts. Ms. Fisher was well - - p.15 2 Administration, had an outstanding reputation as someone | ron | 6 Q. She was a lawyer at Latham & Watkins. Right? | 220 nor ae pon 1 0 at yen ever worked with her on any reset ac | 10 ou con do iter you Sats. th Been? 24 Q. And what restrictions are those? r | 1 A tous gen to have to tuk 0% We 0.5. Cote | 1112 ootf vthiienrgs you could not work on for a particular period } 13 A. On issues that you were a principal | 1154. totam decision-maker on. 200, you b-ag workin, shenah 16 McCabe & Associates, for Dupont. Correct? i 15 then 105 me este che. 2 vo. sven: oection to orn. | 1 avestions Page 42 | 2 ve wn. soir, ; 5 a whensthe first tine you started any } soa am. | 6 0 what ted to the initiation of those | A Twas contactebyd an individsol in utenti | 1 believe vas working on the amerging PRON issue, and 11 might be able to help them in this area. La mde was chase :| 13 A It was a combination of individuals. I | 15 Reardon, and possibly ane ox uo others. 1 done xecal. | 16. nd the individusie you Just mentioned sere | WA come. 15. orior to the --- that contact team butont, you 20 sentioned pron sosue. a ad you been sare of any ron ase 22 prior to hat contacts none 24 What did you understandcobe puronts | -- vee) {| 3 A. To understand better the process of how a | 5 kind of review it receives, what kind of process is | " we. stows: cgecion to tor. | 16 610 yo Sok Ino shatter x nt She sole bo any 22 this. I know that on a couple of items where I had been [ 24 for some guidance from the ethics counsel, but I don't i ! _ | 1 recall whether I did on this because I had no involvement i 2 in the PRON issue at EPA | 5 Q. And the folks that approached you at that i 7 A ves. | 12 Q. And one of the other individuals I think you | 16 within Dupont at. that tine? | 22 ousenss r 24 Korzeniowski and Spitzer, dealing with the Telomer aspect ] | . p20 1 of PFOA. rage 15 ! i 3 to try to get some insight from the folks at U.S. BEA as i 5 correct? | 2 what the process might be for addressing the FON issue 12 A vossibly. I dont recall the sequence of | 13 contact. TT TTT 1 21 wht Sess 40 442.49 Bo4TIG SIRRD $59 STRSTR SRR ARR ARE SHRELE SAREE IY rire nsliaseneiaes a2 Eons 2 a ve Cee come = ant hd you worked with chasis nue - pt oo 0.wiMcihcheaeellMHcocaabe i| 1 developed of had been produced, 1 forget the rage timing. 1 53 | | 2 believe also that there was a request for Letters of | 5 intent trom the various mamatacturees, producers who used | POR as a product. nnd there vas some general discussion 5 about that, but it vas - tt vas very general. . G Did 0.5. EEA convey the point to Dupont ducing 7 this nesting that they wee intending to move forward aggressively with investigating erons 5 us. StowEs: bection to form. 10 -- Rr r-- | . 2 2 13 that Ghd attr that the folks meeting. at Dupont correct? were concerned about M A The folks at ouront wanted to sake sure that 15 they voce communicating with SEA in a say that provided 16 E0A with the Kind of information they necded on a 17 complicated tsaue. 1 G. Ant one of the things that was dons after that 19 meeting by tuponc was to set up a plan for how to 20 a organize communications with EE on PEON. Correct? A setup a plan. can you describe that? 22 (Mccabe Deposition Exhibit No. 7 vas 23 masked for tdentiication.s 24 rm. srsom: oe Corbettreporting.com - - W. Michael Hecabe Page 54 3 ittvitants eto: with ouron: Conmaling Setetions? p22 | | | 7 expressed thee concecns about. PFOA to Dupont in 2003, 5 on how v0 manage the fiow of Anforsstion seven SERS 1% sormonsive v8 pressvin, ) 1 Gn we Wn 8 9087 AO 92 hse bow Do 14 mocked as CoNIBAE 7, an 22k you to take 2 Sok 2k thet 16 before trom April of 7003 entitled Managing the FEO 15 Qa the tine that you stated yourworkwith 20 ouront on FFOR tasues, were you nce that 2 Jovmuit van 21 then ponding against. Dupont. involuing claims that 22 arinking water was contaminated with PRON ovtride 23 Dasont+s facility in Woot County, West Vieginier encore report om | 2 2003. W. Michael McCabe 1 Page 55 | | 4 time I started working with DuPont, I became aware of it. 1 . so se eo DO ls ae 16 tne ta m0 bt res Sr te Ho com u te se tt ro = W. Michael HeCabe Page 56 -- 1 Convene a meeting of the appropriate pacties at the 2 earliest possible time." 3 oo you see that? ` A. You are reading that to me, and I see it in 5 this document. . 0. ML right. Were you involved in any efforts 7 by buront in April of 2003 to convane meetings of any parties to discuss how to manage PION concerns by EEA in 5 connection with the West Virginia class action lawsuit? 10 Ws. StENES: Objection to fom. n HE WITNESS: Twas --- 1 was involved in 12 13 accanging the meeting but that was in how to that we discussed communicate vith easier at EEA on she Era, pron 10 4a3u0 and how to provide thea ith the information that 15 they were seeking. 1 It 4id not involve a West Virginia suit. 17 ox we. nso: 1 . 1 you look on the next page of this document 19 under List of invitees to meeting, do you have that page? 2 A tes. 2 0. You will notice one of thea is Bab Ritchie. 2 Do you see that? 2 A correct. 2 0. And that was one of the individuals you vere worcorbet reporting.con p.2 || || | i | | | . 0D - p25 W. Michael McCabe | rage 57 | CY 1 working with. correct? i 2 A hacts correct. i 3 . Did He. Ritchie mention to you that he as | 4 involved in any work to try to set up a meeting or a team | 5 of any kind to handle PFOA issues? | s us. STEMES: Objection to form. | ' 95. iTS: 2 done covet | 8 specifically, but I know that he was involved in 9 discussions with a number of people in the company on 10 this issue. I don't know whether it vas part of a group | 11 that had been set up specifically for that purpose. i OF 11f2is Br a sree we. erorr: coon, wove emt smoot |{ : 162003 you started participating in discussions with | 15 individuals ag Dupont in connection with setting up a i 16 communications plan for dealing with regulators in 17 connection with PRON? Correct? 1 A. I recall having discussions with people in 19 DuPont, and this primarily vas at the Telomer end of 20 things, about how to ---- how to communicate primarily with 21 EPA. 2 0. and you vere involved in activities to try to 23 develop a plan for DuPont so that they would Know who to 20 call ac 2A and when and on what issues related to proR. ww. coxbetreportincgo.n - p.26 L comseet hy 3 MS. STENNES: Objection to form. i 7 intr and he sn cnt oe unt. coun reponse ER 16 marked for identification.) 18 Q. Mr. McCabe, I'm handing you what's been marked 21 forwarded to Michelle Reardon at DuPont during the 3 a aks smers 10 oe toonme www. corbettreporting.com 0| | I ; | | 1 thought could inform Dupont's strategic planning on any fo 2 issue relating to FOR at that tine? | 4 sent at the end of May. I don't know where that falls | 15 oem sore, 0 wont munweet 15 a have seen this eters. na .3 soference a retainoeeryofueeveonf r$7e50t0 per month. | 7 A. That was what was agreed to at that time. 8 Q. Has that changed at any point in time? 11 A. It is -- it has -- it has allowed for more i 20 mere coreroo ! 2 recall. 9 A. Ido. Don : 0| 23 Q. During the course of your work on PFOA, did - W. Michael Hecabe Page 98 reece 1 A Len I vaguely recall that. 2 0. Do you have an undecstanding as to hy she did 3 not get that position? ` A wo 5 0. 00 you have an understanding of the extent to 6 which Ms. Horinko is being paid by the 3M Company to A. 1 didn't know that she was being retained by 5 them. 10 Have you had any discussions with Hs. Horinko 11 dealing with any fssue relating to perfiuorochemicals? 12 A Mo. md, in fact, I've had extensive 14 not relating to PFOA or perflucrochemicals. 1 Me. BILOTT: I think we have to take a 16 break to change the tape. 1 THE VIDEOGRAPHER: We are now going off 10 the record. This completes tape No. 2. 19 (Bett recess taken.) 20 THE VIDEOGRAPHER: Wo are now back on 21 the record. This commences tape No. 3. 22 bv we. wrsore: 23 24 that Q. you Mr. McCabe, were familiar I think we had mentioned with a woman by the name earlier of Linda ww.Corbettreporting. com p30 | | "i i | i ] | { i [A 1 3 Q. And at one point in time she became Deputy i ww 20 wttoges vy ones. conem 23 had had any involvement with PFOA or Teflon issues while I _ Ww. Michael Wecabe Page 90 , A Ie is ay understanding that she did. 2 0. Was it your understanding that Ws. Fisher 3 would also have had some sore of restriction on the 5 nad worked on at GFA after she vent into private 6 practice ) A She would be governed by the: same restrictions that any political appaintes has as far 23 directly 5 getting involved with the Agency on those issues. 10 but rom an informational standooint, 11 from a standpoint of providing information to a potential 15 0 Bat it ves sour underocaning here vould be 14 15 driersetcritcltyiownisthon0.5t.heBEeAxteonntistsouewshicshheshweascoiunlvdoldveedalin 16 whie she was at the Agency? A. She would be -- she vould bo governed by the 16 sane restrictions that any political appointee axe 19 governed by post amplosment? 2 0. and at some point in tine after He. Fisher 21 Joined Duront, you participated in a meeting with hor to 22 discuss what was going on wich Dufont and FOR. Correct? 2 A Thats correct. 2 Hecabe Deposition BAhIBLE No. 21 as [Eo ---------- p32 | _| i | | | i 0 | | - p33 W. Michael McCabe ; 1 marked for identification.) i| Page 91 || 5 Q. Me. tccabe, Tm handing you whats been marked | 4 as BIDE 20. Task if you identity this as a | 5 memorandum you prepared while you vece doing work for 6 ousont, dated Haren 7en, 20047 7 A. This dass appear to be a memo 1 prepared. . G. tnd this memo deals with some of the issues 5 that came up during a meeting with Linda Fisher in March 10 of 2008. corrects : 11 A. Yes. I D 13 last Line, do you ses there is a reference to an overview | 1s ares. 16 0. an at the bottom of the page there 1 a 17 heading entitled Silver Bullet, and on the second tine 16 under that heading again there is a reference to 19 essentially elisinates 7, and then three asterisks. 2 50 you see chate 2 At see that. 2 0. tou are referring to proms 2 A ves, fam. 2 0. hy were you refering to pron in this vay? - . pst W. Michael McCabe | rage 92 : a dont secalt | 3 to you at amy ot n ise to not sster ve FROR ox G8 dn | 5 A. Idon't recall any guidancebeinggiven, and I | : 76 bthoitnokr,e haeas yo T sotee u've seen s tofrom 1% 40 PR. the documents you produced 11 DuPont sites? | 1 a Heche. ) 15 0 bit you ove ave sup cussions = letne " 010 you ever pusticipate fn any 18 commisations with smsviduris a Dupont receing to = 15 regarding conceses about. comecting the docs an EFOR 2 omen n RR Jp 3 0. bia you ever hen tht phrase seed? | . www.corbettreporting.com | I I 2 understand the, the information and relationships between | 3 information, the contest, and the substance of an sous. | 4 Bid you ever participate in any discussions | 9 specific sites. | 11 the bottom of the page here where you reference the i 19 Do you see that? 20 A. Yes. : 21 0. Again, that vas PRON. Right? f 24 2004, that there was some sort of product process change | | W. Michael McCabe | Fring Stevmeos ah Bub, that ore erinlvete DRONE bo 3 think, part of the eisuwvsion that had eveived to Ene | 8 Eventually that developed into the i 12 was it your understanding that DuPont was aware of ways 14 products? woo 20 recommending at this time that DuPont talk to Linda -. i | rs page 95 | 1 advances public, how to share that information with EGA | 4 about and had set up an ECA process for. I wanted to + 2 spon 7 Q. And it was your hope that if DuPont was able { 11 upconing possible regulatory action on PEOR. Correct? i 0 He WITNESS: Restate that. Because | 14 there is an assumption, I think, in that question which I | 1165 wm. som. want to understand better. || 17 Q. In your discussion here under the heading of i 1 a dete. | 22 developments about product process changes, to one of the | reer oe |1| | W. Michael McCabe i Page 96 1 the ECA process to date. Correct? | To 2 A Thats what this says. ! 3 Q. MI right. And so your understanding was if | 5 that it was going to phase out with PrOR, this cond be | 6 the silver bullet to helping DuPont control this | nu The problem with EPA's regulatory | 12 process and with TSCA itself, which is the law that | 1145 cohneemitchaalts,doeissn'tt.hataddirte'sssaamvseersyincgumbcoenrtsaommienapnrt,ocemsnse.s,It's | 24 by TSCA, and that that was something that they needed to | | ww. corbett reporting. com | - - 5.39 W. Michael Mccabe J || 2 embrace so that the Agency, in effect, could, could get | | 0. So you were advocating back in the spring of | 16 0 ma ens ems which, sien dents win yous 21 actually enpioyes by utane at ens poine. 5h say neve mm | - - W. Michael Hocabe rage 98 1 that it was important to have Linda's insights on this. > 0. Soon after this you started initiating 3 discussions with Susan Hazen -- 5 Q. -- of U.s. EPA. Correct? 6 A Yes 6 thee timer s AT believe that Susan was either in the deputy 11 Deputy Administrator, and Susan was now the functional 12 13 head our. of OPPTS, which is I'm aczonym based the Office of -- you spell it u 0. And ald you have an undesstanding as to 15 whether Hs. Fisher had any kind of relationship with 16 ts. Hazen? | n A. Well, Hs. Elsner had been the Assistant 18 Administrator under Bush 1 for this, this program, this 20 people that worked in that division. n 0. Mere you ever involved with etforts by buront 22 to retain Holt Regulatory Consultants to advise on 223 internAationaIlwaPsFOnAotdedvierleocptmleyntsi?nvolved. i p40 | i by | | i | i D| J | | | | | 5 : p41 W. Michael McCabe | roe ri tin ! 1 Q. Were you involved indirectly in any way?Page 99 i| || 2 A. only that 1 had heard very positive things 3 about this individual and thought chat it vould be usetul ! { 5 Q. Did you ever sit in on any meetings with Rick | i ' A. 1 have sat in on many meetings with Rick Holt. 0 Relating to pron? 5 A. Relating to ron. 10 0. When aid those meetings start? n AT don't recall | 12 . And it's your understanding that Rick Holt and | 14 ouPont to, to serve as a consultant on international PFOA 15 issues. Correct? 16 A. That's my understanding. It In the sumer of 2004, the U.5. Een filed a 18 lawsuit against DuPont alleging violations of TSCA, i 19 Section 8(e). correct? 20 AX believe thats when it vas Filed. I don't 21 emembor the dates. 22 0. id you have any discussions with anyone at 23 0.5. Beh regarding that enforcement action before that } 20 lawsuit vas filed? we. corbettreporting.com | - paz W. Michael Mccabe || . (oot recess taken rage 101 | |i 2 THE VIDEOGRAPHER: Please proceed. | 3 ewe. prior: ` 0. Me. Mccabe, vera you involved in any 5 discussions with anyone at Dukont relating to whether of 6 not to settle the case that was brought against Dupont 7 involving drinking water contamination in Wood County, 6 west virginia? ) A bo | 10 0. Woke you involved in any aspect of the 11 decision about whether to settle that case? ; 12 nde ) 53 a in vevember of 2008, ou na some 14 conversations with an individual named Peter Robertson 15 trying to cone up with a more broad, mere proactive 16 strateoy for dating with PRON on behalf of Duont. 17 corrects 1 us. stewiEs: obsection co form. 19 THE WITNESS: I don't recall 20 specifically when or what the context was. 21 exw. som: 2 0. And it xas your understanding that Poter 23 Robertson had once worked for U.S. EPA. Is that correct? 2 A. That is my understanding. wor.corbetreporting.con | = W. Michael McCabe rage 102 1 Q. And what was his position at EPA, the last 3 AX think his Last position was Acting Deputy J 5 . And he was a lawyer or is a lawyer. Correct? p.43 ! | '| | i | 3 in the fen enforcement cane Lovalving the UCR alleges 10 violations. correct? 13 lawyer about pron? ) 15 understanding the evolution of EEA involvenent on the 16 pron tame. 1 0. Were you involved in any discussions with hin | 16 relating to developing any sort of steatey fox how to 2 eT owt ressld viet 7 ven. dents have 8 T1 lesal backprouns, and T don"t believe I have provided any 22 ssristance in that aes. 2 Hecabe epesition ExhIbLE No. 22 vas 20 marked for sdentification.) [EO ------ | = pas WH. Michael tecae : . ; 1 erm rior ! Page 103 | | 2 Q. Mr. McCabe, I'm going to hand you a document i 3 marked as Exhibit 22, and ask if you can identify this as 4 a November Sth, 2004, e-asil from Linda Fisher at Dupont? 5 A. That's what it says. | 5 0. in this email she mentions, quote, I spoke 7 with both Peter Robertson and Mike HcCabe today, and have asked then to hold thelr calendars for Tussday meeting. S They think ic is a great idea that ve begin to chink 10 through a broader more proactive strateay, and are glad 11 to help us develop it. | O . f12 a mascoarmreecto?ns emt so 1 0. Did you help develop such a broader, more 15 proactive strategy for DuPont? | : 16 17 in A. I'm not the work that I sure what was doing the for context Dutont, of it this is, but was to, as I | 18 think I just said in my answer to the previous question, 19 it was co address how to get the information out that 20 bubont was actively reducing emissions, changing products 21 and processes to reduce exposure. 2 So it wouldn't have been out of the 23 question that I vould have had this, this discussion. 2 00 you recall that in January of 2005 the 0.5. ------ W. Michael Hecabe rage 101 oS Sasa Seviant HAGA == 8 SOECH TASK SSSATSSS 2 tor prom 3 pe din 2easRA ton anas dhese S123 0 Hr J-- s 0 ant you ~ you Tescred that that was going to 6 happen before 52A officially released it. Coprect? ' a dont secall specifically. It wouldn't be 8 omisund shat % waste hossn oon thor. 9 Q. And how would 10 A That Kind of thing is generally publicly -- 2 G0 ot 0 Mea Se: Ss Seen oF 13 risk assesment before it was officially relessed? w A Mell, hen Ee developed its Ficst draft hat 15 vas seleased in 2003, they specifically said that they 16 would be updating It. So it was public information. w ect Seponinion TAMMIE vo. 75 wes 16 marked for idencitication.) 1 ov wm amon: 20 Wo 1 10 nesast secaisiny 8 sawtonin Sora A. 22 revised risk assessment. in Jansary 2008 hetore it was 25 sstunity tolosses vw the puetser 2 at dome recent. wrcoret reper ing oom pds || | Cl ! ) 0 . Hichae woce : Page 105 i 3 from Linda Fisher to you on January 11th, 2005, which is i 6 to me, with an e-mail from me to Linda Fisher, or | 1 A I seo that. i 14 Q. Do you know who did? | 20 In this particular e-mail from you to a23 tomorrow, please 5l0etyomue skeneow.thac || pp-------- | W. Michael McCabe | | 1 A. I see that. J 2 0. oes that refresh your under --- your | 3 recollection that you were aware of the release of EPA's | 5 by oom | . A. he I exid. T think ic vas proce vel known | 8 have a revised risk assessment released. | u A 6h may have indicated that in some way. | 15 A. I don't think I did, no. | 10 do 14 300 Shane 1 nom vn. | 21 of DuPont. Correct? | 2 5 ste. so on cy i i a vin sm | | - - pdt | Page 113 1 2 were aluays appreciative of those discussions i 43 though,Q. Ls aItgutehsiss pwohianttIi'nm atisnkei,nginaboFuetbrusapreycifofica2l0l0y5,, || 5 6 gwohiantg dtiod pyloauy loeuatrnonfroprmonU:.S. EPA as to how things were | ' A. I don't chink tt vas about how things were 8 going to play out on EPA. { ; 12 specifics, that this vas about how the Bch would play | iD 13 14 out, play how out. the enforeabie consent sqsessent. process because that was still undetermined. would | | 15 Do you recall at some point in tine while you | 17 in communications with the State of New Jersey's 10 bopastment of Envizonmental Ecotection relating to PRON? 15 A 1do recall that. 2 Oana do you cecal leaxning in 2005 that the | 22 om quideline for PROM in drinking water? 23 24 talkingA. abouWthsat was the date, the dates that you were || i ercometrremoreing oon . | Page 114 i 1 Q. 2005. Co 2 A. And what were they going to come up with? 3 0. A -- some sort of guideline or number for PROM i i 4 in drinking water? | 7 Q. Do you recall participating in a meeting with i 8 the Commissioner of the New Jersey DEP in February or | 13 the initial meetings with New Jersey DEP to discuss PFOA !J 15 remit set on to S8RS tht eset ten 24 Virginia CAT Team numbers for PFOA in drinking water 1 | 2 (Mccabe Deposition ExhABLE No. 28 was | 5 Q. Me. Wecabe, I'a handing you what's been naked | 10 susie Hazen and Susie to me. | 12 to Ms. Hazen at EPA you say, quote, Could I get your i 14 00 you see that? 16 Q. And you are referring to the case that the | 24 affected EPA's communications with Dupont, whether it | - - .51 W. Michal Hecabe | , rage 119 | ! 1 affected the relations in some way, which was part of 1 2 what 1 as employed to, to build on. | 3 1 know that I had no discussion on the, | 4 the lage) aspect of this, because 1 wouldn't have. | s Q. In Ws. Hazen's response to you right above | 6 that, ane saya to call next week, but that she's limited 7 in wnat she can share. ! 5 00 you see that? 5 A ven. 110 herr Q. 01d you call hex and discuss this Sasue with | 2Ou12 wreA. 1don't recall, but I wouldn't be surprised if || 1 0. What do you recall deaxning as fac as the 15 extent to whch ERAS TSCA Be) case affected any of the 16 communications St was having with Duront? v A 1m very foray on this, 30 don't totally 18 recall. 1 do know that there was general concern within 19 the Aguncy about this case, and they felt that it vas a 20 very serious case. And that may have beon communicated 21 tn this communication. 1 don't knox. 2 (Hecabe. Dopasttion ExnibLE No. 29 was 23 marked for tdentitication.) 20 ov wn nor: wrcorrebporetintg.ctom | W. Michael McCabe i 1 A. I think that any time a company is involved in rod 2 a court case with a major agency, they, they seek to i 4 enforcement issue, establish a better relationship with i S the agency that's not bogged down in a, an enforcement | 7 to, to get this resolved and move beyond it so that it i 8 wasn't -- it wasn't there as Something that they had to 1 the seco. 0 1 (ss concludes tape wo. 3. | SE ---- 24 that, that you were working for through McCabe & | www. Corbet reporting. com | | } 08s -- 2 Tavis csnie. | Page 123 4 oupont? | 5 A. I curreanmtstlilyl working for DuPont. { 0 SR 1s and share avewyre. Ba tw manyof cme 2 a om 21 Q. Which one? [ 23 0. And what was his position with EPA? meeron - - Page 126 : W. Michal HeCabo peocabe Deposition ExbibAE No. 30 use 3 oe. orvor: ` 0. Me. Wecabe, T going to hand you whats been 5 marked as Exhibit 30 and ask that you take a look at this 6 document and tell me 1f you can identity this as an o om ' A This sper to be am e-maid fom Susan -- 1 12 stout Q. And in preparation ftohrisapmaerettiicnuglarthee-mnaeil she days isandtalfnkintghe 13 objective for the meeting she states, quote, Create a 15 clarity for PFOA and other potential compounds and is 17 the, quote, 8 bax strateoy, close quote, and drive it 1 20 you oan shane 20 a. I see that. 21 0. And under Context she references a couple of 22 bullets down to create a Level playing field. n 2 yoo san thar 24 A. I see that. eT aon p.54 }| a! i J [ | W. Michael McCabe | Page 127 || ! 21 "MeutraQ.lizesAndimpaacctoupoflepobtuelnlteitasldodwenraibleelrowintfhaltu,ences." |i 5 50 you see that? ! . a 1 see th. | s Oboes this refresh your recollection of 8 getting regulatory clarity on FON in a quicker vay than 5 what had boon happening betore? 0 12 [35 which she caters was our general -- the discussions chat ee nat vad sto vn 10 po 0 antortann mtn se 15 enforceable consent agzesment process, what the outcome 16 of the risk assessment vould be, ans hor SEA would go 16 exposure. 1 So it vas alt part of alt of the 20 itteront activities that Duron vas smvotved in in 21 sadcossing cho pron issue. 2 Gre those aL1 within the box stsatesy that's 23 roterenced hove? 2 A F'n not specifically fomilias with the 8 box ne corte reporting com - - W. Hichael Hecabe rage 120 2 of their, their different approsches to things. The 8 s Gant oneof the things FR p56 - | 11 MS. STENNES: Objection to form. i 1s Hocabe Deposition ExMEBLE No. 31 nas D 1 marked for taentisication.) 15 orm. nom: 16 0. He. Hecabe, 1going to hand you what's bean 16 hugust 3, 2000, pas ron susan Stalnecker to Linda 19 Fisher of ourents 20 Ws. STEWES: Ghpection to form. 22 email trom Susan Seelneckor to Linda Fisher. ---- 2 0. and this, this eomail, dated Just to days J -------- W. Michael McCabe | $ 1 after the last document we looked at, indicates that } 2 she's providing, quote, a blend of what we said | 3 yostacany, | 4 Do you see that in the very first | 5 sentence? | 7 Q. And there is a reference to, No. 1, | 8 "Would the Agency be amenable to a DuPont plan with | On a we 1 Q. And what this is reflecting is DuPont's | 24 was probably part of our discussion to take some | peop------ | - - W. Michael McCabe Page 130 1 leadership in the industry and propose emissions 2 reductions and virtual elimination 3 Q. And one of the things Dupont wanted to do in 5 level playing field, close quote. 6 A. That's right. 7 0. On this kind of a plan. Correct? i 8 A That's correct. 5 0. So if DuPont was going to go to U.S. EPA and 10 offer to phase out production, they wanted to make sure 11 that that kind of phase-out would be implemented 12 industrywide and not just with Dupont. Correct? 13 A. I think you are putting an emphasis on 14 phase-out of production, and the voluntary stewardship p58 ! ! Py | | | - 01 | 17 of your question is to ensure that other manufacturers, 18 other producers were, were playing by the same set of 19 rules, yes, that was -- that was the objective. 20 0. nd one of tne --- 1 zn A. But it was also an objective not only for 22 domestic producers, but for international producers where 23 there are not the controls that we have in this country. 24 0. And one of the ~- one of the concerns DuPont ww.corbettreporting. con | | W. Michael McCabe i Page 131 } 1 2 50had waabsoutmaktihnisg ksiunrde otfhata ptrhoepiorsailniotiuallddbiescuksesptions with i || 5 very difficult to ask the Agency to keep things | 6 confidential. Things are FOI-able, it's a public agency. | 7 I don't recall there being any, any request that things | OD 13 this First step be a contidential process between BEA and | eer | W. wichael mecave rage 172 1 thoughts in mind, felt that if we were able to approach 3 tndustey sntviduats. . hccabe boposition Exhibit Wo. 32 vas o wt oo 7 Q. One of the things that was of concern at 5 that vas being sensrated shout Terlon and FFOR at the lo tine. cossects u | ont ron conse voor mistepteseetoinss 12 that were being made in the press regarding PFOA and -- 13 ero in general. " Gand one of the Enings that, that bocase 15 identified, to your knowledge, by Duront as very 1176 sitmaptoermteanntt tforomDuEPoAntcaiassstuorignegt tshoemepusbolritcosfhopuutbltihce safety 16 of Fron ox products mado with PFOA. Correct? 1 ae think 28 pues oF the sioh svessseent, penees 21 evauation 5en was doting be put in proper contest. ad 22 56 was in the best position to put that in concent, but 23 thoy had to ---- they ha verbalize it or commmicate ic in 20 some va FO p60 4i | i | | | | 0 | | | I | = - p.61 ' 1 Q. And, in fact, one of the things DuPont i 5 a level playing field and regulatory clarity on PFOA vas | 4 obtaining such a clarifying statement directly from EPA. i 5 correct? | 6 A. I'm -- I'm not sure that it was part of the | 8 not unduly alarming the public. | Sy / 12 which was produced to us from Holt Associates? | 15 2005 one of the consultants working for DuPont on PFOR | 16 issues was Holt Regulatory Consultants. Correct? i An | W. Michael McCabe Page 134 1 A. Ido see that. | i i Po 3 referenced in that Last memo we ust saw from | s Ws. STEWES: Objection to form. 1 or. sors | . G IE you look in the Plan Context -- you look 10 level playing field. Correct? 1 HS. STENNES: Objection to form. 12 THE WITNESS: There is one bullet that 15 says "creates a level playing field." | | od Do 1 0. might below that, Provides confidence to w 50 you see that? w A. There is a bullet that says that. 1 a. oss that refresh your recollection about one 20 of the critical companents of ourentrs plan to spprosch 21 50 and suagost his reduction plan we've bees talking 22 about, is to get statements trom EOA that would reassure 23 customers and consumers on the safety of Bron? - | www.corbettreporting.com | | - - p63 W. Michael McCabe | Page 135 i ! 1 THE WITNESS: I think that I just said Il 2 that in my answer prior to this, or in one of the answers | 3 prior to this. i 4 BY wr. ororr: | 5 On the third page of this draft plan, if you | 6 could look at that page, it's Holt 02936. Do you have | 7 that page in front of you? | 5 A. Not yet. okay. 10 to proceed with these plans regardless of the outcome. ] ) 12 cooperative agreement with BPA that meets our objectives | 0 13 and expectations." | 1 Do you see that? 1s A. I see it. Let me read it. { 16 I see that. 17 Q. Do you recall there being discussion at DuPont 18 that if there were -- if Dupont was going to go forward 19 and propose this kind of a reduction plan to EPA, one of 20 the requirements in exchange would be these commitments 21 by Ben to make public statements reassuring the public | 22 and consumers about the safety of PFOR? i - pot Page 136 i | | 1 proposal to go forward with the stewardship program. !| ---- i 5 Qo Yes. i 1 A. I did, yes. 13 Stalnecker. Correct? 14 A. It depends on how you define negotiator/fair | =| i rece - = 0.65 W. Michael McCabe | Page 137 { ! 1 Number one, right below that, "Positive | : 2 statement that current exposure levels do not pose any | 3 adverse health effects." ! 4 Right below that, "Updated and positive 6 products) are safe for use." | , Do you see that? AT sce that. 5 0. And DuPont did, in fact, ask BEA to make those 10 statements. Correct? D } 11 sestoGn ncdommstewas done as part of this proposal and | 14 A. It was done as pact of this proposal and 15 program, but it was not a quid pro quo. 16 In fact, you recall there being discussion by 17 DuPont about: the extent to which this was considered a 18 quid pro uo. Correct? 19 A. Tdon't recall that. 20 Do you recall seeing the menos where it was | 21 discussed the extent to which getting EPA to make these 22 statements was required in order for DuPont to agree to | 23 this program 2 AT recall that i was seen as fmportant to have | wn. Corbettreporting. com rage 110 \7 2 Q. 3 case 1a2 W. Michael McCabe 9% you restace Sorc Are you familiar with this terminology, 6s romlat0.ory cIlfaryioutylofoork aFtront.he Aoebtjaeacttiizvee htehree,=Crbeoxate 7 strategy" drive it further, faster. Do you see that? 5 AT see that. 10 That's the same program we were just 11 discussing previously. Correct? 1 HS. STEMNES: Objection to form. 1 THE WITNESS: It's a charscterization of 15 a, an approach, but it was not the common usage that we 16 talked about, this box strategy. 17 bY me. prior: 1 Under the Plan elements, do you see the very 19 lest one is referenced as "Legally binding: EEA 20 statements re meeting regulatory responsibilities, 21 product safety, no adverse health effects. 2 Do you see that? 2 AX see that. 2 Q. Mud, in fact, one of the things DuPont made wow.Corbet reportincgo.m p66 i | i | ! || )| W. Michael McCabe : # 1 clear to EPA was that they would like EPA to make | 3 effects from exposure to PFOA? i oT 13 this proposal, asked EPA to put the health effects in 18 publicly about ws. sTomEs: an alleged lack ocfnjheecatlitohn to tom. effects? 2 rm sno, - - no n. Wionaet ecabe rose 102 | | 21 cporrovpeocste?d statements for EPA to make in that regard. ro | SA bt dems teow wm yout reterring to. | a 0. Bo you recall ever secing documents prepared | 5 6 wbhyenDumbaonktingsupgugbelsitcingstattheemelnatnsguashgoeutU.St.he EPA should safety of use PEON oF || -- AT would have to see wha youre refessing to. 5 cab coposion ExbbLE No. 34 vas 10 marked tor taencisications | 1 0 me be, Tn going to hand you shat's been | 13 16 marked look at a BARIbLL 30, chis and cell and ask you co take a mm 48 you secsll eve moment seeing to this Do | 15 document borere? | 1161 0A YIoduons'et trheicsallparsteieciunlgarthdioscudmoecnutmendta.tes | 16 August 26, 2005, cotecences a arate release at the top Ba re 20 a mado you seo the caret several -- well, ao 21 you sen six paragraphs down there is seatenent, "Een 22 continues to believe that produces currently in che | 2 AT see that. | 0. Michael Hecabe | page 143 | ponsaye | 87 macht tor seamess(MiccCuasboen.Dseposition Exhibit No. 35 was 1 o srw. enor: BM Be wee mensnm, Tn ging to vee wnat een . 12 dove a thet, mamas ns tek mn 55 ou Tocnit over 10 peop, dase rupees. 2500 of T0087 A -- 16 spmettsconty. . I 6 ton recognise thin, thoushy up &comment pun 16 together by Duron tn connection with the proponst to HEA 15 about 7Eon reduction? 3 A 1secosmise this as a document that dents vith 20 some of the Lesser what we were dtscureing shot how vm 22 oomosch ton. 23 Q. If you'd notice, on the fourth page of this k 24 document there is a chart entitled Desired Outcome? f pp ------ - W. Michael McCabe Page 144 1 A. Yes. And when was this document? I'm sorry. | 2 Q. The first page references August 29, 2005. 3 In this particular page there is a 4 reference to desired outcome, quote, Regulatory closure 5 pending risk assessment indication of need for further 6 risk reduction. 7 Under the second bullet, EPA public 8 acknowledgment. 9 D0 you see that? 10 A ves. 1 Q. And if you could refer to the -- two more 13 Acknowledgment? 1 A. Sorry, two pages back or forward? 15 0. Forward, page 6 16 A es. 17 Q. one of the bullets beneath that is, quote, To 18 date there are no adverse health effects from PFOA and 19 EPA continues to believe that DuPont products currently 20 in the market are safe to use. 2 00 you see that? 2 a 1 see tha 24 discussions at Dupont to propose language to EBA for them `wnCorbet treporting.com i p.70 ; i Yo ] | | | tJ | | i i I | | | | | i - - Pp. 71 . Michael wecabe |i I || 3 A. T think that that was a desired outcome. As 1 | 4 aid, as pact of this process, and the ongoing process | | 5 with EPA, we wanted to make sure that SPA put the health | 4 vith Em to officially make the propos to 0.5. EB an 10 this program in September of 2005. Correct? : ) Mo 0D 13 ite oroposet spout ceducing von emissions coreet, the 14 meoting in September of 20057 I -- 2 0. During that meeting, do you recall discussion r 22 of wat Dupont would Like from EFA to help support the 21 progean swing fora en -cormetereopgaor - - 0. Wichaot Hecabe cage 145 1 was addressing this issue in a constructive way, that it 2 s vas providing leadership within the industry. & chink tht 1 was all past of the work 5 iasues tavolving Fron in the context of cEA"s risk r2 i |}! i | 8 industry to move faster and more effectively than if we { 1 proves von conptete | a ana one or the | 1G. and one of the things Durant suggested to Eon | 16 ackmoviedping ourant-3 Loadecsnso on this progran. NR 139 a sed 0.5. con vencually ageess tac his as a 20 00a proscon to pucaue. corcect? aoa we 2 a ad you then pacticipated in discussions on | 23 20 behalf aoving of Durant with and Finalizes. UC.So.rreEcEtAsto try to get this program 5 - p73 W. Michael McCabe | : Page 107 | ! 21 0A. AYnesd.: in those discussions Dupont essentially i|! 3 confirmed its commitment to a, an eventual phase-out of | 4 production of certain products using PFOA by a certain | 5 date. correct? | . us. stews: Objection to fora. ' THE WrmMBSS: Can you estate that? vue. srsorr: 5 0. This, this program turned into what you 10 referred to cartier as the voluntary snissions --- 1 A. Stewardship progran. | - 12 Q. == stewardship program. Correct? | 1 Q. And ouront confimed its commitment to 15 inplenent that program back in the fall of 2005. 16 corrects 1 A ves. 1 and one of the things Dupont explained to 5PA 19 vas that it nesded EPA's assistance in getting other 20 industrial companies who were using or making PFOA to 21 participate in the same program. Correct? 2 A. It was secomsended that other companies be 23 included in this because it vas a good progran. It was 24 something that would address this issue much more rapidly wo Gorbet report ing. con | . Hichacl Hecabo i| ase 150 ! 1 Do you recall that? td : pa preston Sesto. 0. 35 wo | 5 marked for identification.) | 6 ox wm. onom: | T 0 we. seabes 5m going to hans you whaces been 10 that ouront put. together in connection with a aeeting 11 wien 5.8. 5m concer 528, 20057 | 13 omthter with the notes that ace avtached to this. 0 2G worms vten vn vane on 20 0 12847 shete on 16 soso cooamntonzets, va wm omer. 15 crtvieat nests? 20 A 5 1haavpaese in frontofnecatitied 2 a md do you see the second mullet trom the 2203 breostttaotmeosnaftehtiys ocfharptroduuncdtesr and no health sttectst Critical Needs is, quote, EPA i PP - n18 a | Page 151 i 1 A. I see that. i 2 Q. Do you recall participating in a meeting with i o e si m a oo toI d n i i 5 critical needs ere expressions of interest and outcomes, Dn L 2A w BI LLP ToEmcm e me o Teemm ee e c-- i--n o-- en | 11 Q. I guess what I'm asking is: In particular, do | Ts | v. Hichael Metabo 2age 152 1 this in proper context. | | Cd "oy S what EPA felt that the context was, and I'm, I'm not -- I | 14 passed and DuPont became concerned with the lack of i !J FU ! 1 communication with, with the different parts of the 2 Executive Branch that are involved in these decisions and | | 3 these issues. i i 1245 peterson what's going on and to encourage their review and | 16 Q. In fact, DuPont at one point wanted to get the | p-- r ---- Ww. Michael McCabe Page 154 1 from Susan Stalnecker at Dufont to a number of 2 individuals, including yoursele, trom Novenbor Sth of 3 2002 5 Stalnecker to a long e-mail chain. 6 Q. She mentions an agenda for tomorrow, and the 7 first entry is 30/60/60 plus. 8 Do you see that? 9 A 1 sce that. 10 0. bo you have any understanding as to what 11 thats referring to? 12 A. he only thing I can think is it would be a 14 Q. Under open issues, there is a reference to 15 White House interaction, more critical now, three 16 question marks. 1 Do you see that? 10 A I see that. 1 @. Do you have an understanding as to why 20 interaction with the White House was referenced in this 2210 way innNoTvembesruspoefct200o5a?t 5 we pars of omeing efforts 23 to inform a vide range of people within the 24 Aduinistration about the proposal, the approach that was ww.Corbettreporting.com em || | !| | | | | | | | | r| - - p.79 ! 1 being taken. That would be my, my guess. | 2 Q. And, in fact, DuPont did initiate discussions | 3 with the Administration. Correct? | . ATbelieve they did. | 5 Q. Did you participate in those discussions? | , Q. In fact, Chad Holliday of ouront aid. | Oa12 wma (Discussion held toes off the record.) | 14 record. | 20 wotticay of swore aver www.corbettreporting.com | | W. Hichael Hecabe | Page 159 f ] : 1 Paul Noe worked for the Office of Management and Budget f | 3 A. That might have been why his name is familiar. | 5s (McCabe Deposition Exhibit Wo. 39 was | | 8 Q. Mr. McCabe, I'm going to hand you what's been f 1211 Dh 14 cot a ovo on vm 1, 005, ine wre forwarded to Susan Stalnecker and Michael Parr at -- and sectrming service tor ote A. This appears to be an e-mail from me to Susan ||i | | A W. Michael McCabe | Page 160 | 1 between the announcement of the voluntary stewardship | 2 program and the TSCA Ble), any timing issue. | 5 e-mail you received from Susan Stalnecker on | 6 December 5, 2005? { w11 8(e) goss Mp public, which means ASAE. j| | - p.82 W. Michael McCabe i page 165 i 1 e-mail. I am just referring to, do you recall that prior | 4 DuPont had become aware that the Science Advisory Board's | ~ 12 Q. Doyou recall discussions between DuPont and i 22 marked for identification.) 1 reer oom | | - - W. Michael Hecabe Pa1ge m1o6c6ked as Gehibic 42, and ask if you can xecognize this 2 2 as an e-mail chain that Susan Stalnecker forwarded to a mone smtvvitenin, Snioniog pcseit, on aamaary 17th, 20087 s A. Yes, it appears to be an e-mail from Susan | 6 stalnecker 57 eon SQu.san SAtnadtniencckleurdetdoiSnustiheisaez-emnailatc0h.a5i.n BiEsAandatee-dmail 5 samuary 17, 2005 --- 2006. Correct? 10 a Thats che date, you. u 0. In the secant parageash of hes e-mail, 12 te. Stalnscker states that "The purpose of my call is to 13 describe our plans for next week, and aake sure they are 14 adigned with Enns interests." 1s and in that. regard, shes talking about 16 the plans to publicly announce the Fon reduction 17 program. Corrects 10 AE boieve so. 1 G. Fusther on in that pacageaph, Hs. Sealnecker 20 states, quote, It is our hope, and that has been 21 confirmed from tise to tise, that ve could isbed a quote 22 from you in that release. Having made the, uote, ask, 23 close quote, it is cloar that other than some 20 presentations, you have nothing in writing regarding oue wrecorbett reportingcom p.83 | i ! | | | i | i - - pst 1 commitment. 2 W. Michael McCabe 00 you see that? | rage 167 | | i 4 5 smece 0. Do you recall Dutnt was seeking paapratcitciicpuatlianrgquionteanyfrdoinsc0.u5s.sio8ns | | 6 that it could include in a Duront press release? , A think it's customary any time thot industry or a nongovernmental organization works with the Agency 3 on a particular project, that if that group or 10 organization is going to issue a press colosse, they ask { pe 12 was requested. Oh Tt is alvays understood and stated hat | 14 5A does not negotiate press releases, and certainly not 15 the content of thei press celesses. So while there may 16 have been an ask, I think that probably was that 17 without any, any accangosent ox prior understanding that 16 it vould be conceibute. 1 Gut Drone, in fact, forwarded a dratt press 20 roloase to 0.5. on, including a quote fron 0.5. Eon, 2221 sproiomroto2t0h0e. tiSmoeretehcaetsDuPont issued its relesse in |[ 2 A. Would you restate that? } 2 Go you recall -- ox Let me estate that. | recorbeteeporticnogm 4. ichael ecabe Page 168 1 Were you aware that DuPont drafted a 2 press release to be issued by DuPont that included a p85 || i !td ' thete was 2 ote oy = quote 30 1% Soswatn oun tem Soak wisn 9 sri RRA gsnumwhaSn60 ste TE Yat S58 SPORE PAVE tat ashe ! 12 It could have been something that just was filler. T | MN 16 marked for sdonitiecantinon.S)uton SRS Hu $5 up 17 ow, ormorr: 1 Ge. Wotates Tnguia v5 hank ye whst's hoes 19 morkat ou Exninin 42, and ant $1 you wks vase 5 womens 20 un tov 4 Shen ont 190, 58 78 secHEER Tbs 78 2 TI e ssmat nss 20 Tr ien eslSeernn d8 efranssFTREaE 5l. So a 23 boing Materials faxed to tezen soday? re | - v.86 W. Michael Mccabe ! rage 169 | 2 Q. And what was Dan Turner's position at DuPont, | a5 that vaA.s deDsainngTuwrintehr wPaesonpadrst sof. the communications team | 6 0 on the second page of this exhibit, you will 10 bo you see that? -- 12 a aed you wild see chat Fathicen forte 43 1 sentence, tus versions of documents Co 0 to Took at. 1 50 you see that? a ve 1 a nea che nent page is one of he versions 1 So you see tha on the next page? 20 A foes plana and you say that the arate s2r1 press areleaeset5svoownsthseoneext rpage1?0 es,toseee vthat.p | 23 in italics midway through the page that is some proposed | 24 quotes to be attributed to Susan Hazen. Sr T --- ee W. Michael McCabe ! Page 170 1 Do you see that? !i 2 A. I see that. 3 B. tour understanding, Sesen fanen bats i | 4 actually made those comments. Correct? | s A. My understanding is that she had not made | those coments? Is that your question? | 7 Q Yes. ' Wot. yet. She had not yet nade those | 10 release. Correct? | 1 AT don"t recall whether shetd nade those ! 12 comments or not. What this looks Like is, is just a 5 2 tr we | 14 similar to this. And this, this is DuPont's press i 16 2. On the cocond page of this drat prose 00 you sec hats | - 18 which again is a proposed quote from Susan Hazen. | 20 A 1 see that. I T2t1 cambiQo.s tnWhteraetotrhne psrhoenpostehed SON prasate or quote is, quote, EPA stn T| 23 market today axe safe, close quote. 2 50 you see that? | www. Corbet reporting.con | W. Michael McCabe | 1 increasing amount of negative publicity coming out about J 2 PFOA and DuPont products using PFOA. Correct? i 3 A. Yes. Yes. | ` Q. And there vas an increasing level of concern | 5 at Dupont that something needed to be done to stop all of | 6 the negative publicity that was coming out in the spring | 7 of 2006 with respect to PRON. Correct? | 8 MS. STENNES: Objection to form. | 11 coming out that focused on the, the SAD report. or | 12 possible SAB report, and DuPont understood that there, i 14 BY MR. BILOTT: | : www.corbettreporting. com | i rage 175 | ! 1 get them to make some more definite reassuring public i | 2 statements about PFOA at that time. Correct? } 3 A. I -- don't recall the sequence. As, as I've } 5 communicate with EPA and to get them to put the | . 12 A. I recall helping facilitate a, a call between | | 20 says Hike in the cota. | 1 Q. I'm referring to the e-mail chain that starts /| 4 Q. Do you see that there is a -- this is an i 5 e-mail from Susan Stalnecker to you? | To on rebnuany 12 12 na she's saying, "Mike and the co's, please ~J | - - pot 0. Michael Hecabe | ) rage 177 | | 1 analysis" on the next page, "Publicity around SAB report | 2 has linked the Teflon brand to cancer. Coverage has been | | 4 disruptions in our mackets and are consumers are very, | 5 very concerned." Correct? || 6 A hats what this says. ' Q. And the ~~ the, quote, Ask, close quote, "In 8 our opinion, the only voice that can cut through the 9 negative stories, is the voice of EPA. We need EEA "to 10 quickly (like first thing tomorrow) say the following." 11 And then there are two statements to be said. ~ 12 Do you see that? 1 Q. And ouront, in fact, asked Steve Johnson to 15 have EEA make these statements. Correct? 16 A. Let me read these statements. i) Q. Including the first statement being "Consumer 18 products sold under the Teflon brand are safe." 1 And the second statement being, 20 "Further, to date, there ace no husan health effects 21 known to be caused by PFOA"? 23 BY MR. BILOTT: { wan. Corbettreport ing. com | | -~ 0. Michael ecabe 1 that Dupont asked EPA to make those statements. Correct? 2 A. That is what this says. I don't know what p.92 i| i | 6 and that this $18 report aid not actually reflect some of | 7 the statements that had been made by EPA in the past | 1 Q. Are you familiar with somebody named Marcus = [NR I 0 15 the ness to have EER make the states shat outont 2 that open I | -L p93 W. Hichael Hecabe : | La cobruncy tn, 200s vage 175 I!] 2 Gos cha. refresh your secotloction of | 6B marked for identii(cMcaCtaiboen.Dseposition Exhibit No. 46 was | | PE 6 He. Metube, 1 going to hand you what been 10 rebrusry 17th, 2005, e-asil from Susan Stainecker at 11 Dutont to ChadHollideyof Dupont, subfect on? I ~ 12 A. That appears to be a, an e-mail from Susan to | 16 prepared to do something. he concern 15 abroad 17 16 statement about product safety. She stressed tha ail ve sant 5s to restate what they ave said." She gous an. 1 bo you see that 20 a tse a 2 0 md its your undecstandsinogn seen 25 corrects 2 A Xone recall the sequence, 1recall tha recorbortreparemom | i - W. Michael McCabe 1 2 EPA the has, throughout context of risk the PFOR process, assessment or the whether it was in enforceable consent 3 agreement, or the stewardship progeen. has made 4 statements, and Chink in the context of the AB, too, 5 has made statements putting she, the heeith effects 6 impact of eron in content. , 1a 1t your understanding that Linda Fisher would be peraiteed to have discussions with curcent 8 3 ottictals avout pron? 10 us. srowes: objection to fom. 1u2 hie oserne HUE WITNESS: x, don't xecall this, 13 Br. smo: M 0. 1% not asking whether you recall the 16 understanding, trom yous Knowledge of what the rules ace 17 as far as what Commer SEA people can do. whether Linda 16 Fisher vould be -- would be permitted to be having 15 contacts with current EEA officials about PRON? A. You would have to check with Linda on what the 21 Linitations on hes post-employment restrictions ace. 2 0. Are you fantLiae with the extent to which 23 24 outont explained to 0.5. EEA that. their own Epidemiology Review Board had told the that they could not be making wncorber reportingoom pos | i | | J| | 0. Michael Hecabe | Page 161 | 2 with exon in rebruary of 20067 3 vo. stam: Gajoction to com. Po | 6 ov. sor: 11 that its om Epkdemtolosy Review Boned disugsesd with } 12 statements Like thats 13 us. stows: objection to form. 16 17 comnicated anything to 2A about any, any statements chat theyrue mace. 1 16 communicated 50 tht, to the aston that 1 would didnt, and ot the time nave sas 20 21 unaware that apd toura. theze vas any communication on tn by the 22 wows. sors: 250 2 ha as soinstobe mynext uestion 00 you know, vere. you aware that nr corbettrepartcinogm rage 104 W. Michael McCabe f | { 2 3 consultants ever oron tases prepare draft talking points for BA on || s 6 0 In fact, soon ater the communications between ouont and BEA in February 2006, where Dupont. expresses 9 tolephone conterence on acch 20d, 2006. Corrects 11 011 2100 had bean making public comments about the 13 Q. Susan Stalnecker had a good working .) | 1 wr we srsore: 1 Gd, in fact, your understanding was that they 21 22 marked for (Mccabe Deposition saencssication.) Exhibit No. 47 was [ 23 om. srsore: 24 0. boyou recall hoacing that acter Dufont made || W. Michael Mecabe | . Page 185 | 4 A. Would you ask that question again? | 5 6 EEA to makeDostyaotuemernetcsalalbohuetarPiFnOgA tshaatfetayftienr Dupont asked February | 72006, that 5 statements Susan Hazen for ouront? of 0.5. en agreed to make those Sh 1 seem to recall that thore vas an agreement N--. O15 wtscustons wich oon prior co a suren 20m, 2005, 15 resaeer ge A I'm not sure. 1need to have more sequential 17 incomation. w 19 as OH. penanat 47, Mocabe, 1've handed you whbaeentmarsked 0 a biewsese. ves. n 22 of an Od ask if you identity EEA alatein press conterence that as acranseript an ss eroR Grover 23 Stovardship progres fram Hazeh 2nd, 20067 2 A Thats what this says, yes. ee -corbettrepartionogn - - W. Michael McCabe page 186 1 . And it's your understanding that since March 2 of 2006, DuPont has repeatedly quoted U.S. EPA's 3 statements from this press conference in DuPont's press 4 releases regarding PFOA. Correct? 5 A. That's my understanding. 6 . What was the need for EPA to hold this press 7 conference on March 2nd, 2006? 8 A. don't specifically remember what the, the 9 context of this was. 10 Q. Is it == is it your understanding that in the 11 spring of 2006, after the Science Advisory Board report 12 came out, draft report, that there was also then a 13 petition that got filed seeking to have PFOA listed on 14 the California Proposition 65 list? 15 A. Idon't recall what the date was, but I do 16 recall that there was a petition. 17 . And because of the increasing amount of 18 adverse publicity surrounding PFOA and DuPont products, 19 DuPont started the creation of a new communications team 20 to take a much more aggressive proactive approach to its 21 communications on PFOA. Correct? 22 23 24 specifics? MS. STENNES: Objection to form. THE WITNESS: Can you give me more www.corbettreporting.com p.98 | | i | }| | 0 = - - p.99 ET 3 J 1 by we. wriorr | Page 167 i| | 3 communications team in the spring of 20062 ` A Tas involved at various tines in | | 5 communications on PFOR. And whether it was part of a 6 newly constituted team or Just part of the ongoing effort | | 7 to have good communications with GBA and the public on | 8 this tssue, 1, 1 just don't recall. 5 0. It's your understanding that during the 0.5. 10 BeA`s 5G BCA process that we talked about earlier that 11 started back in 2003, there was a group of companies that | " 12 participated in that process that together referred to | O 13 themselves as the Fluoropolymer Manufacturers Group, or | 14 PMG. Is that correct? | 1s A Yes, that is correct. | 16 Q. And were you tnvolved in, in that group's 17 efforts to set up a Communications Working Group or CHG? 1 A. Twas generally not involved with tne 19 Fluoopolymers Working Group. 2 . Okay. So were you involved | 221 0A. WOerremanyuofuacdtouvreeirv'esd ignrouapn.y of the actor by ere [ | 23 MG or its Communications and Working Group to actively 24 retain third-parcy spokespersons to speak in favor of ww. Corbet reporting.com i - - 5.100 Page 108 i 3 any HG activity on that pace. | 5 Hnaortdbaals1tratfoergycwoamsmunaidcoapttiendg ionn20r0o6nresfuereresd to as "Clean |{ 7. A. I Lot think I nheearudstthseaytertmh.at 1m about foue | 2; wcw opore: orxar. et 1 14 marked for identiication.) | 15 BY MR. BILOTT: | 10 Hacabald.* going to ask 1 you eve cacall seeing 15 this document betorer 20 htm net sure whether Tvs seen this ox not. 21 do recall tho torn. 2 a ma in fact, ouront, begioning in 2006, 23 adopted a new skeateay on FOR of taking a more 24 aggressive spprosch in responding to media reports on = - 101 vage 103 | 1 PFOA that it thought were inaccurate or misleading in i 4 Q. And also adopted an approach of taking a much i 6 such as the Environmental Working Group, of others, that | 10 point they exe actualy speaking directly with the 12 Qn tack, one of the things tha pont aid at 13 this same period of time vas to try to tnitiate | 15 cbtain thets support. fox this now PRON seduction prosean. | 16 correct? | 111907 EvicomA0.entaTtlhaadtsDuirspoknctorSriedcot.navtne maeeetinogsgw,ith ntheec ||| 20 a mess corvect. | a We Brine. Take a break. 22 OR ---- 25 the secors, 2 (Bete recess oxen) | 6 period of time. | 7 --You were talking about the new "Clean { 12 that period of time was DuPont's perception of an i 16 0. oo you rece seme concomn about somecing ` 2210 Cocsing on erun water contamination fesves st vovions these groups that DuPont considered activist groups were | | re | Page 191 1 1 Q. And one of the things you participated in at | 8 specific meeting. i 12 to what was occurring at the various DuPont sites with | 13 respect to union environmental activists? | 15 MS. STENNES: Objection to form. 1 21 marked fox Wacabe Saponition sdemitication. Sabi. to. 49 wan 22 v0 wm. wore: 3 a He Hecabe, Tm sang to hand you whats boon | || - p04 1 an e-mail that was seat to you and others from Susan i 2 Stalnecker regarding a, an outline for a meeting with ! 3 U.S. EPA on March 30th of 2006? | 6 0. nd in hor Overall Objectives for the necting, | 20 50 you see that 13 th cms on the soon fox mectin 0.5. 0 in che | - 5.105 weiss | 2 chemicals. We are taking steps to verify such tests and ] 3 include the broader ranges. We are also indicating i 5 comptes | . 2 yo ses wr 6 Do you recent a meeting with 0.5. EEA in 2006 | in which Dupont atacursed vith 0 fs concerns in this 10 ceguras 11 A Xdo ceceld that there vas discussion over a 12 number of activities at different sites. And I, I think | 14 xecatt 1 betng the foual puta. of the meetin. 10 sisovsnes. Coren? 10 been a focal punt, T vould have remebered i more -- : 2208 moro sor stemstf(uMmcaCnaiboen.Dseposition Exhibit No. 50 was A 2 0 We. teabe, Tm going to hand you whats been 24 nets on sem SE 7 4 2 3 yo on SESS - 106 [a 2 Seeing? ` 50 you see Shae? || SA 1 see thar i 6 Q. In the first paragraph, quote, Bobby Rickard, | 1 A ete corset. 14 its sive? 19 because of the number of ditferent BEA regions that vere 20 involved, we thought it was important that they be made 22 relationship between the repional offices and 23 headuarters that night communicate some of this 20 information. and because of ouFont's desire to be in, in > - 107 rage 195 | 2 area, Chink that it vas felt that it was useful to | 3 communicate is. | oa paren an fox any asstsance soon 0.3. | 6 its sites with respect to PRON? | 1 A. As I recall, I think that DuPont did ask that | 11 tpactmenta, assent ininisieaors within 58, OTP, 13 The communications are generally very poor, if existent | 15 pesticides regulation and the fact that the states don't i 17 of the other delegated authorities. | 20 rooms. offices ans shave wich then formation th had 21 beam collected so tha, agin, the pubic wouln't be 22 slammed that there could be centers. pu. azo the 25 information that 58 had developed: and tht St could be - - 5.108 1 0. Do you remember, in comection with eage burent's 196 |: 2 revised approach to be more proactive on pron | 3 communications, in the spring of 2006 Dueoats adoption } 4 of something called the "No Free Shot Plants i s A. No free shot. I don't recall that. 6 pact of the "Clean Haraba1 plant Was that ] | Ta matte wha 1m asking you. | 85 Mo Free Shot PlanDto or what that vas? you recall any discussion about the 1 0 A 1m seca. 10 In = do you recall that in April, soon atter {| 1132 btuhpiosn,t.iinnAvporlviilng200c6o,ntaaminneawtiloanwsuofitdrwianskifniglewdaatgearinwsitth 1156 aA. AInddidthehnearsooanboautrtetrhatt,hatyesa. Lavauit was filed 1 17 against. DuBent involving contaminated drinking water in 16 West Virginia in Parkersburg. Correct? 19 Al I'ma Little contused about that. I gensratly 20 recone. 2 a it wis, in fect, the day after a newspaper 22 story appeared ta the Tackersbur paps referencing the 23 fact that Parkecsburg city water had PROB tn it above the 24 16ve Duront had agreed to provide clean water for under | | - - p.109 1 the = let me restate that. I | 2 (McCabe Deposition Exhibit No. 51 was | 3 marked for idoncisication.) | -- 5 0. th. metas, I'm going to hand to you whats 6 sacked 2s EMPL 51, and ack you to take a moment 0 7 Look'at this and tell me if you recommize this as a o Dutont. Interna e-mail from ay 22nd, 2006, including a 5 posting con a newspaper acticle encicled "Parkersburg is 10 Contaminated, Too"? 11 A ois sopescs to be an e-mail from David Boothe 1132 Gand forwarded to a nyuomubewrillofnopetoipclee.that David Boothe forwards | 14 this on Way 72nd, 2006. Coreest? BA ve 16 cave Deposition SADIE No. 52 vas 17 nachos fox sagnesftention.) 16 x wh. Bisorr: } 15 0 Me. Hecabe, T handing co you whats been 20 Seckws v5 Sania Se" wos 2A Yin BONE WORE 70 and ook at that, and tell me if you recognize that as an 0 sis as do vas ane at 4 The Bo $6 408 23 from David Boothe regarding EA vater? 28 A This doss appenr to be nm eemil chain. Tat eeBe E 1 me look at it. Yes. vage 198 | } 2 Q. And this includes an e-mail to you from | 3 Mr. Boothe the very next day from the exhibit we were | 4 ust Looking at, where there is a reference to meeting | 5 with EA on water issues? | 6 A. There is a reference in this on having a | ! 7 meeting on a conference call on Thursday. | 0. Aud, in fact, you were asked to set up a call 9 with 0.5. EPA to try to initiate discussions with the 10 Agency to come up with a BPA water number for PFOR in 11 drinking water. Correct? 12 A We had discussed internally the advisability | 13 of setting an EPA standard, of exploring what would be i 15 Given the fact that the --- that risk 17 set was not moving forward, that this issuc was one that 16 vas not coming to closure, and we wanted to have a 19 discussion with the Water Office, and anybody else that 20 the Water Office invited at EEA, to see vhat some of the 21 possibilities were, what some of the legal regulatory 22 possibilities were. 2 MR. BILOTT: We have to go off the 24 xecord for the tape. | | - - p11 1 THE VIDEOGRAPHER: We are now going off i 2 the record. This completes tape No. 5. 1 3; (Brief recess taken.) | TUE VIOBOGRABHER: He ace now back on | J---- Ta We were talking about events back in Hay of 5 59 May 24th, 2006, there had been tuo 10 new Lawsuits 110d against. Dufont, one in Now Secsey and 12 drinking vater. And within a day of the parkecsburs 13 Lavsult. being iled, David Boothe had asked you to s6t up 14 2 meeting wich 69n to discuss 16 0 ALL righ. Tou set up ~ you called 0 to 17 set wp a nesting. Corrects 18 A 1 Nad been working on setting up a meeting 19 long before that 20 think what this e-satd snatcates 5s 21 that, that ic wasn't a meeting, 5t actustly was a 22 contorence call, with 0 water office had been set up | 22 for he thursday that is tnaicated nore. put as anypody 24 who vocks with BER knows, you don't set these things up, a p. 112 Page 200 | 2 offices together, in a day or two, that it takes time, | 4 information came out. | 3 and I had initiated this long before any of this i 5 @ 16 vas your understanding, though, thet you } 4 tritiated 44m users epi wad 4 dtm i ee | 9 old CAT Team standard. Correct? i 12 a5 we vere discussing a whole zane of options on how to | 10 stamiucs sen. Teta the Sopiond comsome of process what | 15 smvolves a deatt cisk assessment. And we had slvays 16 sass on toe cas <sai assessments a2 bung 4 proses 17 thar insomed of that eventush member, and ve Had hese 16 thar the draft rink assessment was not moving forward. 15 This would give some cegulatory cestainty, so ve decided 20 to Look ot -- to fnitisss this, this discussion vith the 21 Hater ottice sbout hat som of the apsions vere. NS 2 0 ad this aiacossion with the water office was 24 initiated right after the Laveutt was ited in | - - p.113 page 201 | 3 coincidental. | A | . cate Seosition BEBE to. 5 was | $n Hen ner Lm Sentient 12 as Exhibit 53, and ask if you can identify this as an 15 A. This looks like a, an e-mail from Susan | FE 25 wast term Harty Tevet ovations te Sedberson | | | oo o p. 114 LA Thar that i oppended to her e-mail. page 202 || 4 number. Correct? i 6 not. to arrive at a new water number. To our knowledge, | 87 atihsecreusswiaosnnoabonuattioananlatwioantaelr wnuamtbeerr.muTrhi.s was a | 5 0 10 vas your vas ft no your undecstanding 14 address any drinking sates contamination above a certain 15 A level? -- } 11 a awd that 0.5. 5A had dssued a Safe Drinking 10 ater Ack ardor to Durent in 2002 cha. hod adopted that 15 numbers EE ---- 21 0 Was ic not your understanding that tha was a 22 consent. order issued by 0.5. BEA Regions 3 and 5 in 20027 [ 55h hacemy understanding. 20 0 So it there vas already a 0.5. Een order to 1 DuPont that established at what level DuPont was to | 5 THE WITNESS: Because, because that was | J 10 the new consent order wich sont snmauncsa 13 A. That's correct. | 16 ; THE WITNESS: I'm not sure what your 2210 woonst ees came up with under the November 22, 2006, consent order a 29 are seeing to hee of wey the 2204, share we ad 3 p16 Page 204 | 1 not related to the Parkersburg issue, was not related to | 2 any suit that had been filed | 3 It was in the context of a broad review | 4 of regulatory options on whether a water level could be | 5 established, a national water level could be established, 1 6 either as part of or in advance of a risk assessment | 7 being completed. 8 0. ma are you aware of any documents reflecting 9 some earlier initiation of a discussion on that level 10 before May 23rd of 2006 that you've ever seen? 1 A nek hat again. | 12 Q. Are you aware of ever seeing any documents i 13 that reflect that Dupont vas having any discussion on the 14 topic you Just described, a national water standard, 15 before Hay 2324, 20067 16 A Ident recall, but I wouldn't be surprised if 17 there wasn't some discussion. We were looking at a 18 nunber of different options. 19 Had Dubont ever met with U.5. EPA and 20 discussed a national vater standard for PFOR prior to 21 may 236d of 20067 22 A Ident recall that we did, and I'm almost 23 positive that ve didn't do 1t with the Water Office. 20 0. What vas your understanding - let ne ask you | . - 117 Page 205 i 2 A. And the Water Office would be the appropriate i 3 entity within EPA to work on a water standard. | . ve. seams: ugectson to rm. 11 class action suit that was brought? 1 12 ov un. Bisons: | 2 ---- JO we. ssw itor: tcet ometgsus inion te | - - p18 bage 206 !| 21 tDurPeoanttasnatbouotr cwhleotnhewratoerrnotto tthoesCiimtpylyofproovrikdeerswabtuerr, { i 3 unin vas 2150 contaminated with POR above 0.05 pets | 4 ex billion? | 5 MS. STENNES: Objection to form. | o7 wqueusnt.ionoraigoani,n? | SO. Have you ever had any discussions, 1 mean, 10 have you ever participated, X should say, in any 11 dtscussions with anyon at DuPont about whether to sisply 12 provide the sama kind of water treathent for the city of 13 Parkecsburo that Dusont had alxeady ageeed to provide fox 14 other communities around Parkerabuey vith BOR in thet 15 water above 0.05 pacts per bition? 1 #5. STEwES: Objection to form. wn HE WITNESS: havo not had that 10 discussion. 19 1 wn. rior: 20 0. xe you aware of anybody over having that 21 discussion at oupenc 2 v5. STENES: Objection to form. 2 THE WITNESS: There may have been, but 1 24 wasn't pasty to those discussions. i - 119 rage 207 | 1 BY ur. BrLOTT: | 2 seme question with respect to ew Jersey. i s ave you ever heacd of any discussions | 4 about DuPont evaluating whether to sisply provide clean | 5 water to communities in New Jocsey where the level of | 6 PFOA in the water is above the same 0.05 part per billion | 8 settlement in Hest Virginia? i 5 HS. STEMNES: Objection to fom. | TUE winuEss: dont believe hat 11 haven't been part of any discussion to provide water at 12 those Loves. PR -- 1 a e's your understanding that Outont is 15 providing clean vater to communities in Ohio and West | 16 Virpinia where FFOR was found above 0.05 parts per 17 bition. corrects 16 A atts ay understanding. 15 0 Mad based on your undexstanding of eron and 20 the resulatory issues surcounding PROB, 1s it your 21 undezstanding that that 1s the weong thing to be doing? 22 us. stames: objection to corn. [ 2 TUE WcTuzSs:. It appears that at shat, 20 that Loved 1ta -- that Levels well above that level are . Page 210 i PR a Held, the Court will decide what's irrelevant | 5 or not. | 7 What is your personal opinion? | 9 in our Clean Water Act and Safe Drinking Water Act laws | 12 water -- our water levels. | 16 Q. Yes or no? i -- | | cee eer SEE ------er--E------te | Lo cher 1 think thers chess. Page 211 || 2 nie nee en ! 3 discussions with U.S. EPA Regions 3 and to develop a | 4 water number for PFOA. Correct? | 6 Region 3 and 5. he discussions vere iniciaed sith, 7 with Hoadauarters, and Region 3 and 5 were brought ince 10 in, wnat, 2002, 20037 1 forget che date. 1 0 During those discussions, id anyone fren 13 uPont claiing that the Level of 50 in water in west 14 Virginia in packersoucg xas above 0.05 pasts per billion? ! 17 recall, but T 90 win: 1 done wouldn't be surprised At spectttonily they had nor. I 19 a hut vou dont hms 2 A Tams recs. 2 22 same Lawsuit Ws. STENES: You azo talking that you suse zeferenced sariice, about the Suse for 23 the rocorar 2 WA. BHT: 1 tatking about a Lewuit - - p12 rage 212 ] > Ws. STEWES: Filed in Federal Court? | 3 eases sor scmeiicaion. | 6 ox wr. prior: { TG He. Mecabe, Tm handing you what's been marked 5 that as charts from a meeting between owPont and 0.5. 5 10 on aune 2204, 20067 12 vo wen. | wt onc 13 Q. And you participated in that meeting. i oa ra | 16 0 and one of the chings you eventually n (Mccabe Deposition Exhibit No. 55 vas 22 marked cox tgenticication. 2 THz wImESs: What was your question? 24 ov. priors pz cee rage 213 !| 1 0 et me ask you to take a look at this | 355, and ask if you can identify that as your e-mail to | 4 Susan Stalnecker and Linda Fisher and others at DuPont { A 6 ten in June 20067 1 A This does eppess to be an e-mail from me to 3 caaare 13 a. and one of the items you reterence here that 14 wild be done 1s, quote, assess the spect of different 16 20 you sen share va we 18 ousens, compianer 2 ws. STEMES: Objection to fom. 2 TH ATR Tm bagi to Se % 22 think that. this followed a aiacussion share Duro: 23 presented to BEA the pharmacokinetic tapacts of 24 consumption of, of wate: and blood levels associated with - potas re | 3 that consumption. Page 214 || 2 There was a range within that | 3 pharmacokinetic assessment that represented what might be | 4 determined threshold Levels, and they corresponded to, to i blood levels. I think that thats what I vas referring | 6 to. 7 ov me. orvorr: 6 0 50 you recall whether Ouront Looked at what 9 the Smpact would be Af the new number was 0.05 pacts por 10 bition 1 A It amt celevant because it had no 12 relationship to the pharmacokinetic relationship between 13 water consumption and blood lovels. 1 a. So that as not one of the numbers bubent 15 considered [CE 17 a. Do you recall that ducing the time that buront 16 vas discussing this Sasue with U.S. ERA, Dubont also 19 Learned that tho State of New Jersey wes planning on 20 Losuing ita own number for BON fn drinking water? 21 A I forget the, the time sequence, but it might 22 nave been around this time. 23 a. and oupont, to your knowledge, had some 24 concen that the number zon New Jessay might be | Page 215 | 17 ara rn te 80 a rr mr 15 me senting om snes min - ALIEN age 216 i 2 incorrect? 3 a mats corsect. | 4 nemo. hQ.ichAnadctutahellyStvaetnetoofutN.ewundJeerrseby yreceRiivcekdartdhsatname. l! 6 correct? | J Sa And 10 Fost, reviewed the that state memo of New Jersey, and then sent a theeush Lester locks back to 11 butont. disagreeing with the Dupont anslysis. Coreect? 12 MS. STENNES: Objection to form. ` 1134 some aspacts of itT,HEbWuItTNtEhSeSy:didTheayc,knotwhleeydgteootkhait.ssuteheywith 15 414 no. have the Aost up-to-date information. 16 5x me. srtorr. 11 0. he state of New dersey did net change sts 19h Mo, they didnt change their analysts. 20 2100 <= md in fect, during the discussions with wich BEA about the water number, it vas Dupont 22 23 that actuatiy as the mabe. proposed that correct? 7 use 0.5 pares per bisiion 28 a he atacusstons with smn savoives a xange of | Page 217 i 2 themselves. DuPont's number, which was an analysis that 1 4 posts per billion, and that vas based on the ! 6 EPA came back and said that they needed | 7 a, a lower number, and they come back with a range. i 9 lower number? | reek aati a ero se ! 13 suggested the 0.5 number? | 16 vere 2 mma of spare tht vere discos. 4 2 ri JO ---- | To _ p28 | rage 218 | 1 submitted that to Duron. for review. Correct? | 2 A. Yes. 3 0. And DuPont was upset When it saw the draft | | 4 because U.S. EPA included language under the Safe | 5 Drinking Water Act referencing that there would be an | 6 imminent and substantial endangerment to human health | 7 from FOR in drinking water above he 0.5 number. o correct? SA Tthink, as you've mentioned before, the 10 consent. ordor that xas agreed to that set the CAT musber 11 at 150 parts per billion was based on o 1431 Imminent and 12 substantial Bndangerment order. 13 EPA felt that they needed to amend that 14 order and keep that order in place. It included that 15 language, as all 1431 consent orders do. 16 Q. But Dupont was not happy when that -- when 17 that language was included in the first draft, and 18 specifically told Be that the deal vas that Dupont would 19 agree to the number as an interin exposure level and did 20 not want it tied to any imminent and substantial 21 endangerment. Language. correct? 2 MS. STENNES: Objection to form. | 2 THE WITNESS: It vas felt that by 24 including that language, there would be undue alarm and | i -- es wae] | 1 confusion in the community, and that Duont had done a ; 2 3 lot and of to work at restate addressing community concerns about this, that language, particularly in the context | | 4 of a now level that was significantly Louis' by many, many | 5 orders of magnitude, would unduly concern and confuse the | 6 community. | 7 5 we. sro: | 58 that Ki0nd ofSoTDaunpaonstediind etxhpreorsdserc.oncCeronrsrecatbsout having || 0 a ves 11 0 I'm going to hand to you what's been sacked as 12 Exhbit = as Exhibit 56, and ask you to take a moment to 14 document before? 15 Ws. STEWES: For the record, it's not a WR. BLLOTT: In what ay is it not | 1 complete? It's the document in the version produced to | 19 us by Dubont. I recognize it starts on page 7. but 20 that's how it vas produced to us. 2 THE WITNESS: I don't recall this 22 specific document, but I an familiar with some of the 23 discussion and arguments that are made in the document. 24 5v wn. rior:  1 Q. Did you draft this document? p-130 page 220 | { w-- ee. 55 0. men ht secre ne seotection th i 14 was Dupont who proposed that musber to ERT | ) em _ i 1 0. Do you recall there being discussions Page between 221 i | 2 burnt and Ean about. the extent to which any public i 3 comment or public participation would be allowed in | 6 . Do you recall any discussion between DuPont | 7 and EPA regarding the extent to which the public could | 8 comment on or have any involvement in this new number? | 10 upon what coment period, if any, wes necessary for a 11 revision to an existing 1431 order. 12 And what was EEA's position with respect to 13 the extent to which the public should be allowed to have 14 any comment on it? 1 A. T don't recall specifically, but I think that 16 the understanding was that since this was a significant 17 revision downard, and that thete had been coment 18 afforded in the first order, that it wasn't necessary to 19 have a public coment period for this. But I'm -- I'm -- 20 1 don't recall the specifics. 21 0. what vas bupont's position with respect to 22 Whether public comments should be allowed? r 23 A. I think our position was that since this was 24 50 significantly Lower, that public comment wasn't | | - p132 1 necessary, and it was a revision of an existing ordePra.ge 222 i | 2 @ bo you recall that after butont received the | 3 initia) draft of the propesed consent. order with this new ! 4 number, and DuPont was unable to get the EPA officials it | 5 6 wiamsmindeenatlinsgubswtiatnhtitaol agenrdeaengteormcehnat.ngeisstuhee, that pukont language on the { 7 inttiated discussions with Headquarters to try to get 5A to change the Language? 5 a ek thet again. 10 0. vo you recall that acter buront vas 11 unsuccessful in persuading EPA at the regional level to 12 change the Language of the consent order to take out the | 1143 iinmimtiinaetnetdanddiscsuusbssitoannstiawlithenpdeaonpgleermeanttBElAanghueaagdeq,uarDtueProsntto | 15 try to get that done? 16 A do recall thee. 1 0 ere you part of those discussions: a ve 19 a ho did you carts 20 A oh 1m sure 1 called a number of people. 1 21 thio called a umber of pesple at EEA. cont recsll 22 speciicatly who. 23 Were you given any guidelines from butont as 24 to wat you were to achieve by your callss | -- nd sme eee, Page 223 || 1 A. Well, what we were seeking to achieve is to | 2 remove language that we thought would unduly alarm the { 4 down to a level that was highly protected from a i 5 Pharmacokinetic standpoint, and we didn't think it was | 6 necessary to have this as part of the overall message and 7 order that went out. 8 EBA countered by saying it's a 1431 9 order. It's got to be part of the order, because that's 10 what we're basing the order on, and that's the basis for 11 this new level. So they stuck with that. EPA --- EPA's 12 the one that interprets the Laws unless you vant to | 13 shationge tt. | 14 Q. So what happened during that last negotiation 15 meeting in Novenbor of 2006 where DuPont met with EPA to 16 try to get a final agreement on this consent order 17 language and was still seeking to get that imainent and 18 substantial endangerment language out, how --- let me 19 restate that. 20 Why did DuPont accept that imminent and 21 substantial endangerment language in this consent order? 22 A. I think there were a number of reasons. 23 One is that Dupont felt confortable with 24 the eventual number that was arrived at. They also felt ST ew page 224 : 1 that EPA understood, in fact, EPA initiated some 2 discussion about concerns about the public J 3 misinterpreting the imminent and substantial endangerment } 4 language in that final discussion. And it was felt i 6 Language wher butont was going to disagres with sons of | 7 the scientific conclusions that EPA had reached in i 8 setting this level. i 9 So I think that, as with any | 10 negotiation, you win some, you lose some, but that it was 11 felt that, particularly as regards imminent and 12 13 substantial of that and ehnaddanngoerimnetnetr,estthaint, EPiAn uanldaerrmsitnogodthethceomcmounnteixtty i 14 unduty. | 15 Q. Do you recall any discussion about the extent | 16 to which the new nusber under the consent order would, | 17 would have any impact, if at all, on the Parkersburg | 19 Ao. 23 the extant. to hich th nx mumbai Input te How | 20 Q. Do you recall there being any discussion about | 22 Jersey lawsuit against Dupont? r 23 A. No. | 2 (McCabe Deposition Exhibit No. 57 was | || : i - | | 4 assistance, because this, this restroom has a double door | S that makes it very difficult for me to get in and out of. | 7 THE VIDEOGRAPHER: We are now going off | 12 THE VIDEOGRAPHER: We are back on the | 413 oe.record. anor | 15 Q. Mr. McCabe, I'm handing you what's been marked | 17 ame te Anon Linn a5 Out 10+ ms 22 ovens mosoee, 23 Q. And it's your understanding that the documents | - - Pp. 136 4 A. Let me look at this. | 6 although T haven't looked at all of the documents. | 12 than memorialize this new number though a Safe Drinking | 13 Water Act consent order, that the Agency consider | 16 A. That was one of the options discussed. | 10 proposed -- uttine of Frpared serene of Pmt | i pr cern rage 227 |/ 1 proposed Memorandum of Agreement. to EBA. Correct? i 2 a ves | 3 0 and on ote non accept shat fom for | 4 memorializing the agreement. Correct? | 6 0. and insisted on it being a Sate Drinking Water | 7 hot order. correct? 8 A Correct. 5 0 During your involvement with negotiation of 10 this consent order between DuPont. and U.S. BEA, did you 11 have any dealings with a Mike Steinberg of organ 12 Lewis Bockius, attorney for Dupont? Bon ve | 1 0. nd what's your understanding as to what he | 15 was --= was he involved throughout the entire course of 17 AT believe that he was, but whether he was at 18 every stage of the discussion, T just dont recall. 1 19 know that he was providing counsel. 20 0. Md it's your understanding that during the 21 negotiations, when it becane clear that EPA was insisting 22 upon a Safe Drinking Water Act order, including the 23 imminent substantial endangerment language, that buront 24 prepared a List of concerns with respect to what the | | | - p.138 1 impact of such an order would be? 2 A. I seem to recall that. Page 228 | | | 3 Q. Mr. McCabe, I'm going to hand you what's been | 4 marked as Exhibit 59, and ask if you can identify this as | 6 individuals, including yourself, forwarding an attached | 7 List of concerns? | "| 9 110t of recipients, tnciuding mysere. And attached to st 10 are concerns. 1 Q. The third - and you have seen these concerns 12 before. correct? | 13 A. It looks familiar. | 1 . The third bullet point down under the | 15 Concerns, the attached Concerns are, quote, Positioning 16 0.5 ppb as a threshold of `imminent and substantial 17 danger implies (from PK) no Margin of Exposure of, at 18 best, an HOE of 10 for the world population. 19 00 you see that? 20 A Yes, I see that. 2 Q. And do you recall discussions between U.S. EPA 22 and Dupont on that point? 23 A. 1 believe that we did have discussions. 24 Q. And what was EPA's position with respect to | -- eas Page 229 ! 1 that point? 2 A Let's ses. I think that their - I think i 3 that, as I recall, their position was that ~- I think ; 4 that their position was that they felt confortable with | S that level, and that that was one that they felt could be | 6 supported in the --- in the order. | 7 6 Q. disagreed Do you recall EPA that that would be ever stating that they the implication from 0.5 | 9 ppb? 10 A hat they disagread with what? 11 0. That an implication of this nature being | 12 implied from 0.5 po? | 13 A. I'm sorry, I'm not understanding what the | -- "ls Q. The implication -- do you -- do you have an 17 disagreed that the margin of exposure would be 0 or, at 18 best, 10 for the world population using this 0.5 ppb 19 number? 20 21 whetherA. theyI'dmisaafgrraeisdd Iordonno'tt. recall. I don't recall " 22 0 One of the other concerns unser Constorency of 23 Approsch and Message, secend bullet item, is 24 *Tuplications for ongoing and new Litigation. Then in | || 1 parens, water and consumer products, close parens. Page 230 | i oe 00 you see that? i 3 A 1 see that. | 4 Q Do you recall there being discussions between | 5 DuPont and EEA in connection with this Safe Drinking | 6 Water Act consent order about the implications of this | 8 AX remember that we had discussions about that ST think that there were discussions with EPA about the, 10 the implications for, for litigation, but it surrounded, 11 it was moce around the imminent substantial endangerment, 12 35 1 recaln. i 13 . What's your understanding as to what DuPont | | 15 111gati0n2 i 16 AT think it just --- it was a question of | 17 confusing the issue forther. And that was pact of the 18 reason that there was the concern about the imminent and 19 substantial language, that having worked so hard with the 20 communities to address the issue, that this, this new 21 order would unduly alarm the communities. And, 22 obviously, that has a tie-in to the litigation that had 23 occurred previousiy. 20 0. And in connection with a concern over what the i - fe Pp. 141 a ..= vag 21] i| 3 . In connection with those concerns, DuPont i 4 expressed concerns to U.S. EPA about the way in which | Toa we 0 tna coninaes on cha thoy shouts mt say | | 10 1 booze abou. correct? the sate of Pron and consumer products. 12 13'to A. It would not be rettorate what they had inconsistent to, to ask them said in the past. I don't | | 14 recall specifically that, that component of the message. 15 (McCabe Deposition Exhibit No. 60 vas | | 1FA6 marked for identification.) { 10 15 85 0. BAbBAL ne. 60, Hecabe, and ack Ion hansing you 1 you Sdemiy what's been mashed eh 35 an ermal 20 21 tom 5En, Susan Scalnackee of upon which you vere Duron copied, to Hack slong Folin at with others, 0.5. from 22 vovenser sen, 20062 25 24 trom A Susan bacase me. Stainecker This does sppese to Hack, snd 1 om to be an acmait copied on 15. | | | ! = - p.142 i 4 past few months, you may not appreciate the level of our | 12 A. That's what this e-mail says. | 15 a threat? i 16 A. No, I don't recall that. | 15 tevsg sseomres stoner 26 tae. et. 70 sr 2=2 facts sheet vith tNhePir public press release. |[ : 24 A. I do recall. | 1I -- YE Page 233 | 1 0 An it was several pages of background as to 2 how the number had been developed and why | 3 00 you recall that? i 4 A ves. | s Had DuPont seen any of that language before i 60.5. BEA released it in November of 20067 ! 7 A. Oh, boy. I, Idon't recall. I think that | 8 there had been components -- I know that as we were | 9 developing the consent order, we were asking EEA for what | 10 their = the basis vas for their, their concerns about | 11 this. What new studies, what, what issues that had gone f 12 nto their --- into theix approach and decision, | 13 particularly a Chris Weis memo that had been developed, 14 Which nad not been shared with us. nd we asked to see | 15 811 that, and 1 believe that we saw --- that we sa it 16 before we signed the, the consent order. 1 But whether that vas the equivalent of 16 hat ended up in the facts sheet or not, I don't 19 zenenber. 20 0 It's your understanding that when U.S. Een 21 announced the revised consent order, one of the things it | 22 represented to the public vas that this vas being done at 23 the request of the Ohio EPA and the West Virginia EEA. 2 00 you recatt shat? | | _-- pms 2 tact, 1 a0. | Page 234 ! 1 A. I vaguely recall that. Yes, as a matter of i 3 Q. And is it also your ---- 4 A That as included in their statement. : I | 6 Ohio EPA didn't even send the letter requesting U.S. EPA | 8 reached final agreement on the consent order? | 10 0. Do you know shy Oho 5PR was not even informed " vs. STEWES: Onfection to fom. ! 13 14 51 wn. oro: THE WITNESS: You will have to ask EPA. | 16 58 ox Hest vipinia BER on the consent order? Wa we, x sia net. 16 0. To your Mmovledse, dia anyone at Dupont ave 20 Language 0.5. 58 used in 185 fina fact shest for the 21 tina consent ore? a a epee Ebi vo. 61 vas | 24 marked for demsication.) | || 1 oe we. store. vage 235 | | 3 as Exhibit 61, and ask Lf you can identify that as the i 4 final fact shect released by U.5. EPA on November 21st, | 6 along with an attached copy of the final consent order? | -- 5 10 0 Involvement and do you recall whether vith deatting any portion curons of the had any Latgunge 1123 drateinA.g the1 daoctnotshtehsi.nk Dupont had any involvement in |i 14 To your understanding, did anyone at purent | 16 Language used so this fact shoacs : Ta 1 um dont reenit. 18 0 After the consent order vas Einaiised shat 15 20 wo've Just been talking about, that the ew Jersey Department it of came to your savisenmental attention 22 planning an finalising snd xeleasing ito Final numves on | i - - Pp. 146 Page 236 1 2 that picked the 0.5 number was released, you became aware | 3 that the New Jersey DEP was planning on releasing its | 4 final number for PFOA in water? i 6 BY MR. BILOTT: | 15 A. We were -- I was -- I was instructed to | 18 number that it had come up with as part of that process 2 rene 22 the zecord. his completes tape to. 6. f | - o Pp. 147 vage 237 | 1 the record. This commences tape No. 7. | 2 Please proceed. i 3 bx we. srior | . Were you ever involved in any activities i 5 relating to the State of North Carolina's efforts to 6 select a number for PFOA in drinking vater? Ta vet directiy, ne | 8 Indirectly? i 101, 1 wasnt involved. | u Hcabe Deposition Exhibit No. 62 was | 12 marked for identification.) | 113 BY a. we. MR. BILOTT: Mccabe, I'm handing you what's been marked | | 15 a3 Saibit 2. I ask for you to identify this as an 16 e-mail rom you to Kathryn Kamins Hecord at Durant on 17 Sanuacy 8th, 2007, forwarding a messrancum that you 18 prepared? 15 A It doss appear to be an email from me to ! 20 Kathy Hocord. 21 0 Mad is the attached memccandun one that you 22 prepared while you wese performing work for Dupont: 2 A let's ses. Let me take a look at st. his is ] J o i pms : havent. cevieued this thoroughly,Pabguec 238 || 2 it, it looks like it could be a draft memo that | 3 prepared. { ` Q. And we discussed earlier today how a | 6 efforts to select a number for PFOA in water was | 8 Rickara's --- 10 ringing at this tine.) 13 (Discussion held off the record.) | 14 THE VIDEOGRAPUER: We are back on the 15 record. 16 BY Me. BrLom: 0) Q. We had discussed earlier today how there was a 16 memorandua that you had prepared that eventually was 19 finalized and sent to the State of New Jersey under Bobby 20 Rickard's name. 2 Do you recall that? 2 A Yes, Ido. : 23 Q. Is this an early draft of that document? 2 A. It appears to be. = Bh p. 149 _ I_i 1 Q. Who asked you to prepare this, if anyone? | 3G ans the Steve of Now sorsey aid not publicly | 6 nT believe hat chavs when they disctosed che -- 12 tow seven. 15 a md cheers because you pactictpated dna | 14 nesting, sions with some othe folks com butont, ith 15 the state of New Jezsy exe they provided an overview | 16 of what hey ere doing with sespact o picking this 17 mens. corset 15 gave ws the mover 1n that necting. 20 0. Buthey gave you an idenof what spprosch 21 they vere taxing to the masher. Correct? 2 ae 23 0 ae from chatmeeting 55 sas your 20 understanding that they might pick a lov member. 13 that wage 20] | 2m || ` he witness's cei. phone basped a Chis | 5 time.) | 7 a So Duront asked you to try to put together a | 10 selecting hese usbes. correct? 12 a. After the sesting vith New Jersey, where the | 13 impression vas given that the state might be selecting a | 18 10 sane, you woe asa eon. ve pu. sone ! u us. stEwgs: Objection to form. 18 Somes ase sen eset SS RARER 0 OE 20 the the Sees shat Hew Gncoey vas putting forvars, $1 721 vmasifk1tchtmtehis Kin of momo woul herp put = very Low I : 23 (McCabe Deposition Exhibit No. 63 was | 24 marked for identification.) . |! - past 1 6% we. ersom: Page 241 |} 2 Q. Hc. McCabe, I'm going to hand you what's been { 54 Maencoex-dmaiatl. rom you to Kathy Kamins ~- Kathryn Kamins Dutont, and muber of other individuals, | | 6 attaching a revised version of the same document that we i 7 saw in Exhibit 622 ! 6 A This ts a memo to me fron a very long list, 5 attached to a very long List of people that this was 10 forwarded to. 1 0 his is an emasl from you. 12 A eomme | 13 0. Correct? i 14 A C'asomy. Fromme. And let me Just check | 15 out tne attachment. | 16 X don't Know how this compares to the | 17 document. that we were reviewing before. It could be a, a 16 later version of it, a revised version, but I haven't had 19 time to look at ic. 20 0 XI just refer you to the first page. Te 21 subject Line of your e-mail refers to this as "Revised 22 memo." 2 50 you see nae? 24 A. I see that. : 5 p52 Page 242 i 1 Q. And on the first page of the memo itself you | 2 now have the memo coming from Kathy McCord and Robert 1 3 Rickard. | . Do you see that? ! 5 A. Ido see that. | 6 0 Wo, if anyone, suggested that the memo cone | 7 fron those individuals? | 8 A. I don't recall who. It was discussed and | 9 determined that the momo should cone from individuals 11 or Bobby would be the best. person to, to send the memo. 12 And as pact of the process with any of these documents, i 13 there was considerable discussion, review, input, and 14 revision by individuals according to their background, | 15 experience, particular expertise. { 16 0. Did Bobby Rickard review this material? 1 A Yes, he did. 18. and do you recall there ever being any 19 discussion with you about `the extent to which any of the 20 Language you had proposed in this memo dealing with 21 health effects ought to be revised? 22 A can you restate that? 23 Q. You included language within this memo dealing 24 with health effects from PROM. Correct? | i! | - - 5.183 LA comet. rage 2143 }| 3 of your Langage senting with beaten aktocts ought 5 bs | 4 changed based on information or guidance that DuPont had | . ts. sxomes: xpection to form. | 5 speiicatly mentioning the Epidemiologic -- Epidentoloay 5 Review Bone. 1 know sha Gney 450 pave oper. ons the | 1110 hmeemos,ethtautpaIcwosuulsded,efearndthoeBcoobnbtyriobnutteodxic4olosgaitcalvaya.nd || cave crpnateton See vo. 58 ven | 14 marked tor ddentitication.) | 15 1 we. sizorr: | 16 Q. Mr. McCabe, I'm going to hand you what's been | 10 as the Tesco chat vas sent under Rath Hons 19 sinarees vo the Comisuiones 9 tn How Secoey 20 Deparment of Snvizomentat. eosacion Agency on 22 memorandum tha. you -- tant. you estes 23 20 A steached his at. appears havo' troovbieeuntdhat$l3eccseortawcitt.h the momo || . | | - 18s Lama in fact, Duront decided to send thispage 244 |i 2 totter directly to the Comizsiones of No Jocsay DSF and | 3 copied the Govsznor's office because of the concern buon. had that. the individuals actually dratting the | '6 number should be csa.lcusltaetemds.: COobrjreecctt?ion to form | | . TUE wis: Chink that the Letter | 3 wae son. to the Commissioner and to the Governor's office 10 because DuFons was concerned about. the, the lack of 11 scientiti riser that had boon introduced into this | 12 evaluation. | 15 87 wn. ions: 15 serseyts Sconemic Development. Office to express ics 16 concerns, as well, in hopes of having the State of tow 17 Jersey revise the way it was approaching calculation of 16 this maber. Gorsocts 15h. The, the New dessey Sconcaic bovelopmont 20 Office vas contacted because the individual that is in 21 charge of the Beonomic Development Office is ono of the 22 Governor's top aids. tars involved with scononic issues 23 involved in Now Jexsey, and tuPont has a substantial 24 prosence in Wow Joxsey, not only from a ssandpotnt of -- - p15 Page 245 | 1 thoic facilities, but also in processing the waste of a | 2 munber of ew Jecsey companies, and it has a direct ! 3 bearing on, on New Jersey's econsnic future. | 4 Q. Do you recall the individusls at the State of | 5 New Jersey's Environmental Protection Division who were 1 7 they learned that DuPont had gone directly to the | 8 Commissioner and the Governor's office trying to get this 5 number changed? 10 A Xam not aware of that concern. IQ md, in fact, after this letter vas sent, the 12 state of New Jersey publicly released the number that it | Bp13 had picked as a guideline for PFOA in drinking water. | 1 WS. sremEs: objection to form. | 1167 hich 1 the beginTnHEingWIToNfESaS:veryItlwoansg aprogcueisdsancteo setlevel, J 18 water standards. 19 ov un. sriorr: 20 0. It vas ater that letter was sent, is the 21 question. Correct? 22 A They issued this after the letter was - oh, 23 correct. Yes. 20 ad the mmber chat the state picked in that 1 knowledge? rage 2] | i 3 Q. Correct. On whether they should or shouldn't? | 109 A other? 1 Chink that when Shis mamber came ot, there | 12 for a clacstication. 1 fotiove tht hat mapper ut 2 BH 0 In fet th vesmonse v0 youn Setter <= Tn | 19 0. And they attached with that letter a | a 1 DuPont that there was a distinction between the kind of i 2 number the State of New Jersey was trying to develop for i 3 long-term chronic exposure over a lifetime to PFOA in i 6 billion. correct? | 8 5 dLiosvteisnctairoen,notbutoftietndisdetn'tusmiankgeLmouncg-htesremnsec,nrobneiccause ater | 10 exposure. 11 12 that. 0 ou recsit that regard convecsation me. she post speciicatty cited had had directly wien in | 1143 C1h0ripsrecWiesiselyofthUe.S.aseEtPoAcewnhceerse Mr. Weis explained that that | 15 AX believe chat there vas sone atscussion of a 10 set. 2h 21 entorconent. Dmean Branch He. of Weds en, a 3 a toxicolostoe with an forensic enforcement branch. 22 23 He 15 not with the Water setting voter standards. office he and 53 nok nveived sich vould nos. cone to tha [ 24 conctusion from a basis of having oxked with the priaacy | | | - -- p15 1 (McCabe Deposition Exhibit No. 65 was b ! 5 marked as Exhibit 65, and ask if you can look at that and | on tot doen seen to ban acm tromme 10 12 provided to Kathy Hecord. | HE | Trreoeronortim eon | | - = p.150 W. Michael Mccabe ; 3 emewnmmrtrr mr amrrmmreeron| | J 2 wieder ssssring rage 263 | 1 2 A wie 3 a win that semplinn i i . Ae. 5 You know, I think that, pen reflection, 6 there nay have boon some sampling that was conducted. I t vomssenn | 5 0. Have you ever seen any results? 10 A wen n R520 you awase of any sesslea? | 0 12 A. I'm just saying I seem to recall that there 15 vrs some casts, 10 0. bo you recall whether the zesults showed any 15 PROM in any water in Delaware or a Delaware River? 16 A I I hesitate to, to recall. I'm very furey 17 on chat. 1s 0. In the last fou months, Dubont set up a new 19 Regulatory Communications Teen. Correct? 20 a woot, 2 0. And you're on that teen. Correct? 2 a tem 2 Q. And Shane Snyder 13 on the team. Correct? 2 A. I think that Shane is on i peripherally. rim ho cotrropbor iang.ctom . i Page 261 ! 1 not sure that he a s' itts ing member. | 12 out there, and, if necessary, deal on a case-by-case | 114 Q. Doyou have an understanding as to what, if | 20 ox. snore: 2 0 Correct. I | | www.corbettreporting.com | - p61 Page 272 : 1 deposition. 2 We are now going of the record at 6:37. | 3 (Doposition concluded at 6:37 p.m.) ` 5 | HAVE READ THE FOREGOING DEPOSITION, | 6 AND IT 1S TRUE AND CORRECT TO THE BEST OF MY KNOWLEDGE |i | ? 8 _ i | 5 ICHAEL WeCRBE | 10 un 12 !i 13 14 15 || 16 |i 7 18 19 20 21 : | 22 23 | - - p.162 1 INDEX page 273 | 2 DEPONENT: W. MICHAEL McCASE 3 4 EExxaammiinnaattiioonn bbyy MMsr.. SBtielnontets ence i ,226170 i|{ 2 Suapoens in Rhodes = | Exu ` MCCABE DEPOSITION EXh 71 0 Subpoena in Rowe v ||{ | 3 |i 105 3 Notice of Deposition 20 n 4 Document Bates stamped HCCABE00287 a | v 12 5 Document Bates stamped MCCABE00288 50 | om rr rere || 1 11 7 MDaoncaugmeinntg tthiotlePFdORDuPIosnsute,Condsautletdin4g/25So/l0u3tions, 53 i 158 Document Bates stamped MCCABEOO291 and 292 58 169 Document Bates stamped MCCABE00296 through 301 60 1710 tDohcruomuegnht21B5ates stamped 015-0002-0002111 6 118 11 Document Bates stamped WNBGO1687 3 || 12 ncurses stares mco00s ant 4 0 | 220 13 Document Bates stamped WNBGO0DSO though 58 68 | 22 23" 15 aDnodcumzeeant Bates stamped 063-0151-0052243 n | a - p.163 1 MeCRSE, DBROSITION EXHIBITS (COVT'D): wPwagee 274 |i 216 Document Bates stamped HCCABEQ0283 and 294 73 ! 317 Document Bates stamped HCCABEOG321 " | 418 Document Bates stamped MCCABE000374 78 515 Document bates stamped HCCABEOLO67 and 63 83 |l| 620 Document Bates stamped HCCABEO1038 on 721 Document Bates stamped HCCABEGL354 and 355 90 522 Document Bates stamped 063-0151-0004875 102 923 Document bates stamped HCCABEOBOO1 106 10 24 Document Bates stamped HCCABEOISTS or 1125 Document Bates stamped MCCABEO1636 110 1226 bDoorcgument Bates stamped 063-0151-00485%0 111 | 207 27 rDoceumennttBates stamped MCCABE2014 wm 1520 Document Bates stauped NCCABEOZ040 1s 16 25 fDorcuamemnteBsates stamped 006 0133 0067020 119 1 30 51 Document Bates stamped 066-0002-0000485 Document Bates stamped 007-0164-0001THG 126 128 1 2 32 5Do%cument Bates stamped HOLTO2934 through 152 2153 2 CDorcuemeont15B3ates stamped 087-0IGH-0001TAS 139 2" 34 Doreen as Document Bates stamped 066-0002-0000471 142 |{ 2 |i | - - p.164 pws eames | Page 275 i 1 MCCABE DEPOSITION EXHIBITS (CONT'D) MARKED | 235 Dthorcouumgehnt81B0ates stamped 003-0131-0000769 143 i| 43 36 tDohcruomuegnht82B3ates `stamped 066-0002-0002789 150 |i{ 537 Document Bates stamped MCCABEO2723 153 638 Document Bates stamped MCCABEO2791 156 i| i 5 through 798 | 5 and 867 940 Document Bates stamped MCCABE02876 159 10 41 Document Bates stamped MCCABE0288S 160 112142 aDnodcum1e3n5t Bates stamped 006-0133-0082374 165 ||i 13 43 Dtohcruomuegnht2B97ates stamped 006-0133-0083284 168 14 44 Tuo-page document titled DuPont Media Center 171 | 15 45 D91o8cument Bates stamped 006-0133-0088917 and 175 i 716 46 Document Bates stamped 075-0144-0011180 179 18 47 Dtohcruomuegnht46B5ates stamped 004-0134-0000461 184 : | 19 48 Seven-page document titled "Clean Hardball" 188 20 49 Document Bates stamped MCCABEO3074 and 75 191 2150 Document Bates stamped MCCABEO3137 and 138 193 22 51 Document Bates stamped 006-0133-0108123 197 | 2352 Document Bates stamped 006-0133-0108297 197 |i = - p.165 - f 1 MCCABE DEPOSITION EXHIBITS (CONT'D): Page 276 i unrkeD } 2 53 Document Bates stamped 075-0144-0011918 201 |i 3 and 919 | 4 54 5 Dtohcruomuegnht 76B8ates stamped 003-0131-0000751 212 ||| 55 Document Bates stamped 022-0046-0001349 212 | 6 7" 56 tDohcruomuegnht2B83ates stamped 022-0046-0001275 a7 || 857 Dtohcruonuegnht65B2ates stamped 006-0133-0135635 224 109 58 Dthorcouumgehnt29B4ates stamped 022-0046-0001290 225 1113215690 DaTEnoi-dscmtua,miSelenldtaftrBeoadmteD1sa1/v2si/td0a6mB,poeodtwhiet0h06t-oa0t1ta3a3cdh-ia0se1tn3rt8i5b6u0tion 223216 i|| 14 61 15 EMDruEil,ntkiipDnlugePo-nWptaatgAeeg:rdeoNeceuamroennttMheeatsbiuutrbleoesndt FtWoaacstPhriSonhtegeetctot:n 234 | Works | 16 FUR 62 Document Bates stamped HCCABEOG628 through 237 16 63 6D0o6cument Bates stamped MCCABEOGST6 through 240 19 20 64 tDohcruomuegnht22B0ates stamped 062-0074-0000210 203 21 65 Document Bates stamped MCCABEOTOT and 79 256 22 23 CERTIFICATE OF REPORTER 2 ence 277  Pp. 166 page 277 1 1 certrercaTe J 2 STATE OF DELAWARE: 3 New CasTLE counTy: | 4 oreqo1,ingoebdreapoAs.itiDoonnnewalsl.y,taktehne, ofdfoicheerrebbyefcoreertihfoynthtehee |] 56 d0ttaehkepeotnshweiittbyniceoamspneso,sxiawtshiinoosdneuWsillytmceihssnawtgroitrmonhonen,"byyatDeRpalpesaetwabeareersfeno;srienoonftthheeSDaeiccfaoeommrmpbepegemroteiesn1r.pgsentsas ||i| 72rCE0hey0aqp7tue,eusrTtitetaodimntghtneheeiutbnheodeseprtrpocmrooyftuunmGnsyiietrlyaebctiftoolirio,trnyevriatehenladwattetthdhneee.r.tetoarsfaantinsedocrrrvirsipecesdp.uiacoseaydneddto |i| 9 10 bdryeeploaastniiyvteioofnortwhaeesmpplatorakyteeinee,sofoafndantyhfeuratathctetorironnetyhaitonrw1 hcaioncmhsneoeltntse3 mployed 11 biyntetrheWesItTpeNadEr.StSiiensmythtehhaeroneduttoca,ondmenoofroffifctiihnaealnaccsiteaialoslny.tohrisotherineany of ! 12 Decesber A.5. 3007. | 3 i 14 | 1s 16 BERR BoE Te { 7 1 CEXEPRITRIAFTIICOANT:E $P1E5R1M.A5NENT | 20 I| 21 | 22 I 23 24 ||| | i i - p.167 i ErrataSheet Wo Tesificd in personalcapacilyss | Recalled ae dReepaossointion i plpairnotxiifmfaitneslmyall3s0cyleaarmssmaagoter iD.C. ;| [25%T |Federalnoted FoderiyNotiead | rfCo ---- | W.Mitac McCabe Ciyor__Wi ington ) sueot Delaware )) Tow: I | LHEREBY CERTIFY, thatontis_7h dayof February 2008,before `me, aNotary Publicinandforthe Stateof __De/@(dare,personally appeared W. MichaelMcCabe,who madeoath induc form oflawthtthemattersand factscontainedherein aretrueandcomeet othebestofhis information,knowledgeandbelief. AS WITmyNhandEandSNotaSriaS,eal. MyCommissionExpires: Qua CTT NotaryPublic 4008 TIT TTT i DuPont ConsultingSolutions Managing the PFOA Issue -------- ee -------------------------------------- ee eee) April 25, 2003 DuPont Confidential I QThPe miraofcslineces: corn MeCabe ET : Pp. 169 Key Assumptions.......... ee Sa + This issue has moved beyond the Wood County, WV class action suit. + Attack by the Environmental Working Group on our brands and our corporation could quickly escalate to a corporate crisis if media traction develops. + Clearer accountability for various work streams and over-all strategy is necessary to efficiently and effectively handle this issue. + Itwill be difficult to get all interested parties together quickly in a single meeting because of busy schedules and the need to have the right people in the room (no delegation). + There are key learnings from managing other issues that are relevant to this issue. TSO ecpvesetemacs kd Frat SATO 0630001009684 . p.170 Basic proposal............ ee + Convene a meeting of the appropriate parties at the earliest possible time. + Between now and the time of the meeting, conduct one-on-one interviews with key stakeholders and senior management to get input and start to gain alignment on the roles and responsibilities for managing this issue. + Use the interviews to establish some of the key responsibilities prior to the meeting date. + Objective of the meeting is to develop a future state that includes: * A clear understanding of all the relevant work streams that need to be implemented and managed and the desired outcomes for those work streams. Assignment of accountability and responsibility for the work streams and the over-all management of this issue. oAcurwreelnlt.defined internal communications plan to keep all appropriate parties Po 20 hvespo etm hu ee 0530001003685 : PAT! Listof invitees to meeting............... Ee + Tom Connelly* et + Andrea Malinowski + Don Johnson* + Rich Angiullo* + Jeff Coe" + Alan Wolk" + John Bowman + Bob Ritchie + Jim Trainham + George Senkler + Bill Ghitis * + David Rurak + Jane Brooks + Kathy Forte* + Mike Kullman* + Ann Gaultieri + Nancie Johnson or Michael ~~ # Anne McCarthy Par + Cliff Webb * Interview prior to meeting J asm o63.0001.0000888 The miracles of science" 7 wasn xscorour p.173 EXHIBIT | . Ce] | 00 TJs, MaIs&arEu |i D`DeuaPlonSteSgPmSenPtrCodoumcmtunSitceawtaridosnhsiTpa(cFtiicesphant) | Caornofmident "TfhoigsgdioncugmepnrtodpurcotvisdteeswpaortdentiaflocoDmmuuPnoiactaStuirofnasceaPcrtosethtaot ncSollduboendsebvealnopsesdnadndbudseiinoeysesd.Tinhseupport Mpaurypo1saof 1t:i0s0pd.omcDuumreinngtsthatridviesctuhsesiaocniictilsphootpieodnhoaf weeamcmaenetbiung dciosncsuesnssiuosn osnchseudpulretdifnogrTthaurcsidsay, {Shteag"emOankee,ShteagGeoT"woor,nSeawgtaecTthircobtaascdticoaldscmuessiaotnionboateaicncthaistdyopceumnedntp).riory of he ek es |! Inberea Boies 2D 1. Ani the ors, nd ln or. 2. Onvgoouighnogucto2mm0a0n)icaantdimonosspliaknlnyianginsmnand2a0t0o4r,yAbletchaouugshewseoamrdamyansaogienvgenacweieskstmhatywpiilspewrshiestn. Cfeinuepsihoenasrd"foilml atchceumed0ssi,nNeGaOns,uomvraDtuePdoostpSlPiS tcuosntomiers,avceo.vOnegrosinsghcotmmpuonriecations cers. ppelrcienptgioanned gpleomentteatiounevmiplacetpofmainasgeiceus.tomer, egubory,employesand ackeiplace 3. gRivTeAnEimrees.oPnruomaectnidvsecodimspclloesuarnedand updcatoeusfror1d0DkuePyoscnitetnhceeismpoofrwthaentroepphoirstunuiteysa0nbdusadta3ny ofabcet-rbaiseldiisnuclsuidinngsccomapretaitboorsutedsuonfii.enduyNoGtOSd.ocs no cively Ll defs cry, | 4. eSluaitveedfodractassru,ppjoargtotnh-rcoenciodmemnucreiwcaetihoavne,iTnhoisuirscecnhcalelaenngebtheecsauuesetmaonfytseliomnercaseeaprsodauncdts. cWoemmbuneicratnionvs.ant 1-11 he act"butwe stdos0incustomer 3nd kets endy i sot1roaocnkgnsoamwfleetedygmetestsahageessbuetbwuibttehepomatsicaaotioocnt-tgVeotiatngssupppooirgthoturonposhietiiosnuea,ndWe2)hdarve(0essonable | | ||i | | casos | m Lo rmss || Situation(AbridgedRecap) E e rm e e Group(EWG). E E =SSemEE en cooperationwithEPAandEPA'smessagethatpeopleshouldnotstopusinganyconsumer or SE EHeE Em E | D + Client tedthat from various `and industrial SPSbusiness S m E FE --e --m E --r m --E --e e--s proactivecommunication;accordingly,weviewStage Onetacticsasmandatory, ongoingactivity. Stage &TwoandStageThreetactics maybeengagediffwhencustomerfeedbackandconcernincreasetonew "hoe mrmnn | StageOpe 2 | |i p17 | ode oSoTt ea p i tae itrp a s i n ans Provideoutletforcommentsandlorquestions, including acallbackoptionif requested . p T Sr et men E cSoTreis AS " ` Proactive telephonecallsbyDuPoatsalesreps toimpart a"businessasusual"messageand ySaERleConiti a QhuisnoypDhnte rA pioeitoyptpeie eSgpreeynemeonn een 5 ) Getsinputfrom salesreps;developstopictrendsthatcanbetracked/discussed Ae g CEE S A oe sEie r Rn nes0e t t eTr ts Ee tE eAsWSyAe eVnsEMSAa TLm oE Ws ITeTeEN Issueafertheinitial,universalKetterfrom PhD. | StagSEeI TwiT opgn T EATI ETERSmeiiTgOMEtiecEtTssON TR AOS * R SEers daete ancusa tto--mmr earl--c egtte--th r(si)--s--c? o--mriivionttomeoetns women | p17 o Theory roms pic tig vs ton 0 toesdos hv J | ` wees || i} pr EXHIBIT MGse | Jo Lk i| `September 10,2003 | SCcrototwLe. WiMnkoerlimnagnL,LEPsa. || W1a0s0k1iaPgeinnosny,lDvaCnia20A0v0e4nue, NW ii ATTORNEY WORK PRODUC-T PRIVILEGED AND CONFIDENTIAL. Dear Mr Winkelman i{| 0) ~. EonfcAluogsuesdtp,le2a0s0e3findourinvoiceforprofessionalfees andexpenses incurredduringthemonth |i Very ly os, | cIroFneytmoaucihtatmv.ee.aWWnyeeqahupaepsvrteeiceoinnacstloeotrshereedqouppiprroee-apnayiaddFdoeidsteisroansaltElxiCpnrrfoeowrsemslasltiic&obniM,lpalrfeoiarnusgesdeLoLinYn.omtahkiensgiytoatueor {|| PV.icTeerrreesnicdeeGntane. Bs TPrHoEducWtEDIeNfeBnEseRG GROUP INC. PTCA Enclosure | 1 WNBGOI687 { . p.178 EXHIBIT Nabe 12 | 70 _7L2 | September 29,2000 DRiicrheacrd,C.TeBchinnoglhoagmy Plansig. EDLu.PodnutPEoxtpedreiNmeenmaolusSsiaonnd Company BWiulinkiinoggio3n2,8 DREoo1m98481050328 Dear Me. Bingham: APlteaascehrdevpileewastehiends obidleenoiftyneswrycannddiivdiadteuslsweyowuowiushTiukseokctoonsciondtearctf,or Wthee PhFopOeA0isssupeesa.k ) with eseexpe soon45possible sertevinapproval romDuPont Wwihtohmrergeacdtetorecsatneddidtehsewe thiasvaednidscausvseed7thedissbuewliithnhedfboyllCorwoiwneglil & sMtorofienxpoenrts behalfofDupont. 1 JAsosnosctiaantBe,CliBnoicnakl PMroDf,esDorAB. DDierpecatrotr,meYnaloefI[itexedmisaciMpeldiincariyneRisk Assessment Four YaleUniversity SchoolofMedicine 2. HDaenainsaansdiPdreosf,esPohrD, DNoerpmaacnm.enmofoElpdidSecmhiooolloogfyP&ublBiicoHseiastthics University ofSouth Carolina 3. RPoronfaelsdsoDr.EHmoeoridt,uPsh(DR.eproducive Tusicology) | DUneipvaerrtsmietnytooffABliaoblaogmiacal Sciences wncoooss | i p17 (a) TM 1| , RSiecphtaermdbeC.r 2B9i,a2g0h0a0m | Page? 4. SCAolsisnnoiccPiahalitlPeihCpalsis,nmiMcaaDcl.oPlroofg&eyssToorxicology | UFanciuvletyrMseimobfeCro,loRroacdkoyMountainPoison&DrugCente, Devs, Colorado Wreesaulrtinc'oncfoidmenmtihiadt uearmocfnoutestatndeifnfgoertxspweillb0ecoamcploefttihetkheeysvuebyjeectarartesrpereavnioduwsillyl denied t1ecyeovuinhgavyeoaunrToqeuedsbtaicoknsoonrhceonmmeewnetxspeprltecsasncdiodnatteos mteydoiuvscoloyn.eWstecloomoeikconrcvea.rd to Very nly yous, HSenEiodrwaDrirdecDtuonrkelberger 6 ) TPHroEdvWctEIDNeBnsEeRGGROUP INC HED Enclosure | WNBGO0O44 | || -- - i | | September29,2003 | ' PRELIMINARY EXPERT CANDIDATES | [Some|nA-- yiones | Coty |ooBauaope | Commer _| | TD E fmEromm.ans Ed NOES Medicine "000 70 arma = [oRC oyeeTsy -- em pf Eomrciie in,t ! aS VTocUmnive Schlof | - am | ePL a rmootE fPi, eesd:es | Togs | fsdoto fm=Sus--sa_--ns . T | S bein || fo`WashingtonHospital [ 3901 9625800 { i | ATTORNEYWORK PRODUCT--P'RIVILEGED AND CONFIDENTIAL. || | 'WNBG00050 i nmi i) : Somer, 1s ' PRELIMINARY EXPERT CANDIDATES [FLa amie[aE SiE Rn | Gory |FT= a Esr.Bi a |[CEoEmms msm Eb= =s E= a Ee [P =E{Erarern, opvagl orre | EFm a eSeee rk El i TonathanB. |AssociateClinical :LEE if EnEy D DABT Director, Yale poral "Occupational Biologicaland| Agtrobeereetainded F= Fxoessurveiince || r=e YaleUniversitySchoolof =EE. soepible | Fami nnos SSA eErveeensasd ull== [{o--o = ai gms Bpr=ee==) tI || ATTORNEYWORK PRODUCT_FROVILEGEDANDCONFRATIAL |! 2 | r-- . p.183 | i PRELIMINARY EXPERT CANDIDATES September 29,1003 | | | [Home | tos |Cry | opin| Commins] MRTRe |PS Orecepioenip ofMnmdm e, | Ceaonp:an | eCoiu.pon op PPMrreeovdefinos,oPf Fsrheieynsof coworaoycernit.ion, MViacnaiSchUonolirsy pvriironnmanl Tome For 3 HHEaerivarmrd SmchoafoPiolil. | ptey l | Dra. mo. Dogars12d MoCdoimnepo | pOocapisonaat]l STaehdenGatetoarhgSercWaeanheiasnihon mdmoeoor ) nvr ? d[iree,y | | . nen i | frie | DMB ADB.TM.r PH. | EDL gmmvroinmreanL otuollsod Fad fryer] | sScOdhcoHetcaotufhPpSabeiFrcevHsitessat dieaasad cecil DMDiovidirciontneofOccopuions aieanyib,on Sn DeputmentofMedicine: orelogy | Givi MD. |MselddiEcnivoCt|| MOodTinee ervicnmel Ii i HDaEerpnvaavrrtidmreSonctno!foHfesPkbhlic: Hein cdpaoonnpedieir | | AFTrToORNEY WeORK PRODUCTPRIVILEGEDFRIVIL ANDCONFIDENTIAL, i| 3 i WNBGOOOS2 i+ i p.184 _-- September 29,2003 | ' PRELIMINARY EXPERT CANDIDATES | MDDo.dMTPRon|| DPolmeddCoe MeOtoioipnaeont EnOvcicpoaeimoinnaallHmedal fUSrnciohvoneorlPoufbLicoavtihe nd rmanSec: a Ui Derpvoo afoEfoatfMnPbinyir rreclnsry| Pods |IOctal Cprroyme mbdoiaat.o, woery a G5y, Fi |VCiltbi CFearl PHroaofPatSsrh Rags JRDe.covhe |CPDormeimmioenPedavics D DSMepEaeDrmSienmt dais: pComoeirnty |Temeans 97257 yGpmiolor Lover. MaD. |CitndVa iceCur, MCehdiilcdCsomearpi PHradv iaTda Scho @oamrsmsaoss isomminge sich MEDv, ra er,|DCeipaanrtof aris Fe afrgironw0d CBioyalotsic Gis `mein - Dam TORY WORK PRODUCTFLEES ANDCONPOENTAL ` | WNBGX0S3 | .Severna | + PRELIMINARY EXPERT CANDIDATES I [oa me anion WilliJa.m Riley, | Corny | opr | =ome S 2hiae| ae Podiatric. Tet SRI. TDiIn [oor m n3 t Aee hgez aomuncs = { 5 sTee Ec reemrc oT= Seeom : =Ei. FoEaa TEo.e. n I=Sn I a esr |Pr a p : b=a=w.= Er | =S==t--nsnee fuaeE=5ge7, | ATTORNEY WORK PRODUCT.P"RIVILEGKDANDCONFIDENTIAL | . i| i re-- 3 . p.185 [-- | ' PRELIMINARY EXPERT CANDIDATES | [hee Tpmer|PaAnion | Cocos |a a Bop |Comme] | SESS lpFpem n ,m, | | | men. (Fproiees en, e= rass a LSEiSenT,tE , i = oa ee oe rr >) PAD. Departmentof `Epidemiology & SEErt=,in Biostatistics. and environmental La Eae epidemiology | | sf iapg s University oLae | | "TodSchwartz. "AssociateProfessorof Public Health Exposareio | EE=feiEem, , be==im,ee WLGordan Trak a [BE ifEcn En--ponies Fa F=om |i `SchooofPublicHeath Crvroamnal | ATTORNEY WORK PRODUCT--PRIVILEGED AND CONFIDENTIAL | . i wnsooooss || i -- | `September29,2003 | PRELIMINARY EXPERT CANDIDATES | [orEme Ee| --|]Sommitoen | rao |= =a p=ric| =, Gommns| 1 Er =, a o To ||LPFm oo arieerr ee sae a= Sseme--| |[reet .) TT t|rorm| EEEE I eos L=i Hnezrmann a ---- - ay . [E xa Em -- ES | = fE A=Tt Ce ---- SC EE mr, ATTORNEYWOKFRODUCT_FRsIVILEGED AND CONFIDENTIAL 'WNBG00056 | : - p.188 . | A | ; September 29,2003 || PRELIMINARY EXPERT CANDIDATES | TEwne =Emo|Gi [Mame | afiaion | Category | =[Expertise[ Comments | re== e e | fpee Bew5= 2=re, I re E=EEE=na a , = p2 Bo=al | | r EE EEf CEoo == E= _rEEZe-- Em f= =o ono |rz= = =e= pm = EEEEEleEEnR I | = : | 'WNBGO0057 | : _ p18 | ! i September 29,2003 | ' PRELIMINARY EXPERT CANDIDATES | TT oiWT | DiN or TT = CT T Terai S | PD. RCIeTntereForrLsieStcenes omritopmentt ATTORNEY WORK PRODUCT PRIVILEGEDANDCONFIDENTIAL 9 | hi p.150 misc GleavAR uum 05/09/200506:50 PM SueF ee Ro FocMp ay visi-- t yur-- B) GMeiolrlgere/HASEe/DnukPloenrt_@JD/uAPEo/nDtuPont@DuPont,Sara B. George? 1done knowtisgroup... DGaivnigdyG BUISAEDuPont IbaAitSs | CynbiaC GreenAEDUPon@DUGPeoorngtH. cSDurEPaoTnnte pnco SSeonknleRr_lJaiA/ARED/DLuFPoonnt@@DbuuPoennt FocMoy tnyo? t SShoovuald anyone mee with these ols? ForwardedbyDavid BIS AEDuPont on 05092505 10:48 A -- Wyeothner ov n. 7, Dovid GBSAEuPon@OuPont odWaenme:ss Gon MoyIVSyou? HSoisoe [ET hCTSeEuiarlplnayeoPoroainneesBdnpuaEerCtionRnDoglEunapNc-ocBebnhEeteRGmdSF.aeahGdavuehte.soelriUotooRpoucmaaeaGtbnensetni.knonoFfbLroiso.tEmthFdh.eieTrsHtehc.ECeu/.sWEssE1elIsruvNhvouiBoreoEwosmRcswGaeh.siSibnHsoOennVnsEvvtciehhIdreeheeem.niiccaooasrmdela-cstwbsoouwcstcioydrvnhterlbovegaviveenoroycsanycos,ynd aFsa"noeniaveinmn asShoemecahddiivseccFroaercttsee.sofsorWLelhoembbevelanilteueveedainndtdheesnvuerleoornpydinvogef $Filrueotteoaitaers:sonfsorasbeiPaptiseseor Mou von that oe Can provide en ml Ln hin aera ee ue rWECeonncetcaiornntetaeiwnhueDtetouhpebtoreolnitsateehvseerveitehtwehusar:teevocTlhhheuea"trniegioehndearemocfaonamsctetlheiiamsvreiartictisiesosuonefsWhhanioidfce,h. thSmneeeiwviscemaoiolnoortnseds phteawhsreasnumceehovaeninngo,edacowveide MNeCabe &. IS 063-0151-0052243 p.191 caWodonvndotecirantueewhetDtouhpebornetl'itsehveerveietwahsza.et tcAhhsearnegtehdearemcaonnaacsgtieidmveiertnaitteisoonfswhtiohcifhs thwdeeivicvsaoiluoulnedsphawusersumciehgahnttgoedprowveide itno mtoheve tDhurupsotnttoforuwseardevoilnvienxgecuftliuoonroocfarbSotns tstercahtneogliocgiepsiana:s a key base on which aeIvcwiqodueuanlicdnetdbeyboamusoeswtdithiandotvuoorrceascctyaepadibniilntihtediiespsac,sutsstio1n0gtmelotlnhtehsyseouisasnbsdouueftso woluiertahrnsuycwochueesrtesoesbweetitnyeoru see ctohnatvewresatcioounldaroofufnedr ttohehseelpt.opicIsawmouhlodpinbge tusheaftuly.ou will agree that a OIfWi9LLMayasktomytryasstiostsaentt,a StihmeerrwyheWonloIzyMni,ghttococmaellnoyrotuhr oTfofivciesitdurwiintgh tyohue.week Thank you very much for your consideration. Very truly yours, MvSyicrcioeenncPe5r.-eBsaiWsdeeeinndbteArdgv,ocaPchy.D. WT1aH2sE2h0iWnENgIitnNoeBntE,eReGnDtCGhROUS2Pt0r0e3Ie6NtC,. NM, Suite 300 PvFhaeox:neL:p2b0220e.2r6.37g33g.0r7.04o81u70c0po.m dy"eoPluriivaverirelengtoehtids otrmheescsoaandgfdeirdeestnsoteieaanlyionndiein.cfaotremIdantisionunchthmiacsyasebmsee,sscaoygoneut,aisnyheooduuldmiandyetshntiosrtoymceosptsyhaigsoer. If message." 063-0151-0052244 oo ~. _ pam A, McC& Aassobciae tes Sen | Jue 23, 2003 EPFmhaoacne: 661100.338888.59468215 whidsincateQeattink et i || `ScapeofWorkProposal i `ForEPAPFOA Assessment humanThheealUhSi.mpEacPtAsiosfcpuerlryfcoundoucrtioengiond(csPeiFsOsaAm)neanodto(fosrisnsatredlactoimngerst.heIcncalvudierdoinhmiesnaanld !|| pC10ornohtcuremoslaniAcehtxepoosduderevene.tlfoMypimcneCnfa:obroemfa&elnifAoosnrscotecoaisbaslteeicstopErnoPspAotsiscsetsssupmnrdeoevnristdteuannDdudipenogonstfcCsihoeornmui4coarofltfhcSoePkeFTtOoisAxoincsanSwduibtpshattalnwcaeyss || ongoing coraling sevice 0 sd i negotiating tis process. Speiclly, McCabe & Associates wil: a | ++ ADedvveilsoeopnstaheegTiSeCAtoprmoeceesAsgaendcAygneendcsyeaxnpdecrteatiiroenms.ents within contextofDupont ++ oRPbrejocevcoitdmievmeenso.nnd-taencdhnfiuciallaeticeswpporfopteieseiitlerpartepiaornedwiotxh kseuybmAisgseioend0ecAigsieonncmyakers. | J ++ AdAsvsiescseshNonc GpOubalicctiinm vfeorsmnattdiowst nirntedgioeustarneadcchsoumsmtuengiyceaxtpelwaihneintgnapaprsoperioaftet.he processand || ++ PCaoincsiupltweitihnaiptpermoparliaatnedAegxetenrcaylcwoonrtkacitnsgosnspsrooncessastavnadrifoeuesdbloaccaktioonnssuebnmdiassdivoinss.e ++ AsCPsoreoorvsdiidenaanatsdesaiadsctvtainiscveeoasn3bwpoirtwthocDufhpTaeonlnogtmGeieosnrvseErRPenAsmeelaenrstcdheRrreslotiigpormnaismg.h(tTaRlEo) tinptreoraccetsisosnnwdiohutAcgoemnec.y || ++ Asnailtyzne"wdoervsetlocpamseen"tsocfencalroiossure"priorcteesgydeWvheleonpsp.roces is complete. WuhmibcheervoMefcrtChiasebsteer.&tAemsBscaainstdpeornsotphhoaesscebsrortoennpwtrouorsvkieidenofgswMeivclihCcDaeuubp&noenltAsChsheoeprrmosicecesaslssSeoivlcaiotcmiepoolnesfstaeipdtperooMrsTairamcaahtr2lyy02020300.8o2,5na 1H.oi2umr0bs0um3eond1d.cho,vnearhrseserievnvieecfenstelheoaftd$hy7e,pw5ro0or0vk.li0o0dnpede,vrEmexoplnedntsheisrparesosspoocisuaetde.dbTwhiits,hfhoswaogeruneledfmboeenwteowuroludolbdaebeuctilAvpye! | I negotnted. i Submitted by: WPr.esMiidcehnatelMcCabe EXHIBIT | (abe lf 90 Al - wocaseooa | " - _ p.193 y TTT --e-- Serres EXHIBIT | .- f|CCabe 2 From: MikeMcCabe To: Spitzer, Ritchie, Korzeniowski, Buck, Moriarty th Date: 3/704 || | RE: Mestingwith Linda Fisher as`KTonnhmdoesemwheoaeoltfwiinrmhgeuiwrctithleyhisLoesiaunowcdneeahp.rorgowseviitodcehesoaucnhdsolwmoeimsotkouhmnateihwceohfaoapptihowenrety'iuovnlueisrtbty4toeonetsetegsrtssisonodnism,negbotatfwoa|uyarapartsosnouhcmeph1mtiintop.nsns1d,tv.oyeenraitfy shoudsatwith ancverviewof thePasse rom mers: pespocive. Taheelsocnlosamtefurbfsoktmgolhrawsnecpiee.lnoTmDheuerPdoifniltinnnsdgoanim:noesTrttohoefvttiheobtuwseoginrwdoutsuhipe nnlpoldamihyeerwsruisosirhoeepesowldicydrm,oeonrnetwoeuld iTcesopmmrpeclisisecnvacitdeewaohndedbcsyouEmePmuAnraiocmdaEtPheAdo'w10siph1eereEsPpnoAcginvseod,dabsitsebbdsebudyneldiievnesdrtuosnmd.i1Tx0hecdsfmh ecsisvaeogs syessealaymsebso.w he dL2iis0nt0diancnateyiescdhsttheos3unatdhemer8Pset3iancmdrtohheacpsoppmrpoelgrerexsi"steydo.ftShhoseereeltati0ounsnhdiepsstiannodrdterltohapopmreecri"ateteelromseres'e | -ND S`hLAeeggeahncacysy:whTehhairecdhlGerugonamscoyttihhseesrrusiesskihnoDofuumlPidosansltisnoobnehhepsafr,otbroeostftthionetmohyveevrivceiwseIww.gAhagainth,ebe1pidrnoogns'itkonrowhboyewhtmeucIth aludsemaolaiinggwnxioplrotsechse xlsotginpcdalpppoouoilib,cny ppraJtuhEebpPyiAsllehgoaEcuPyAls'bissocvoeonrurcgluhirnehgyeeRpuCcrRnAgIhaGitsEwsRuhClerdLoreiAsv.ioclFnvrieoonn3 OsPPhSnmoyowobpeiufohceurdseed. 1s heDeputy' le ocomesthedks,bt Fhrion may uleForm | PmrxiolpceresitsoesnneFcsr)duaswntdirhrfihoienEr:OPtnoAdepertohfceeyosvswe,rhcvapithewwaihsalisbibendootnnheerwnsitkeh totfhe,dceonwleoldloidcdlscuimonmfmoaerrsmiaz(teiootne.eFhauasntpsarieoocsnesss doRswahenehfbaelvtelnchetvaiemrhstacescbomefewanmhsoerrretcchoen1vp0oraolcudetseidsiAug,newdnhecarytwpatryoecieutsthsce.oLm1OevUsowEuiClldAl lpsrongcidevsoe.newArhsaktLbimrnetsros.give SohiduoltevwebvhreBslpurloolodepitu.cemht1paethrvahonevecbeetsaodlsnwechavoayrenwsgbleeosliiphemvtsee0ldhneatshrealdtawtlihllebyhwLaciyleniodmuiatmWtofeetshsPisohqoou.adg{msioslroieciushsttrohpusbseliscalbyoruotll 21 IInnfthfetlEheCoruiAskeprsrsonecmsessc:meen; 3. dae,InfluencehowEPAcharacterizes theriskassessmentandthe ECAprocessto |i || won | -- _ [3 ----------------, T------ , J---------------- : | 4. ParnodmoTteechandoalotgsyPupoelrivciysiionntohfeEWPhAi'tspHrooucsees. by OMEand theOfficeof Science. { | Mcchgeonsss | p.195 Huinisneopon Teer " Su RChioecfkafurtngS iOUe=hAamU EOIrOU=EDuAo A PEonIstOp@CsDNo=uPSnPtoaogcnreeyti,.J@CouOhPoaon, [-agi-- JSO1E3tm2a0ge0.hmaaintdinrnSe.RPahtearRyhoelbneussSooennodctMTaikEeMtr ECoUTbOdeeoy anw d hrav aThskedNaardtelo1ldihhrllcclplordrnoecere] C-- omes Cres Fn erosconye insooo eon me 16Dfic,Mike w Cm Iowooatutso esdeuwangtaotoatgw.oo(eBea3bscys,gomhtemC,eMsooeSGoubl1O2hH!oGotRnoe,hmeHtoBSillnRragDnidwg yhJ,oeuw vtrhsaamoev vwsaansrte ssago0eparhtictpirpsiattoeri)ng 1 a aaa ot re 3 ty.Bo oStarcy.ehacvaantorthsrameA aeoraEmnfaworScSmnoinSmSoksireCh rstpoa dececs onfe oddouttws hhtave knows Deas 0 low NeCabe Ee. 82 063-0151-0044875 cova omens ne " EEE cans usciacen a EXHIBIT Jae 43 So = er MCCABE00001 ps7 fTroom: fo: FaehzyanshsMemte@15ea,2p0v 0a5n3s3a tActgpoc sr @eh atioe k et | See Rea ii _-- CS5a5lhsqbBaexattArwwTneeetka.Cia>ns yTouyo.u know, 1 an Limited in what ! can RGTiehitnAioennedg)oA"FsSsorisseStseavanattnscaAitdoemniniFaetrec"aiHccEoAiTrinsTotanHdetTohxEicssubstances gee EXHIBIT 4) ho lo || | |i{ MS S ichaeB ln McC. abe i1i Sunis/z008 11:29 Susan Nazen/oc/uSEPALUSEEER i Secteer | { OlJoan asck gJatt Tooum!sans io en 10 comer 0m || oS352 next wack vould vock 41 you are availabe. || hanks and enjoy what looks Go be a beautiful weekend | sire | piMh eccCkaeebre ARe sesLoecilatseasnt 1| Stele:betahrctmasoneke bi i f woo | ' p.158 PFOAUpdate 2b July 27,2008 awwer PeCabe E29 1 1006-0133-0067020 Discussion Objectives Awaranoss of managing process. Update of issues. "nput essansesnon p.199 hd 2 006-0133-0067021 5.200 CTT 0 Discussion Flow + Managing Process a-+ lWItsoesrrunkeasstteUrspeodauamrtceSe:tsaD,tOugsJl:,obeEamPliArs,esgWiuoVlnaAtroerdyu,cctoiomnm,upnriocdautcitonresformulation, Strategic Issues. Lessons Leamed -- am 3 006-0133-0067022 : p.201 Managing Process BOvuesrianlelsOsbejsectives: Resolve DOJ, restore reputation, viable INenerteieedrss:aencFttaiisoctnieppraotdemocsvie;snistoesna;immaRikoeibsnusgsi;tntNieesgseruadettimoona";ngUaogtGeaHmhecenoatmdo;mufGntuihicedaatcniucroevnesr"a and Tove; Toa oil and pie Structure: Operational Team; Core Tear; VPIGM Taam; Searing Team oar corcom. ww 4 006-0133-0067023 p.202 Cm DoJ So far, s0 good +Global Hold Order; U.S. document production +Wilmington area complete; 208 interview3s4,0 boxes. Forensic images of hard drives + US document production expected to be complate by 8/31 - Substantive issue roview Aug-Oct +White Paper by year end 2005 [-- am 5 006-0133-0067024 p.203 Cnr 1 WESTVIRGINIA + fIonrdtehpeecnldaesnst bSectiewneceenPeaxnpeolsubreegitnonPiFngOAwoarnkdtohausmsaenssdiwsheaasteh.erthere Isa probable fink = Aesessing Hersture andplaningthelrwork ~ Community education underway +W`aat=ndeNrienctderisveisadaturmayelnretwqeulpilraotojowerycntaesprpasrro(ev<ai1nl0s0p)hlaavneibnegenstaabtgaeinoerdai sixwaterdistricts n the class ~ linoswtl5i0nipoatnfsacptoivi atedcarbon estat hobecuompakt widthin ix maith (rem fo + mPleaimnbtiefrfssh(aSvTeOaMnM)nounced thei Intenttoconduct a "heath study" ofthe class. independant Siance Pane as rased sueson ack of protocols and the need0 make tis + Additional blood studies baing issued: itl Hocking, Univ. of Penn svsroncorsens Lo) 6 006-0133-0067025 p.204 Sere ro toe chai cana ih Enforcement: EPA 7 + aEPnAd1rorveipoowrotfarebouxnedsercondtisaciunsisnigoonvar500 reports is complete; onl3y stud Classroom + Aidndteirtpiroentaalticoonunoftsreapnodrtminogderesqtuiinrcermeeanstes,innofit nondiscidstuorde; issue is: + Work with EPA to ensure appropriate press. Program Office: + PSaenceoln(dSdArBa)ftfRoirsmkedAstsoersesvmieenwtRiosnkPFOA in January 2005; Science Advisor + FsDirunabafslttanrnootptioevrxetpidesicsstuceeudsdsuJinuotinnl;eQS24i7'g;0ni"5lfiikcealnyt"new data submointseiddobryabDluopaonndt and 3M; eaF+inaEamPibAsRwpiialstlketdhAesinnsce2o0sn0ss6mi;edDnerteSAfBtroproergtu;laFtiinoanlsRmisaky Anostsbeessimeantoorn2P.3FOyAea 7 006-0133-0067026 p.205 ITT 5 Emissions Reduction "W+oWralsdhwinitdoenoWvoerrkasllFmlanoufractouermpiisnosgioehnmsdimoswsneiboyrn8s8s%reduced 90% vs. 1999 ++WLaoUtSreskPtFutOoAcnmhaandduvfaafencotcrueorrvsienrwgo1em0mWayiaessasyirhosWnsksrebdeuicnegd 8st9a%llecdwormidpwaidtreoeIdW "Worldwide overall reduction goal: 98% by YE 2006 Areqduuectoiuosn bFyluYoEro2p0o0l6.ymer Dispersion Goal Commitment: >30% PFOA Lod industryvidoadoption of golandcommento US EPAFab, 2005. + Announced royalty-free emission reduction technology sharing + Aasecus Fuctopsymer iserson Reduction "Clear and Recognized Industry Leadership [-- = 8 006-0133-0067027 p.206 Cr rei esGSoiEsxonim aFlunop r2otele om mmeernPrsodeuct Rreefoorrmumlatiion Er m TAeseri ar AAT Sm restorer ro --TE----e--t--me Sor a m pt rerproerse e a otsorssthwhom BE er AA e---------- TY [---- Li 9 006-0133-0067028 p.207 Im w Fluorotelomer alcohol hypothesis Alternate Sources. (Mabury, eto)does notfit recent published dota d+aPtFa)OA blood levels have stabilized or actually decreased since 1969 (German & US * M+ultEimpislseiaolntseoruncaetsecsoounrsceusamorcfelreP,FPOFAOAhamveibeegPnIviAdersntiigf,hie,dtoh)actubeatnteedrfitthedata + Exp+ oPnortnpsootuerncteamgaessotnssfroom:manufacturingsued bywove con38sercsss + PTONPFO aus rhfousvedars 1 070 0d adGitBug `+SMtaoncukshcorlimptUnpirveerpsairteyd)isubmitied with internationalexpertco-author (lan Cousins at Preview at International meetings has boon positively received ar cosionn a 10 006-0133-0067029 p.208 GLOBAL REGULATORY INTEREST Canada + + WEinlvlirsounsmebnotthCaanahduamawinllhbeealftohcaunsdedenovnircounrmeennttaalndsiokr fautsursiesksfsobtAymhrYeEcZtn00it5c. Gormany + TEaPsAk'sedbheyatOhErCisDkastosdeeslsivmeernatn environmental sk assessment i paral to US. Organization for Economic Cooperation and Development (OECD) + Surveying member counties on uselproduciion of PFOA + Taskod US. and Germtoadelnivyer a comprehensiveriskassessment E++" nvPPiFFrOOoSAnmIIesncnutorattlnonTortweyaootnnitehLsR(TaLAgRePTnaAdgPaoo,nfPdaaOnPyso,fOthSePsAeRIn,toetrcm.a)tonsi rates Malor sue: PFOS = PFOA I the minds of manyregulators [-- aw 1" 006-0133-0067030 p.209 Communications Communications Plan Objectives: + Prevent customer de-selection + Provide air cover to regulatory agencies. + Reassure employees and investors. Effectively manage events + Avoid litigation issues. Wh+ MaotreWiplrloaBcetiDvief,feirmepnatc?tful and less defensive + SEpnegaakgetohtealcptiocfsruesspeedctaegda,inkstnousw. ledgeathbilrde parties + Trained, credible on camera spokespersons; more "B-roll" + Tight integration of SBUS and Corporate withclear execution roles. maraca am 12 006-0133-0067031 : p.210 Strategic Issues Communications - EPA Strategy Competitive Dynamics ~~ prGolocbeaslsersegulatory + Scope Change Brand + Occupational/Human Health ++ SInetiearnnaclaAsltiiagtnemgeynt +acLtaibviosrtissharsholder ear corer an 3 006-0133-0067032 p21 What Have We Learned? +Our Core Values are our anchor The Past will be viewed with the lenses of Today Science is necessary, but not sufficient +Our Customers need to hear from us and be reassured + Achieving a level playing field is difficult mBeeainnsgetmhberWaocrilndg'sthMeo"sntoDwynpaamraidciSgcmi"ence Company sr am 1. Agglauient,haoturhoClodrseusVatlougeesthaerre our and firmament in world sets us apart. of change. They are the 2. We are expected to be omnicient 14 006-0133-0067033 p.212 -cen e ETEIe orgay Re ||| W= P !| e 53 tot so mpeasIie raat || a e o -- sp sesa rnctcenoa ect:crt sey wichi rte loi EPA crs iy _ anotherway, howdoweactiaizethe8boxstrategy"anddriveitfurther,fastor. Sat toestsate cngwsresp opocssassaps. EXHIBIT LAUDESD R +SPaoositenimpacctoorneMesOsUt,aeLO?oIo,snECsCAopraoa cnensiasenksg. awossveedtrssopotirtEt54ny Qo 7s .,1) 3F}i S NarotzeR smpcpotEcntnardabruaenlaes } | | --| p23 ;S-- ilneourn To Chen FhatOU-AEI0-Ouponi@DUPe 08/03/2005 03:40 PM Stiacdk Stacey cal ior i bend of what we i etry an your hes F((1r.2i)yWGasoRuplsodnotinPheDFAoOcgrAeoonInncnyDpubsaPeodnomtvseaondonuyca3ntssr0,aahnDsuh(p3onstSuPaasnynwiaaasnpeacot.fo S{2oeoTmaimnoisngap:roydiSeceaptteedmbeearmFrreappaea1oowmaka4w1k7eskm1hisnddoEmPoAs SB5MeOptWUwoaseue.lnndSiEaEpPspARrhea)cnicdathEDextukyPoadounnreithabnanstauvhse0wfoskhaoagvbe rcFoaancmtoeewton0rtakcpocobopomepslish. G4. oSvintiscae: vtoebyDuPantpbiyc:osuuprr ous nthmarket ng FYaoturesykuibngro?Linda Fisher abutwhats going on sewer th wr, GB.oinWeenwhsevlaetndiog ecuulhntoanwadirtlwceiutodbnseelteheedWDhuPooSnHotmoemToeynaoe,uh0o1ssciaxcnoonrfGtoescmhneif?casl,gots WT7.iiSgeuareaadbyoouxwC0ilh0ah7r3ye73wokieMeopsroeserap. Aafoornrnathtwiescuaphofthoe 8nesishcusosipons frei T{8eaLlaositnpitwn:ipgrousonagmhae iremorboioifa0vnsak0csEPeArsaonc Dfursp1o5o,mOpHreparetod Metabo &. 31 087-0164-0001746 ' p.214 . pes anaunat Draft Release: Risk Management Plan asof8/24/05 0 Jao Lema voe.p=' ~ EPA has reached the 1% binding agreement with the leading global `manufacturerof products using PFOA to significantly reduce PFOA from products within 5 years. `We are impressed that this manufacturer (DuPont) has chosen to make these `commitments even though after alotof studies we have seen no adverse `health effects associated with PFOA. DuPOnt has taken a global leadership role in making voluntary reductions in emissions and content prior to this agreement DexupPoosnutreand EPA continue to work to determine alternative routes of EPA will work with other manufacturers to reach similar agreements and will work within the global regulatory process within the global regulatory process to achieve similar limits. It is ourbeliefthat these actionswill lead to significant reductions in PFOA levels over time EcoPnAsucmoentriunsuees to believe that products currently in the market are safe for DuPont Needs to: Commit to monitor and report our progress on our commitment Share technology with competitors Agree to legally binding commitment Pursue new technology to "virtually" eliminate 8 and higher from telomere products Continue all of our emissions reduction efforts WeCube te. 34 066-0002-0000471 . p.215 Continue biodeg studies, tox/epi studies, exposure models and other studies 10 defend the health position Collaborative discussion on our view of the importanceofscience in global regulatory process and what we will do Define our contribution to help EPA fill in their roadmap for this process Develop our own parallel communication plan to capitalize on this What We Need From EPA: `This is an interim closure until the risk assessment is completed Verbal commitment to take 2 more active and positive leadership role in the global regulatory process Help from EPA in clearing bureaucratic roadblocks in the PMN process Revise their model from sequential to parallel approach (risk assessment and risk management) Risks: Biodeg studies have no timeline/internal alignment on commitments Other competitors have developed altemative technology No timely PMNs Analytical methods changing Expectations around accuracyof low levels Odtihreecrtjiuornisdictions cherry pick our EPA planordrive us in adifferent SAB risk assessment More aggressive attacks on perfluro chemicals. 066-0002-0000472 : p26 We only get "pat on the back" from the EPA and no commitment Monday Mtg: What are we trying to create?? Need their support `What we are prepared to do? High level commitments (green) Specific commitments, incl what's different from Jan Legal context t Risks Next steps...key milestones 066-0002-0000473 p27 | | EPA Proposal August 29,2005 fe PeCabe 63S 1 003-0131-0000769 p.218 SE Meeting Objectives ~ Support for what we ara trying to create with EPA + Approval of high level commitments - Approval for specific commitments Insights and direction emarercaetonn a 2 003-0131-0000770 Cre Agenda -Desimd outcome win EPA Linda igh evel commitments Susan SpecificFlcuoomrmoiptromdeuncttss George oorcese PHaesncrayl LWagahtwcoenntaeexetdt from EPA WLianrdtana NReisxktsstops SSuussaann cam conn. p.219 ww 3 003-0131-0000771 p.220 Cre Desired Outcome OINUDTICCOAMTEIO:N ROEFGNUELEADTOFROYR FCULROTSHUERRE RPIESNKDRIENDGUCRITSIKONASSESSMENT ++ DEuPPAonputblciocmamciktnmoewnltedgement e+ xApgorseuermeenatndtohweaolrtkh teoffgeectthsearnodn((21))ruengaunlsatwoarryedstqeupesstnieoendsedreto execute the Plan een am 4 003-0131-0000772 p.221 EE Why we want to do this + Achieve certainty regarding EPA actions. + Reduce negative publicity + Reassure customers, employees, investors and others + Create level playing fiold +Secure global regulatory clarity mrcrn am 5 003-0131-0000773 p.222 |C -- -- = EPA Public Acknowledgement f- rEoPmAthheasenrveiarcohnemdtehnet ist binding agreement o significantly reduce PFOA io~nmDdiuuPsstoarntitao,lnptxhreoxd%luacrbtgyse.s2t0F0Uu.6rS7t.heamrna,dnuDtfuoaPcsoitnguntriefhriacsoafnctPolFymOmriAot,diuhscadestPaoFgOnrAee.wecdotnetoltroeemnedtruncperhogedliuorcbtal `tCnocuhlndobleogfyobunyd2,0evxenwhiincrhawcielqvuiarntuiatlleys.eliminate the possibilty that PFOA +haDsuProenatdhyasretdaukceend mgilosbsaliolenadbeyrsxhxi%p oflroemin19m9a9king voluntary reductions and bTololdoavteothtahteDreupaornetnopraoddvuocrtssechuerarletnthleyffinectthsefmraormkPetFOaAeasnadfeEoPAuscoo.ntinues to u~DnudPerosnttaannddpoEtPenAtwiialllhecaolntthinaunedteonwvoirroknlmoegnettahlereeocnttshe science to better C~oElPlaAbowirlaltweowrikthwlitoh obthreergmulaantuofraycbtuordeiress to raecahciehvseigmliolbaarlagrreedeumcteinotnssanndPwFiOlA J aw 6 003-0131-0000774 p.223 DuPont Commitment ~ ACogmrpeloettosdleigsapleyrsbiionndirnegdcucotmimoinptrmoejnetct and ofher emission reduction efforts prPoudruscutse.naw technologytovirtuallyeliminate PFOA and higher from telomer +CCoonmtimniutemDePnEttoefufsoerbtesretprtoedchuncotlfoogrymuklnaotwionn and emission to DuPont reduction + Monitor and report on progress on commitment SCohnatrientueochtnooxlleopgiy.and blodegradation studies, exposure model and other SCtouldliaebsorraothivuemdainschuesalstihon re Imporotfascniecncee In global regulatory Dpreovceeslso.p robust Communication Plan mversesmranen a 7 003-0131-0000775 p.224 - Fluoroproducts Gos Snr itmie) ter 8 003-0131-0000776 "Fluorotelomer Products Hor Boni p.225 7] A per 003-0131-0000777 p26 ry CDoumPmoenrtcFilaulorMoatneulfoamcetrurPirnogduCchtasin PPoroldyumctesr Teiamer A- [proas] Telomor Todas | \ odes. | VATlocN loahmoelrs ATeariyioamtaers [orcas] [] [J prea oroct Pmrpoucrutrisoosrs [indirect Precursors [] siodeg Precursors em romcover. TEsoiorms Li 10 003-0131-0000778 p.227 Cor Average TT Homologue -- Distribution in Products(20E04N ) | ph i = C2 co 8 FloCr8otalcomlar CChazin LeCnlgth Cle C18 C0 " 003-0131-0000779 p.228 aOvnedraPlrloCduocmtmiCotnmteenntt -ImMpaunruiftayctRuerdiuncgtiEomnisssions TFaokceusbroonadPFaOndA caosnsmeravartifkvoerevrlilewhoomf oplotoegnotuiasl apcriedcsursors ct: se tr ih ctr ech ov + T tte mR erBltE,oeronno St isibt TSeen sars A+TCC oontwa sdea rraipnetaeeti cual ett tas cnet we ros species aicmipdlsemaenndtptreeccuhrsnoorlsogtiheats will also address other homologous 5 aAgfgfreescstivperloydumcotvsewittohtrGaBnsafnodrmlaotwieornaclhatiencsh.nologies that provide 4 pCoornstiisntuoenttfoulnocotkiofnoarllgornogu-ptesrm solutions tha reduce the use of oar coveeen. Ll 12 003-0131-0000780 p.220 Corr Te wsesy Ttoanswo SPS Innovation Strategy to Transform the ots Offering . po EE fe RE w----------- Ci 13 003-0131-0000781 p.230 Chambers Works Site 4 Curr+enFtpoPtenstiaclsmtoautrsicceas imnyclaupde:se Potters mardocuing waste: skeom whashles; sfa omdie ssin ++ LGatecralosvocahsatctuoebntfuarsnmoeimsbdiomcao(esmsomcmeosrpnaasttancnpdaPmovFirOoenAss)) Fot, Prcagis and lar watever osimert B CurePnFte OSAtaAtusrcsbkiwa1nd0a0ssesustomr:es(saosssrdosnapcmoannitmutensireoms5e76c,a) om PFO000WaabtaerpeooimmsBSoonociolmollaf arm28ma0a0nneccree.,nenionion) + 247045000 y ahyrehommoaro egudo ,dw1aa8sr0tkm oeobyoemosmsacl scatad 0stfom grate em irndeetrpcoucsuesrrss::WateoiesionsofS050 nea EPP o52Boner soot yeof scar oddsandsos serially 0.00by kid ao Cision of62 rnc soofspn 40000 ty mondo ntl iwe. 14 003-0131-0000782 p.231 Corr Tw Chambers Works Site, cont. A CurreB tntoskta1tus0forbroaloE te1s2a0s0BoefrYPEFOOSA:we erairs 3T5ORaEcar to 16i 68bclyou)an 4 Propborse.d Comamitmmernt YE0 S rates: OR ct 1060 asrs + GT ua peaci umers. vaa te rir n 20ae nRe20Raee(s00s Kreduce ) (roeat pdse0boCs c8onime) 8 Act iCoilnonsnrtetqouonifreheodk:i sirkgsInnctromssvlattmevoartureousSsd(recdntsspocsmlohnco-tnteacurrons) SA orossc aportobE teavkearts to spc rnin Clacton and ocktston ofscheand clproces sess aomermrieen am 15 003-0131-0000783 p22 CT ee eee 4 Additional US Toll Manufacturing (SC) Currreonnt.St<a1thusnamiss stmt rt reson,seo 5 sr to 45 iycin orion os. + tse sma503 tttss i 20 ersronwats sr (15000 ln whieh dchage to CoJ mmimant by YES: en armcoven Lo 16 1003-0131-0000784 p23 corr 4 Additional US Manufacturing - Pascagoula, MS 4 Cu+ rPeEnOtN:SMtoatouws n +Drmecusrs: eHiobnroswn tahaontvo hre evweenstc.awcaasideas odlselsoOW + odstmress: Lssrn20Rte comme lechor1 sste (nd 000 A Co+mEmiTatmmaeinatbn stoanty orsto ot 30spaanofdissuswoes eeTasg trvrcsoSemonmecennS3a0n2g00 son pn PFOA ret o++tuPrnOacAnPo<1ancuoseemnsb:gi<n1oeimsTcsCovmoamrraasomdsrt5srkmeass:o(ns 0oo0cnim8ad) actPrecas:<2 aecod orsnd ors comrsesnen am 7 003-0131-0000785 p24 &CoAdr ditioT nal Global Manufactuw ring: Villers St. Paul (FRA) CurTreeornontnsPtmaaentrsuoase:s.AinrosEemmairssiosntssns<tors ndtesw is t a jea r tt 2i 8 tr Co"mmeivtimteonot s20r0m6innd SR hd 18 003-0131-0000786 p.235 Fluorotelomers Manufacturing - Summary CurrewntxSoeutvcess 8of5E0a OyS:tsviroetStoer a 0 Gdsrt vet 5aoT npanto spor rA810e9 rheLrSe meI s pi, etGreeb eeo1f Pro+ pD osedceBe omOmnm btyiEl08ea mrsoterncr dutl5%e ct4040is gtrdt ct)TOR) Soropesedcommimeentrseo2sdesveevloepbsybertbtyssAn.ollog5ry0waokca0n(E2nod cobuytrEvo0e8)orstlstr ActiooS engstroeyqeuisarE eed tscFhONdtsprossewthsnht oense7r99% eve 20 wi itC3riteis or ic sear am 19 003-0131-0000787 [ Manufacturing Emissions p. 236 -- | [MPaFnOvaActining [pret Pema | | 2a0s0o41VE200a5so][YE200800(YE2007200 IYE2010 i | {a0 20000 too | findirectPrecursors |#1000] 1600] "1600, 800 1} eomvmienen am 20 003-0131-0000788 p.237 CFurlruenotrStoattues lYEoOmS:er customers f+ PFaOA product haesvrge vesof20. 10m ihanes fm <0 1-1005moo.101800 om++ Qm5iaeitcrmPeocceussn::s(tPaircoYtssStEhcvta0eera8teveNOof1-0005075COm.C2BaRctteinasnseo Gl 200 000 i) 3E OPFrOArcaimner:rircescbyy958%5inemantctianngT dohraosse4oanvrYgs e<of1s<1p5m (o(14550y0) LriopnoeasiestdPcColaminmdeitssmhe(onxvt0e1modaectacdigentlyreodeuvepglohp ourthpebrecsatttseicmnhstnwoylooakgyeDwsoemciantocin: 3 A +++ CCDSooovymteRmpnnoaocnIwgreTooPT tEaonSbrwee SttoTnACuemashTosrpoEAcitaetnaI encntdufli cAUeswing ordpE pa1rcocas1E r3nrSecetcntisdairht 0C0 Actionsrroenquiargeed TERT spore nd yen errSah Ro) Lopte rinoofsTo o0c0h8onsictneypotycb hEO8tsdbcpomcintam 21 003-0131-0000789 nr C8 Product Content p.238 Tw Products | Z004YEZ005 VE2008 YEZ0T_[vE2oi|o PFOA 1 600, 600] 45) 30] 1 `diredctt Procusos | O 72000] 8000T , 4000100ys0] 1 er ro cover. _ 22 003.0131-0000790 p25 SE CuCrroPennrtSsetu,amsP eeros:Po rotE dst uocttaT ssa e-IsFRlt uS roirooo ntI e1lo0mR era s N i8A dtd GA ormniEDSm(resetsnscurA tve):ssooI e conteI et 1 0 wn. Propt CPoserEdcoommeenh nte tornaligentyrdSseye ivdetbelestoedcchpencoeeggy wecacn edliniTnaHte 8CoS nersyhovteR mrartrS oroR Tsota oAtaprrodauc inewR oisn Sous nrcnn Sn GO Com E eee Sh cpt sene g an 5Aetrr--na--ndtTnbt3m0r0n0 ryso ES qr esntsc 23 003-0131-0000791 .200 ee -- CBuisodteogsravdzatioovn sspbs of Fluorotelomer Products rCeoEr nT samiymaat Yat ismt cu--re l:--------r iATO-- RE a n Ee aovei mgaesapswso I 0390crshor) tmp JPpr redco doym ortodsi lno cn hiigoss acTN ra a erois m d uaom m r --me -- -- cme BAR 80 2020 085-curvework ww 24 003-0131-0000792 p.201 CIT -- = C8 Totals - Manufacturing and Product Content a is TPotFaOlAs | [7 2o0s0o4200T5owVEZ00625[VE200770[YE2010 z| | `DnirdectePrPercuorcsuosrosrs | 933020000,, e6320000, 20500,] ~~1820500!] 2Fi armen am 25 003-0131-0000793 p24 Cnr Summary aWarvesacted on January comments and are exceeding eduction GFoaE raclurvrieentwaotndPFfuOtAuraenadctpioonasnhialvA eprteackuernsborrosad and conservative b t Em yeS groaso Ti e Teera--as--ei--herres aImcplkemaenndtipnrgectuercshonrostloegime athast wil aso adress hor homologous 5 eALgoCgarkieisnsnigvfpeorlroyldmouoncvgti-nwegrhtsoGotaaunnosndfsolrotmhwaeatrtrocendhautcaeechhneoluosgeieas ptehrastipsrtoavnitde Sanction drowns pi. 26 1003-0131-0000794 p.243 "DPE oT oo [-- fut) 27 003-0131-0000795 p.244 DCuoPomntpGlrobealShoPueFrOcneA RsSetdirautcveigoeyn rue. FM[ aanuiace tuoirnega Tiinne dusttriese Fe Puo.e||sTTsoetameseeym |S[weero oo by2007 rrovee.s| F[a TSooErrnin||rwran out by2007 Ertm PissanesSasa consumer Em Fate pot=a LL 28 003-0131-0000796 p.245 ISS DPE - Fluoroelastomers Manufacturing 5 Viton Process Change n 2002 process change inthe making of Viton Eliminated use of PFOA of 13,000 ibs in Europe and 10.000 bs in USA ouront Pulomanes Fastomers Ll 29 003-0131-0000797 p.206 = TTT DPE Sources of PFOA fFoMrKOaLlr(esmzalglummansufaancdtounreinVgitunointingCuhmambers Works) still uses PFOA ++ CPurorgeradmcsaoonunudemrwpayi60oo0rn0ebd~uece riios `Contract Manufacturing for Viton +Some Vor rion ype 1neVorca si PT mpiGeof + P+CutrrocfODahaknapGys0r2ee.aden JansmacewnPFOA + Ch+ineFsuCronpturcahcatOsepseformaFsrwainceaecposdustmcaocfeFwIihiPtFOmAa.dewh FOR [a Em Li) 30 003-0131-0000798 p.267 corr DPE "Manufacturing" Box--Water United States Chambers Works Water Emissions +Catoneatmentfficioncy 2685%(CaronBaAdhesionTechnology) ++Ce urrmEm9oe 5n%rLeos hveeisonti smces 1596900 ayes + teemingsions, stes tb oad 0205, andst + Committe<40Barmas mend2008 907%recuctioncm 1988) [ra Ss Himes a 31 003-0131-0000799 p.248 hr DPE "Manufacturing" Box--Air United States Chambers Works Air Emissions. + Enno atmae <1 yeathankstoStnsodwash Tralee Park, DE and contract manufacturing 0umegot mpounded,mised,mode ndpos urdbersshiping users +Engneoingesmate 10 spear outers A mmtee wo 32 003-0131-0000800 p.208 Co Ts DPE "Manufacturing" Box--Air International Kalrez Contract Manufacturing + A Enainccrongtcm mompeetusndea,rmeisc, kid an os redBefcsshpngocslomers upon PatormanesFazer Ld 3 003-0131-0000801 5.250 A | DPE "Industrial User" Box -- Air Worldwide aFlnudoarroeclmaasitnolmyeursmeadtetroiaclosnthaainvcuhneimqiucealchgeamsiecsaalnadndlihqeuiadts.resistance, iFnlduuosrtoroiallafsatbormiecrastoarrse. sSoolmdeasargeufmurptehleertpsr,oscheesestesdoifnpcoowmdpeorusntdos before shipment. + COnuersectcnocpkes keesspactheate30BroirAwsnaarn iFr2a3co-mCoumetyeTpOuOrchases) +590% PEOAdetoedby harm ccolsofbsrcaitodnsige owns PmSee am 34 003.0131-0000802 p.281 E DPE - SoE lid Waste Streams Worldwide FMOL materia (Vitonand Kalrze) oo MEartperraeimaanirde ber ArtJ icleEsrmmaerd weitahrVnitonretnhat -- ars not cured " v"hestraainrtetodno=no ns rtcd ldcn J ecetiwrnovsatihmvoh neer erotrnnotsvnes ertsctrsnntt on Fn ~ Engnactgexist <1 >Words (1075 contr) 3s 0030131000803 p.252 EE DPE - Key take aways Manuei ftaecrtsurrinsg emisesidodnos. 97fs an40 0d 00iUSA rs + rtaintratarednaiodaosdknconrfrt50 Ind"Netuastryiad l2Ust e i oet stoeg st rreeser [Ror aR brravia srs wh esChinenaE ndFh shoe 18Gist ros + Poonfastens a 36 003-0131-0000804 EE Research Projects....Bobby 5.253 oncom an 37 003-0131-0000805 p.25 ST ---- 3 What We Need From the EPA A- sPusbelsiscmaecnktnionwdliecdatgieomnetnhtatthfautrtthheirsiissrkegrueldautcotrioycnliossnuereedepdending Risk + Commitment to apply to industry t+hCiosmpmrioptomseanlt to take active and positive leadership globally around ~ Help to work together for a smooth PMN process Flexibility re logal definition of commitment - Collaboration re communication J-- am 38 003-0131-0000806 p.255 or = DuPont Commitment - Legal Options 1. Leotfinttenet(LOrN) - Unilateral commitment - Enforcement via "bully pulpit" 2. Memorandum of understanding (MOU) - BiElatnerfaloagrreveicmae"enbtumllyepunlpitt" 3. Consent agreement (CA) - Bilateral agreement - Enforcement via TSCA or stipulated penalties 4. US. manufacturing plantspermitlimits earner. bd 39 003-0131-0000807 5.256 Corr -- Te "Level Playing Field" - U.S. Options 1. ~Produm"caTtnSsaCgAeimseancth"allenging statute to achiove timaly risk ~ CChuormeinctalrsisaknadssuessess.ment process addresses existing ~ mSoigwniufsiceasnotfNeexwitUisngechRuelmeic(aSlNsU.R) can be usedto adaross ~ nPorow-mcahneumtiaccatlusring Notification (PMN) process addresses 2. Manutacturing + Curent risk assessmentprocessmay lead to plant mission mi. a wo 40 003-0131-0000808 =r -- -- Risks Tm L mET ee ni oe se r tnr alCrieEcnAcsi oncoenvnne omee iarern ww 41 003-0131-0000809 Next Steps Finalize commitments + DCerfeianteo rEiPsAksianntdoraricstkiomnitsitgraattieognystrategy + DGerleianteeaCtoemmmounnitiocraitnigoannPdlarneporting plan Define ongoing research commitments omar coer. p.258 = Ll 42 003-0131-0000810  EPA Mtg 10/8/05 Introduction: So Appreciate thetime...recognize Katrinagandhaykeept you fully \ occupied...the storms and the disruption to the petrochemical feedstock infrastructure environmental incidents has impactuesd greatly...thankfully no and even more important all employees and their families have finally been accounted for Last time we presented our reduction plan. Showed that we were on track with what we showed you in January. More important, we introduced elements of reduction which we believe are more. significant and systemic than the first plan. We showed specific Ibs. and % reductions for emissions as well as caps. We showed product content caps and reiterated what wearedoing on the biodegradation front. We also showed you a competitive landscape which makes a o bcoemnpeeclelsisnagrycabsuet fnoort industry wide reduct sufficient. We also ions as shared our share with you alone will what you already have seen and that is that DuPont has been criticized and in some cases attacked on many fronts and that our competitors are taking advantage of the situation. We are going to do the right thing in any even, but we ned your help igrecognize, publily, our leadership in this area. ship on Note: statusofSteve Johnson awareness and thinking? I< Cabe E36 066-0002-0002789 p.250 Meeting Objectives ( rTSeocaourrg:e EEPARsRenwtihVaurary ExposureReduction Stewardship EvantanFamewoekforDontcomment andinl1 ci<onmpiesh +Nneaxutsmiyeenmgaoge:ment "UCSom.muannidcGaltoibaolnrouistoy spon HLoguop ours te, ravepert == - ? } 2 066-0002-0002790 Gog FasAs ALi pEgSa ) Slerdamashys Ped Meeting Objectives: Yow estedwo AU daelep a wil sit J platen Sobel ~~ Given an hour, we will have tried to be crisp' thoughts sending the charts ahead may help although we respect your tight schedules and `have no expectation that you have reviewed them. jWhat we have cdoounledibsetaakpepnlioeudrtPolfalnuaonrdoptorlaynmsefroarmneddftlhuaotriontteoloamgeernienrdiucsptrlyan which : participants. We have worked hard to get it into nearly final form for it to be presented to industry. Also, as possible. I saidon We will Ssehpotw8,yowueawnaonuttltionf e ofi whan oturwa seidl peraoi psossoz eoanne adsarc lIfoowkeincganfosreycouurer gthuaitdtaondcaey,aswteoaitrecopmrpelpeatreednetsosgaennedraaptperaopdrriaafttenfoerss. your review within the next two weeks (7777) + We would like to get your guidance on how industry can be engaged ipnertmhiitstpirnogcweses wainldl hwaovueldsolimkee ttohosuhgahrtesstoomoefftehrouupghatnsdtatretste.rsToinmethe other subjects and, if we are in the right ballpark, we can prepare for follow up discussions. This includes the regulatory situation, both the 'US with respect to the PMN process and the overall global situation as `well as the "legacy" questions you have raised. * 066-0002-0002791 VERSP Program /, -- or I o man a rroa-- sh -- ERE hd { , 066-0002-0002792  oo se go 1d 'VRSP Program Voluntary Exposure Reduction Stewardship Program... combines your conceptof stewardship with the essence of what it is and that is reduction ofPFOA and precursors Will cover these areas which are our proposal as well as suggesta tshterusctaumree,awrheaast atshawtawsoiunlcdluldikeed liinke for DuPont and critical needs going forward 066-0002-0002793 .284 | Core Objectives ) eTa o aeasa icmlutamheryoparronegrakampsbeooatvsgongUEPkAEnaSAonopytiooninnte J r TFowrorake witphrEePcAmtatroismeplemehnstSamnoatthoeg3us toryproosce ess ororeFview | Em am 4 066-0002-0002794 p.265 ' Core Objectives Intent PFOA is reduction in and direct and environmental loadings, indirect precursors and the net captures rReevcioegwnipzreoctehsast scooowpeeractainognetwiltlhebneenweepdreoddufcotrsatosmmoaortkhetnaeswsporoonduacst practicable 066-0002-0002795 p.256 Key Components of VERSP ManufactPurFiOnAgfraecctiensdenmiastionpsrorceudruscotsions J) >> CBoasptaaovnaitlacbeyteacrhineosloognys > Gompanyidaparcantrecto rom baseyear + Produc>tPFcoOnAt,ednitarceduncdtiIonndsirect precursors >Parcot duction rom base year Biodegradation Approsch EE an ih it 5 066-0002-0002796 p27 oe Key Components Thbiroedeegrbaudcakteitosn:. facilities' emissions, product content, and Generized formofwhat we presented. Will show our - anbubmrbeevrisataesd wfealslhiaosnarecommendation for the standard plan, but in an Smallclarification. ..when you see best available technology that `meansjust that and not the term with the legal meaning - 066-0002-0002797 p.268 - . Manufacturing Facilities Emission Caps Bostavaiable technwloldlriove cgapye Hardca otapoe undsparyer) on axsing ci " FHaarcdctapsepoecnifniecwnfoatcciolmtepsangoyianggfgroergwaatred =e am ths pe lb pated eo dorvachd wb. GUUS Comanches - ~ ufaratiats a 4 tue Lever - Suzy cast .+ cekn ein\Agedad ) i) eo : 6 066-0002.0002798 p.289 Manufacturing Facilities Emission Caps Key aspects arc using best technology available and applicable, hard caps on existing faciltics as of2007,hardcaps on any new facilities `going forward and facility specific which requires leveling effect and cavoomipdasnpyo-twenitdiealcalopcational imbalances which could occur in a 066-0002-0002799 p.270 GRleodbuacltiMoannsu:faFcltuuorrionpgolFyamclelristi1es99E9mitsos2i0o0n7s I PVroEpRoSsEed Co_momuiratnmtent 1 ar 05% oo water Sos% an Timaindnofgcs rgrensd asv nit vot oeun == am ! } 7 066-0002-0002800 p21 Fluoropolymers Facilties Emission * Global Wpoessicbolmemwitetwedoutlodysouug9g8e%st..a.b>a9s5ed%ofnorwthhaetinwdeustthriyn.khioswaegvgerre,sswivoeu,lbdut have to be done on a company specific basis Based on Yearend rates and are aspirational goals os por bs {hes hes.coed "lo Jenash wo. o ~ e 066-0002-0002801 ! p.2712 repr errr rss e Global Manufacturing Facilities Emissions Reductions: Fluorotelomers 2004 to 2007 PWroHpoEsed coDmumPionmten < PFOA . or Direct Procursors~~ * 2% Indiectprocumsors oe IoRreedduuccttiioonnsswaocuhledvenodabdytDoubPeoCnotmpanyspecific and comparable =m a= eo "+L2e0s0s7 oafrea Yseeanrseenofd wrhateerse industry participants are today +EPA would need to determine company by company Expectation is that reductions would be comparable to that of DuPont Ii Y r=) o 8 066-0002-0002802 p.273 Fluorotelomer Facilities Emissions Aginadiunst,ryouirs ipneracdeinftfaegreesntaprleaacse,wweesbheolwieevdeyothue.rseidnuccetitohnestweoloumledrhave to be done companbyy company with the DuPont reductions as a guide 2004 as starting place wreCsWaonsAA whos a durch + indunedd ~ how deobigoeOon dec"khi ndadek Cp udur . Uphcokie Goss Joon Ine ova p wacg Tbo | Ae pon riety = dobar bsewir POhRo dob Rel gd | 066-0002-0002803 Global Product Content Caps and Reductions: o_--n womSnGeon Fluoropolymer Dispersion Products ( mE EP[FOAeEe<seOpsmpm e acn+ ngtsar<osoypps mn597n%rn eveenr = a fy . 066-0002-0002804 p.275 Fluoropolymer Dispersion Product Caps. o + Again, we believe the cap should be the same as ours....<50ppm by 2007. * The announced `whatever cap is iangdruesetdrytogoaanld,ispa9r0ti%cublyar2l0yi0f6i.tWisethseus5p0epcptmt,hatthe percent reduction will be >90% predphoduch SUES 066-0002-0002805 p27 - Global Average Product Content Reduction: Fluorotelomers "oarE mCof ie = oe BEB OZ: BEE nL nr----R ree = aw hn LOE apts dk [1 5 re - ami (edn gated } daft Concinpnesd ook dual we oie .ou "i aed Coons #8 UE bs wes A Go (tS Ns t ole Abels --(pgm cy 4 to pre 5 cunlews? o #540 ocfchohsol.h 3 CondYeS+ he 066-0002-0002806 p27 Fluorotelomer Product Caps Show PFOA as well as direct and indirect precursors (broader | definition) Refers to products with6c } Ruso ti mehnar 20% solids, a product pproorftifloeliwoilwlhdiicfhfewrildlepdeifnfdeirnagcirfoaslscporhoodlucoerrso.lefAilnssoarteheusperde.cuArlssoor expressed as % to make it easier to measure and track i. Gaon) @ 5S 9S Sm PR C 5 3 Guar Seas 34% TT Shthoewlaerdgeanvuemrbageersporfodpurcotduccotnst.entFonrumusbetrhsesienlsetveealdsofwihlalrrdesuclatpsingiven >95% reductions in Ibs. ofmaterials . I want to take the time `About one third of our (ondloutmpoeaseirntyercmleedairaatbesoutwohuicrhpirsotdhuecntulsineed. by( 1% Wo tshoelsdetoSu1signTeormspatnoicmsawkiethfiwnahloprmodwuecth.aAvbeohuatTd oorvwiolflthhaavtevcoolnutmenetis . prleudsucaticoonmsmtietwmaerdnsthiwpedaicsccuosmspiloinss.heIdn waidtdihtoiounr,loaurgreSst1 ecxotmemmiatlment, nfroat bso 2cu%stiosmceornwsiulmleidmpwaictthi9n5D%uPoofnttheininPtFerOmAedimaatneusfvaoctluurmeeasnoldda.c(cAonuonttheedr ~~ "45 for in the Fluordpolymer numbers.) (3Ausndethrisstiasnndeagnodtiaactheidewvietthrianndsupsatrreyncpylaayberosu,titthweimlalsbse bimaploarntcaeontfttoheir % Beoss products and their value chains for all products 2010 goal is under developmenBt~a,t we are resourcing it to find the `tmeacrhkneotlnoegeydsp.a.t.hhwaavyisngtosaaicdhitheavte, tahlitshroeusguhltiatinsdCaBtIthfeorsaDmuePotnitm,ewmee.et believe that should be the gold standard for others as well Again, consistency in measurement processes and analytical methods LJ will be key oksoond fwd 2.6 meals nfeonn To3nsy. Corps 52Gh. o=ymen 52 sete $043,6 43nuslhs AS3aF,m~ 2% tenn Deo Z dmn enfin 066-0002-0002807 p.278 Biodegradation Approach { EEIp Ts e i i Se T res mo meses Tianawo amoon Boab BL A =x am _apradopdeedetatty, ch Logan 4g tr 2 <a doo o or ak of pat bo PY eo ened p74 end o woods 475 Cpt #] ou bod i ranin band goer TPR ) ph 2 ) Drang Goris Aropeacitn Qrerntl 1 066-0002-0002808 p.279 Ifthe goals are setcorrectly and companies eliveragains te is - `iswhniocthccroiutilcdalbgiooidieggrfaodert as products `will not have ~~ nfent Talked at some length as to how to include this is the VERSP and bcaosnicclauldlyedtwthoatpaitnhfwaacytst:he approach is quite simple and there are | aTphpelriecaitsiaontewcohrnkoltoogdyecvhealonpgeprtoodduocttshethtaetcthhneomlaogrykeatndneperdosduacntd D`woantthaensdcitehnactecatonnportovdeegtrhaatdeprtoodPuFctOsAb,ioodregradation does not result in exposure idMy SF TchoemmDiutPmoennttaipsppraotahcwhawyh#i1c.hWies thheavbeasdiescofidoeudrtothsipneknidng10asndofoumrillions of dollars to develop 100s ofproducts to serve 1000sof customers and we' u`nmdaenrysmtoarndetchuestloemgearcsy.isPsluues., Twheeawrocrdkoitnogatnhaelywzoerokutrocluororeknbtack and products, build a global exposure model, the Sources, Fate and tThreanpshpiolrotsowpohrykbieshwionrdkougroivnogluonntairnyprareadlulcetl.ionTaskteewnatrodgsehtihperp,rtohgartaims Iktnwoiwl,l bbieoudpegtroadtahetiootnheirssnointainndiussstruyetofocrhtohseeftlhueoirroppaotlhywmaeyr.iAndsuswterya.ll rTehaesotnesloamnedrepoitnednutsitarlylyisanitnitaruvsetrryedaisfofnesr,enittwpillalcbeeanddi.ffifcourltcofmopreutsittiove help EPA to encourage them to also take pathway #1 Fcaoimlminigtmtheanttchwoeicme,adyeouinmJaaynuwaarny:t to consider they make the tShteudsyhoofrtexainsdtminegdipruomdutcetrs.m aDbaotuatisDuavPaoinltabplreonduocwtsa.nUdsmefourle in to `kmnaodwe bayboouutroctohemrpse,tiptarotriscularly given someof the claims being eWxepesnhdoeudldovbeerw$or1kMinMgotnogaemthoedreolnienxwphoiscurheinmdoudsetlrsy.coWueldhave o pPalrutsi,ciifpaatpeplications do contribute to exposure in a measurable | `way, corrective steps should be taken now 066-0002-0002809 p.280 eer o VERSP Structure | ~C~omWpeaknya.rs,peacrietnc,sogrtemetnotse l "il*EsEkste.iatbnoalrgbilepshxhapbmrpaolsreeo,iclnGionagdnesto,pneruutnos5acibe5nclsgesGeulxbtiadsmeteailncgyotemhmomiusdsnoniciokcneadtte.xipoEonPrsAisepnecceiafnicdweb LEstapblieshapcp1roepirnisauntreeacncaolnytasiciasltmtedtaihtodaosnadnandnmayssssurement nEaadchcaommpoanny tSoepxeecciuetseotf acromomficmoemnmitttmoeEnPtAaLnOCd)ttodnoe cpuumslecnt == an pu rdo Ho Pack --oten angapens) 21 P --TR\ . - Jpoberg progess Sao Cake BML ectslie olay bo Mrodsdoc Ww) Pulte npgudodiny backShp finHooer rok } - Vtiedong Praga 3 mordabe AHL fattowp wi SVue 12 066-0002-0002810 p.281 VRSP Structure | Believe these will need to be company specific, onoff agreements bbeettwaeielonrecdactohwchoemrpeaneaycahncdoEmPpAa.nyThisetgoodaalys, athnedtteicmhenloinleosgywitlhlenyeheadveto oorvecranS6ge0tMacMceisnsfatcoi,laitviaeislaabnlde$fu3n0diMnMg i(nwteechhanvoelosgpye)n,taonrdwiflrlanskpley,nd `what they are willing to do and what the EPA expects them to do. Dfoor ebaelcihevceo,mtphaenvye.hiWclee twoilslecbuerseutghgeesctoimnmgiatLmeetnttersohfoCuolmdmbietmtheensta.me Aveshifcalreasaswietiasruencdoenrcearnnyedot,heoru.rTchoemmbieatumteynits itshaats iftiirsmfuasntdeerrttohis accomplish and casicr to administer ci<ee. bein LEG + * Bclaesaerelrinpeicwtiulrleboef ccruirtriceanlttsotaetset,abbloitshh.inFiarbsstoolfuatlel,anwidllreplratoivviedteearmmsu.ch Also needed to set the goals and measure going forward Wboeuylonddsjuusgtgevsitatthhaetdtohcekreetp.oArtisnpgecpirfoicceEssPAshwouelbd sbiete,ovfeorrteaxnadmpplueb,lic, malisgohtenbaebluesemdorteo reefpfoercttitvheegplroobgarlescsomamnudniicnafotrimontshe public. Might Again, we believe the methods and measurement specifications scohnofuelrdebnecehadridscwuisrseedd intothisprocess. the issue ofwide MvaaryiarnecceasllinthaantaltyhteiFclsuaonrds measurements. We have the world's leading capabilities in this area and could help you do that. Ge 6\ 066-0002-0002811 | ) 1 n.202 -- Elements of DuPont Commitment +LOC fromtDaumPokntttoEPfActhaatproviAdeRsspecaificsofofcoB mmitmY ent wr oLrA | RE ) ) : EE = Bh oe : Con oeoo on OAoP A ?QI#3 wvng owW et E (0 ~DRY? a? Te Lr bade: WI) ro) esd POP font Kap Se w gots @ TU pg edste " 066-0002-0002812 p.283 | Critical Needs RaptaipodicoanmtmtitomieednotoaugconrvostcsambrocttekshorrIniadnussstorqinensces CCooAApnugttusgsnoaerpgehElPvrAlvopelois marsgsert ESmPoAotchorleglulaabtoorwyripatrohtccielosobsaenlsfroognuleawtporryodbuodcitess TErPaAnsrpeasrtaetnecsyafoeftyacotfipornsodauncdtrseasnudsnoheath effects Wel axecuted communications strategy == - 14 066-0002-0002813 p28 Critical Needs ! + As you may recall the pie chart we showed at the last meeting, total and complete industry participation is needed and secured as soon as possible We believe EPA will need to make those high level contacts and to follow that up using your public voice as well as showing visible support for DuPont's leadership in this effort We talked about a smooth regulatory process for new products and you expressed willingness to talk about what that might look like We both know partsof the world are moving on this issue and we `believe we should talk about what we are doing in those venues Transparency we think will help keep the pressure on to move and `help being held accountabile for delivering * Given DuPont's unique situation in termsofboth what is happening to us AND what we are doing to move ahead, we would appreciate `your public support in these areas What is said and when it is said is key...premature disclosures could derail this effort ~ Note of pay. Pachshp ERIE 066-0002-0002814 p.285 ; Industry Interaction + UJtPil-- ize Du-- Pont V-- ERSP-- as mod-- el for-- EPAtoengage Industry P+ onscussitbrlyedDyunPaomnitcrsolareos?diferent htemtacnonnc u0awle1 ynoykpatd,cdergapgsaarlgasgaeort pe EPFAennegtootinatEepcaormepapnonyssp,esciennc tVERnStPs == nn )] 15 066-0002-0002815 . n.206 Industry Interaction We talked about this at the last meeting and were not clear as to your expectations and our realities We believe the first step is to finalize our commitment asap so it can be used as a model to engage industry. This will provide us the credibility to provide encouragement, incentive and perhaps will for others to do the same We are prepared to apply the right people to get this done asap As we mentioned before the industry dynamics between the fluoropolymers and fluorotelomers are very different and the approach o will have to be different. We can share our viewsasto how to do this in a way that will enable success. Here arc some thoughts about some possible roles for us: Make the high level contacts with industry and engage trade groups o Inform, sense, encourage Feedback positions as well as any upgrades Company specific VERSP needs to be done with the EPA __ } oo]a. rm :: -- aa eee T2T ) JodmsehTwoopps pal oo oon s | Ency k Jo oustp QocthCty || Cee foto bo onesine 0686-0002-0002816 p.287 i( `Communications Process dL ood a agree towhet hou b sid, when andbywho == am 1 } 066-0002-0002817 | EE -- NextSteps crovoascuss 2 5990 i oN m gorg oF @5 y- he 0 go Ape | > : Mme | ==S" et | gard a *2 C goon @ @ Bs Wn obo | don 2 ~h : wo 066-0002-0002818 p.288 | N A N -aLW Additional Charts EE am A A? 066-0002-0002819 .20 Global Regulatory Process eEPaAAglmobanldiltientgaedEPtoAoPraFsOsabailtspshhshcancseabmaseed decisions 8 +DafiAnrneenrsnoecrionapeindt eosf souarf,oorrctiansd the EPA nersts vntinof ora rityoai ratomovforward = am 19 066-0002-0002820 post TTT Global regulatory + Wloeommienngtidoenciesdiotnhissmwahyenbewmeamdeetolnastcraitnedriwaeothhaevrethaacnosnccieernncet.haOtne cxample of what could be done is shown here We have aplan to engage regulators outside the US and are prepared OtonsehaproteetnhtaitalwiptohinytomuasyobyeourecgaanrdsienegaonudrreeflfeovrtasntwiinttherUsBecAtion points. Key elements will be: VERSP, health effects, PBT, ----Sources/Fate/Transportpaper, and societal value 5 Frvonmovs `well as we do that things will be happening over next few months 5i [2a LE 0s pr, 20 "8 PR fw wt2 " NYow No 7 soles? ust 2 VY pee? fod ow wn*)o | 066-0002-0002821 ar . { t: f : p.252 "Legacy"/Sources, Fate, Transport VTEoRCSoPmpiietsenuyradedrreesdsuctthieonQupestironsodnatglmakcressputaroougsrrmleasesstmbeeuttidondegs. Workin Progress: mous SoBulordcoegsr,aFdaatto,nTSrtaundsipeosrt Paper Global Environmental Mode! +NTeaxcthnstiocpasl discusonstiheosnbovse =r an < ( 20 066-0002-0002822 p.293 "Legacy"/Sources, Fate, Transport Ymeoeutimnag.yYroecuarllqwueestsipoennst isnocmluedetdi:meWkhieckriengditdhiist acroomuendfraotmo?urHloaswt did it get there? Is there an environmental reservoir? Clearly an industry-wide VERSP,wpirlolgpraeoss will be made going forward but these questions still need tobe addressed Wroeradky tion ppurbolgirsehssa ipnacpleurdecsaltlheeds"iSteoumrocneist,orFiatneg,MaOnUdST,ranwsepoarrte,aobuorut . `biodegradation studies, and the Global EnvironmenGtoaclsMuordeil--. + Wpueblbieslhiienvgeaist wiseimbpeloiretvaentittwoilrlevbieeswotmheewphaapetrcwonittrhovyeorusiparli.orOntoe of the o key themes is that the sources, fate and transport is global, and hence the criticality for global coverage of the VERSPs Ss Shwo0 ?ae wi ebss| yZid ee an" a tlhe pie2 o Luip e pt Hur.Segye SEdE Va Ln a HED 066-0002-0002823 ll er From: "SusaMn Stainecker<susan.mstainecker@usa dupont. com> ! Ef S R S E A me E T ee bdot we ren 6 eo sakear |i| Fisher<tinda|Asher@usadupontcom;RClitonWebber. i ow h. S B ErE dtemeeT m E n n e Ee rLE nr |||:| Tumer<danieLa tuer@vsa. | sAtoensbeaeirs `Sauces Paper waste i OD EPCAotmamteennttosn Overallapproach | Sr e Tee a yetert ttrts \. EPAstraopteneisgsueys: whatdotheyreallywantandwhatdoes thatmeanforus? i Opn es.Wes con rm toe Erni CommunicationsPlan:whatdowewanttosay,when 8ndlowhom? (ldabe | Sl SFI, Cote Teamreview ofroqutaorsatogyandEPAmeng,Core Team nap US ---- | dcTE hhainsihselcoyiimmmeunniaciaitieoB nbieioys fh ohbrtusO nenp by rthheeci le intyenadedslrienc2etippiwSennthloanysdsScrorntnesaieenysh } D 3S5e,l EEEroTTr iTyrEioiaiel, mCiSye,,,RSn iAeibnowtaen ] messin rwsparSe--ssa--S--peetn Srostuanac--Somnoase nen. seen -| woes || i : - Ol p.295 LT ----a --me-- sapc: ted nus hsaces | F7E B eurcino cs hm rs uyesaaappoorr ccoopmmastcipohnsi:sca1BweibnokccoommibicnseQGweoilkccoonLaons SSeintne TReoFioOnnsen1900 SenMichel, 1woulddeer Lind cn ibeheKnowsNo, nd sliilSeino] hi conc Bw N`roowuboswacenoldnmloHetraorazcveesidnvwNeopdoauenlepddbhhaeshooeOtlMphBfe'ulesW.br&hlasebessesHipnsogo.IbrT.cehcoaNostomwomoseuhnldodNubmoepelacpSokunSstSiaoecc(etisSwausdikJcomp1alsceotuabs )edarsk1EnPobwAlgtm.hohevmme|edstfkoionrgwnhaoaropdkwp.e|ned, Bhibtecrhiiwdsusctonsve0y0ed ghheFirn,cttevnewwiithhacet tShSrSnshpWtheHiohsdseevord3lsr Mike : ChMoamdcmeCFn&odrAatDs7ebiAven1e9317 G103803675 work Eo ( C Y266e .383.4003n ,fax i lobe 37 Foo FromsSes M Secor<i MSoackerpdonUtSe A DTGaooi:cLiinida,c) F33P0hiaerL2Mi0in2ca0ha2Fl1o5bP-u0Br5uGn0Ud0SoApoorpcto.mcso,mm>sbcincdi Gathenco,mHewB mds <Hos ondGdonUconsSSoAotFollowop e Mh. ur r VEYmp tcebeeriesmehby. SR oIi cetSoy LehctMieneeelrsyddonfdeehanneoeso 1 | NrmegetoEiasaAmD enmeinPvtersiSnA,or rr I erty mtr yt ------ | Thasecommuicaion sovsb tended citsdsotiaspBR> formic htmySe. | wockseazsos | - Pp. 296 B{oiEplnitee,socoolndtoiu ra ceopioaptnodeddeccoittayoofuwoeshcarny. moeatbna ortpatm hSyokcmryet pepfo oiseotcPssenshcodteheby otcosto contactoft, F eo ecra t omnEoo SPmoustson anpre Kn Mp DPoondim int - MCCABEO2867 ] _ _ p.257 i FTroorm: ce: SeAtaatchments: Subject: "MTSausrahnua MSrRtaoanoucsmeos?rr@<cusuercssoanmprdsotnhntdaecaucopkmooosnr:ne@cnuosdsema@dJuDupaorsnetlncAars F iCcihaenki mVaciosbseo rwocoln@rouenrsr waucbphouhni edoardouop:ontccorc@aeCatbihinneWkenlbeb CifkloaonnrwWtoobae@stucseAodknaownansoen>sdoapdbuoepnrocnWoticmcoJkmoeirnoAboebrer w kardia EMyomnodcoyi,oDanaebycmee@0u5s,m2a00db5up5o0ent8cAroMm> DDucokeclk 11.11.0590 pont com> EXHIBIT ae 7 1`hSuzByoHgaozsosnphuabskrceeciocmhmemenadnesdw3o5sau.Sbhitdheodoocokkewtmaanteilvsibeowore ut ckcoorrtMik an Lindahav vowed TEPER Ei Anhcehaeddtrhoetthseesdtsraefeofsrhe|cwheaurksdfMeatLhiadDoann,dlHsiectsoavnde onemar eview andwouldapesciatohtbedoraby | 0~ Mdoooorseub,iMa4rste1, cveandyocokuetl?esslt oanknow at he ndso Thanks haEpraptslaimcmcaaobcmlimeou.nnsLaeceah.attioImnfayy1osubefaovFeruisvneoitlebgytehdet,heiCnoicnnettneddneeddnetdeicalclapcioiafpnltce,notpyyacounigdhacxioeenstmaeairnnedsbayc LCinoeeumhiaonilleyo-nnoacoitliIcnainepaadctdt,ehlaetitseasrtytrhuiisscet,Slyacspoirp]oyniinfngriotmoefdy.eoiusrPeleseiyabssoteteimn.oontUirolifyenttshheisexspeeh-nimdacsiilt,blyy n77a% CCCooonnnssttprhracecuuttoeuosfiafyecrGo.ensCEsTaohcnitsatoeef-dfmeaaris,l "adFo-ecCsoonmntioratacctchonaTsmntacmiebtnnuetdneetd,& otfhisanea-mcaeielpadnocces consent to the UVrseen'aotforssenodferdsataconttaactthiridnfpoarrmtaiteiso.n for dicot maeketing porpases or for Erancass Deutsch Italiano Espanol fostugues Japanese Chinese Korean Rep:Dupont con corpemai_diselatmheaarl i wows || on p.298 : ; S3uEsianlM.eree TMfSrt ean To CheflobertWRickard/OU=AEX0=0uPoni@CNO=uMParotnhtaL, ii 1|| Sean EpEd y emEmReee s e nH. SEa | | eEeoEnne t Fp o Ar E Soi honBOnnCo-Cobion ramones ' Satbeese Front scaree nTOos a-- callma10dsy.Stay twned... BSEe meer bet 2 EXHIBIT abt La OfUIuI00 SubjectPhoneCal i ({ ) ir mmaveb BnasyBteetdo e,id rnhri os m:oerse. TSa ho apyelwamycot ect maeplnSpertrvak20d | e e saspieShte cr tosporraSv4e8etpea:ht raahhm,r. te) e E i mseesaeranecaoemnsA e rheseesso rRoourossestewen eyeet A -------- Rifookrtyso1 cOurNisSdheleawyshnidvorp3eoknngasvoeroy oOPoPv 0cEhFetho [ 10m 2g peak you 3 ckfor ein imou | women i|| | rae , p.300 oh me e To.FoNB -nSeusaD A n SionS eckn rOU@-bu AEoInO-t SCDHuhRPOoe, mBa@rDmurt, CleLindsJ asWO oemaen PiFB crrsoamee e-aAbAeSLGeOn iaDrriounnep@To aoePtnom@.OCuhPaovna,W ce CRhrodbaAeglFoaIDOurOUDomR-oiamEADu@QLs-OoDnOU.Po-raCnHiC@DaumPoinnt,eCN Cif Sublneete MoFatxedtooHazre Tosday Th owing mate, including Kthy Foie' over ne,wer axedto Sun Hazen 130y. 1) Kathy Forefoxcover eter JE. 2) Plan A EPA and DuPont Announce an25 Draft News Release and Communications Plan VERSP Ps reon ARF00.5d.VERSPFi TieDAT 1 20 3 Plan: DuPont Atnounces Jan26 - Dra News Release and Communications lan VERS?PasRsFB DRAFT. 1 2008 VERSPPan TinOAT1200 5 4) DRAFT Ltier of Commiment (nluded based an input rom Mik and Lins) Sus5 Bost rogares. oon JeCala 006-0133-008328 ; p.301 an fra fESarmla mary 20,2008 TMNhoi.enSUgnotAmesdHSiatzaeennsAEdnmiionnsmsnotral Protein Agcy OVa00fPofepnfrvmeamsinon,AvPeemestiancdiTvdse Substances RWoaotmin1go0n7,MD.C. 20460 Des Mi. Hae --asdonyourconversation with Sus Steer,wear provtihedaitanchgd documentsforyour Thoererarcurently wosrsionsyormeting Mondaywith Se oason il drine which pion Plan A:Spurlbu concenannouncebmyEePnAatnsd ont onWanJdiry,25 lan B:AnannoubynDucPoentomnTehurnsdaty, wary 26. oKtneohswploanmhs eicsuhcde hheraoffnanonudgswreeewgidllsviaindsh csoemcmruinnis cgalwtyiisowns. ldin4. DYoeuswicl s1c4 ehsati,PnPAsvet us Wnd peaissiaoancirncgoedmptaosfDhuPtocnotm'smiLtttorpofaCormtmeitnmyeo.ur Wpreowgaamn.t ob rt mts your ness e1yroau shavae ksugnastoionUs,npdleaSseeedsontteensstasemoooan mest 302-773-4i4n1 S'sabso. She is Ses [Vie Frrsidrnt Dae Public Afr emirmmmressonon 006.0133.0083285 p.302 DuPont Confidential Draf--t Plan A 1/20/06 DuPont Commwiittsh Ut.oSA.gEgnrevsisriovnemePnFtOalAPErmoitsescitoionns ARgeednucctyion Program WILMINGTON, Del., Jan. 25, 2006~ DuPont has embarked on an expansive program to reduce public exposure to a persistent chemical known as perfluorooctanoic acid (PFOA) and has committed to the Environmental Protection Agency (EPA) to participate in the National PFOA Stewardship Program announced today by the EPA. Elementsof the DuPont commitment include: + Reducing total global emissionsofPFOA from DuPont manufacturing facilities by 98 percentby 2007. This incorporates the substantial achievementof 95 percent reduction already realized through DuPont's ongoing exposure reduction program; Implementing emissions caps on its U.S. manufacturing facilites; Implementing PFOA content caps on fluoropolymer dispersions and luorotelomer products; + Implementing caps on potential PFOA precursors for luorotelomer products; + Implementing studies to assess whether the potential biodegradation offluorotclomer products is a measurable source of human exposure to PFOA `With these actions, the company wil ciminate or severely restrict potential routes of exposure from its facilities, processes and products. "The EPA National PFOA Stewardship Program, announced todaybySteven Johnson, EPA Administrator, is an industry-wideprogram to significantly reduce environmentalexposure 10 this chemical," said Susan Hazen, Acting Assistant Administratorfor the EPA Office of Prevention, Pesticides, and Toxic Substances. "We arepleased 10 see DuPont' leadership commitments to this eductionprogram." "DuPont is commited to actively and fully participate in EPA's stewardship program," said DuPont Vice President Susan Stancker. "It will significantly and rapidly reduce PFOA emissions 10 the environment." DuPont has regularly kept the EPA informed ofprogress toward the company's `commitments relative to employee health studies, research on consumer articles, the environmental fate of products produced with or containing PFOA and new product formulations In addition, DuPonthas worked individually and with others in industryto inform EPA's regulatory counterparts in the European Urion, Canada, China and Japan about activities and new information concerning PFOA. This work includes a discussion on the emission reductions from 006-0133-0083286 5.303 DuPont facilities as well as the reformulation of ts fluoropolymer dispersion products. The `company has developed new technology that can reduce PFOA content in fluoropolymer dispersions by more than 97 percent. DuPont has offered the technologyto fluoropolymer `manufacturers globally in aroyalty-free exchange. "Although thereareno known health effects associated with PFOA, the presence of PFOA in human blood and the environment raises questions that need 10 be addressed," Stalnecker said. Repeating earlierAgency statements onproductsproduced with or containing trace amountsofPFOA, Hazen said, "EPA continues 10 believe that the consumerproducts on the market today are safe." Aboutfluoropolymers: fluoropolymers are used in architectural fabrics; chemical processing piping and vessels; automotive fuel systems; telecommunications and electronic wiring insulation; and computer chip processing equipment and systems -- in addition to consumer products such as cookware and apparel. The aerospace, transportation and electronics industries rely on products manufactured using PFOA for purity, reliability and durability of manyof their key systemsA.boutfluorotelomers: fluorotelomer derivatives are a family ofcompounds used as ingredients in making firefighting foams and coatings becauseof their unique properties. They also are intermediates,orbuilding blocks, used to manufacture stain-, oil- and water-resistant additives for some textiles, paper, coatings and other surfaces. DuPont is a science company. Founded in 1802, DuPont puts science to work by creating sustainable solutions essential to abetter, safer, healthier life for people everywhere. Operating in more than 70 countries, DuPont offers a wide range of innovative products and services for markets including agriculture, nutrition, electronics, communications, safety and protection, home and construction, transportation and apparel Hii 125/06 006-0133-0083287 : p.304 Plan A -- EPA and DuPont Announce on Jan. 25 Timeline Monday, Jan. 23 +WEePbAbadcvoinsteasctSstRalincehcHkeoroodf,aEgePnAcyprpelsasnofaffitcre;SstheavreesJoDhunPsoonntmneeetwisnrgeiease end Wi`ctohmmuEnPiAc'asticoonnssepnlta,nW(eWebbbbc)ontacts three key news media outlets re: embargoed prebriefings for Tues. pm., Jan. 24 by phone (Webb) Tuesday, Jan. 24 MEePdAiaapnrdeDburPieofnitnglsettweirtsheWxacshahnignegdto(ntiPmoestT,BADP), BNA by phone in afternoon (embargoed Foulntliolwrielnegasseetliecmteiv--eTaBdvDanbcyeEnPotAi)fi(caWteibobns,oSctcaulrne--ckveerr,baBl:oothe, Bryndza) BCoOrpDornaottiefiOcfaftiicoenrs(CnoOtiHfiacnatdioSnha(Swt)alnecker) o KAdevyiNsoGrOysBonaortidfincoattiifoinca(tFiiosnhser()Fisher/Rickard) KSceiyenGcoevceornntmaectnst(nRoitcikfaircadt)ions (Parr in U.S., other global) + COHKecyallCutsotSotmeevre nJoothinfsicoanti(oSnta(lGnreecekne,rStpoitazrerra)nge) Wednesday, Jan. 25 DEuPPAonNtewNsewRselReealseeaissesuiesdsu(etdiimmemTeBdiDa)tely following EPA release, PR Newswire US1 Media Interviews (Boothe, Stalnecker, Webb) WNeebtswiotrekuNpedwatsedup(dTautmee(rT)uer) Investor Note (Lukach) COH Letter to Employees (Forte) Customer Letters (Weitzke, Brown) 006-0133-0083268 5.305 DuPont Confidential Draf-t Plan B 120/06 DuPont Sh`awrietsh UA.gSg.reEsnsviivreonPmFeOntAalEmPirsostieocntsioRneAdguectnicoyn Program WILMINGTON, Del., Jan. 26, 2006 ~ DuPont has embarked on an expansive program to reduce public exposure to a persistent chemical known as perfluorooctanoic acid (PFOA), Elementsofthe program include: + Reducing total global emissionsof PFOA from DuPont manufacturing facilities by 98 percent by 2007. This incorporates the substantial achievement of95 percent reduction already realized through DuPont's ongoing exposure reduction program; Implementing emissions caps on its U.S. manufacturing facilities; Implementing PFOA content caps on fluoropolymer dispersions and fluorotelomer products; Implementing caps on potential PFOA precursors for fluorotelomer products; Implementing studies to assesswhether the potential biodegradation of fluorotelomer products is& measurable sourceofhuman exposure to PFOA. `With these actions, the company wil eliminaotre severely restrict potential routes of exposure from its facilites, processes and products "The voluntary actions taken by DuPont 10 reduce emissions of PFOAfrom its manufacturing processes and reduce the amooufPnFOtA in itsproducts have shown remarkable leadership and set an examplefor the restof the industry tofollow," saidSusan Hazen, Acting Assistant Administratorfor the EPA OfficeofPrevention, Pesticides, and Toxic Substances. "We intend to work with allfluoropolymer andfluorotelomer manufacturers to develop an industry-wide voluntary reduction program, and we lookforward to DuPont being, a leader in that program." "We look forward to working with EPA to further develop an industry-wide program to reduce environmental loadingsofthis chemical," said DuPont Vice President Susan Stalnecker DuPont has regularly kept the EPA informedofprogress toward the company's commitments relative to employee health studies, research on consumer articles, the. environmental fate of products produced with or containing PFOA and new product formulations 006-0133-0083269 5.306 Tn addition, DuPont has worked individually and with others in industry to inform EPA's regulatory counterparts in the European Union, Canada, China and Japan about activities and new information concerning PFOA. This work includes a discussion on the emission reductions from DuPont facilities as well as the reformulation ofits fluoropolymer dispersion products. The company has developed new technology that can reduce PFOA content in fluoropolymer dispersions by more than 97 percent. DuPonthasoffered the technology to fluoropolymer manufacturers globally ina royalty-free exchange. "Although there arenoknown health effects associated with PFOA, the presence of PFOA in human blood and the environment raises questions that need tobeaddressed," Stalnecker said. Repeating earlierAgency statements on productsproduced with or containing trace `amounts ofPFOA Hazen said, "EPA continues to believe that the consumerproducts on the market today are safe." About fluoropolymers: fluoropolymers are used in architectural fabrics, chemical processing piping and vessels; automotive fuel systems; telecommunications and electronic wiring insulation; and computer chip processing equipment and systems in addition to consumer products such as cookware and apparel. The aerospace, transportation and electronics. industries rely on products manufactured using PFOA for purity, reliability and durability of manyoftheir key systems. Aboutfluorotelomers: fluorotelomer derivatives are a familyofcompounds used as ingredients in making firefighting foams and coatings becauseoftheir unique properties. They also are intermediates, or building blocks, used to manufacture stain, oil- and water-resistant additives for some textiles, paper, coatings and other surfaces. DuPont is science company. Founded in 1802, DuPont puts science to work by creating sustainable solutions essential to abetter, safer, healthier life for people everywhere Operating in more than 70 countries, DuPont offeras wide rangeofinnovative products and services for markets including agriculture, nutrition, electronics, communications, safety and protection, home and construction, transportation and apparel. wii 1126/06 006-0133-0083290 p.307 Plan B - DuPont Announces on Jan. 26 Timeline Monday, Jan. 23 +CoEnPtAacatdvniseewssSmtaeldnieack(e3)rotfoasgcehnedcuylepl1a/n25afbtrerieSftiengvse(JWohenbsbo)n meeting Inform Rich Hood, EPA Press Officeofplan; share news release (Webb) `Wednesday, Jan. 25 `DWeasskh-isnigdteobnriPeofsitngfsileintiDm.eC,. awpiptrhoxWa1s0hpinmgttoomniPdonsitg,htA)P,(WBeNbbA)(embargoed until FolloBwOiDngnosiefleicctaitvieonad(vCaOncHeannodtifSihcaawti)ons occ~vuerbral: KCoerypoNrGatOesOfnfoiticfeircsatniootnif(iFciasthieorn)(Stalnecker) KAdevyisGoorvyerBnomaerndtnontoitfiifciactaitoinosn((FPiasrhreirn/RU.iSc.k,arodt)her global) KSceiyenCcuesctoonmtearctnsot(iRfiicckaatridon) (Green, Spitzer) Share Final DuPont News Release with Rich Hood (Webb) `Thursday, Jan. 26 DMuePdoinatInNteewrvsieRwesle(aBsoeotihses,ueSdta8l:n0e0cakemr,,PWRebNbe)wswire UST WNeebtswiotrekuNpedwatsedup(dTautrene(rT)urner) InCveOsHtoLretNteorteto(ELmupklaochy)ees (Forte) Customer Letters (Weitzke, Brown) 006-0133-0083291 5.308 DRAFT AMsc.tinSgusAasnsiHstaaznetnAdministrator OTfhfeicUeoniftePdreSvteantteisoEn,nvPiersotnimciednetsalanPdroTtoexcitcioSnuAbsgteannccyes 1200 Pennsylvania Avenue RWaosohming7t1o0n1,MD.C. 20460 Re: Voluntary Exposure Reduction Stewardship Program (VERSP) Dear Ms. Hazen: eTxhpeosDuurPeontot aCpoemrpsiasnteynhtacsheemmibcaarlkkendoownn aans epxeprafnlsuiovreoopcrtaongoriacmatcoidre(dPuFcOeA)p.otenCtoinacleprunblsica:bout tPaFkOenAraoromsethceargleyneirnatlhipsodpuelcaatdioenw.heAnt vtehartytliomwe,letvheelUs.wS.ereEndveitreocntmeednitnalhuPmraotnecbtliooondAsgaemnpclyes `lWahuinlcehePdFaOAprohcaessnsottobbeeetntesrhuonwdnertsotapnrdestehnet chheealmtihcarilsskspottoentthiealgerniesrkaslapnudblpia,thiwtsayprseosfenecxepoisnure. blood raised questions that needed tobeaddressed. DuPont's Commitment P`TFheODAuaPnodntitsCpoomtpenatniaylipsrceocmurmsiotrtsedfrtoomeDliumPionanttefoarcilsietvieesr,elpyrorcesetsrsiecst eannvdirpornomdeuncttaslsolotahdaitnganoyf ErexspiodsuaulrseaRreedruecdtuicoendSttoetwhaerdmsahxiipmPurmogerxatmen(tVfEeaRsSiPbl)e.. ETlheimseinntistoiaftitvheiiss pcarlolgerdatmheinVcolluduen:tary + tRoedthueci9n5g%glroebdaulcetmioinssaicohnisefverdomthmraonuugfhaycetaurricnngdfa2c0il0i5t.ies by 98% by 2007. This compares ImIpmlpelmeemennttiinngg pemriosdsuicotnccoanptsenotncUa.pSs.remgaanrudfiancgtuPrFinOgAfaicnilfiltiueosropolymer dispersions and DePteFrOmAinanidnganwyhepottheenrtitahlePpFotOenAtiparlebciuordseogrrsaidnaftliuoonorofteflloumoerrotperloodmuecrtsproductsis a ImmpelaesmueranbtliensgousrtcuedioefshtuomaassnesesxwphoesutrheertothPeFpOoAt.ential biodegradationoffluorotelomer products is & measurable sourceofhuman exposure to PFOA fWaictilhittiehse,speraoccteisosness,DuaPndonptrowdiulcltse.liminate or severely restrict potential routesof exposure from its iVdEenRtiSfPy pcaotmhmwiatymseonftshuamraeninctxepndoesdurtcoasnudpppoorttentthiealonr-isgkosifnrgopmroPcFesOsAunasdewretlalkaesntbhye ENaPtAiotnoal PFOA Stewardship Program introduced by the EPA on December 14, 2005. Further, at your 006-0133-0083292 5.308 treoqauedsotp,twseimihlaavrecowmomriktemdenwtist.h others inindustryto encourage participation in your program and 5W0ethbaetlifeuvteurtehecosntterpisbwuteioanrsettoaktihnegewnivlirtornamnesnftorwmilplrboecedsrsaemsataincdalplryordeudcutcseda.ssoTchieatseedvwoiltuhntPaFrOy A DacutPioonnts'asreBitohpeerressiuslttaonfceexPtreinnsciivpleesimapnrdovDeumPeonntts'smahidsetoirnyopfrordeudcutcsianngdempirsoscieosnssesacnodnsdiesvteelnotpwiintgh and introducing environmentally preferred technologies. Background on PFOA, Fluoropolymers and Fluorotelomers pPrFoOduAceis falnuoersospeonltyimalerpsr.ocFelsusoirnogpaoildymuesresd hbayvea unsuemfbuleraonfd udnoimqeusetipcroapnedrtfioerseisgunchmaansufraescitsutraenrcse to 10 eclheecmtircicaall porropeenrvtiireosnmeFnltuaolroapttoalcykm,erhsigahreteumspeedraitnuarrechicatpeacbtiulriatliefsa,brniocns-;satuictkomcohtairvaectefruilstiscyss,teamnsd; atenldescyosmtmeumnsic--atiinoandsdiatinodn etloecctornosnuicmewrirpirnogduicntssulsauticohn;asacnodokcwoamrpeutaenrd cahpipapreplr.ocessing equipment fPlFuOorAopiosllyamregerlyaprpelimcoavtieodnsi.n tTheestmianngufhaacstusrhionwgnantdhatcosnvoemresiionndupsrtroicaelsspersodfourctvsirtmuaalylycoalnltianidnusttrraicael `lemvaedleswoifthPFDOuAP.ontOnuorn-srteiscekarccohathiansgs,foiunncdludniongdettheocsteabsloeldluevnedlesrotfhePTFeOfAlonin bcroaonkd.ware products tPhFeOmAaniusfafcotuunrdiinngtprraocceeassm.ouFnltusorinotseolmoemefrluporroodtuecltosmearrepnrootdumcatdseaswainthuPnFinOtAe,ndneodrbiyspProFdOuActaodfded pdurroidnugcethseurmfaancuefapcrottuercetioofnfplruoodruocttesl,omienrc-lbuadsiendg spruordfuaccttsa.ntsFalnudorooilt,elstoamienrasnadrewautseerd rteopellents, for aanwdidhaerrdasnugrefoafcaepcpolaitciantgsi.ons including textiles, paper, fire fighting foam, medical barrier fabrics. aPprpoldiucacttisonmsa. deBewciatuhsfeolfuotrhoepiorlyumneirqsueancdhafrlacutoerroitsetliocmsetrhseayraeruesweiddeinlymuasneyd cwrihteircaelldyeipmepnodratbalnet apnedrfcoarbmlainngc,elisowesseemnitsiasli.onsCrfiuteilcahlosiendsu,stproilallutuisoensffioltrerfsl,uhoirgohpopluryimteyrshainndclliundge siynssutleamtsiofnorfoirntweigrreated `chmiapdemawniutfhafcltuuorreo,tealnodmevraslvperso,tteucbtinmge,dliicnaelrscaanredpgraosvkiedtesrsfoargasienvsetreblsoeordv-icbeoranpeplpicaatthioongse.nsParnodducts eprnovviirdoenmseunptearliobrenpcelritfsorbmyanexcteeinndienxgtitnhgeuilsifheoinfgahnyddrporcoavribdoinngfieraess,iearnmdacianntecnoanntcrieobuftemasingynificant consumer products aTnhdeseextpernoddeudctlsifberfionrgacbornosaudmerrasngmeaonfayrtbiencelfeistsu,swehdiecvheriyncdlauyd.e eIansaeoddfictiaorne,,croeadtuecdecdomoakiwnaterneance, facilitates healthy cooking while providinag surface that is easily cleaned. Potential Risks and EPA's Process to Understand Those Risks 006-0133-0083293 p.310 bBoatshedbyonDuePxiosnttingansdcioentthiefricscdiaetnat,isitns,clDuudiPnognttoxbiecliiteyvdeasttahaatndPFemOpAloeyxepeoshueraeltdhosetsudnioets pcoosneduacntyed bhelaolotdhorfitskhetogtehneergaelneproaplulpaubtliiocn. anNdonDeutPhoelnetssr,ecPoFgrOiAzehsatshabtetehnedperteescetnecdeoatfvPerFyOlAowinlepveeolpslnesthe pboltoeondtiraalisfeosrqhuuemstainonesxptohastursehotuoldPFbeOAaddfrreossmedo.ur pTrhoudsu,cwtsehaanvdeptraokceesnsesa.ctioInn atdodrietidounc,ewtehehave: ceoxnpdouscutreedannaelywsehse.alth studies, expanded our monitoring data and performed extensive fate and dInatlaatoen2t0h0e2,isEsuPeAaninditrieadteudcea spcriieonrtiitfyicreunvcieerwtaoifnPtiFesOsAurtrhoatunldeidntgopaatpuhbwlaiycsporfocheusmsetno edxepvoelsouprenaenwd a`psosteesntsimaelntri;skss.oliTcihtaitngplreotceersss,ofifonrtmeanltlyfrloaumnfclhueodreoaprollyyimner20a0n3d,filnucolruodteedlodrmaefrtimnagnuafparcetluirmeirnsartyo risk parnodviddeevedlaotpainognfaorrmaanlgeToSfCtAopiScescitnivoo4lnviEnngfoprrocceeasbslees,CornesleeanstesA,gprreoedmuecnttiosn(vEoClAuSm)esanadnd toxicity; `MmeamnoufriacntudraeorsfaUlnsdoecrosotpaenrdaitnegd(iMnOdUeSv)e.lopFilnugovroolpuonltyamreyrreasnedarfclhuoarcotitveiltoimeseraddressing potential etonxtiecrietdy ianntdo dtehgerpaudbaltiicondoocfkoeut.r products. Information developed under this process has been eInstJaablniusahreyd 2a0n05i,ndEepPeAndreenlteapsaendelaorfeofiuntesdidaendscuipendtaitfeicd edrxapfterritsoks apseseerssrmeevnitewanthdesdooocnumtehnetr.eaftTehris aPdFviOsAinRgeEvPieAwwPhaentehle,raltshoe aresfseurmrpetditoonsasutsheedSicnitehnecedrAadftviasroersyciBeontairfidca(lSlyABs)o,unisdcahnadrgceadn wbei:th aecftfieocntsi.velTyhuesewdobryktohftehAegeSnAcBy tiso odnetgeorimnigneanpdotehnatsianlotriysektsraenadchaepdprcoopnrcilautseiorniss.k mTahnraoguegmheonutt the. criosmkmaesnsetsssmfeorntrepvrioecw.ess, DuPont scientists have contributed numerous studies, analyses and. oDfutPhoentAgheanscsyupinpogratiendintghegrEeaPtAerpkunbloiwcleprdogceesasboauntdPhFasOwAorankdeditscoilmlpaabocrtatoinvehluymtaonmeheeatltthheanndeetdhse EenPvAi'rosnmreengtu.latoIrnyadcdoiutnitoenr,paDrutPsoinntthheasEuwroorpkeeadniUnndiionv,idCuaanaladlnayd,wCihtihnaotahenrdsJianpiannduasbtoruyttaoctiinvfitoirems raendducnteiwonisnfforrommatoiuornfsacuirlritoiuensdaisnwgePllFOaAs.thTehriesfowromruklaitnicolnuodfesouardislcuuosrsoipoonloymnetrhediesmpiersssiioonn. Faciliry Emissions Caps `Icnocmopnrjeuhnecntsiiovne wiinttehrnEaPlAR'&sDpuebflfiocrtprtoocebsest,teranudndienrspatratndprhoomwptPeFdObAy rite,aDcuhePsonthteheansviurnodnemretnatkeannda D10uPdeovnetlompanmuefaascutruersintgo prersotcreisctsetsheanpdatfhawcialyitsietso, exposure. as well as aTnhiesxhianuvsotlivveed aantahlyosriosugohf pervoalduuacttisonanodf precursors. o"fThtehiascteixohnasusbteiivneg Rde&scDriebfefdoritnctoinsdulceteerd, owvheirchmaanreyeymeabrosd.ieDduriinnVgEtRhSisPi,maer,e aDudPiornectt hoaustgrowth stirgannisfficoarnmteldy rteheduwcaeyPfFlOuoAroepmoilssyimoenrss. anTdhefsleuoirmopterloovmeemresnatrseamraedaelrweiatdhy uthnedoebrjweacytiavendtoare 006.0133-0083294 . p31 pfrroodmuaclilnDgudProanmtatmiacnruefdauccttuiroinns.g fAacsilaitrieessualtr,ouwnedptrhoejewcotrlthdatwibllybyeearre-duncde2d0b0y7mPoFreOAtheamni9s8sions pFerrocmen1t4f2,r6o0m0aIb1s.99i9n b1a9se9l9inteo. abTohuet n2u,m40b0erbos.fpionu2n00d7s.ofAwtoorulrdUw.iSd.e fPacFilOitAiese,miPsFsiOoAnsewmiilslsdironosp will Our dienccrreeaasseedbuynmdeorrsetatnhdainn9g9ofptehricsenmtatteoriaablouatnd1,t2he00stbes.ps in the same that can be period. taken to control PFOA efmuitusrseioenmsishsaisonasdvfarnocmedcutroreantpoUi.nSt. wfhaceirlietitesh.ese reductions canbetranslated into hard caps on PFOA Redu-Fcluotroiteloomenrs "cTohnetesncitenitnilfiucoardovtacnlcoemserthpartodhuacvtesbaenedn tmoadsiegnailfsiocaanltllyowreudsutcoecdiormemctitantdoliinmdiitrseoctnprtehceuPrsFoOrsAthat may than form PFOA. 95 percent. DPirFeOctApcroenctuernstorasnsducdihreacstaplrceochuorlssowrisllinbeourredpurcoedducbtys mwiolrlebethraend9u0cepdebrcyemntoraend itnodiinrdeucsttrpiraelcucrussotrosmweirls bwehorefdourcmeudlabtye,mbolreendthaannd,50inpmeracnenyt.casTehse,sdeilpurtoedpurcitorcotnocaepnptlriactaetsioanretosold fwiansisahteditgsopoedsa.k aTnhderebdausceltiinoen feofrfotrhtessbeegraend.uctLioonnsgeisrtchheaiyneaprer2f0l0u4orwohcaernbofxlyuloircotaceildosme(rchparionduction ladednrgetshssegdr.eatBeerctahuasne8f)l,uoarsowteelllomaesrtphreoirdudcitresctaraensdolidndiinremcatnpyredciufrfseorresn,t wciolnlcelnstorbateisoinmsi,ltahrely `"ccoomntmaiitnmeedntass saorleiedsx"prbeassissedthianttreerfmlescotfspcaornttsenpterinmtihleliaobnsoerncweeoifghwtatpeerrceonrtootfhetrhessoelvmeanttesr.iaIlnsaolln a cwialslesb,earseppalratcoefdoourrrecmoomvmeidtmfernotm, where content commerce. reduction objectives cannot be met, products DfluuPoornottelbeolmieerveisntoeurmredsitaetweasr.dsThihpeparcotgiornasmdsehsocruilbdebdeaebxotveendwieldl troestuhltosien wcohnotepnutrrcehdauscetoiounrs in a nreudmubcetrioonfionuPrFiOntAeramenddiaptreesc.urPsroorducocnttsendte.rivIendthforsoem ctahseesse wihnteerremeidtiisatneoststheocuhlnidcsalhloywfeaassiibmlielatro memoidsisfiyonthaenidntperromdeudcitatceos,ntwenetwriellduecntcioounrsasgiemiolaurrtcousDtuoPmonetr.s to pursue a program that will result in DanudPopnrtodaulcstoscboemymointdstthoecaogngtriensusoiuvse giomaplrsosveetmfeonrt2o0f07o.urNfelwuoprrootdeulcomtesarrmeacnounfsatcatnutrliyngbepirngo,cesses daenvdepleorpfeodrmtaonrcee.ducSeucocuerssenivnitrhoinsmeefnftoartl w"iflolotdperpiennt"d,oynettsimiellymarienvtiaeiwn ahnigdhalpepvreolvsoalfseffforectthievseenenssew aprnoadluycstiss.in DthuePoapnptlipclaetdigonesprtoocweossrkfowrinthewthfeluEoPrAotetloopmreorvpirdoeduncetcse.ssaIrnytdhoeccuommeinntgatdieocnadaendDuPont ahpoppleiscattoiocnosmminerocridaelritzoeabcrheiackvtehernovuigrhonpmreondtuacltlsythsautstcaoimnapblleeteglryowretdhefoifntehifsluiomrpionertcahnetmipsrtordyuct line. PFOA Reduction - Fluoropolymers Fchlaurraoctpeorliystmiecrss. aNroenedtifhfeelreesnst,fDruoPmofnltu'osroctoemlommietrmseanntdfhoarvfeludoifrfoeproelntymaeprplpircoadtuiocntssains dequally aggressive. Fluoropolymer materials are sold as dry resin pellets or powder and in a water-diluted 006-0133-0083295 . p.312 (amaoquunetosu,s dmiuscpehrosfiownh)ifcohrmistdoeisntdruosyteridalinfafbarbirciactaotriso.n.ThAqeuderoyupsrdoidsupcetrsfioornmsscocnotntaaiinnhiPgFheOrAaminousnmatlsl offacrileistiiedsu.alDPuFPoOnAt(icsa.co0m.m2i%ttoirng20to00repdpumc)e PsoFmOeAofcownhtiecnht icnanflbueoreompiotlteydmferrodmisppreorcseisonssorbyplmaonrte tDhuaPno9n7t pceormcmeinttstonogtretaotlsyelrleddiuscpeertshieonpoptreondtiuacltsfowritthhesmeordeowtnhsatnr5e0amppemm.isPsiFoOnsA. Mcoonrteeonvterb,y year end 2007. DexucPhoanngte.hasTohfefeUr.eSd. thfilsudoirsoppeorlsyimoenrtmraenautfmaecnttutreecrhsn,oklnogoywntoaosutrhecoFmlpueotriotpoorlsyimnearsroMyaanlutfy-afcrteuering Gprrooduupc,tshabvye2c0o0m7.mitDtuePdotnotais90ofpfeerricnegntisretdeucchtnioolnoogfyPtFo OheAlpinentshuerire wtohrelsduwcicdeessdoifstpheirssiionndustry commitment DabuaPtoenmtenatl,sowaitseorffterreiantgmreonytalatnyd-frreeecoavcecreyssfotro its patents reuse. and technology for PFOA emissions DpruoPgornatmwfilolr sciomouklwtaanreeoumsalnyufcaocntduurcettaoceonmspurreehtehnastidvoewfnlsutorreoapmolaypmpelricpartoodrsucftolsltoewwaerndvsihriopnmentally rigorous controls in their manufacturing practices. Biodegradation and Transparency p`TahtehEwaPyAfohrasPrFaiOsAedtqoueenstteirontsheabeonuvtirwohnmeetnhte.r bTihodeegobrjaedcattiivoenooffVfEluRoSroPtelisomteoerlpirmoidnuacttesoris saeverely r`ecsotmrmicittteexdpotsoucroentfirnouminPgFsOcAie,ntiifniccluadnialnygstihsattofbreotmtearnuynpdoetresnttaianld btihoedpeogtreandtaitailonf.or eDxupPosounrteiasnd ddeetveerlmoipnaentdheinftartoeodfuceexitsetcihnngolporgoyduacntdsptrhaotdumcitgshtwhbiicohdedgorandeo.t mDeuaPsounrtabilsyaclsoontcroimbumtietttoedPtFoOA in human blood. cAosmpmairttotfooduerveolvoepr,alslhaVrEeRaSndPucltoimmmaittelmyenputblwieshiannvailytateicraolbumsetthaossdessasnmednmteoafsuourremreensutlsts.thaWt e will pornopvriodgertersasntspoawraerndcyouarbocuotmmouirtmreesnutlstsavnedrswuislofuorllcoowmmwiittmheonntgso.inWg erewpiolrltipnrgovoindceepoeuriroodbijcecrteipvoersts hmaadvee.beWeen awcohuilevdedb.e hTahpipsywitlolwaolrlokwwbiotthhEEPPAAtaonddevtheeloppublmiecchtoaneivaslmusatteo tehnesuprreogtrreasnsspbaerienngcy to the public as we work toward achieving our objectives under VERSP. iAtsseuenkdsertsocroermedovbeystchieesnteifciocmumnictemretanitnst,ieysosuurcraonuncdoiunngt PonFOouAracnodntdienvueeldopcoaoppperroaptriioantewirtishkEPA as hasospeesstmheenVtEaRnSdPrishkasmasneravgeedmeasnta maoppdreolafcohresthfeorEbPiAopeNrastiisotnaanlt PmaFtOerAiaSlsteiwnoarudrsehnivpirPornomgernatm. whWiech will be the mechanism secure the commitmentofthe rest of industry to achieve similar results both here and abroad. We look forward to your supportof our efforts. 006-0133-0083296 : p.313 Respectfully submitted, VSiucseanPrMe.siSdteanltnecker 006-0133-0083297 . p34 W-- : iloraen To CHa W asberOUEAEI-DPon@DNPon 02/16/2006 05:21 PM. Stbie Fo URGENT Set Gi ue 0 Glee FoardTBebnyEnSun SachaAETuPonton 0262060521 PH -- contin Fr] Cryo SoaACTAPON@OIPt, Oil CraAETP RO, oe 02/167200 cms Carolmarie C Brown/Contractor/AE/DuPont@DuPont, Kathleen H Forte/AE/DuPont@DuPont, R Clifton Webb/AE/DuPont@DuPont. Daniel A " `Subject URGENT:Script mWheaen eec', pPaosesoevmieown.he aachd. ion 10 s10dChad . J Cate ww. HS 006-0133-0088917 : p.315 CSiotvueartaiogneahnaaslybsiese:n bPrubolaidciitnyparirnotuannddSnAeBtwroerpkormtehdaisa.liSnikgendiftihceanTtefdliosrnubptriaonndsti0ncoaunrcer. markets and are consumersare very, very concerned. vTohiece"AosfkE":PA.Tn Wouer onpeiendiotno,EtPheAotnolyquviocikcleyt(hlaitkecafinrcsut ttitnhgrotuogmhotrhreowne)gsaatyivtehestforoilelso,wiinsgt:he s1.tiCckoncsouokmwearrperoidnuycotusrskoiltdchuennd,erthtehestTaienflreosnistbanrtancdarapreet sianfey.ouTrhfeasmeiliyncrlouodme,tahnednothne`waantdeorfpfreoroufnjiaqcukeetasnidn iymopuorrtcalonstesb,enaemfiotnsg other products which are valued by consumers 2. Further, to date, there arenohuman health effects knownto be caused by PFOA rAenpootrhteira clrareicfoymimngenadspaetcitoinstwoheErPeA.thTehEePEAPiAs wwiiltlhcroensspiedcetrttohtehereSpoArtB, raelpoorntg.wTithhetSheAB "nseuwggiensftoirvmea"tiisonthaensdtsatnuddiinegs ansostescsomnesnitd,eruendtibl ythteheEPSAAB.coTmphleectuersreitntricslkaasssisfeiscsamtieonnt of process. 006-0133-0088918 p.316 Susan Si0s21l1n7a1c2k00e6n04I:4S2 PPoMre To cc CDoNn=nCahaLdSaunHdoelrisd/aAyEl/ODUU=PAoEn/iO@=DDuuPPoonmti@DuPont bee Subject EPA GLuirndnaeheadsacnodntbaectperdepMaarrecdutso dPeoascoomcetkhainngd.gotThheimcotoncuendrerisstaabnrdoad `rSaetnsayttaectmoeennwctehraantbowtuihttehpyrchoodanuvcsetusmsaaeifredtsy.(ciohnSethrieenuissitnrngeos1si0endufostrehmaathtoailuolsnweethhoawlladnwtporiuoslddtuocitnsd)icate `ACNusDtotomeprosinatreofuwtiltlhmatoTvEeflaonwis10anoOtthyPeFrOpAr.odSuhceergsowthioshaalvleenntiootnstihganteodur up. He said he would talk 10 Johnson and have him call you Robin, please make sure Chad sees this note. Thanks 075-0144-0011180 ' . 3 ! O - - ] (2a82e 5 TRANSCRIPT OF EPA DIAL-IN PRESS CONFERENCE ON EPA'S PFOA GLOBAL STEWARDSHIP PROGRAM 2:00PM. `THURSDAY, MARCH 2, 2006 WITH SUSAN HAZEN, ACTIN`GOFAFSISCIESOTFANPTRAEDVMEINNTIIOSNT,RATOR, PESTICIDES AND TOXIC SUBSTANCES mjr-- , Washington, D.C. - p37 |i i || ||i | | od |i I ii i || | i !| | osorsecooier | | - - p.318 i cCoonteaOssPEoauRplAeTsO0R:lGAoosaoadvaereemownp.alcMyecanameetiesBoeperrssndonoeil beysi A i ||| Ant oaks ets atoils on ssn Te 20 HiikethtooasnkaoqpueypsotuitoHnydugrionsgnothalisdetHriemesiwmeplyhprsessystara aaend thenuepmbehrnoneeo1 nnytouer | || -- pTiaingbeDeraOBTmo7d5sa5yh(s5ic):oe1n,stahocicrillBoiblZlieoc.or1tsoyotSwantot inmitA mh ov,hewsocping SOosneosPaonltoh:ePieevsdneCrhoosde EweogbrHeos fetrhafete SreomSoUnSsAeNoHEAFaZEEEO0NA:SSGoondnsemoPorno,geveroyonte--,e--ckp symoutvyeeyeccmlhuforr iking ------ wPereemv.aaTyooaeanosowpo,tweensraeMlaBroochwi1nagaEhdAeasdrloineem,Tehshdaseiwistneoscehe And 25rent thai ty |b| | O angAofssyoukknowd , PROA is proacet ssosiad thgats wdTnohemmanufEof ide || CiitsadPEoGnA.Tohe ssywdontshtonroneg rot wil be `manufacturingprocessdoesnot,however,mean thatpeopleusing theseproductswillbe. ||i E2Hr0i00sPF evraan.Th SE orpreis Ssomit cmte a-- lSeetss satehrPeFOA os stot pom a yet | Thisi eit ing do height hing dono rhe cionmens, | bpRunDeabiilneinhgc,hs eCraeatltpohe,mthnec SdaiguseaenscPyme,FAm aaOrnkdAtofonnradSagfooeeensck,y.ooCWtomenaepphnloauoSdt,oArDkececremoaso,AmosMaehhrim,sCCiibCs,lCrliariinan,t, i||[I | weorsiooooiz | | | il : | | Dem r Each companyi differentand weusedifferentmeans to achieve thegoals,but | Ere wait,oc o sgoe we rt mlnEpbNriTrehsoonts ||! `pcroongtrinaumeg1o0awlo.rkwiththecompaniesastheyfurtherdevelop theirstrategies10reachthe i | by rgCrs io ct re `Severalofthecompanies have alreadymadesigaificantprogresstowards thegoal | Compas i w PO aed fortheirachievementsthatthey havesireadymade. EPA isdevelopingguidanceforthe Dm cCca o S eoporumomnSeetE mo o iyascn irhdRevg Orp erAenn ePe SEsFAnmS OoaoSe ewney toaeems tdpmeT a Sp apP ehrntecbvpihni eObn rEeohCehesDdoaEertvbo nt tieybeeahsirnBipeotrrrkhs.ns eeidiebolrry `October31 of2006, andguidancematerials thatweprovideto thecompanieswillsiso re ha forward tosucicntheissaresa. pt eure pt em et Pr neaPr 0 i Somrit ciogp A | a R i e a r gep T okfrir esanlT oee ottTfovhioeteprrnodesi of-- doerocFsi Cohveretyhensyoa theFeOsNt weeeowE ne ether i wleili, eg rrta eTs kyoufopEriceing oecollydevo bevypy0 [I i| . Oy { 5.320 . i MR.ZEE:Whoisfirs? | fosrkjausqtuOeasmPtoEiomRne,AnTrtOestRos:csAtoamtrpaitnhlidesttthhieemQeu-mIawbnodeu-rlAodrnosietkoeenr(.y0oruermitnedleepvheornyeokneeyipfaydo.uWwoeuwlidlliuksteeo Yourfirstquestioncomes rom AmenaSaiyid (sofpBN)A. d`ieSrcouartQcsC:ohamaVrpelasenn,si.geoHsootdhwastiewsromEuoPlnAd.gusoTeihdniigsf1fA0rmoevcnentrsaspSepaerytohiaidcshweeifsfto?hrtBifN,A.yTou mhiesntaiqiouneesdts,itohnefor | w8o6rkisnegnMsS-e.coafHctAhhoZefErtbNha:esseelWicenolemlpfwoarnotiwhcieslrdleobmeci,ssd5siifofnraseyan,ntwdtophrriknoigdsnu,gacwtnicdtonh5t0eawcnotem.wpAiannldibeweswe,owirisklitlbnogfewailtlh0 Atthhneeidmwpoa0rbnkestiftnoegrrwhiuotndwhetrhtsheteayman1dr0hedogeotwietnrhgmeiy0nceihrteohcewurctmeah.neuyfaarcotbeuirnegrourseudse,tPhFeOyAwiolrlthheaspreewciutrhsuorss. O 2:Whois 23041705a(An0 dngttdhttehihreevirimr,ptbuouarlttctaltnhtiepmcisidosnowiafbltytlhb2eied0oa1ay5n,.tAohunrcgaddosoolftihtehptordhoaagyvrteah5me5ny-ompeadrycscenh0tobroeesdfeulcdeiixfiofbnelrebeyot t 9c5n-opuegrhce1n0tarleldouwctthieonmotrotwhoetrokttahleawnadyvitrhteuaylneeliemdi1n0atwioornk,andthecadresult wil bethe PublishiMnRg. YournextquesioncomesfromMaryDurburrow (sp) ofThompson Q:Okay,canyouhearme? | MR.ZEE: Barely. 700giveQm: eHi.thes1utnadteurssotnantdhtathaatndPFthOetAiwmiellfabemaed?ded to the toxicrelease nveatory. Can : PtorxoipcosreeMalSde.dasieHngAiPnZvFEeOnNtA:o,rYyae.dsWd,eiwnagercaehreeimn.tiAhcaesplysrootucoktehsneooTwfR,pIPrF-eOp(Aianiarsuindtinohbtgeliceun)rf-roneronmttailtycieloiansntndeedcceoonsmstmahereyntto `reuxlpeemcatki0npugbplriosches8pssroptohsaedtheleealractoptpiosrtyuenaitrioersvfeorrypeuabrlliycpianrt2i0c0i7p.ation, andwewould `ask queOsPtiEoRnA,TrOeRss:staArttthheisnttihmeep|uwmobuelrdonliekoen1yroeumrintedleevpehronyeonkeeiyfpyado.uwouldliketo || 004.0134-0000464 | _nIg] ;j ee reer e P ooN | earrtaozne rPsvotytosps omy (END) O | sess | So SE =3 T= oc ? i SS -- :8 zg || z | } | | fake 70 | i1 || | ; || Eo Eo Po Co |  i[4 5 2= 3 5 22 ts%: =S sf. i x 8. 8&8 t bE - S Se z 5 5 fg is 8 T c s o53S9238282x 2 :g 8 3 <5 8 EE fr: 3 g E=g t < GBc 2 s a S3? E o5 go e>3I 25 2B8 s8222%98 := "5 oo oo 9 oS 3 Es: > 5% 2 : : oco =soOSe 8 5p5 2i58lc 2 : | ooO E E 52E85R5EEs8R8T33 2: = E 2 vz 8 gs s 5 i3g5 5 Eif 5ts ii s5s 8 022%0 se 58 BEES c 3$535E5z3 pBviEgtEs ukvdgegE ; || ||| ||| |i | | i || | | | | 1|| | :bP8P :o li|| PBoE | So 2 c 2 4 "-- 3@ 08 J&2,5Z58a85 e2338 r= 33 2 52582250 2 T2H0T7T5S 205 8& b4: 8E5S8S8E6 333:% -L5 X5c2e2g9E8 05T3w8s3E. 2 E 2 T22 3: 2& =gai5e es s > 4p 222, g 3383g3% 3 $i20 . al ~ a E6 E) o2O SeqsaEsE Seg c oT = 585 gee sEgFREEE 05g29 iOFr% 222880 LST LL 8 . 05 5 o| | | | g || | | || || |{ | i | P| i | EF | 81i i p.325 81: 8 2 8 wn g :2#8S [o2 s @ 53 oO = 8 2s z = HER! = 3 2 g 0 : 08: al= g2qa S2 EEhs = 3: 29 g 5 Hi iZ + LH T 9 = 2Q0% -3 1@3 25S2S8E% _ g22%u 2otg : I 55 x8 209 Ss86 S 5E2 8 So 28 3 s 0S5e 35 s 278 of a4f [27] o:O f2< ag5p2 i3agiSiEsE i 3i ssigid F : 5 -~ 2so2 2222 832g 0f B58i eEsEsi3s c g o i ==] 202 5 E Sf e22r s5 s$e sg88 n in8 i 5i,i si: ts e; 228 > A 2325ge 2fgEE S ot3E8D 5ec BEE L +e E2 sP E ie 8 isi izeoil s s eis ; E582 82% | 5% 3 ; gs 3 ES | ||| || | || || || ||| Co || | || ||| | | :" ||| | Po|8 i io i| | | LL p.326 { o i o : 285825 3 : sa3d 2gtg o SES fis =: 0 :Ss5H 8paE s5s5e8i5i5s]s || o : =4 $os3eEs2fs2E3f EgE3sE2Ei 8EskHsso 02 : iH z | | Sal o Lh 2 So3i 4E5e Bs SEH ifoei dsE nil : || i> i H p H1 t i Ei $HFroiegiieflirtzilssri20in22 2=: :< i =si liia3sl8t% r 8SearHi iie] 2|H2 :siz4e8 s sist | 50858 g 23% | i $p88> FE)5 338858 jH aifH tEis in: 0 | :o a H s8gi25f5i 3ea%s fn ii 2s38d 5h gos e I | 3 1 298h LE 35 c85sEs CHIEits ss | I I iSs283s85:3: Fn 8 3 HHon g 1 | S<EEe2i2tfcit gi28S8e3ssyF55 88 Ll :3 a o3l g2 ele3s22 Si3a5:ils $885 8s sSEiisissiis g= : Ee5 s : f:: 1|||| o ig | i i i c :he L:ogs25 8S 36 8T= 2T2 8x3 85 = 25 SQSD 2$t088ec i:8zg ii:ys3 [zz 2s223:8P 5E6 88 o 5 2 if1 3 3: E5 3 5[2 E2s8g fs igeo5f ss: i ps2 E582388 g888 pt 2888 8aE > 56 Ez 85 E33 g 2 7 EI EEE SE 3 gi-1088: 58: Tr S5ogcg 8 Be E=2o %oSELc E5 3i& gesiiciizsts * Zf1 iziH edicons $35 2E2% 2835 Sii35::85; I e8 8EEea R 5 E:Ee 85 i3fd ] g 3 fo 2o c S e 3sg 8323 :: 23H85E 5a S e$g5Rf3 9IeEE 2 o2RI8EL 3gZ s88ed3 or Se wos ged ggs & 59' aig + O CE. 0 8 : Co p.a27 | || || | | || :: | |i |||| |||| `:` |f H| | 53:g: |||| i |!| iN - c = 2Ss3Eo 8gZ2 gp 5 38 2Ss o: > EFE.EE 2B8E%2S 0B 2s2s i 5 8% foots 8 $3 SE EI pugs E i- F 2322 -- 8 sE_& 58 SE F go I nw g5g8 EE8EE3 g&|s 2E985>s 5 $5 >5 2 Eggs Sa sc gd o - 23 E> 5 8 Z> 5c% 38% 2 E HEE g ee oo 02 Tp 2 5ar Eo 822s826t%55e 2885SE e 2E& 2wG25o58gn88 8398 88 3 DO 22 53 gE 22 23 ES 835 Ed, 2888 oF Lr c2Eo3>gaS 48,88858 803 25858 85855 8os5 go 2= 9S5o9p0 S 388 F s2l BE SEEZS s8gT O E5 5>E fo3 35 555285E Z3 T SZs 878 83:2 2F . s Ea C8 U6% 895% 783 .- p32 i ||| ||| | | | | | ig || 8i|| | ` | or Sa -------- To: e Se eegI mnenPA aEtr Sol Robert WRickard<robertw.ickard@usadupont.com>;MarthaL. ' EE TL Soi ertiegin nsde rBSeI ceeilry oanperc: +a FO a a GC r r ed lgrg aapaey `Subject: EPAMestiogthoughts ` EXHIBIT Gbed] ok `Verymuch welycourothomughets: &nbpp:For thoseofyouonBBs,thecutand. Dip 14s -- 3/30/06 1 Draft Outline | Ovenll Objectives: e B iis t nenSecsmovpmaeesarEdesavpdyonpg ECD Comunicate ourconcerns aboutlackof consistencyof approach toward theissueand. 7 See oe m Se oee seoecn eeings1sdtivusrs ta oe otgre i ro, saohwtttwhg enpsnmotvd sehs endwiel Messages: + Industry ae responsesdono tvisnedicrtateslyeyvelapolaynoinugtsfiielodcaendsdodnboctoboydoeuwepolloafosrmthteoseulnccyesdsoft esmts hesoe Mgoe so ie 7 `compeiitive realities are knonwyn indivi noursamme, Hotspelemne || E Ieasurement ise seuessbvuttshosshavmeoenasbtloetd mvsoorwegotrabnulBaersseccpowunhiabiorlteospttobss oeestoaabbloe oishheeed.mwket || . were | : = : - p.530 It avaWietaeocntoonrbcytehea cmoneni edd evn elofocbeiivlid toisurtsess.We will otic to dothe || S"phpiprrtooepr1gissaarenfdleaetrvyeemlosouflsftdsirioWnakeinnwdgiwelantvceirrooannmdnetnhtbieaelopsmroaiucngiiecitenocolrfuiadsnhedasgreiannbgdreroaeavsdourlstitowebiotefhtycohruema.icTnahlses.ppaebWroseupewtenetchteihvaes || | TaS+"koiunrgWssefeopratahenvleertvhieetlysp.rSou(ccCehatspotofsFdaaernvdeilovcprihncgxeaoumhpelsbecr)eonacdeesrrraalnoggeyswhWiecharwialsl oinfcdihceastainsg sheorfmaftociuvse faoororekDasuotPofoinbntidg.ugOseusutyriainnmtdpeontathceiortntsoDmiunaPioknnedtus.sutrAreygot1und,owreetshoweuarencietsr(0mshmoanoreveyeDaunPdpoeaotpoluet)oafrehceonicenetrlategadodhnvtihtel | i a I Mer | Agenda: 1 Vpluntary StewardshipProgam, Recomplishments | LMMeeavsnesalaggpiilnnagygipnrgocfeiselsd Now prods 35 SShhenedirrccsionedpsaeyis 3 Ghobal regulon drecion i | hIrniitsecrncaaontmim.ounnitoccwah:tatio1mn5ayyiosubefoarpcreiuvnsiosltebgytehedt',hedcnoitnontntideaandedmecdrieceritepcioievpntisce"onpty7eoaiundshacecoeensthaeuirnnedsseyr ||| FEEooeerimleanlsyaamohtiItnaicBdartdt,ehlaetitse'.asnrtychilUssoet,ley/Caiopipr)yaibnfpgrtoeomeFdy.doiusrPtLrseiyabssuteecmin.oontUicnoytfesChhsiesesxeepn-lmdiaecirilt,lbyy | RCoLt CConaemtriotcutreofafecro.ntrTahicst ocfofmeert,} docesontnroatctConssmeiavratte,5 ocfonsaenntsecGeopttahnece inter or nce so ehira parties Francais Detutaach Itoanlitaneot.Espanol PoertmugtueSs iJnpiangse .Chinese Korean | i | | : i| | i| MocAsE00TS | ` po ~ past I i ITom a onbensnonsawsbions !|| FM psogo ! `Subject: Fw: EPAMeaing | A Pa eE Ep E --e owen " E eS aE R al apampa ea. torsd | S ce iaenE ese RgmA annomr `BobbetyeRickhard,yMikeMwrctCai ybeaend |mseedtwiotmhetrhseBEPAs(aSnunstieHaczen |i E`vaEtctueralolory rsvocoivtmetdliaetntemerdsifrromthateCsn8mWorekiisnntgGrrSsouehp,beemtnc.asnsrditnrquveeirerd s | (hdEXoeHrIB,ITSO Suporte tvs nt to vt wo we wor ayers S022 ||! rfeabruetbiaoirmartg i t5t6 n ewwe cvtelsisFrote obeerd. neel | erolae tonottrberawthschtooSsttBmiihttoyEbodnottaswaetbsooetseofoeti. ewetrem-- e | rr oy fa oi TaF oro ceopnar en srooT eea n--as-- tenbls ne--Ste 1 thomeat,plese dont estat tocome you veaysuesofconcerts. on [I A SD ThisIcToEmmunL icELatiornLia fooTroruhsoeoydbySeTthe erniEnrtenl t dh edtreS cn pinpientta oSatnadtiseceonpmtwaii,nhss, ||!|i |I weowseosisr | Symes tes poe te phy eet i | | i wocapeastss | nem Sfp EEomlalnono, TEfo S GE E oaEb EWB I E ReEE kaCi, e ayes i= cet Pa or To cc CN=Robin ROR/OU=AEI-DuPoni@OuPont aLoE-- n EI puiTs -- R -- e DP =HE oa.a rerpeceari s | i| | 2x 2, | irr cva pTS SoennEE oon, E eER ero r met B e E e EeST n eTLeT E T LT AeemeetrC er oe gernete M rtr eeeI sreeon FeT R e sE e n E teCphreomseeetsee scceeneperrtsesre cosas || i . = p.334 SE ------ | BE oeEmvioawrnse 3% ToUHMs aEypEbaoe anouPneae FGadousagMhr athaenv@e Por suis ne Era Toohteats MichoeieCabe<richoeinccabe@earink et e w_er--ean r a a AGa bene on sESaeen Subject EPAwater 2E A yonu aceeearvn asiElibelee", hXismuyTonuascieydoaouyton4 p8om1.hoHweolcdontfheeredantcee. cal1d11with wae uH. ovicenaescvieciatnees p:SNtoaOrr3meiaIinucdoEy0eDsri(lvekoag sion nee XEXpCHaaIpleBieIsT $9 | | 006-01330108297 |  p.335 ?SSutsiamnackerAEDuPon rasa To. Pi Nl=aTthaolOmOo aUUs-AAMEEIICOOa--e nDDnuuepployo/nrO,,UCCSNNAe-EIGCOah=raDyduMPOont, ON=Siacay taaiOU-AEIC-OuPon fo Subject Forinto 2 Woegrhaev.ehijovuusert 5ec0or/m0em60esn1mcewpdorrodkviiwsdicilunhsgstlihoonmsawaainrtdehrtOhlPeiWTynaeSdt..e|WsiDulgigbveisieteosydfoihuEaoPfu,AnrikhTeerhtewhyheekwnniwotewhtvhneereyexxlmipteolesetu.arbeourtedPuFctOiAon TBhoannkhsesttaoctalel me f you have any questions. (7 0978) SThuasnakns, SenTtifmootmhymyreBlloancdkBerry Wireless Handheld TSFoerrnoms::PAT0Gi5Am/-o2-t72h/4y300CI6orreel1a1nT3d2e8amA CSeurbjeScaty:reCoLmmSienabiaccahtions Report aPcatrikoenrlsabwsuurigtrfeilseiddeinntWsofoilde PCFouOnAtysuliatstawgeaeinkstthaDtuCP8onftro-mThDruePeonretsiWdaesnhtsionfgPtaornkWerosrbkusrgh,adW.cVoan.taamlilneagteeddicniatyclw.a cSoavteurradgaey'iPalirkkeelyrstboufrogllNoew.ws and Sentinel carried an account ofthe suit and quoted a DuPont statement. More Parkersburg residents file C8 suit against DuPont By JEFFREY SAULTON, Staff Writer iPnAjoRryK,EemRoStiBoUnaRlGdi--strTeshsreaendPaprrkoeprerstbyurdgarmeasgideenitnsalflleegdedsuliytcTonotsadmainyaatgianignhsteDcuiPtoyn'st,waatllregsiunppgltihees.company has caused bod Plaintiffs inthe suit were identifiaesd William R. Rhodes, Russel H. Millerand ValorAa. Mace, all of Parkersburg {Acrcoourgdhinthgionthgestifloinnog vihtehrthesiWgnoiofidcaCntouenxtpoysCuirrecutiotwCatoeurtsculpeprlki,etdhbeythPrarekherasvbeurbge,enUteixtpyosBeodatr0dPfForOAat,faCs8toannde ryealarted me wDautPeornsturpepllbeyatsahtaestPeaemrekndetrstboudrayg,U"sDlutPyonBotarrde.greWtsetwhilaltadcelfaesnsdaocutirosnilvaswsfuoirtcehfausllbyeangafilnesd hoinsblawesuiohtf, arwehsilicdhefnitssbwthhofcco: and legally without meri icCab &.53 075.0144-0011918 5.33 aDPuaPrfkoaenrrtbs'ebsulrrogewpacliyntyysawteaestste,arba"liAlschecevoderlrdseiagnbugloatvtooetrhyeg0ul.0ia5wdpyaaenrrcste"pcfeoorrmdpbrililalniiknoint,n,gwtwihateihtrealrtaaJwnesadusithtaoivnseebnareossetudblteoaensnhrseihcgeohnwtastetsotp0ro.e0ss57ueplatasrhtedseaptleetcrhtbirinilglki.PoInFn.OfTaAhceti,sn thereareno humanhealth effectsknown 10becaused byCB. "We believe, therefore, that Parkersburg city water is safe for human consumption." FAalctilhiotuiegsh, iPnFclOuAdiinsgnWoatsahirneggtuloanteWdorckhse.mical, the company said, DuPont has dramatically reduced emissionsofPFOA from d"eWveelaolpreedadtyechhanvoelorgeideuscwehdiecmhiswislilonsusb9st5anpteiraclelnyt rferdoumceouPrFUO.SA, cmoannteunftacitnuirtisnpgrofdauccitlsiasnsdienmceis2s0i0o0n.s Ifnroamddiittsiomna,nuDfuaPctounrtinhge.s facilities by 2007," the company said ATcocvoertdhiencgotmoptahneysusict, itnheac1o9m9p1acnoymhmandidtetyecetxepdosCu8roefglueisdseltihnaenfoorneC8paritn ppueblbiiclldiroinnkininpgubwlaitcewrastueprplsieusp.plis as early as 198 `1antdhweasnutitonthceonpldauicntt,ifpfsriavcactuesneuiDsuaPnocen,topafstneagnldigceonncteiniunionpgertaretsipnagsst,hepaWsatshainndgctoonntiWnourinkgsbpaltatnetr,y,graonsdsrneeqguleisgtesncmee,dirceackllemsosn,i+ ind".Tihasebnusarumisteomeuennndttstswoaibtnehddaaettrteeoqrrunmeeisyntse'dfoeraeastijfauoldr,gtcmhoeemnaptcetanigosanai;tnsoptrreyD-aujnPuoddnpgtum,neinmttaiakvnieddnagpmotashteg-ecjsouidmgpnmaaennnytamilinoatubelrneetstfto;ormbaeepdpidrceoatplerrimmaoitnneietmdoerdaiinctgarrileallmiocenfoi1st0tosraaibnnagct c`oormppreenvseanttorreyl,eaesqeuoiftaPblFeOoAr,inojruCnc8t;ivperorevliidefi.nPglaailntteimfaftsidveemdarnidnkeidngawtartiaelrbaynjdurfyo.r all other further general relief, whether Contact Jeffrey Saulton at saulton@nevisandsentingl.com. 075:0144-0011919 . ) _ p.337 fo E&3H doi Ss || = of pe Cale fies ETE Ee Ee Sy oi Toray - a Gi Bese PARES ro | (cle | gio IT) | ----! . --~ . 55 E :4 El Hl 2 k:7 EB = 0::: i oO 3Ho 20 ESE E=] Ll 2 Qo E:E oo Ei S & Hi 0 6= o > s =< o 2= 9S 25 Ss 5d 5 8= E3 LSoe5 3 3& 55802 =% S eCcog TT 0 a3oSco& o&@ - p.338 -- 1 || | | | ii | | | {L | L 1 I | | "| ! wosorsioorsz 1| - _ i: ; o 4:: E NN; i 3i 33E i 4]2 :) .EI3 wOWnwo E3Pgg 5. g . >nh g pa= L"w s2 OcoEss 5826 > = c & g0 =00Cc co R`ioDc C > 29 Sg--_ Oo SiC = 5O 0 56 2 BX6 X 32 0 3 w. ae =S koe] 3 <o@ @ g<Qo 2 c o 35 QoLo0 3 8232 Z.2z2 EZ 5& > t ooc 56 = 83 => 0.8 5=k 9 ==09 E32 09>85 o oc> L2Sg5g r. o p.330 I| | | | | | | Co |i || |Ii || i ovoratoooss | . - 340 i| he 3G2 80 5Qacs 52 <2 ||| ca o T c=on0 os2 *o | o's 0288 . 59 - | 29 QJw28T%o v3 2 2 Se5 9oR8E6R5223 So% 23 5 sS 8 cDL50a5d E.o0 S8w9 i 2o3s Eo28go33483x9g6 2EC2 x @ 2a g @ Eo || d o f0 gxX2o0gT_F 588 S oon | Sc $e50=3. gE iF Eog5 2CpEg@?EaS goeog3F LEe e3 a | Sgo=sBsT2E 2B? i oof 35588 Sc 2x5 | | E 20o8 2c2c2883229 5 88 oF2 Ec e:4 5 252 =895 s E6 g2 2T5 2TC R 22 8383555 E 8358=] | i 2o825 = 308 2388 0253888 EE2E 5 || Gbet cCO Es EE5o ES2f ,E 0co.8 U5E S3S G5? Y% 2I23T3E83 53852 058 v E ODF5 O 85 1| | {3S FO EGR Sok o5au28n%8c=e% f0og8 SLEEE | i{a D5i2Ep05=s2 "2Sg8>3ooe88x%22Q wS8 2925552838 E g9Q3w8a 3R5 O Pxo Soo 35559 omgol@ d 88o8o2w.05 55=] | mm o==s 283388 25 aK i|| oonsroooorss | --- _ p31 ;-2] eSE5 o x-= 3 " S65 i = =i Oh H4 <S< iPwn feEb 0c~~ FoC p F&E@ Si .=.SE Er ON fg D 2 F 0o=Oo .Ss 3 3 . <{ SXeE w= gg fe bo <3 - soS&gJ se5 se ES Fiske S 5Lo 8i = S2e2 s25>9SF9 TS5 aF ee5<83 g~ S6 32E2 PoST =Stn95E&T5E%TS e5:22% sEgcs:gf3fiEELBEEcSS S85 228%55% S52 och o FoF g & arNSEeEoZ | | | . | 1I || |{ || | | || | r || i | | 003-0131-0000755 | ~ _ p32 3 =: i: !4B8 gl o Yq co:) on y E = 5 E:lI E Ee = 2i &: = 5 OQQ S82s w ze ~ 288 EH2 2? >> 5 2 <S 235z2 wu> 2 2 as Oo gn > 3 v25 2S2 x 8g 83 2 2 8 8 EE $28 98R EN a on Hsieiszs: 213 ZSiEZSETZ3EESE-E%S EAE EE o8EE E 2 2x 222S 2a3f5E -8282E 8bS Es@Escgis E25 22358588 SEcSE8 =SEuw8sFse 55 gSe35gSd58gL5ss88s385e [8488A 9856= 382T] | t | wows | || eee e ~ ed_beeep3n 3 E E bi .O || 8dsl 183 {| BH YSl:.s | FO iEOOC Ew ErCe) LD 3gL s: t EE 2 = LB =8 EO ==] L : = zi FL EO 2 229 ES o<e8 & : S|ii [S|3es3l a 8 2Fl|ifef SwIlRlE e 2 g SEE 8 sl [Slas| 25 SIH 8 g : fo S o] 3 S 2 3s 5 SI, .| gli2gs l 3 S|:l = F oo |N EE| ERR Ell: oldc| E crss3gs8ge- 8 3 suoy 3 manner | ! -- 7) _-- \ |\ 11@ yg i GiB : fe N 3 | x7 e C= mons \ - - p.345 | . | iT vi % a: PEEL 2 : :2 29. Ej: cSgEgt : 28% 3: 53E: : i ER2 =a 5g29 IEEI aa: dd& e 2533532 3 588 r8i3: a 3 PE 8& E 3 dd 253 s3i:t = E: | 5|| 7) lL 2 .3gd 2 3LS 1S Le,Bz fFise: s52B8EF% O 5 2a Iii F3455i23g G8 = = Zh 9 Eb 8 ailg:tgy g(8SS3sE%fZs @igi3g o 8. s; 3d fg2fcdid3 sii 3S83:ia gs55z28 || | | Co asoiooorss ||| a --_-- _ ~ p36 i 2 1 3 | | : | fSoeoe... 8B EI E- EeI: CEQO . $ =ES 8 fr sg %& T =fe 35 2 3. 8 srrr EEHo -- 35 FF S8S i = Sg fg5: 2 23%: gE | = 0 < 253% Eg Of SIs: FP e3E 8 EEE Ei OOOZ5 SSS8sS88322E8f Ef2F Boft8pE2fe3gg9i DsER33 323@ | |i<O :3 i 3 i 2 |I | . . . 1 | owsorsioone0 | _ | ES p.347 | | | E! +5 tl = J E 2 Tr 53 2BE 5 g8 o ilES S8 yn Eb l c 83 e Hd 8 + Eown 2gE2 FE -- 3:3 = go FlLO<< 338 5 =s 25 eh 2I 23 8 32 32 $= 38 gid2 2a x 8x = u&w 3g @ 3i = | | | I | | woman | | _ -_ . p.348 El | 8 =Ge 0 BExw 3EEL Q2 3a 8g 8= g ga 3k 2B 2 : ISe 3g iE Lo = Ol I! EZ 4 y-i =x : = 3"=m i 2 2 2= 2| | f 5 2 gof 2g = fy 3 Bi a3 a a I E | | oo0s0rst00072 | i p34 | o2] || :3 Ee g i z s Ec]l on 82& 0 o g | 9< | 3L5aa | wQ=o lsgL 5i E 32 Ls 3=s : D Fy EE ] @ aS 3 g3E EE 8 a2 3 FI 73 I28se% | EF & > 5s | & 38 cg I Tae = TE 5g g 38 EF 8s d 3| oof5 3 = fF 3 ei By5g& 88gg,gd S53s EHEF OSasd =EO 0 BsF 2S558.8225558 =9aB | E -o2f s5z 2 883 58 2 387 weSze5xSg55d8pz3e,%s 3=S8 Ey > Ulg 2 g wo 4 TgEEpZzaagsys 3 8 ki! Ssvg 293 940853 5Bm B5 EEL=SE2zT7Te7TgLeC5 I / Mo ag & | | wees | | i p.350 | <3885 3 || I Lio: 2: || IER | 3: ; | E: 3E30Ha: s i || o 28 i} 3R 2 esE 3i8st2 i sEg o:g sEo: H i iE | i |< ss z 2 |ET Sc3S38883%33 <f : Ei! ijii | b|e=Ep E18i 583259s% 5$f:i oZSt E f eigsi:etf: gH 1 HLi3i5 2i 8% | 3 32S 8 f= gzg Hi | 32 Sis 2 j E,E5H % ss1eeFk: f gE2aioH g0:h s32 | f st icc | F|0 Soineytd3e HI : 1 SEiIIZELEG Engel i ~= sHsHid gLS SUB ; a 883 2 EEs5=3 $ i3 3oo O d 838 BE = S iijsi:gs i5i2l d2a8i ied 2EzsE2 | 4 5 ~. a BS S00gfrE aEkiSH e2rrEfi 2 :15 S2o | | || I| . | 13-01rooorss |||| 4 om. | "mE| | 3, E[i8f BEaelpeyy 2B1EE oii Ef|Eg pu) El oie Oo --= ER = | e oERm | 05| mm--- : i 6:88 BE FFs Fr | momen | ~ p32 | = 3 3 i| : | c 8 = 88 || 0S$ 55 33 e | 3 <2 EI 3 sg 82 | | 3 z5 5 | BEE ds :| 3 E5Sis :5 s8 gs=f:83s S12 |||| E% 23 2 EIH R | 1 Ss E55 I: 3Eos= SPE5S38:2:i ||| O 3os p= aZ 3: i2Ss 5Egf23Se5iEs%sTt |||I| 2S 22 3: goons | | SsEe= E *Sfofnz |f|| | | | worrovors || ~ 5.353 [ : 5--~ || : | 2c z2 || : 3 2g:s 2 | 8 EEE: gt | E:p << t2iEs g 1 | ; 5e 3 HH | . : 3 ETf es S5 iB2 = ET Bz:3 75 ,55: | |HSsRp3s iis cigs || , O 2 Es 2iEpeies | oo 3Lis gis2 || : > >< < SHEE 5833288558 | tcSs 8O Sg8o5Sg:uEo6lEi8s3s8 SE LEH | 3f 2Q g2R8=8822s2 || =] "ee |i oa ' i 003-0131-0000767 _ 4 i H 3 x Cw EEEDoQ Ex : =oO a bss | | | | | 1 { . i| { i | | | [ || moons | EXHIBIT b , 0 iD7b7e75)3| | | | ante. MacholMcCabe [ros------ wTofSL eusremn Mrei StamebebctkeorAuEe yDUuePOmlRQlOeUPt | a Foes foAnEee Rte cr A . || | Semi et C1o-m-muAnsisteimebsleseuxrriosutnidninggdaMtasshoinabgtaocnkgSrooruten;dPbF)OASithnetrhceowmamitaeirtaiets U8)hortehe Er | SpaetmroSstasres SSpartsSSotuat., BThoe9mvps |ii EE EC megee+ is d tai | To tt von at on S a a omes awe,e | H Sri Ene 022-0046-0001349 |i . . . 7- _ -L p.355 : ! EXHIBIT | n2(80be775b DuPont'sJuly2006 Proposatlo EPA | lBJoad0ocsnh0oeiol8dco0manybtblht1i5eob0scoe50cck5oEa,nPsaAiadpnTenerkcacxtbuopiacnoocnnssagsuue,esrDn-uxtbPhpwaoiesnoot5sdpp0ruoo7opor0vo0ersoevdop0oi1.rtn5sJiuocsltspvyoooanfcdr2aa00p6rro1gi0nlwsoaewpteerarpt.rnheDeshucsopreeoerning `1A5lt0hpooughh,scarsowaneindgemaownls,tr[atAeRbeElWowE,dOriKnkWinHgwHaTteHruTse)rswDeubreealrheaasdyporsotteyctebdoantthe. Osctleopbsotor i5mGpalelmeonrtdtheslouwnnearceoxspeoasruyreas-bwaoskedosscsroenninogle,velof0.5ppb.Thus,the I PFOAClearlyDossNot ose an "imminentandSubstantial BEinodanngteor1m5e0nPtatrosHPuemraBniHoenaltnh"eart iLenvgelsWaFtroormS0.o5pPaprt:s Per Foe: TphoesOecdtboybePrFO5AdruasfitnogrtdhereccounrtraeinntsstcrweoefniinndgilnegvseblyoEfP1A50rpepgbar.dTihnogsalelefigneddihnegsaaltrhoraissk.s o5Cn4on.tnhtieBasnmaaimsonpealdn8itno0gnrerteShssooUulnsStsaAliRysrteIodSukitnhsPaairtoaGogdreairpnhP21Pa8rA,oYhgEaSrProaAfphhsCan2Ss,dO2atWt3wo,rem2i4rn,e2sd5atyhnadtrt2ha6oranids `aus35up.mpameaBrrnaiszielesoddOpoirrnnPodatv,rhnaeitgiphrnfalcoporhrmsnao2troi2onotngxhardvodaauinlggafhob2lm7eata1nob5tE0oP,v5sAe9saofinnddrciesn.Atphrie1ildi2os0c0ub2mhi,eewnnvhtwiscythohiastofrvci faaclty,eespeciallythose thatarehighlyexposedorthalmaybe particularly .. | b`oTlhleesveeftihnadtinPgsFaOrAeiwnidtrhionuktitnegcwhanticearlosurplpeigoalsspurpepsoerntt,sbaechaauzsaerdttheorheiusmnanohreeaalstohnafio Suggest 0 exitonco of such lovelsbotwoon 0.5ppband150ppb.Onthecontrary,the,scientific erature does not a Azica EFAe Su sapereoie `confirmthat nosuchhazardexists.Moreover,themostrecentepidemiological = omonstates `evidence ~basedonlong-termstudiesofDuPontemployeesatthe WashingtonWorks hth chess skhfoc 1anictod tor cormison `watersupplies containing PFOA,even atmuchhigherlevels. |i ozz.000.0001275 | |i i . - p.357 i| | tTahosebsyoodcgioianlnoowdlciwohinhchlaeundyset,uaodcirveeesrvcseoenhdsoubaglylghEePesfA,fetdchtoastnitonhthaeursmteaansbsiu.sshT,ahroereyoFvIaennnsvsiuorgeegabellshto,r1hshauptmePacFniO.eaAsn,d | dNhooamrohdniogshiehrreacoacpuaicpdaaautmsioaonllaoclgoeynxnspetocutsdiiueorsnepsb.aevroofnorbPFymOSeAMde,xpthoesuU.rSe,amndahrumdanadcisotefausPer,FoOrv,en a DtuorcoPhfonoirncotanlchoca.os*mpArmesevwnitoosuss1l0ygruaarvciimonwgemPdFthOhaooAssairtcnueadtnihiiouncmzaaensertahyteeadualrrteh,aTwnhodiacpthew,rehioonPcEuovPtrmAoaiwrniathdedhseoertoabdlyd fects aroknownIobocausedby PFOA exposure1% `hPMuoFmrOeaoAnvahetre,eEavPo,lA'Ausspgudloen1s5cfi0rnbdgiondagbssaolnpoadribsntodaeonmtieann,itnapokaviennregtwhoefatssrcieanfuoipuprclveeexsapIorrstncsoo, cnoihnamvzeahrnadteld o thvhoeoansrpiefancuaisrfoocrsupwunordrptoehsoeeoWxfapsohostieondng1n0lionn1iW5n0goprpakbssaoffacPivFleO,lAcioonrnctPkhFaedOieAdiiInnknhisen2giw0na0kt2iernfegfowlrairteoeprorsreetnrhvtiarnreg Hotimes, "no riskof deleterious efcsis orpecied." Tho2001ConsentOrderwithWest Virginia 2DBi0vy0i1wsvaooynlouoffnbtAaaicrdkygcGruoaonlustnoydro,tftoitrhsdopeaWrbonosettlwVwoiaorsngciDonunaPvDoeennpte,adrhotmoneDNnvotivoelfmoEbnnevorif1oWn5am,ol2rt0t0aR1lesPporuourtecrcetssiounnfaodnthte fao(nruPnuWvbolgiuVciaHiaoeanDdldlchhtECahoWmWViPoDcsHltH?hVRil-rgG)DiPunPLaoYDn.teTdehpteeac2tr0e0td1ocimfnoHveneasarnolyntitthnogacrnodneHcou1nmtoraanctRoonosscgituhrnfaceteciAsa,lzPoBnFsusrseaau awArasolsouornsdssumtphoponlWtiaoessf.hTiAonccgiottrodniTWneogar,mktsh(feIpeocair"tyCt,AiTnfcTluotdahine)gc,ornicsovneasnlitstcoirrnndgedronfagsgwreopaoedrsiewneosiltaasbialvinecdohsfpuCbl5ic | WVDEP, WVDHHR-BPH. EPA Hoaduarars, EPA'sOfics ofFess ang . | elouemnCeosirgoouncstimhoounGekesaermyonokdfenyoisnsor mfhaearryko.erSsuenunsugnofoanoesac.s,mo-o"TrDpoielsscecyo6oPf oosFoerngnoossraSyanaelSeiaidoa.oieatsrons daTouhclroogmyaoifPnunacetr,uasdonse3hr4eCrooalalliorRaehaviiyefwonsPiFcOTAovsaeolroiogny$c,61 K5e0s1eoyrao)rose 50Lo8tofo.mD.0obe,nW. ck 1DrSubakShale, EPA, ansriting t 2D0u05P)o.nEsGommanis on PFOA isk Assesamant 1 EPA'sSansAdvisoryBonn lars, iota. Jd. EPA's own publ salemans aor isyearaothsame afc, Seapag1e1 || 022.0046.0001276 | . -- p.358 Dovlopma, EPARogohonNalta,l tufoCs hi Sci (NGS0, || : i i Tc`oAErgtReaRnicn)wyf,ooarrTCooixnnichciuSnmuaabtsnttbtaaonsxcieecdoslnoaognnypdrtDooiftsiheteaTcsorexgiaRecrgoiilzsoatgtryyo,EndxaecndadilcDeauntPceoedntfo.oprNFoiIesCckSAisnsugsbspcosunebtelranctted ||| andcommunicate ok assossmant valves, "healthbyapplyingtoxicologicaldata to theriskassessmentprocessanddoveloping CAT Toam Report 8setforth intheCAT Toa finalopt(August202) ho GATToa wascharged C`AwiTthTseetalimnug t`iriizsek-dbaasteedahmuomfasnciehnetailftihc perxopteercttsi,vienc`lsucrdeienngitnhgelfevoelllso*fwionrgrAePpFreOse(nCt-a8t).iveTsh:TMe* ea | Samuel R John Cicmanec, D.V.M., M.S., USEPA Office of Research andDevelopment I FalotleornbuPrr,evPehnt.iDo,naUnSdEPTAorPosgon i | Jennifer Seed, Ph.D., USEPA Headquarters, Risk Assessment|Division, Office of | TERA i | `JMAoincadhneaaeDnlolMDlaolhuairrds,eoP,n,0M0PSh,,.0MG.TISC, Jo Dan Biggs, PRO. BAB. `AgencytorToseSubstancesandDisease ogi John Whole, Ph. puro : - GJeorhanlWdhKyesnnnere,dyW.5., PhnD. DABT. (consutant) 3 | RaU-ectlriaoAnitssansostudnapMtpdeaodrrIytnDthsoeofmirnatilrA oenpfoirGtF,kAK,aJoraremGnaJosoBhrnoisotnS,,Jia1nn.e5st.saShnsarkmrse,sGoaromtheConmneor.,Rogrreortll |I ||| o2o0s000t2r7 | | p.359 1| Guests |{ Th GATTubman vin aay2012ad Mey20 aol iw JJiomhnStBeurtrean,hMo.fSf.,,PhO.hDi.,o3EnMvi(rsotnumdeynstcailenPtoislte)ction Agancy (observer) || Mthaeyto6xiacnodl7og,yd2a0t0a2.T10hdeovsecileonpt,iastmsoonngtohtehCaArTthTinegas:m(m1)aatnfoorralppprorvoixsiimoaneallryef18ehroeunrcse on ``addovsears(`epeRfIfDeYc)t,;wahnidch(2)stah"secdraeielnyidnogsloaovfolacwhhoimcihciasl tGehfaritosdnaosttehxopecovtoe!dattowchaiucshe any `oelxoptoosruiroouissoefqeucatslIosof@xlpooscsitohda"nftohxeppoRsIurDo,laansdtsthaeraeftomro,.thelve alwhich noriskof a asp mistmod pry opr 0 is. on | `oTmhpelGoAyeTdTbeyaUmSc.alEcPuAla,taesdstehtefPoFrtOhiAns"cRriesekniAnsgsleesvsemleusnitnGgutkhdeasntcaonfdoarrSdumpeetrhfoudnodl"oagnyd I`aXWs,hoftruhetehGtehAreeTrxepTwleaaasinraefndoybllycooEwnePfdiAtchtReboRegteiwgooinosonnIltlIhaX enggduuiiXddaarnincsceke-obbfeafsceearduecsdoebncyteRnsetgmriaotorineonciloqnausniednaaRniecigovi.eo,n 16. moro hoalthprotective." ooscrfraothaePnAiI1n0Dgslc0io.ev0ne0t4isomtryswCXe8cr(yoPapFyrO,eAws)heinintcdwhrhitenhkeniCntgAhTewpaaTtnoee,aluvtsohitanengdRuUenaganlnsoiimnloIouXsdsl0yi1st5oa0asocscooospstsamoshnhto || `equations. Dr.Soed ofEPAwasnotprosontduringthatpartofthomosfing. "pTphbuso,fhPeFCOAATindTreianmkciongnwcaltuedre,dtiheytwsoiunladlreexpporetctthnaotwriitshoafHdeetlilmoeroiofuesxefpfoescutrso.1"0150 || The2002ConsentOrder Undorthe SOWA I 2"0Th0i2sc,ohncolsuosiEoPnAwraosgsiuobnsaelqofufeinctelsyenctoonrfoidniendobaycEonPsAoRrotgoirodnasrwlilahnDduVP.onOtnuMndaerr c7h, : Section 1431ofthe Salo DrinkingWaterAct(SOWA. + "S`tTuahntadetesr2g0tr0hoa2utcnDodusnPosouenrntc,teotorhdfeeWdrrniDontkEiens;gtwhaaaltnodCr-Wu8Ys(Bd"PHFfHoOARs"uh)pahpdlayspLrbueevbeionocudksealtyneedcnLtlieotdrteoIdntHnholceoktihneg.. It | .| tNThooavtaemDmuwbPaeosrndte1av5,onl2do0Ep0iP1ncAgoatnghsroeenmotooornodapoertrcomomatptnonergnaurtsypsccrtrehooeenCniAinngTgllToovvaelm. o(fd1s4cpupsbso,dwahbiovet)h,aaCnAdT Ti HUoonbcldkieigrnattgehdaetr2oo0par0sou2vncilodenossaslettnhotmeoarctdoionvcreaodnprtpiinrakotivinoegndwibanytpteuhrbeltiostcehtdrewiponukribenlggiioWianntatalhfooofxfLccuaosbe,cdDekudoPro1ni4pttwplba.snot | y 10 ` | i 020060001278 | | e=e - ee p.360 A-- | accepted hal 14ppbPFOAincrningwater posednosubstantial isk. Moerweosvcteare,niinntghlaotv2o0l0w2hcaolnosveenltoovroldewra,sEPaAtoRregoitobnystlhiel aCnAdTVaTgoraee.d Ttohacacrepataofsottathhe,o pastfouryears,since August2002whentheCAT Teamsetthescreeninglevelof150 bpeplbo,wEP1A5R0epgpibopnolsiel annodrEsPkAoRheugimoann heal. Vhaveexpresslyacceptedthatconcentrations c"oTnhtursa,dihcetperditohaecsttiaolnosmaenndtsstiattohmeOnctisoobfohresceratfwtooEdPorAtfhaotglieovnellosoffcePsFhOaAvbeafwloyon 0[.5p2pband 150ppbmayposoanimminentandsubsianialendangerment ohuman [EPA'sRecentStatements cMoonrioroavdeirt, tEhPeAfihndaisncgsoInntitnhueeOdcttoombiosrkedtrhaor rpeubrl.icFsaolroemenxts aaboEmuPtApPAFdOmlAitnheaarta,oisro 2`0S0t6ap,hiennvLit.iJngothhnesmon1w0rootie atonDeuwPvoolnutnt(aarndyspervoegrraalmottohetremdauncuefPacFtOurAeormsi)sosniJoansn.uar1yh2a5l, letter,AdministratorJohnson informedDuPont: | "`Aclhtahnoguegthhoaucrurrrieskntapsiscetusrsem,eontdaactteivEitPiAesiasrenontoatwyaertecoofmaplneytsetuadnidens espwecdiafticaamllayy i1 relatingcurrentlevelsof PFOAexposure10human healtheffects." i LotorfromStepL hJohansonn, Administrator, U.S. EPA fo ChareOs. Holiday, Jr. ChairmanandChiefExecutive Officer, DuPont (January25,2006). Similarly, EPAannouncedat apublic mestingon PFOAthissummerthat: Ge p ---------------- | "EPAhasnoinformation liskingcurrenlevelsofPFOAin hebloodofthe ``gneeneedreadltpoubulnidcatrosatnanydatdhvaesrespeehresailsttheenftfcehcetmsiicnapleso.pWleh.iAddiitnifoonramlatsitoundiysibsesitnlg | developed,EPAistakingtheprudentstepofseeking toreducepossiblesources | now,toavoidpotentiallylargerfutureproblems."(Emphasis supplied.) ofafictiosridnerp,otohplt;"thiosiesssaimmpelylenvoetlspmosasiybplerefsoarntEaPnAtoimimnidneanst1andodossubisnttahnotiOacltobar 5. Lti IGn7.of5.onrsmiatiioonnEFAPovAne,,annh,neoNruWno.cneWmueannset5hm,ia2dn0og0a8o0n.thR,eooimth11l55e,aUrSySEePsAsEioantandbNiogr,-E1C2A01PFOA !i| " | zoos || . - p.361 EePnAd'asnogwonmvoenrty:roecheunmtpaunblhiecasttha.tTemheenOtcs.tober craft order cabenrecnoneoledtwih | | TheOctober2006Phase il Dataon Washington Works: | F`ienmaplilryi,caelveevniidfenEcPeA,hcoandsinsottasnptwoiktehnt1h0etehxeisItsisnugebsoodyroecfepntulbyl,iwsheendsocwiehnatvifeicfuerrtahteurre, that PFOAIsnotassociated withhuman healtheffects,evenat exposurelevels `Sccoensairdienrgalbleyvehilgohretrhtehlaonwtohras0.e5tphpabtwscoruoledonicncgulrouvonld.eretherthecurrent 150ppb W`oDrukPson,tWheaeslboVoignitapopesapnoopompciigidealos`tTmuhedyfioisfteopmhpalbsooyooofastahgitstshtiuedWyacswhaiasngatlon `pcortoesnst-isaelcatsisonoaclisautrivoenisblleatnwceeienntoecncduepdattoioenvaalleuaxtpeo,suusriengfsoaemrmuomnPiFuOmApleervfeulsc,roaoncyiancato `andchangesinclinicallaboratory measurements orphysicalexamination endpoints. baWltootrohkdeepsroePlrFyuOmmeA.rAlpersvoldeiulgcshttwipeoornseifftaoiivuientadsytsaooncrdiaasntegireounfmwrcaohsmo5floe1su0tne9dr,bo5le5,t0wpiegpeybno(osr0ei.rd0eu0sm5,1aP0n9Fd.O5AL5DipLnpwmo)rikners T `cholesterol (but not HDLcholesterol). Thosecondphas fs suc, retuspecivecohort morally icy,examina a | | `cegmaepunlseoeryasleopefospd,uealaastthcioocnmo,pmaabnridentodhdoaoptnohpdouclgaaeutnsiooor-nasolpfpooDcpuiuiPlcaomtnoirtotwnaiolrnlktyehrreastUre.esSs.indttihhnegeWWInoassWiheisVntirgVgilirongniiWanoaraknsd seven neighstabtesoinrhoirongiogn. The fasulisofthesocond phasebecame | avaoniOcl loba er1b 7, 2l006e." increasinAodneetamloeddaalnaalloysniostfoimoIsinctheermviacl(h1o0a-rytodairsleaga)s.emHortoaiwyshtehoiws ovidnceraseaisrgehwt,as i| nnoott iobsnercverdiwonittahhiostsshteaurdmdyo.deTlhsi,soanndetohbesoevrevreadlilnmcorrotaalsietycroautlesdbfeorahreaarntddoimsoeeacsuerwTeornece -- ChalHast epor.2008.Amm1onStiautmsPRelaated tuo aSrorucmBGirootmsasrSkaeercoonfnExpSoosaurbteaannd:of | op oe th Sts Bolted to. Sonim Bomadar ofSomean rn MortatHaysAknaellylsReepsRoretl.at2e0d061. aASmemrounmiBulmoPmarokarroffExupoosurIonPhoaPsoecllyltmoRrealPrrnoosdpouocctiaiiovntoPCaoemho.:rt mmm | r rs=elgginoinfaclaAwnsottrantkciersretsipcsoaopliulnnactoiinobsnoitgreniosfmimchaoenrtsiaanmcyrewocoeorsmoopnoauKnnyod.oTayhocoassnsceoahrsemssoorica,llloWynhsaondncdeoamnspttaaartpiespdtoataltrlthysebo Tolatod 10PFOA exposurs,bu herower oo few asaIomak defnivconcludons, |i | . 2 i| | 0220046000280 | i -_-- p.362 | or couldmoan asmallincreasein thoseworkers mostheavily exposed. | `Iconsvuimn,caingaccoennntocitni-odnepbtehtswteuednyoefxphoigshuyretxopoPsFeOdAwoarnkdearsdvfearlsedehteoaldtohmofnfsoicrtasl.oaInntyhe || fo`asnccryoeboefneitrnhgeilsgeeavvreidldeIedsnnaceseca,retbsihstearkraeryyya1f0nipndrdocijanepgcrstiicnhiuotmuhsae.OncShtoeoeab,letr0h5.--9d,hraaWfvLtReo.nroGdefrraacc--totuah&laCbtaoas.i0vs..5aUpnnpldtbcedan StalesEPA,251 F.3d330, 342(3d.Cv.2001)(vacalingEPAordorissuedundorSalo. `aDtribnikairnlgWaanledrcaApcritciou1s4l3y1s)e(tTtWeJdeohnatvheen1o.c2hmoioclesbtuatnd1arcdofnlcolruadmemthoantitahe).EPA n DUsueProsnBtaasesdAolnretahdeyLOofwfeerreSdcArleteenrinnatgeLWeavteelorSfu0p.5plPiaersttsoPeArllBKinloiownn. `PPairFnakOgiArnhagapwshab3too9rootnfodtuehsteeaOrccsttoaodnbaPetur0b5.l5dipcrpaWbatotorordrheSirygdshioirroe.cmBtssuaDtnuDdPpornitu valtohepaP wrsoaavlliodroreesaayldsln yteoefmmfasottrweoshdoeurreceof `o'rPnEQaAtaebowavtee0r 5suppopbli,eTshi0esvcreirtykaklnionwfonmuastoirown hsonsoierxeilsetcitnogdwianttorhsoyOsctleombcoorntdairnast o1r0dheurm.baunthteartehd.uces oven futheranypotentialconor thatEPAmighthaveaboutrisks `PublicWaterSystems PBrWaiasvseahtdienuWgplaootnneWeroxStroekunsrs,cievhseee,rknevnaiorrweonnttmwoeocnPotunabtllmaioincniWPtaoFtroOirnAgSadylasttoraaambosro,tvahened0ca.o5mpmpuibnti.etdTinheusemstbuwroorrPoouufbnldiicng `HWoactkeirnSgyWsiaomrsAarsostohecLiubaeitcnkOihPoiuobn.llcSorviceDistrict in WatVirginiaandtheLite | | a `D8puaoPcrohaotniftohtnhaaesnsddeewsmaitgenaerddiissttraintcet-saot.fgL-rutoehbeoo-mcanerktn,tGatrwhairntonhuulDgahucrPAtoscnotBtiov.aartTedhd,eChaaWsrebasoptnVpirsroygvsientieamfDososrppmeascoritffmiaocnnttoof + HbC eoaglitnho coannsdim Hnuugcrmtaani otnnsoRafetscs hooerutrtifrcs ceeaasttehmoei afnstcafopano pcviretonyvaieen sdnscLoeu.obencaks'stpheorWmoitsmtoVdiirfgiicniaatiPounb.lDiucPSoantnweil r= wtEoralelrafLtlmioetlnedtaHfonecdcklliatnyngtd.hiDas utlmPouocnsatttedbdeeosnliioicgranlteyewdniootnhtionantnlhdyopafulGroAocdhGpatlsaeeiadntbomfyetDnhutPesoOynshtti,eoma,vbLoiurtt.laepDHueoPwocnwktai.tnegrs _____ | -. `hArasaepsssppolocrniiodsaceptadoolnntofdooanagsdrepvteeoeraarmdtaifltporemsooneuddcinikidnctsgahoctefiorocmenomq.muoCimnoreinonssdtfptserrrufomcrmilotoOmmnhLooiidtfoittfElhiePecHaAnotcoeikonwinLnwfgairlboloemfrHOoofrrceiektaoihtnEemgPo'WAnsat,ptofeanDcrduiPnognw.til beginonceOhio EPAissues thepermitmodi1f3ication. 022.0046-0001261 . = --_-- - p.363 i PAutbtlhiiscpWoainlta,rDSuyPsotnomtsh,astnhoatsanlsloyotfakeernoadaftroemaastoinvabolwoastteropssuwpipthiionsitso tcohnetrtowloa1ofmfeackioed `GAC treatmentoperational. Private Water Systems "`Tehnevsiirtounamteinotnailssmiomniiltaorriwnigthorretghaerdcotompmruinviattowsasurrrsoyusntdeinmgs.WaBsahsiondgiuopnoWnoarxkiso,nstihveree a0r.e5 appppbr.oxDiumPatoenltyhaislayl(r5e0a)dpyiovfaelroweadtaetrosmyasttoowmaslkonroswupnpltoiceso1ntatihnePuFseOrAsaotoaflal bofotvheose | systems. "orth ssoyusrtcoemosa.fpTpdhrrooixnskiiemnasgtywasalttyeetrmh,siarDtruy(oP3oo0pn)ethrhaoatmsieaolsnrawelhaaednyrdIanrtshtoeapalrflofevediscdtiiasntdogd-soryfis-ntIkneiomn-gsapwrratoGfvoAirCdet0tathaheotssmooel.ent udserrs. Tiwhaetonetrhkeorthhioomseenussaergres.connociodtoPublic WalorSystoms,whichprovide say | sIynssutemm,sDcuPoontnbegPtaFnOtawAoaiybeoavnres0a.eg5optpdobp.rToovdidaeya,tltheamtawloerwkahtaesrlsaugpoplliyebso1o0nusers whose `accomplished,and iwilbocompletedoncoth stateagancios givethe oquirod |1i ``aopdporrovaallstfhios fithmeruenmdaeirnsiencgtwioonrk14o3p1roofctoheodS.aTlhoerDroiinskinnogbWaasliosrfAorctEPhAo[n0iistsauolayanllof tshepuotepntoifpaldlryilanfkfiiencgwteaedtuessre.rsMorethoovrehra,vtoh,ooOrcwiiolbohrav5dorian hoorvdeorrywnialanroftuatcucro,laolrlaotntahitse | apmorngoriecsniadeneynstwsaosyf.tBhuotsictcoomulmdiwotlls.olaytheprocossbyralsing undueconcem || F`aonrd t"hCeornecalussoinosnsseotffLoatwhaibnotvhee,dDruaPoondterersaprecotnfoutlsluypspuobmrittesdtbhyattthhees"cFlionndiifnicgesvoifdFeanccto loorvotlhsefofaPFocOfAretacboorsvde. F0.u5npdaarmtespnotrabli,lltohneIrneisinnokisncgiwoanttiecrbsuapspilsifeosrmEaPAy'psofsinedainngsthat err... imFmociOnNeGnltodawnidtshutbhsetapneteira-lroevinewded,apunblgisoheehduerrprimadneehmeiaonlltothg.y.ThNoosrecfainndtihnogysbcoasnqnuolabreod WlievlehlEsPoAf'PSGFrOiAni7n6t5h3ebiPoUoDdofSthIegGenesralpuatb"iEcPtAohanaysaidovienrfsoerhmeatailotnhiefnfkeicntsgciun nt ----------. ----.- OpcPetFooOpblAeoe"rxapn5oddsrtuahfrateot1r0"dEehPruAtimhsaanlniohstewaralwotanhrgse.foffoactn.y"sBtoutdhieosfsptehcoisfeicsaltlaylraemleanttisnagrcourcroerrnetlcetv;eRlissotfhe r|i Maolrreeoadvyert,atkehnetOocmtionbiemriz5ecorar fairmdionractoom6pxlpeotsouroftalolsdr1i0nrkeinfglcwtatlhoerssutpopplsitehsaftoDuunPdotnot has |i 14 | | ozomso0 | | 1 . ~ ST - p.364 | acwolanetteaadisynubpPopFelOinAeseo.fveeWrnheadatlstltheaemnladolswoienrwsahtceerrewesanuyipnpogfllseelv,iemalinnoafdt0min.ag5nphypebaf.rooAmlaalkntaiofnfagedcyktrneodocuwashenironsgxhaplaolvsoeumralaet || whialtlootwbloeovxelpsodtiheednboyadthoedafpspsruoavnacloooffhaon sEaPAtaarrodgouriloryagoncis.Thoseapprovals || Forallofthosaroasons, f EPAwor tissueanodorfoDuPontalong heinosoftho October 5 draftorder,weareconfidentthat areviewingcourtwouldfindittobearbitrary andcapricious.See,e.g., W.R. Grace &Co.v.UnitedStatesEPA,261F.3d330,342 (3d.Cir. 2001)(vacating EPAorderissuedunderSafe Drinking Water Act 1431) ('WJe havenochoicebut 1o concludethattheEPAarbitrarilyandcapriciouslysettled onthe 1.2mg!standard [forammonia).). | " || ssn || ii .--_-- - - FTroom: <"AiDnakvednwWyBoMootoell"eedn?adckompeiorrcctcoaisahme,a@iuaosoauyspoe@nKiastmsoidnopWorekront a"Dnovi:d WEooth" ac a minmoch tr@eaaa a rppiapnnoknrotosoo.o r ;nT:aoSohati)Ws i LsRaDaroo:sci"tat rosso ptcom: RSeinc:h: STCohenecesasna.1Nsaa5nveRseeorr05a. 3008 505diponcons Sitfect: CatoConca DovePlfeindaatts ache ed. (So tachedfle:Concerns11:2.06.750) Thiscommunication s fr us b he intended recpictand conan informationthatmaybePrivileged,confidentialorcopyrighted under `applicablelaw. Ifyouare nottheintendedrecipicat,youarehereby formallynotifiedthatanyuse,copying ordistributionof thise-mail, in wholeorinpart,isstrictlyprohibited.Pleasenotifythe senderby `rnetducronens-pmiaciuloaunsdldyedleestiegtnhaitseda-msai*lEf-rCoonmiyroauctrIsnytsetnedme.d"U,ntlheisssee-xmpaliilcditolcys. `notconstitute acontractoffer, acontractamendment,oran acceptance: Frr ancaiasoDfedn sanhtltt hairndps aErspiasnolPotgues JapaneseChineseKorean o`ufseaocfosnetnrdaecrt'osfcfeorn.tTahcitsinef-omramialtdiooenfsonrodticrocnosttmiaturtkeetaicnognspeunrtptosoteshoerfor p.365 | . | i NEXeHIBIT&9 040 i/o | || 12/3/2007 i p.366 -_ eT i | g2 of3 8| gd: || Eg 5g2, 2 5 32 3 2 Pr =Fg 23 3i= %3 8gE 53 gfe, 1 2 fol SE5E 3 23232 8 3 38% EfHas E85 Sg a 8 2 g$edi 83 gid E238 fois [iidif 2d 5 45 Rs ffE5ey3Eegs5 I&2 4 S Egea Etg zfa 8zE 5sg cd cEEfEs aE82Ei2d8s S5TEw 3 8 = 858 HeEBf ES: 93 g >3 OEOCFgESEE83fczn8EsssaEdtcyideye3$FFsd3i.o0g283g530yE82F g$43 SEE || EEiggizggi Eepdiiiiiil pIERIIIGEES BHEEsEeEssienifaisgi s53HiEfE8Fi8Ti8i9Ez8R5iI4iS5i8Es5S osig ghz] g9nBggeait JoFicesiiit SE ain ! ipiodgns p2E8E2Os ERE = BEE2EER88% cate 2828232 EGi gBir REEEdStIaEiIsESY Hig d | 8 } | 2 } 8 25 I Z 2 S& ~oz nA ~~ 2g0E oie | Hannan | Fu EY oln | =<IEi SL 4to zS a oo | - - ~ p.368 I summon To pomakQt epomsetoor | S"silmecokedohEtIsDWoPmO ce CO f Sh-oMamrtehBr rLRLoasc/oOUne ADbEIuOa=oK DusPoe nsai@tIeDKuaPsaonn.st.lKnds | BCOTu OTUuIABAGtaaokOiamueaPnmeo. nb.ponCilchokemw, feos sions [rup-- PMeaOproA.chotdveoorwnnhe1ad5osknouffspowhmotosrcioninc,ceyyoouhautdnoynokukrpT0eacom orhoecveehwlfeyBvorloynfcTokekhoomonawc"adbwoiuht o i2 ySout swOoocrswnh t wodeuclidoeo.nntTcw.haerEP0AphuoesCSoncveoySkpouot kg3sab1s0kCPESODAthot om See youtamotr10o3w0. ST--amnFkosrwardpbySnusanM SisineckadAE/DuPonton 110520080429PM.-- EXHIB0IT40) SSs- T TSAn 1topreSS anuSD amceA nemaP @Dwn (pihpabAi] 1g TN svoos suit Hews in `ohSomunemearsnftoh 1nf-eow4s30a0ccoewnsihcamceernmbeb0od2oe)ksd4t7bh5et3lo7cw0o0n1tohro(p3e0s)3cs9o8h6se5l5o.pft.hOeytroiiucnsc.o.dswlm5 y3c0i6s0o0n0ig. | estroge. | om 1P)rHoegardalminesassociated withEPA announcementofthe2010/15PFOAStewardship U3. EPASeoks Exminoion ofTeflonChemica by2015, Bloomberg, 01252006 | E:P.A. Socks 1o PhaseOut o Tax:Chemical, TheNew YorkTimes (NYT), 01/26/2006 MTT SOFTe CTCTIEATS 772 me EPAUrgesTalonChimica Bon:DuPon:AgoestoPhase-OukofWarisomePollanPFOA. Harmiu Teflon Chemical To Be llinsed by 2015,TheWoshiogion Pos, 01252006 2)Hoadines associatedwith ScienceAdvisoryBoard"LikelyCarcinogen | oosorsorsese0 | ~ ee . 2) Headlines associated with Science Advisory Board "Likely Carcinogen" JS ---------- Teton ata contin cack Auton Boden Cop, 1217500 Toon chamois sc poke, ons Oly Sa Kh Rie, 0127700 Heine sociated in TSCA Be) Adis Foo ouPan stesn Toor fo, Tho Sd, 1210205 Hoodooassocilod i PAPHNouta nic PA NesC3 Moy 8 UreFor man,WhoHosorl 0332008 5) HeehadoiiLneos avssoTcuimasteHdawitthol7 igatTioonDoss, Os oles Rehr, S00 Suk Out Corin tr Sgn, Cours 1, 407800 Part Root i GSAgsOui, Psu evs a Sanit 033020 Hino ssocite wih lve of PFOAfoundoneplnshes eetstr, he Ppt Oss, 1500S Glues cl voter it, RihnondTm.Ospc, 7000 5.388 i| ||| as01330r38561 | | ' -- -- p.370 yoF"am Weslaco comihcimccse@esciok SE ssa. -- |!! Seagnt:ls, ay Monday,January08,2007 8.27AM. | | EXHIBIT ade ip gap _I7fily ! OD | f 1| | | |]| 'MCCABE06628 ' : + ------ eee S- T'hNIeDpEuPr'psocsoenosfitdheisrmaetimaosn iitsd0evperloovpisdoainmpaorptanpibra(cokoagdrdaoruenscdsiihnnfgorPmFatOiAondeftoercted Pm`aFeteOmxAotraweinmledllopyurltooivwniedleebvraeolccsekngitrnawocautlniedoronasntbvetathrewciooueurnsrsteinhtteessEtiaPtneANaoefnwdsJcDeeurPnseoiync.tkSnrpoeewgcaliredfdiigncegaoltlnhyi,s. WaresdhuicntigotnoonfWcoomrmkusnsiittyeleoxcpaotseudrneeatorPPaFrkOeArisnbutrhge,aWreesastuViirrogiunnidai.nIgnthNeovDeumPboenrt, DauctPioonnlterveealcohfed5paarvotlsupnetrarbyilalgironewehimleontEwPiAt'hsEoPnAgoLi0nsgalisak parescsaeustsimoennatrypirnotceersisims: beingconducted.Below thatlovel,noactionisdoomednecessary. mi etoosinosomous boost oscio Tlehveels5opptbakleevneolcaocitinocni.deTshwielh5rpepcbenltedveeclisseitobnysbEyPoAtihselroswtaetresh1ansaantyhigher Miensnatsoalbawlbhiyicashnhyhastsealldoo.worTohiissilnevuedlfarsoNmor7tphpCbar(o0li1 npapwbh;iacnh dsCeatlfao2rpmpibawlhoivcehr; dPecridoepdnoots6oi5eaxtupteihdoiortiney.acTthieosnoenacaipoantsifoafne(coteaqnuiacPkFnOoA(wableleidnggutnheadtemEreiPtAnsits: ; innottehenporuogchedsasotafhcaonsdbuecetinnggatahceormepdrteoheesntsaibvleirsehvainsaetdiroinsaklhaaszsaersdslmeevenlt.andthal `aPwFnhOdicpAhe,rhbsauivstetweehxnicacehmoiffnaePidFttoOhAosirionaubhgiuhslmhyaantnhsyeaapnodtvdeenttrhiseaeleefhnfeveaiclottnshemf1ef0nehtcutamsraefnlrseog.mietTxihpmooatpserueresetnoce s`ccioenntciefmisctchoamlmudneisteyr,veastwheealtlte3n5ttihoneomfangoymvearnnumfeancttaugreenrcsitheaslaunsdethPeFlOaArgienr iJnedurssteryioacloannodmcioenss.umNerporodvuctetthhaetramantsyohiehmaplotrehtsatunldti1esetthheanslahtiaovsnoalba,enednNew `EcPonAdausctaepdrtohcuasfutairodnoarnyosittseu-psppeocritficlionvleorilmowleervetlh.anAthses 0d.i5spcupsbsoesdtbaoblloiws,hocdurbryent a`tphbaarcmkagcorkoiunnedtliecsvetlusdioebssoofrtvhodecihneNmoiwcaJlosrsheoywfatnhgatinogvefnofmanxa1c0tio4n1lpopvbe (w77a7s) sial t`hwoauglednnoo ropsouplulianttihoenl.oHweorwienvgeorf,b5a0cakrgoruosuenddbpluobolidcluenvdeullsyofaPmFoOAddbelyected in woxiurledmdalryolpoawsaactrieosunlletvoefltshvisoauctlidohna.ve every expectationtha thirboodlevels A`cnomimmupnoirttieasn.taPseprehcatposfmtohreeltevhealnseatnbyyarEePaAiinstihseicmopuancttyo,ntahfeafercetaesdurrounding P`amrakneufrascbtuurrgi,ngW,ewshteVnitrhgieni.5ahpapsbbaecetinoendluocvaetewdasoatnhnoohuenacletdh,imipdaictnsoftocmausPeFOA p37 T |i 1 | i{ | {| I | |i | MCCABEOSS2 | : _ p.372 mere. der. dees 1 | fd, acloamrmmunoirtireaisseinctohmemaurneiat1y0caodndcreersnsst.DhuePronnetehdasaswnodrckoendcdeiringsenatnldypwriotvhitdheethe | NaetwesJtescriseentyi,fiicwiinlfocramuatsieounnodnuePcFoOncAearnndatmhoenihgeallhtohc.omImf uanlitioelseavwteolieasbeotrvienthal byevgeolivneNremweJno,rrseasyeaanrdchelinssetwihtuetrieo.nsaBndinadounsts tryhesehxeotwenisd nigvneoshciuemntainfihcweaolrtkhdone | effoveecltgsoalunbcahcaklgireonugnedd.levels,DuPontcould nllet ascientificallyunsupported | Backaround Scant RedactonsArey 1 N`eDuwPoJnetrusesye,sbuPtFODAuPionnmtaniufoactituhreisnogloepuesreariioantshaetStlsatCeh.aOmlbheerrsinWdousrtkrisalaucsiietrysin `faoraexm.DuoPoxnthoastaankednPsFigOnAifiiscuanstestdeepxsteonrsievdeulycbeyemiirsasfiigohntseorsfinPFfrOoAfiaglhling m`aCnhuafmabceirusrWionrgokpse(ra9t6i%onrsefdrucotmi2o0no0f0pltoa2n0t06i)r.anD dwaluerdoomP eissnsoio otnmsaonn uffPacFtt OuAref.rom PFOA inNewJersoyalanyofissites 0 "`SPoFurOcAehsaisnbpaeretnsdoefteNcetweJdearsteoyx.tDreetmeelcytlioownlhoavsebseienncoobmsmeurnvietdyicnianrkeiansgwwhaetreerno facies using PFareOlocaA ted. i | EhuPmAainnpeaxrptiocsuulraorthharsotuagkhena vaoglgurnetsasriypvresotgerpasm1anrneoduuncecpeodssaiybelaersaoguor.ceisnof aJnadnutaeelyo2m0e0rm6a,nAudfmaicntisutrreartsorloSpatretpihceinpatJeoihnnsaognlionbvaitlesdtetwhaeredisghhitplpuroorgorpaomloymner pPaFrtOiAciapantde.rTelhaetpedrcohgermaimcarlesq.uBiryesMcaorrcphor,aatleeciogmhmtictommpeanntisesothhaedfaoglroweiendgtogoals: 1 fr(1o)m aTyoeacro2m0m0i0tboasaeclhiineev,ei,nnbooltahtfeartcihlayne2m0i1s0s,ioans95o%raiedeuncvtiiroonn,mmeenataslumroeddia 1`0anPdFpOrAod,uacntdcornltaetnetldhevieglhseorfh:omPoFlOoRg,pureecchuermsiocarclhs;emaincdals thatcanbreakdown ------ .C(h2o)micTaloscothmamlicatntobwroerakkidnogwtnowlaorPdEthQeAa.mainndarteiloanteofhhiPgFohOeAmc,porelcuorsogrue... c2h0e1m5i.calsfromemissionsandproductsby iveyearsthereafler,ornolate than DAusPdoenmtonissterxaceteeddibnyg tthheergeosaulltsssfertobmyreEdPuAc.tionsatour Chambers Worksfacity, i| | i i ~ para O _ } Humanexposureshowsnohealtheffects |i KDhnuuoPwmolanentdeghxaepssousvruorrloeuunfnadoriulnlygswaPonFrkdOeAodhxwaiicslhbooEfePnAPFsaOisnAsc.eem2bA0lc0e3doculnroiinnsvgetsihtaidlgbaoteiedmpyeroo.laeWscnbiiteeanltifeic |!| mCouncihsbhuaisobnsoeinndsesvaerleopaeidbsoyhiandveepbeonednenetxrtaesnseiavrechanndscioimoprnesh,eDnusPivoonacnsdhave || `Cnoviecroendmtoonpiiacsl muocdhealisngloaxiec,oloigoyd.earmyoasdapthoenr,cacnhdrsikstayssaensdsmmeentth.oMdso,re than pa0sptolcorw-yeovuirosw.ndsuc havebeenpublishedbyDuPontscientists vorthe aTnhderpaoteisnctuiraellntloy xanecnolrmeofofuegcstvsioolfcumPaeFoOlfAs.cieMnatinfyiocdtthaeasssteusdssiangrthpeukbnloiwsnheidn pmooar irenviaewbieydstnhceeeUndSt EPjoAu.mTalhseadnadtaarboasaovpariaobsleen1t0y1ihncpxuibelsicfspopmroneidmoaclkoe2ll0sy0 houdmcaolnosgeixcpaosueedsto,PaFnOdAsoovveeraelxetpeindseimivoeploegriicoadlsosfuidmseaantaslyezsinwghdeare fPFoOmA hasbeanmanfacired ofused. t O mDsuahPnooywnnpteo0dbpoelosepnrnoe5ste0ingmtnaoinrnyehopurldmaiacsnecbsoluconaotdn,nhoaetnepvdrietdsheeannctlehysbehpoorweispenlngacnteheoafdtt.hPeTFomOaAhlhaeraicsaobnlterea5rny, | L iDneuvxPepososniuitrg,eao.itnhgNederivcgeoermnipelalynoisteo,sttdhheaestrcmmiaionnnuof1ahctSeuvoriuedraecnnecdseougfastcehxPepFroOesdAur,hduaasnnfdtathodeogEesPcAnuoatrsehow || `anyadverseeffects to human. | pEErPPeAsA'shsarOeslPceToasnSef,oinmseiDadeltcoiodmshbaootn.rse"1vT4eh,ro2a0al0go5co.cnSacsuyishoaannssHwiiantfzhoeirnmn,attAhiceotpniabnsagtsAdewmdioonyinesatarrnsai.tmoarIlonfathe 1| stthuactiwosoounldd oexaidcuosflecotbseilnlaenviomatlhse,r oiusl]awsoighnaivleicannotihnufmoramnathioosnltahimhippaocti.n"t A`JAlogthehnnoscuyog'nhsaEcnPnAoouhnnacseccdohtlnahasnuten{osdatlc1iohguaanogtghhenedor.uOcaintsakaJaannsussaertsys2ym5et,nh2te0am0ca6t,tiveAidrTciniaireoenunaotit,cxtho ee acLwooamphrlueemteanaahnmedyaSnlteUhwfdIaetcatsmC.a"yFcEihnaatnygeT5thTreccYuorueCnnUtteTdpUaiTbrOovVeeR,TtoShdeOAtTgoPeEnFPcOAyaGn/vnReoAutnSceSd I a[ T is Jua ne5, 2b 005 Py FOA Itommateion Foirn umeontthal "oEPA rhas nno inyfoermaetione |}i Hfrp eomaEPtA'sesh evoersal PRvOiA letlootnadoentcwraosn.cdoco kes.i3s0aval iilabe.UncoafgPhFthOeAEPEAstPooFOgA.weCbtoetat | { ! || MooAgEOsY |i| _ p.374 ------ Tr | J iandkvienrgscauheraletthoefvfeecstsofIPpFeOoAplnet(Emlphoadsiosfatdhedegdenienraatupnuibolincs.o)sry SouFntandonsmandarin oA PEON || | `aSappdpavrcaoinafcccehaslon,sliBouscthasasarashcoettsesroimtzeainntg(m2eh0et0h4r)ios:dkpoolfougiyshbaivoleapireeirkssuilssattsensdhtecisnoesammlepdonomtuanftodirv.PeFOA |ii bWa(hosilecerdhroaendi1n00l%3orsmeas"lpLdoBonMssIeeC,,uinisi2nnhtgohtaohlpeluhbmelonidcdeaptloieiodnn)tBcsaDolLdcae(tlBeoeddnfc0rhowmoitachrckeuDs.oesIrnsutLemerlnveaevlledl)osate | m`aoocstcsueersa,scamcneundrtta.etrTeelhlyioosrniesd,pdsaerhtcoiulcuylbraerefycleotrcnutsesifdhoeerrPedFdostOeh,eambwoohscitacuhaspbepiroooflpor1giiasctte!amrboielsnyp,eonfosressk bpberiecoldaoougmiscieanltahenosiwpyeoeanxlsatohcsoafolidbnafroodmrasrtroiluoanilaoevdnaw,iiaahbnlsdeeolrnowtohlomvpiernlaasmtiaincotanhKtiablneoes,llwc.hsiAocdfhdPpiFeorOnamAtiyt, saucpgrgooessssetsdspet0cheiaxeltst,ehimeraoeladurososeewo,ifdhioellvepasraitaloldimooinsnsiein(ni1hz6so.wsheohruiunscmceorPtmFapiOonAtuycnoadnscfsoooencliiirmaatitineoadntwse)id,has icnoamp.aarnidsiolnosrspecios extrapolationof oxternaldosesand alowfo cree LO CdaUloscniunklgattheidsniMnatarengmiiamnlsadosotfsuEdexiropisos:ksuavrsesoe(sMsrmOe-Ent)waptpterioaeicWhea,iglgBlohuhwttiefnng-ahlolof0freir-tloalos.bgco(eo2ns0i0snc4m)peyotet. s monkeys, postnataleffoctsinrats,bodyweightchangesinmonkeys,andLeydig i| | Croolmlsmeovresranlsaatm.piGngeseturditepsoipnunloani-oonocumpaetinonPalElOyA6sxoprosedopovpiuslawtiiosns,vwohircehs || deresaemtp$oir5nme%saspietnoretradchlgoueendmnteaiarnovauleopprxoapppgoeuesrlubaProtFeiuO.onAnTdsshoeeefrruuM1m1mO-cPE1o4FnpccOpeaAbnccirouTanttchioaeondniusbropyapfyBeaoprunpobrtfooux1oin4mdpnap9tnbe5alw%ly.pat5(esp2urep0sbe0et,4ad)wni1et0h i | FTruu m IRn eL.4otsekP2r00asCSoAmofrtk ortgonespitonopusns0 ih rThteMorateorftbpouteyslanctrnlcrpeeelhn 6des ctth te rm mett intgso, rntoekwhe rsestoe pwpre e CE ATT ~~ Ao50mfe4rsihcaiCQnmRutetd,C3irGCoesWhs.akaonntdoa1dna2t0api0on2odrdPo2n5ot3r7su.0ErOmneonnnt.ooHOesWat(chP034er3aspeoscovtnde.01rhA%1secA:S1hnre8an0ttOo2len-one,1hG9rWr0,reoe1tfn8;o | hf areeset20oes rion SihPo bo ||| . i MoCABEOss? | Lo | glied------------------ || + population. | Science AdvisoryBoardandToxicity | Ei e `basedon intemal dosa.* The toxicity endpoints chosen,and theMOE i LL E, n (2004). EPA'sScienceAdvisoryBoard("SAB") convenedanexpertpanelto | i tPhaenSeAlrBePpoarnte,tlheenSdAorBsCehdaiErPAa'nsdritshkeSasAsPesPsamneenltCahpapirronaoclhe,dptahratitc"fuillarnygtenheeral, EB i L E y L T represents apromisingandrelatively innovativeapproach forriskassessments > a a a DRa Tama | 0D extrapolaonCansistontwiththe SABPaners conch',ie EPA' useof assessment,both for carcinogens'and for non-carcinogens* bm IE SE yr Er ERE TR m a n tm EorE rn te a eE e r cmere yit yt | ? US. Environments!ProtectionAgency.2003.OraftFinalGuidelinesforCancerRiskAssessment. I ERR ||||I| `.ConcoirUaoSnEnPvreoocnemsetnstaRlePprootepctriooanrAegednocyt.e20i0s2k.AsAsRsesvimeawroFftohreuRmefeErPeAncReIDOoRs0e2a0n0d2RefeNreEn.ce || ~ p37 I OTN rt" at | iEnnPccA Andaamtinspiansct,rkaatorcoSoftrpeplrhoaemnllJsioohonsononhboas sbotaaetelmd:v(oi)vtwhseabsdboweooensnccnoeoamrmplypotowoyears. | | pFirerossernsttleeyuksndsenrawaeyc."niTcherlA otnd gam noddi mioean dcdei hpd strs hadtott tb heAr gpena ocy yit notkeo sndpssr otnoo sier arSne>ydsitemshvaseemtAroginieonnhscoliyhntkakt.sraTeCfopooecrtAteeodpntooehoartpile itewiAlPldsEndeOeekNraBzseStcronnyyd SoABmrmeveie eeweonncte0toherssisk EaPiAaxronkiatlhhesoeppguaeroritsoreoorfsnioee:u.kWh1irodiuocwForcevsaonvednoentta, PharmacokianndsExtpoiscurse er -------- PTeovansctnisstyf.elkvTis arnetisashdpaorte ohvsiocdoenm(vpacPols ueaFblOeinirdnoos fuosrsmnniattsisoo noeeoopnntvhPe,mesEeovroiumnPrFoOoaAtpcop(nercoenrtt0eraactdti0ooonrsn,. atmci sonam BYOAorl arom soorenamat ofLe || 3 Ovtariaonga ovmd7w9i0r.d3a70.1 hdensssservenseveswweesreecoomsoi | Dwhoaaysmccaoaclmccmuklaaistedr1o0mubderd1t0s5,n1i0o.e5.,pfortevePrayEnO1AepwpshbooofsPpFeOoAmsitndrsinkringwateringested {| charaocmteerinzaatiodn fsorpcoonsnumeorfafreticcloensscmointdaeibneinrgyPwFoOAr."oilssiSngeonertalbY |L prCoveidpo othsnSoon i rc pmolmod, ot FEO a Emmeettatl. (2006a). Arecentphamacmoo delkofi PFOnAienpl rimi atec s | awn aog ten 8Prac T TnCoT tyS eT vant weT iesemea boon eoso ------A---- - Emmet, EA. of ol 20088.CommuntyexposuretoperuoroocReltataionnsicpsabettwaee:n lI Petememmattehs$7ta.ein4ner0asinESonos sme,t nt 4. stint 0 || Pe rar heto4,5.2ger eeenoss efstteitnr |! | | i | Moonstaeess | + : iy { ~D . - - p37 I i | IPmFpoOrAtaantnldy.ivneorostreanatlifusnocrttilionncctaealstllsy, csihgonliofsitceanrtd,ashsyorcoiiadt-isotnismubleattwinegenhosremrounme, wToerrheve0fmoayetuonldoirignichaielsrepeaassrioad,meeintteesrsmstou(adrineedsdce.lr"luimMndPicFeoOs,Awrahivnieresceseilrdo,eonotnrsvopwltiaitthneeclaertehacrisosetuondrt,yso)Tfhose i | rethsosuesfosuunppdonrttthheegceonnecrlaulspioopnu(lhaattioPnF,iOsA,fietvaensalsserouwmlicetvheaildsvaearrsteexhceeeaelddtihng effects. OccupationalExposure Fpoubrlsiesvheerdaaldepcaidesd, o3sMt,muadsiiethsoeo Ul.tSs.womoarngkuefryasciTurheerseosftAuPdFiOe,spdeornfoortmedand | dveemonnsaittrhaetohiagchaeursoacclucpoantnioocniailonebxepotswuoreens.PAFsOdAexipossuriecanmnuodrheusdmoatsnaldbeieseladoswe,, `DcounPsoisnttenftwinidtihntgshiebnotdsyepoifdpeumbiloilsohgeyd sHtourdaylour atslrWeaasdhyidnegvteolnoWpoerdkscohorta6 1100W2o0rekv0as4l.,uaTDthuee,PuofsinistntigpsnheaartsueemdofaPhnFoOspAsildteouvmdeiylowsla,oasgnicyaacplrosolisesun-disiyeoaclfatsiesomonpscliosayuteiroevnsesasblleaWtnacwseehieinnnegntdoend a`boocrcuaplaotriyonmaelaesxuproesmuerent(s0 oampmhoysniicuomlpexeamrinfatlionuencdprcionatnsod. cc+hWtaonragkenesrionPdaFrOitcAoal plopesrvoiedllusicvwteieaorsnesfofacoiiuiatntyidoatnonwrdaassnefgreouufmrncodhmbole5etsw1t0eere8on5l5,s0eiprgpuhmby(c0aP.rF0kO0io5Asi1,na0wn9od.rL5k5DpepLrmsc)ha,oltehAsestpleirogolhlyt(mbeurt notHDLchalesiero). | aTlhlecasuesceosnodfpdheaastehocfotmibsisnteuddayn,darceatursoes-psepcetciiveiccomhoorratlmloyrtaaltleyssitnutdhye,examined | WUa.sSh.itnhgetWoensWtoVrikrgsineimapgleonyeereasl,paospcuolmipiaor,eadndtotthheepgoepneedraatlipoonpouflDatuiPoonnitnwtohrekers `oorfevtsiihddaeinsncgeecoionfWniednspcthreVaaissreegbdineimcaoaarnamldeiatsyveoavslesanobncleioiaoglhnobdoOrwciitntgoh besexarplo1o7ss,u2ri0en 01t60h.eA"rPoNgFioOocwno.anTvshifneocruinnedgs.us sAtsattaitsitsitciacllaylslygnroinc-saingtnifiinccanrteiansceirenasieaibneKtiedsnmeoyrctaalnlcyewramosfroaulnydaacnrdosasthe sie Sonn erveesatdaEtAo,s sthprams.k J Oopw, oavreo Mpodr8e.77c15r . Rart bt er L MMoerrauyHAarokfiGaeensRepoPsok2e0St0i8FtAosnamuoirnkdeun1Pt eSrroaonGrresoCooofEexSdpeocosar35Sn8vReoientpofeCer,il ysRWelaatRsa3pSho20om0B5 AmtmorokfexnPerrhcco3caPnaoyst:rPaosac. PRaerkospCeahciMovraey | | || | MCCABEGSSSS i|| . p.378 -- | ; ) wWThehereesnec10oamsfpseoawircaeaidsoonos1ht0elmrneaogklieosnGpaaplveiaeirrikobeeorrpcoeonplcuhiluasetidoinos1n.0rPoAFmOGeAhaeesixeapdomaseunreao,erbgstaotnex.re ||| m{{oismdceehlenstmoaehrnvodlia(h1oc0:vsyee0ra8asoamMgo)otraHaotywyerSvaheteros,wfehodish5mSoecheiltiwsIaensacsnaeowstaosibnooset eMnocwrdtioevalsoeeadteodIrn s SSmiandlyi.nTchriesaosneionctbhsoesrevwaotroknerGsomuodbsteheatvainlydeoxmpoocsceurdtonasof Goudmean a. AKtlnhloohswoenueg1x0,pebacasicoasduicsnuescsobemydmeauxbnopevoess, tsh1uet0ouaPnFdOinAnogfpholesaalttsh femeicstsouAdPlioFnvOges,sfi1arstapbrreoovteon 0 Texmhpionsismuitzreos,awcnhoedarndohptaohlesaSslcree,ienseisxnugpeosf,seuerilensIgoorifoPepFmoOarlAspdosrseopnetrirmyaslahrsoleuessdssbumcoehbnta0sm3eAodPoFodnOs,, || UwEsoiumkndgmtrheaeeslusltaet1ru(m2a0pto0p5rd3o)ix,inmiatnnegglwyEatP0aArpsJcorvooefer(PnRg0OoaAv)1spoepfrr0u15m0.03Tpphpibpssdeertuakmiifnnoevwedlabtyer: wpBrsiosvoiisdsemsemnrotarnugetshfaoinuhanennd iargschce(uaganetdneheMroOaElp(ot-p3uM0io0as)itobcnaaosenrdseopenorntveedramblahylvaOaedito)shseeene5dapkoli.ntant 0-) GWhpSisraiesnerhaviionmesgd)heoaMnoWlnreoevroelkvsesrho,actcauasrpcartneioeotnninsnegceeisvseeasorafyn0od.5hc0pe(oE1ms,msieuctprpooaarsltee.icdnobmyeuhtnweiatyhta Conclusion | waBnleaoctraSuTusopeptpuhieotshsicsialeinonpceosdbrooevsesp0n.oot5cpsibuhe,pvpUeo.rS,wt.oauAnkymdsbyuoghgaerssetseipooninosfiaa hebtaolaitscohtiissanekhvfgerlwedbaretidlneokriwng | pSatharenrsdopaorsrdnfonottlihonnge).iinWgtehheykskncxioeinwctihefiecvoereassgeeacnrtclVh Xhoaotgfrs2hoi0olcweposaarVPtlXFp.OaA11piroowsnoanlt(lsdpaamoaeonmrta2on0d0 I Sootanehvaezairdia brcankgovnooutrodlyevel5sUinnsNupepwoJretresdebyrsacnigeincneg,fbaum Aw0o.u4ld1ppt. To E rin heroCa Go toR E a STS AEaroosnnmFesaenC, 0onCnowan,tdenwhe2of t003dP 5re s maie sc e0wOt e9dan wodmhoAi toR cRrc ebo icehcG o s e hn on am Ffrteesiaenge2e0 ah Desa Soa rato Yon See weir || | MCCABEGSSYS | i - _ pare ; unenkdheeartmpiduobnl3eienxpaedcteatlbieornstetahantggsciooncalvlaygseeonucniedrsacharrmgedweitpnrotetcting | DbiusyPiNnoo1nwhtwbDaoorsustledynwaier5lec1soSmooefotkahllec0aoanpcdpakorornsuosdn1y0(a00lpaenovysiodnewcciaihseoiofnnfPoFrgmOaatiirnodngbeiPiFnggOAewbvaoalmuraatkeed ih hebestscionca vais 0 | | MochsEess7 | . . y i) _ p.380 1 f FTroom: KMaitcohganlKMaamibeMsuemicChaconcerstbanedi@oesaemnohcikonrkdaa@vcetsdeonytconm || ce: Andros VMainovai<andren ralnoveki@usa dupontcom>Anes MMa`Masaitinnaooawwssmkhoi<cakanndnderaeesasi.esv@muiaslsmnopewostnktin@cuoosnad>n.oAdprauodpnesoacn@tVo.icrAonsmnn> KK || BMVoeaoitsnhsoeow<e<dha<amaunmddrwoebns somaslonoeuhnpio@poeno@ncuu@tsoosnsdu>vopiaAosndncdeoems>ArnK MBRaososoas<cabmmnaak twa)bi seoos so@dduumupdps souonaepntotuncegmtoscnAusosiesnemtaaa L MBMaoisosstnehoadwnaenvtisdmaansbesooovnn@meuas@taundsuoapwdousnp@toonotsncadDroapvoasndcWaamshon K i MRBaeoircnyso-wcpsmkaaiu<tdaaneldrreopeass@musedautpdounnpocnoocmovmAssrdPoeapidoar@DVcuomssAnan K RoBMooaossttshmeeacdrontanivak.e1mobaososso@eh@uaum@sauadadouappdooontptoocatormcsoooDraocvHiaOcW.h BNRoircakga<rtipeatdnobeerowa@riussmacasiamvkipoomansodtcuripoceomnsotRaco@obsmenpusoAWncnssdroaeema nrVnK MBRaooesnsseciodmanaiukam|wsboseoesn@eis@usdsdauupcdouopnptocmnoootommenMPoataurldiOdnWa | DeBReCirayrcekkscmuetbromrdaeGcraatsausaudsposdnvocppooonntRcaconomaAmnSdWrheos V NBaoMtoastlohnceoawdmsinacakdntebesoeovveis@smusaapdiuopnnocnootncwooOrsopMovinat@dcWoaumsmAoan K Bccerho<apsosstearberwerA cgoe@unsdaur dpuopnotncutopa comonRmooPbanod kSWOhi | VDMiaenlCDunasonawcnsacsnjaianoydrioecaavretmn@aduiuesosednnosuposo@anscuspodomonJpacoymoncmeoSmAsoAdoenaKV RBMeoessooengsk rmwiowasbmsoasoiadoeumpadpooon@neptccooun@omcFsouuamdamdmDansW.a BeRrga<poruiedberrpA@kuasraodu@puosnatcoomrRcaopnedSW.o | EXHIBIT | VF'DaeenCrDaurnbs<iosneick)iioe.enhdoosev@uacsnadaduusrpdeouknnptGo@nsotmducuopmso>ntJaacyo.nmes nda J Cie 3 i ie 727)p SAacehmewnis: Subject NTeeeosmtea1n90o7 dsoczWroloeu. Revie mono ere . Basedonourdiscussiaochne,d sth revised memoforreview duringour 830all, | +McNCoambaen&dyEsDsrociivaetes. | |i ChaddsFord, PA 89317 i MCCABEOS676 i : - 610285625 (vo) wanichaelmecabe@earthink ner<pA> p' or |p31 | || OO) | | wecaseoserr | . - ee p32 y : DD rere MEMORANDUM To. From: KathyMcCord, Robert Rickard(iles) Date: "NThUeDpuEr'poefsfeoortf0rdsomveelmoopiasntaoppprrooviadcehtimopaodrdtraenstsbaPcFkOgrAoeulnedcitnefodrmaaetxiotnroemnely pTroowvildoveeblascikngwraotuonrdaol nvatrhieoucsurselnetsistnaNteeowfJsecrseeny.tSpkencoiwlaeldyg,ethoinsmPeFmOoAwainldl ``ocuotmimnuerneiceenxtpaoctsiuornes1b0etPwFeOeAninthtehEeaPrAeaansdurrDouuPnodnitnrgetghaerdDiunPgornodtuWcaisihonionfgton reWaocrhkessditaevloolcuantteadrnyeaagrrPoeamerntkwiethrEsWPAebsttouVsirertggianp,irae.IcanuNtoivoneamrbyeirn,fDiunPaocnttion v`elaofs0.5 psparrtoescpesrss bisislbleioimnn(g5ce0o0npdanurctistepde.rBellioown)IhtilovEelP,An'osaocntgiooinn1gidsekemed necessary "Tohveels0o:5rptpabkelnevoelaccoiionnc.idTehsewi0t.h5rpepcbenetvaeclisoentsbbyyEtPAheirsslaotweesr t0hsaentanhiygher Miensnelsoatabwbhiiycashnihysstecaoldnesi.dTahriisngilnocwleurdeisngNotrstlheCvaerloflrionmaw7hpipcbhstoo1tpap.2bp;oabnldevel; ICaableilfionrgmuianwdheirchtdsPecridoedpnoolsl6o 5ieaxtupotidhiotorna.ctTihoenosenacatpiaolnisiroonftloectaqnuire PFOA `raecviksneodwliesdkgaesmseenststmheanltEaPnAdistihanttnhoetpernoocuegshsodfatcaohndauscbtienegnagcaotmhperreedhe0nsive establish anationalhazard level, `Scientific research conducted to dale, which has examined thoroughly the `peeotnevfnitrifoanlem0hehecnuamlattarhnsessff.feegTcithismefaprtroeomcseoenxncpceoersnausrntedh(pae0lrPdsFeisOsetAar,nvcefeaoitlhfstePoateFisOetnAatbiolnnihsohufamgnaoynvasedorvnmedernstehte `haagteuncsieesPaFnOdAthienliandrugsetrrsicaileanntidfciconcsomummuenriptryo.dauscwtesltlhaa5tathoesmoainmypomratnaunftafcoituhreerts b`ensatetaibolbniaeslehaenndcdboynNdeEuwPcAtJeaedrss1eaypscroeoacnacou4mt0ii.oe0ns0a.lrSyuNsiptpee-osrpve2cliofeiwcedirnhtweetermiemahfhnoavyeenhl.helaaAts0hei5ss9tsupdbi.ess.t,+hat-. diosvcenusfseandabcetlioonw,ecvuerlrwenatspsehalbaackrgrmousntaduldeivceeslsoofmtehakescuhireamdinbcaylvasahroilowutsihat `ngseoontuerrcsaeulsiiptnoipnNuttehawetliJooewnresreiynrgaonfgbinagckfgrromou"nndobn-odoeldelcetv"e0ls49ofpPaFrtOsApefrotuinido1n,ihitewould. | | | ! i i I | i{ }| . T | | i i MCCABEOS678 | _ --- p.383 : i i GCnAoonvmhimempoar0rstn0a.nhtaaWahsiGpaerocatrovocnfdmiaknaoynnnwgioaetmsePoroaulclbevcaelg,oceniotyvhmerbl1in8tSerpioamwociratpoemmrSmtaaponosevcanaten,sdsrsetesbgoylas i| | GEPiAanhdasatteas oofhWoosdtoveseiiaaonwdROoNwG ntpcoanu.s CSmroolekocowmely | `mCco8abnicrrceem1ys wavdhioeencwnuotmfRheonht0e.pf5epiapbceolsfedoivervtlbbewoycaShkseayelaoonOunnonoofguHnDofcemeeeldrp.omdietIonntfa0.co1tTfP,hHEEePdAAol.rn,esAfmpkeeoerndyrm5tebh2adoe0s0rs6y I Satsheodocmumenat assnerts: "Curent hes0 conoowinvsegsa to the toxicoolfoCg-8y'and the likelyhumanhealth impactsthatmightresult fnirkogcamieentxrapnysoasowusifrpte.aehTscGhceoerm3emvaoarnweltnleosohunpomsaeomnedhaerowaseilhiantah(0>nldaaodtoaetcefeursrer.ieonDutellyuasvoaPiulrtsaeobselwuentonghraaktte1edh s 0cvs i messot oman onPORant hoo: maonvgeKcoorramn 0pofitohotve towoderoiNtowwilJceorsuesyesneksecuotnoraennd the NJDEP,aswellasthe EPA, will havedifficultyexplainingthevariation. | (, OD TBE Lhaoisvseemdaeor mnow0liasy.so aoeuKtOthoet fSvrheooaessnsaongaa swrgwheeyktsshm dete0ih.p5ssbpySpt baboBilroegvvaeelhi inosnaybpyrrubDo eduoesrnpoto,dphrt sceceohadtuhtiooeonrnarsy Cvos tsoty S3hSoweirnginao almsanenuhppoogrShsallolvees0o3tbkcghroton owas, Deport Background SignificantReductionsAlready : SJE ocofinssrphayorefsc1osfsNyosw.sDstaeyrtDsuoPoosntFp 0L0O0Rsnrt oectchesoPpEeO-- N Row CShtaatmeb,eOrtshweromrkussfaaciltysoionNsoawv J(lBrOsO,TuHf)DwuoPcoonotoosnm l aovssProonm vod ---- Gelociod i areas hore ifoctes wing PEON re "ext bye firen fighs tersi in-fiv refie ghtil ngfoy am. howPFe OAhv as-e aisr obee. n + - - ida f DVuiPcoknst(h5a4s%taokcenisoingfocfapnatnttaosanocetceremiiosssioonnssooffPPEEOON abtoCshambers TAPE. iese l 3.do rd PFOA i died iosvn | wocnseuers || _ _ p.384 .o | mnulpeacatconstfamu20i001n020g06)Theo esol arsiidhn | J i`eJnaxogpgghronlessosuobsrniaevlieteSthfirfeooowuragtrhhEdeasPmhvAaiolpjlauopunrntcaaarhyemkdprooaogynreaaPmpr.FOaoaAgInona1Jldna0ednrouefkadroourycore2dp0M0oc6sh,saeiAmbdiplmcieadnlsisso.alurrBacclyleoosaurpoarSfrrtchetupheimhaa,ealslnns ||i | fhooloawignggroodspatiipate Th porr6qures Copate Gameime10nt || i(a1rn)odmparTyooodaucrco2mc0mo0in0ttbtooasaliconveslv,soo,1:fnbPooFtaOheRfr, atphryaonces2ms0io1s0rs,icoahna5sm50i%caarloectuhvcaittoocnr,aombnoeatasakurdmceoddwina 10PFOA and related highs homologs avrmeats: and 2) To commit o werking toward he elminaton of PFOA, procussor chemicals thal canbreakdownlo PFOA,andrelatedhigherhomologue Sorechemicals from emissions and products by five years thereafter, or no later than (BOBBY REVISE) Human exposure shows no heath effects KnhDouuwmPiaoonndtegxhepasossavteoolduunnotdauirnysgwaPonFrdOke0dh8wa6islibh oeEfePnAPFaiOsnAcc.oambA2l0ce0d3dou0riinnngvesshtaibgiaoutdmedep.oofeWlsieoridnsiac !| O CMoCuvocenhrteshdiaiosonpbisocosinns4ducshaer2e5 ovKalcbcyelhoiaRnyvl,debpmooorooopetxtreesensseiadvpreeahnhhocitaoeonmndspmr,erDdauepsho,eanntndthiavee || 5pa0arsvptioooonwrmceyonoutrnasmdoSdeihngs. lhov.ebobdoeognrPadsUionI. baGyeD1ukaarstsesssmcento. Mvneerrosthehan anThdeproestcntulrotxacnoaonopoauslvooofuePEcoOfAts.Miannycodfaita sasosleesssin5g0thpukntoawnnaidn peer-reviewedscientificjoumalsandareavailable 10 thepublicfromthedockets maintainedby the US EPA Thedalabasepresentlyincludesapproximale2l0y0 toxicologicalstudies, andseveralepidemiologicalstudiesanalyzingdata from - huHamsabnoosnerxpaosmedd ato cPFiOouAoweveeedrd extensiveperiods of timeatsiteswhere PFOA reve DmusaPhnooywnnptiodooobpiosepnnreossoiegnmntaorneyopmriaacnceoHuConatnonthodtabaevhiadatalnytchxoopshrpoarwonisenodgn.ctsThaoolf P6hFecOaAothnasebrEeyPRnA.G. i andnme areivesgadkigonntgy to deereInsoofeu xpocars sand f TfrReomeEo aEtN mpsieotigPonOihAelEdtaPotdsnicoROsArocnaBecdihbo.vieas, ceU inoohwPdEbOh eoNEome nTsOyAbe epcend || | | wooaseces || i OD. Sse 5.385 i I | thusfardoesnotshowanyadverseeffects fo human, | Eas nce 4707SorAlan `pErPeAsshraseconlfoinomeDdaecheissmobenerse1v4e,r2a0l0o5c,caSsuisoannswHiatzheinn,thAecptiansgtAwdomyieanriss.iIoanfiatohre | i t`shAtluatdthioweusogauhnlEddPltAeoahxdiacusefscfo(en0ctbtisenlnuieaednvietomtgahlaest,rh[eeoirsida]atwsaoiaghnnaidvfseitcnuadonytihtnhufoemrmamanattthieeroandliatithgitemhniplsyap,ctothi.ne"t `J`cAooghmenpnlsceyot'nesaacmonondcunlneucswiedodnaththaaastmna[oaytlccthhhaaonnuggghoeodtu.hrocOruinrsrkJaeasnntsueapisrcyst2mu5ree,n,t2tao0c0dt6ai,vtiAotdEemsPianAriJessniaonltootr ta`otawthasurJmeuoanfneahn8e,ya2sl0ttu0hd6eifPfoFescOstpAsei.cni"fFfoiircnmaaallltlyiyoarneslFaotcriounumgnoctnuerdtrahebanottvl"eeE,vPteAlhsehoAafsgePnnFocOyiAnafenoxnrpomuoatnsicuoernde `liandkvienrgscehureraelntthlefefveecltsosifnPpFeoOpAlien."th(eblEoodmofatpdhdeeghdeinneaarlaqlsupoutbailtiicosntso)any | `SaaipdnpvcraeonacDceuhsPeiosntnitosacknhaadrsasoctelhseersrimmzeiannngutfmtaehctethruoirsdekoorlsfobtgohyighsabanivowepoerrrekssiiusnltgtewenidtlicnhoatmlhtpeeomEuaPntdAi.voenPFOA, cron nt ope ee `Specifically, Butenheolfalf. 2004)" pubalriiskassshessemednt for PFOA i | mw(ohircrehaceacu1tfro0a%atere5elys"raLpnBoeMdnIsdiCedr,ei"cnitalnhyrteehaefllpteuhcbetisnctdahpteiodoionn)stcesamalcoludwlehaliteecddhbtfioroolomoctghciceuas.lerIrenustmperoJnneasvldeesolaste i p`r`ooacsdcsuoerms,siamnneandtn.tthyeTrehexiftosrraesc,apsfakhriotaiurcluddlibasierryciobrnuutsieiofdnoe,rarPenFddtOlhAoe,wbmeloicsmatiunaapstpeirooonfpratistasetste,amebwtlhryii,cchfporerriiskl bisboelcouaguiscgaetlhtrgheeawsepteohaenlrstseehasotrfteoiwbiesndcoofrvroelarataevmdarwiaiaitbinhtlhseoieaowrnoutthmtnihlseeivcpeolhmosipaonrnutmnhadesbciosodeyki.iminoAnedafdltPioioFdncOaslAly, i`no`iaprcprao0-ssasendsdptieonceilxeetsr,sepmiehaceilusdssoeesxoet,fraihpeolnlpasttiteoondmoroifsnnoie(mxai0tze.lemtahsleoduronuscmeersPtaFaniOndAtaylcaolsnocswoofncotirradatiierideoncwsti)l,has comparisons. TUcRsailncugttaliesdntomnMaerginsadoSafsoEExipsoksaa usrese(sMsmOoES n)afpoprtrohacfhol,lBouwtieangnhtiooxfeiceotolaolp.gi2lca0l0ee4nn)dpooirnts Ea eo pettussoactammntt. R4s4TooatP7r0amMacCe o691c36o50of brgelpotion opm i | Otte tThoeMorrsenofaExdpososur0eeissantsrtaadtao poeospsteevtark vdbysetting er |1 | i mcGABEOGGS p.386 ! mforcanolklmestyevsue,mr"aipolonssratramntsapst.lailnGegefsnfteeucrdtaisliespniorpnautnlsoa,tnbi-ooodncychuwupemaiatgnihotPnaFclhOyaAenxgspeeosrisunemdmlepovonpekulelsyawstoe,iroannensod,sbwtLhaeiiycndheidg `2de9m5o%npsetrrcaetnetdialveeurpapgeerbPoFuOnAdosfer1u1m-1c4 popbn. cTheeunpopfeiarprbproouaxnidlma9ti5e%lyp5erpcpebn,twiieth errsetpiermeaspteendtrshguuebenmsetarasnnatelixepapolpopnusrluoarltteeic.otniTsohneeorfMucmOhPiElFdcrOeAna,caodnlucletcnst,brauayntdiBlotunhtoaeefenlth1d4oepreflepytbidawn,atsh(e2u0gs0ee4n)detraol Population. ScienceAdvisory Board and Toxicity ``eEbsaPtsAiempdautobenldii,snwhteeerdmeaialnddrogaesfnete.ir"saklTachsoenssteoisxsistcmietneytnwetinftdophrotiPhnFotsOseAcphiuonbslJeiansnh,ueaadnrbydy2t0Bhue0t5MetOnhhEaol.faflsotoawl.as A`d(cm2oi0nn0d4iu)sc.ttEraaPptAoe'rsSrtSeecvpiiheeenwncoeJAfodhEvnPissAoo'nrsyd2Ba0ot0ae5rdddrMa(af*ytSA3iB0s",k)a2s0cs0e6sotshmaenlnatac.vcnIoenmxeppaaelnrniteepdalettntheoeEldePtSoArA.B. iPntachlneuesSliAorBnepoPofarnm,uetllhteeipnSldeAonrBosCneh-dacEiaPnrAca'ensrdhtreihaslektaShsAesPnedspPsoaminenentl!sCfahoparpirriosnakoctahes,dstpehasrasttmiecun]lta,nraygentndheertahle, u`seaofdPFmOAidbloosnoedilinelvosexlisctaolsoegaimcrestauseduiredesofTehsetiSmaAtBedPdaonseelreinppolratcneootfetdhtehat hedirectuseofinternal measuresbydoseby US EPA inthisdocument ] 0) - or`efcporemenpvsairerinontngsmdeaaniptlrayodlmcoiossmeinprgoaatuennsddbrseyclvaotamirpviaeolruyseindrntoouovtaetlshioevfemaoadrpmepirunoissautcarhlaflpoirroancr.tiTiskcheaibssasneseseswdmoennts d``oaadspmpeirnaoinasactlheyrrseeiddsouufcrseaesimdbtiihcneentnahe!iedsonddso1ectosiunmaceslnmutediaessucnuocrenerstsiaodiefnrteeixdepsboiysnuttrhreeo"dPauacnenddebl[f|y]ohtbheeeiunasteemoafl esxtriapoglatnisotnie."p tCoownasridstreendtucwiitnhgtuhneceSrtAaBinPtaynreerl'astecdontcolcursoiosnsss,ptehceieEsPA'suseof re We2 i sf chUOalrnsgeeenst:,oGsbrWnaintweheetibagha-tr2aft0si6ons3owtoPefeeesceelderbctyebdoo,dtymwhrhotthancchvnaendtsgewse.iaeghrnchaenogcesli,c0oansonnnaezftorboedy AOm2fe0cr0h4iu2cdraQennuR.aenidkCJar.tCovsehsaavitanelddosartuiHootnaobnfospdaBud2cor5ro0so7.c6t:aEnOebssuresno,nHGiaeWea.(oPFPaoOnafSra)slap.e.ntchdto20t01hB4e5o1r.rR:uSor1ooc0hma3Omcsofcn2ntactese-ihr,neiG1rtsYhsei9.eosm0feusn.oo7eo.fm- pCerhtuecrmooocans5espu1oh5r0e9-r16ae1n1d othrBorochemicls nan iecy popaton bom Ses Wagon Hast Ele(cUtSsAEsnsooncmienwtiltPhrEoxtpecotsieonsA1gPeenrcoyrc2o0d05a.ncDcrAack RiasnkdAs5sSeass. (Jaonft4h,2e0P0o5t)ent Human || | | -- Tr vochoRosoez | | p.307 . |ii ee | i iassnesstmdeeonts,rbmnoealasfuolrrceaircsinuogpenabpnsyd:FofDoArnr'cosaontrwcnielnaotdegstengsu"idafonrcisek 11 WIcinalMrhcairnyeogg2ae0nr0id6c,i0thty.heBeSheaAczaBaurisdsesdoueefsdnceiipwsrleorperosurestaearcnthdodnieonvdteielcdaotpeaestdpdhiuerpaiomnlgoantnihgaePlamfnoereltmheemSbAeBrs || | WMpoarbosyci2els0os,0w6EaSPsAAusBntdaPelarenwetahyra,atpEo"PrstA]o.hRmaoesleodrefictnlhgiinsetnodonlweorrweedsaaectaharcacohnncmdltauhyseiiSomnpAsaBrceptgratorhcdeeiPnsagsnotehnreis.s ||{ `haceosmpposlleeotnosaiinslodimtfshPekeF,dnOiaAntt.calaFurdoeirnignUctaesngrcreeaarts,eodfnio,nilmttiPhepFrOreiAsmukantausrsaeeslfosodmfern1atws.a"nneAywcdotdnesictltiunogsinisoanUloS,n sisEinPnccAoeAtthhaedlplaimcmke,aigaeconoSfntseiifpdohersermanabiJtloiehoarnnmstooaauntnhttlahosefsoPeiastnereealdrr:ceh[vhiteahwsaebsdewboeanasnccoonmempaplriellyteeddt,.wo.ya.enodarrsis . priaonstiootgnbrtealtcyeoutmhneidssenarvewawailyta.obx"liec.Ti"yThtheeAsetdrimniigsnkiaassntsdreamtseoscrmhaeadnnditesistdistclhdalaluttnahdieenAtrgowteahnyecbryyiitsnkhtaeesAnsdgesesnisocmye.nt `1`a0naidsntfsoheremsAaglsiemonnecnyfiihtnnkasaisln.rgTecphuoerrAetegndetlntechvaylasntonwfioluPnsFcoOceAkdipanusbetihcceoblnlydooonSdAoJBfurnteohve8i,ge2ow0no0onr6ca:lep-tuEhbPelAifhcak1s0 I a`EnPyAuaids vtnearksidentghheteeahsleetpprhererufsdsfieesncttttesnsittncaephpeooomfnpislceeaed.lkAsidn.dgiWth1iiolrneediunsfctoeurpdmoyast1siiosbnillielsnsbeoeeuirdncegeddstonoveolwop1e0d, {|1 0 avoidpotential large flute problems. Pharmacokineticsand Exposure RocontuctonsbyEmitand oleaefom hoUnivorsiy |i afPanecidnlinstsey.ylleTvchatneeisdahe"edaapltrtoahvceinaddenpbvoaeilnuutsasbelidentrnoesrfiefodiernnetmstahleovipnintgohnhneaearsremarfualmucoProFopOioAliybcmonaensrceeepdntr,toriidauntcctiteoiamonansll | doserisk assefosrPFsOAmdisecusnsedtabosve. Emmeotttal (20066) ound RL iIktB Atas pEpme omueFm rotucPnraracasonhACpaOcecAtymG.oPt2Op0W005oO5DI0gr5Na. ieGuNiCdAeTsObOrHCAanerRise kAssesm ment FCOoSmUAa.tAstPreiceMs: hep cmroSpeansaar1a5banoeknAZsOOkatrPts. oso amon en b en2,20 teom tpn it 4Pros so2Lo0n0m08cEComoTmntnyEAecx.apnooseoeesp2turosp0easn.tsoeGurscosesrony:GRxcpoo,ssaErofoinpo,rbMseocedeitos4n6et75ee5o.75sREsntaeoas scCsbeatwen Parameters 3Creo Emboi487n715. |i| | | wocasEdo | . p.388 .- { | i ``tahOvaHatirlamaenbdlgeieaadinffsarenormdu2wm9a8tP-eF3rOd7aA0lplape,vbte.hlsWeimhneerdnaitnadhnoesmselerysusemerdlrueimcntvkeaidlnrugeeswsidwaeenertseacotoifroLrietotlrlaetPeHFdoOwcikAitnhg, | bwyascocamlmcuunliatteydc1e0sibdeent10s5;, 1.0.5,ppfoboefvePrFyO1pAwpiblolfbaPpFreOsAenitdirnisnekrinugmw.alToher.ingested `pharmacokinelicmodelusedinanexposureassessmentandrisk i| aE`grmcoommheeentatta,tlr.a(a2f0s0ocu6rpacp)too.rnetsAiurvrmeeeocfrieanirhtztepiscaelhensatcmaocnitrraroiinmiinnnggavmPeoFcldOAeoT,lto"kfoisPciiFnsOgmnAeeniteenrepadrtlibmyiatecs" 1| optrhoevridpeesrffluurotrhoearliknystiacgihdsn.torefiningthephamacokinoti modelfor PFOAand PImFpOorAtaanntldyi.vneor soatriestniaclalulnycoiicolnintiecsatls,csihgonliefsitcearnotla,stshoycrioaitdisoinmsubleattiwnegenhsoemronuem, wf`oiovrrheeermofaotutonhlydorioginidcdtahilesrpeaaeasmes,ettiheerdssmte(ouradnenidetcsdae.slrluimMnPdiFceoOs,Awlhreiivlneerlceesaswiled,oeronnrtopsvwltaiittnee hclareetharcissoetudonr.t.yso)Tfhose theefsofueslcettss.fsouupnpdornttthheegceonnecrlaulspioopnutlhaattioPnF,OisAn,oetvaesnsaoclisaetendwliotvhaedsvfearseexcheeaeldtihng Occupational Exposure i0=) Fpoubrlsiesvheerdael dpecaideds,e3Ms,mtuadsiitehsoeoUf.ilSt.sowmorgakenyrus.fTahecsotefsutAruPdFeiOer,spdeornfoortmed and `demonsirate acausalconnactionbetwoen PFOAexposureandhumandisease, : `c`voDnousPnioasnttte'nttfhwienhidilighnhgteshrieobncotcdsuyeppaoitfdipeoumnbialolilesoxhgpeyodslsuittrueedrsay.toAufrsealdlsWraeisahdyisdnegvtcieonlnmoWuoporerdskdsetcsaoihloebretladorwo, IWnor2k0s0.4,TDhuePfoinrsttipniatisatoedfatnheis sptudiywads aecrosmstsu-disyeoctfoieomnlpallosoyuorevgesailtiaWnaccsehiniatnegntldoend `a1o0bcoceruvapalaloturiayotnema,eleuasxsipunorgseusmreeernuttmosoParFmpOmhoAynsliiecvueamllspe,eaxranfmlyiupncoartoteoinctotinaaelnnacdsapstooeicenintasdt.ic"ohnWasonbrgoketeswroiPneFcnlOinAical p" eWrehcbuoninoeSaTcct.edaofcsonnlsuome2r0tr05ees.ExEposum reSstsis8eTsasnmceonlt aSnXd11)d9a0k04c1h0a.raceizaifoon |1 sme PAharhp CGoko tacsr nMEec.kn eysaPro2b0e0.h"ePdrtaominatof oRgptlgsOftiNvEesY.O,TT00S08(SOT600S0F - S*erumeEvlnsmaodtcEuA,aohteaath2p0a0r6a0mCeom.marOeycs,pEonroenoHpde. 4r67h7n1 onRdeaamnssbettweeen | MMeesrsarsAoecfsGetasnRiesnpaHoPe.ot2hl0Sa0o6trAsomcRimeoaenndPnc1tP3. oearomrnBmcarirtGooofsExoSpcoicsoen9a!0S8RvnoevaconspctaiofvecCooo:knt | MCCABEO6684 f . . el 0~) man ploesviellsivweearsasfoociuantdion0wraansgfeoufnrdombe5t1w0ee9n55s0 eppbm(P0F.0O0A5(i0n.w9o.r56kpeprsma)l. tAhseplioglhytmer porotduHcDtLicohnolfeasciifelryoal)n.d serum cholesterol, igycaendLrDLichodlesteerosl(b,ut Talhlecasuesceosnodfpdheaastehocfotmhbiissnteuddayn.ad craeulsreo-ssppeecciivfeccomhorotratlmloyrtraalitteysistnutdhye,examined UW.aSs.,hitnhgetWoensW!oVrikrsgienmipagleonyeereasl,paospucloamtipoanr.eadntdotthheepogepnuelraatliopnoopfuaDtuiPoonnitnwtohrekers roesfitdhiensgeicnoWnedspthVaisregbineicaaamnedsaevavielnanbelieoghnbOocrtionbgsetrat1e7s,i2n0t0h6e.rNegoiocno.nTvhienrciensg us `Aevstiadteinscteicoaflilynncorne-saisgendifmoirctaanltiitnycarsesaosceiiantKeiddwnietyhceaxnpcoesrurmoer1ta0lAitPyFaOnwdaasfound. Wsthaetinstcicoamllpyasrigendifitcoatnhtolyriengciroenaaslewionrkdeirapboeptuelsamtoirotnaliftryomwathsefsoaumndeaccormopsasnthye. site W`oThreos1e0a0ssfoecwiaGtaisoenssldoidmnaoktoadpepfenairiv(0ebceonrcelluastieodntso. PAFdOeAteaxdpeodsaunrael,ybsiustftohrere. tiismcehienmtiecrhveaalr(t1d0i-syoeaarseagm)o.rtHaloiwteyvsehro,wtehdisamsoidgehltwiancsrneoatseoibnseornveedmowdietlhaotthoenre m`ssotmduadelyll.isnTcahrniedsaotshneieeonovbteshreoarslvelamwtooirroaknlecirotsyumrlaodtsbeteshfeaoarvhialenyaderoxmdpoiocssceeuadsr.eewnacseonorticnocurledamseedainntais kAnlothwonugoh,baasdciasucsuesdsbeydaebxopvoes,urtehe(r0e aPrFeOnAroehseuallttinhgeifnfescetrsfuimnldeivneglstsfhaartaarbeove tmihnoismeizeex,pawchteerde ipnocsosmibmluen,iteixepsossureu0rbiorpeprlosainsuttsonentmmaidtteirniigaAlnPsFugOc,h ais5pArPuFd.ent0 UT`sheuixsnp,ogstiuhtrieessdaeenrdaurmnottthoahtesaiclnrtkheicinnsgiswuneagstl,ueevsleielnsvgeoilnratPieFmoOoafAldpro1posppeebrr:il1syk0sa5hspospueblsddsebmteoebrnamtsimeneedtdhobondys. `wEWiotmuhlimdnrteehosetturaltatlni.gn(ea2f0o0pu6n3d)p,i"ntrthheeogE5ePxn0AepsripcarbloompefonpaiPunFlgaOtlteAivioeennalsoslefr0rey0up.mo5.r0tTpehdpibbsysineOlrisunemknlieenvfgeawllia.stearnd providesmorethananadequate MOE(>300)basedonintemaldoserisk AsicMsaRsektedoR1eporSton700B6e,rAnammarof ExPpeossbeusoriocoiPaanyonsee:srPhoacskoi.n PRtetosCpoebocMioovdey lscla onmEce2n,ondipao2s0o0e88.nGcsoensm.uJntOyE,OESmon1 pedR46r7507O0 GHESIS RAE AmI edcanRdCros0da0 boddonors. Eton HeathPespct 1110--0Ge3--n,1G--0W.0oo). op2fe0rc0iho4drdQcoounceanntJssuCtosrhuaiaseastnoHdnootoefh,pseBea2rr5oo3o7c5ch,aainOceenul,ionnaGenW(,PdoFetOy)1spoop2cu0tv0osn0AbrSouacmhnSaerencaeaot,niWceroeheirsgneioosrnf Chmosphae54.15681011 p.388 7 i |i |i i | || || | MCCABEGSo8S | . _ 3 op`brasismesaretvsoses)md.eanMltolurosevioenlvgsehtrha,elafaisrrscetne(eoartnindnetcghelesorsveaefrloirolefy0mo0osx.ti5-0cpoipn.s.be.riisvnascturipevpaeso)erihteneadflitbvyherewtnhedeip.gohi!nitn e`WxapsohsiunrgelosntWudoyr.ksoccupalionalstudiesand ihe Emmet efal,community Conclusion wBJaeelcroasreuyssuep0pstlheieesascliaoevnoerclebodololooowswnI0oh.a5llpsTpuboppp(ou5r0ta0hpnsypsi)ungpgewerossutpliecdoibniosefi,eashhpeeaoUln.tsShi.rbiAlsemkffyoorrhNianeskw.ing wepseatlraltbsdlpioescrhuiemdeonatdneidn(.i2Tnphogebwraeoitrse2nr0o0sttphapintnd)ga.irWndtfehokresnhocowehinhgihelcfyr(oeosxreiacirnccehrotvhelaaptrogsoehfgnioltiewVocsXfPaVoFXflO.2A0Its pfbrryeossmcein"etnnsceoa,hnbuu-mtdatn1ewh0ote.ua4ell9dptcuhpnhttda.ezmaTmroidsneeotfpabuabeclvkigecreoixnupnetdciltsearvtaeinlosgniseihnsanNleogwooJvneolrymsuemnyosrnuatpnapggoiernntgceides cmhaanrngere.dwilhprotectingthei healthdosoinadelberateandscientiically sound p.390 | ! ||| | | | | | | --_-- i TH_-- D peoi Edd || re a si A amen n | rDe EEEfEorsven soe 200 Le A n uyd,Cereisis ~ Dter FO P.O. Box402. | OD secotnum eC t aa nn pyCaseape amoe syeryIottSi eeCr hamtrebesteei,seodoiteref -- m-- ci edoEtiT saeng tt ArmTtOaAaSmeybaeyrwWheotVireg teTTdrOeefee |i ma seTe de oat,tSeTs VEAaShSna t aaf Sr rPe eRr e br ae b EoiEttyLLlOoeb m SAntreee"sg1hey E Eee tet Ee | meres | | - T -- E p.352 { Lpirnaer.iyteky0in0,0Commision i LmhaeabrioirskoefcdoowrmDHern.ofRktovhbieetrsEhcYiWnoo.unvRoaiiskksio,anscDhocnootnnsDsi.vioiRoepefikhotSddtSeacsQennfSteEr,PneA s osnAHdn sveepLrroovtiis Ri3.gnFhitersd,bvryDeump,poonritceVhiioWcaPvePFetrOsVtpeabrtntsSsowalhdsve,alDhaoa,stsgTrroeuvnsoavheisenwspsfemcseawhiShMegaoyhw,endSeynemnswre maticsero pa ing OA. SWintttDVhuiePgsonmnestnlrdOenveooeve0.AtpHEePyAeccotcrbaiesssihaoodbkyKBskPAricewoenf boih heessceofe 0D. _eLl--eiTehank iyoounoryooucrnoomlseoonuuoghroeSapesonetthso.tiFwocoondtie mpemroorpar c. vPOiRd Sic, KHaatteKerMeocWoennter] NnaeyNWiethterPAsr.CoomisiSoeon,sErbsviene epi 0520074000021 | i .--_-- _ p.393 ! ary | To: KatyMocers, || From ORoboe nRicaks,oOumtyDiottcaSSinso, tSseces Date: Jam11,a20r07 -- h OavateoorrvoiGVeonwvae otpsoofnhlSpe rrp oo onbaosvsdiSa FspEpoenOcErAhhtSt eoslmtaeesnrehi yypiootcc mkiaosn oO DoEuveoanctornempsmaDoironessnsturroaaoirnin5ngg8ehsasoDonanoaasAnllormpatrscEopptAm eSF emod ot n rms Ep - TCVa1okr.ar0in.oae5Ss5toveTstohcte oc0adtprhowaoi sahusnSrtyoecEoeEAnsAsebbcyyooacvoemraes,tosT h eeteincetefrs ETa5ir0E8gtP1Aoanio hoeidrroCaspsootofac tpstabdoo cochoetsan o peteed o sk su 5ea5etssc tTorOe CCSoTocrneomcpnrmcseseiieesn2cedawoemlsecm eoanpdourncats nPodfEtO,OApwohva iichso ra aSoayo A chcyrasntopofe seohtiaens CNomeaetrsihesmaothsEeES tneioeta rey onan I "wr Secrm tov asBoo SUPPOITITEVE tower thi TheUS on oe pb eStabihed by EPA bs rr] a precautionary 4.sie: 20074000212 || 1 : hericalshow atven a acto vevsstat backorder fom ) "onoNnno-wddeJlere0scety",1g0ewn4oe9upradrptoostppse5irto5rnilk.ion ro ofvcr measuredInfinishedwaler bayvoasrivoulssooufrPcFesOiAn AGieniovIiammeporrptntaeonlthahnseodpwdepcoooottroeefen1sasnpyclnawta.tiieGrollacdevsew2lebi,0se9iti%heryItnbti5seyiri1ism oimkEraarFppreAoera yolmSfiabnbdoepnogets lo,sseroSotobdtWss yimenaassiessufo n.e DneS2iproamnOiaerimocen,n.TofhHeoaodvoksc,BusOmWeAindtefAoarkSeels3s0sa8hmaceGoasasnPbutirraySfcoceweo'oeefPrtre ehcpeodnetiolorssShS0Soocfeiprg0e0 Knoviodge onPFOA. Akeysna sistant doom stents Cunt itiVhmreparaieckIotssonhohacsloniofsgsehonosrGuessowsirtpahtreeecgoasrrds5o.tf3ot,ehmevelToshsxsiecrnolosooogdyeovwfiChs-o8a'nraonadletehaethlsoikoeiklyshDcruammhtaealnth CToDouovrPeomonotwinehrantshwosroakdteaodbdpoivge 1oB3t64oilwtihatke2aSJecaewonssmtmcpielseoinndccholeoonernndebPeorssoanoCvoencsa hknneeds a Te EPA.wkho Gh ring vn 0{~ aSFoiEntmetse.soenxBpoiyorgfeo,veromsveanryt.aosewhesssorpaybariosbnsnwvyiOoobydoon--ntSSa-- oiovnnPsESrRooeven oe tfos s Sakonovis, Doonak et sc sens BStagcnkitgcraontuRneddustlonsAksedy CSihNPHnFewEpOsdADursaorsfyDoNbnnoebweeutnsnmDeesssotesPynFut.OrtDAleuPnemoatamnenotxnudtdfsoeoastmcsceusnryooekoroaswptoaeoattriinns,scoPomFmP1OosEnCiGhItAaSymobewrksisnWgevoyarthe0osg8be0iss ha SToRrG amesmeeered bs03 G15, aha ered bo 40 PFOA" heeid insmn nesters p.394 | !| { -f i ocz00740000215 ! i I] {1 ; aRriouhsosntede rPoFOtAei iStsarrp eTsat evnltaii,tph gevaerusis foernmsotfgAFeF || Rd E p ErmniS OSL tnom StcsdOesiiAenOArpCestcyc DuPonthastakensignificantsteps10reduceemissionsofPFOA atChambers Works y E {p tyJ nepT o g Lbb oEe eb tn en k 2m %o cn etsarr, ECSBoLltaTo mateSn npretaEOd --i----t TTgv OeearAr =F ee OL em Wraytte eroabtunttoease eoeAtoeyp Femon en e laAnn LW eE r eE goee t,SalitBoA,Soepa aMsTe developedby independentresearchinstitutions,DuPont'scontributionsin thisareaalso TPReem SmEsa eoefytc ssepet Sa =A TeSe aA re ry ieie bylheUSEPAThedatabasepresentlyincludes approximately200 toxicological -- SIE -- EPA rneTfvarnmsiPonRsOnNthe.ERAdN.iPFmOA.redscoechecifetweaintcheinegbore cmeeAmayAsW c o - iL | 062-0074-0000214 { 5.356 i i 10uiGnPb3oe0nmiptradensoyecgnsptliaoncetehsnucmaannrnnbhooletrotboSeddoif,ucuayloslnuydn:etxtotiphhelaalxiIpenhvvoeidspd.ereTseneoasceetwsnhhcaeseooc ywfisno hige0mhrnaateolEePt rcPFtAaeOar laAnixhd3a pai00sin%dr bmruaesenetny trynyypsa, ehProgoFepw.OlnAe. | | iBnaasieedosnPeFtOAhGonpdscdoooenlsupxoksaes,DiukPonotbhaekGeorsrhopuwkeelc.h ofsion | CrEeOPlPAeahSsae,socsnoaDntefecidremmheabdte.riTs1hc4en2asg0oa6n,vceSyushmoacscnasiakoznons,VmAAoTibghasoAedpdaoisnstaiwraomyoeerlarohsf.hsonaSaPgnArdos0s c Bfeelcftovseshaarnits,5GsokllgwcoohnatvehunomainnfhoermlatdoInmpaatchts~ pAoiPntU3EPwoAuhladocadounstdo0 `gOatnteoJhaeEsnrPudrAaartiyasa2nan5od,ct2s0tesu0vsd6ay;rtAfhdosmefnimanoainktstyctersraattdouirrleJiglosenhatnlnpys,deocnnihaioenawAnlgdoleaunytncscrymes'adasciytohnncagctl"hcufasusjirioetnhhouagsuohovnrouilrscorhpfiasPnklgOesdA. > STpeootrsuonrreaofoatnhuirnArga c,uhror2ei0n0ta0fvPfeFcOtA.o-fFiPaoFmbOaAylosIne hrFeeacburlrmoood0osDfh-tohwF.geiAnheArsosp7oucbyic to nyadversehostsaffectsinpeop' (Emphasisse noGroeions) SCivnoacnercemDusaPonnntkahneadraosvkesorefmnantubomocepuiorardesorllsoognbeyghcaovnpewoorrukniodng.sSvpitIohnckhihoaEetPym.AiBornaPpeFprOloAa,ochreas.a 0; (a2mmoou0dd0aee4ll)ieeddpduBbolUociOscmLhebdBaeiasnieecsrkhnuaemssodeDvososcmesaemetnoLWtrhofieocvarhlPc(Fr1vOa0iAl%obareassetnpdooon2nkseeLniOlaMeIlhGewodc*otsnssc,euosidcionicsgnehaoaotnw)ich | . EDDmirioeacopooeranfarrnteoktsppysoosenntcxsse0aecscsseooml0eacbnae..:caoTGnhordibturlsieopoanrwribshdcahsoredywe1dseavneorClaoPtirFnnOchAro,iobbodsoocyhaw.ehmAcodhoafpn1oaasprtSpytra.opyide | ioslcttaposleroofemtaehliermwiowdzooiestdhvgo(afr1ifcsasoorntmesaautInohnPoavFwsOasNAotsccioCinooaomenpwaoruiahnodhodpn5.h),aGaarHnsmmdoispnoepisoeopdsn3eecdcieo0sePetcFxapOeAiglofodotopstgehoe,ontosf xo dosesandshow bor reccomin UVsiitnigosvsof Eexpmoosedsos(eMrOsE aslseosrsomeonbtoapvekunachr,iGlsegehnolatnofdpo(s2004o)rcalteued || RenToT l oTemassa pm s---------- TeE tofoa tgnneofExprionraseenotf thoottc Perna dhdeedby cok the ras of [ Pacts | i 0620074000215, ii | -- p.3s7 --_-- ) 0rr aSGnoimenecraea!sprcaknsi::sbioWocncy wellagghnPc4FhaOntgesysiwenimhrtoivreets.o3cntrdoGLsAesRwGiSo1olmemsoeckvseerysspoopsintl SSei3r4npudom0coTnoocnae-nucupcapateoorpnbasuioforpnaob55%spptoosreesdopnolnoedbam.twoarish, wg0ia5h%npadeercmpoaannncsiototeoednrsavsreoageeTPOofEAO1 N Ccooynhcaattnaiartoooatnoeotfr.1s(t3p0ps4i)waopr1ne5s.0010seuporsoisnotl pratocieoxnpofocire.Tnha3O3Es,Scoatloted SclanceAdvBoiarsdanodTorsicyly GePnAaepustbctoanhtaenctTrwhfihikhcosssyesbssapmnaaintsoCryhPoEtnO,eIrntJhanoBtuarO(y220S00045camEtPasRssoSvcwaiseebnased S20Nv0ia5n3cr0,u2B0i0o0kdhaCactSssAecs)oacpnaooroinaalhceaSsSA1oB3EPaaPnAoeAnTsiopsco,amSaSAhSpCpotkrseveietfonofSdEAlFFeASd SSPpeaonsreoasCmcrhaep.naarnedchaatusTnoe onfgciaPnmFeiOonDoofoudSllAoBeFlaoann-ecaanncacoersshuoedssEofPssecftptessodfsoosvroaeacmkent DDiirhceienorfgohcako0asermofiltlyeeBndomovaeaasrnesScPboOylcSoussobhfykUeeSksSE.ePsTAShiSeSKAmhlBaGePoooflSurAetpeSerontno ht Covuarniotussoctoemgaonfedio harmtorvTmHpSackabcasedeosccompasnodeaytoStohrees Burnoconarerptueatrtioan'tkoonnsdiSnTCkpioondnauesctneednabtryevepthtioeomouwesnsneoSofyAaDvdPemoaesrssatesearceodaonnrsdyadomobreciu.eenmttedhdenoEtsbPesesRamosedvMscsoerpaoesefducprbsymeoooflo Goremessgi apporedbyFON'ow ispadre ookmoses,bom or -- T ra T sti. fo `carcanidfn ornoon-gcae rcinnogsens'." eg es. ks ty S Tied oSn nToSh t Se0aPe wuBrmBySPemsptenhEeSentASneoee1iAs eftn amSA I amen I ee I ee Se -- te n A,e Li okEkt Ca aA e iiok ec Combat aS. rans || | |i i | i i -3 I | 05220740000216 {i| i p.358 i IFnoSgMoaersya2to00hf5e,nhohawezarSerAsdDedmosscurdpolvoirklsopeeoddrt0airniddoocoxts ahe ppoitloanSmtAolDnorrPocacrntcaeislnwomogesbnUiacnyd.wah, | || REePlroAerhiinagrrdoomocnaidnnedd1mat0rsyryaaccdphaoshcnSanirAhiBFoopanasrchoeospsagosriastweaeWts,ohyc,P2EF0dOP0A6g.sFAicGoaenrcParhsn,etloF1ob6eip0Po0FrOA || snCotoeaonnlaoarfamyhnrbsdorspAeyhdoeooareenhsnaaagbbi:i.onU,C2SEo5pPraoAicAokvagdnedorfehordrmoutaSntlaeropahoeetnosgJPeroeaamcaahonbvnciolhoiracosvsoiieavkweepdwtTaieshds iRooooconroremsyephrseasTsseaarnetiployaruteneddrTeharhrwytayao.k a8TsshseeccasA asmsoodncctmo0SiiADadn ddeodowei eideytihs baoolytoht heae1A1r A9ggoena nccayyesit,snealsneocnddahsreootnottic PneoaoeTt.hoAeAigonona0 yasaouncslauondioeof oiaaooennerpa200eh5:eE2aPtApyhSa rnoahchraoasrteonsacksing PrarmacoaknidEnxpeosturse rREtoncdedepniotepvituabsnlsoiecaaeBtsiodonnipsthobsaymbmEaoitmcnotenioDnlnatiacn3odsbcerooerbeaonaspgePoduF,nsiOefsoocrmoolndchdueentoUioenrnatiiovaoknecssrsy3s0s.osTso0PhnleeoanscnteiasdcydhaoaacrfisaP'hF"ObAe t | 0: Sodnirsocesuessnreosuaebiloevnvcawtelea,udteEeeswreardnrttCoootrPfr1F.LeOi(2dtA0w0Hw6aoi0ch)vkcaikoAd,aoOtfoodtraamonegscgeoddwo1os5nk.t:12d8n0a6F,3Ocv7Ro0iye.vae1WPlnhOenf | PSFpEnkrOcnoipsbhonpecuovnanseto.rwThehoaersdpecaceomhmseamaneabrryeCrhcwoiiirommserodacrsaeokniceaeveEdd)oro7ooPiieEn:kdxA1b00yi30Ei5mr07n3 gaveePoesoFrte.Omp(ewinGektooarhc0ntd A [ CS S om use re am ptenptyaA Tn Att iees.2EARre0s800, ME en r =I o e pnin 8Pkat.-- re -- a a-- Sen ee a eT emI I Nn re o5 ntE i8n 7.4 R 155.EBoTvismast AGottbephar as2.0074.0000217 | | -- - on | recomhumockivtemaloPON!pr ineesprtesnig io m opre.eotasoaotnn eraoscoShaicaeksei,pnoo yontoslhorosa rsvoen)BsewerePaEON re ees peasoohoee o ht Soe p os i Occupation Expose e oroot dsean,n NUa S,mao mtrseeeoi.OAoPEonorSpmotebaotrtmsBdeamndd iho a nsWegEeener otoeesi A a meteorn eo ese-- e sre ore .Y D S eo e 0om:aTem sSaE Leto aretsnn aoTysosCLeeolley C pote preie c hor ooenes e ctoysAe rbiey-- d setlepSrta eoe ta Bn Tarort d Ceeoe S mo. as rt tryst i enern `availableonOctober17,2006. Noconvincingevidenceofincreasedmortality en A 0iS SEE TITLoess ems pA e A ne ora Sa --x np! ee eLrEa Smt ya,NePros p39 |i || | | - | aszcorsamoats | - \ pe pp -- 3 | ESE kidneycancermortablyand astatistically significantlyincreaseindiabetesmortalitywas EE E BE E E E a EEy EeEEna ESSE aeReE rE a T T IST t Ir eEU r SpT T R iE Sh e e aU ESk Te , foundinthegeneralpopulationas reportedbyOlsenatal.,"and providesmorethanen e `sacnrdetenhienEgmlmeveetltoeft0ai5.pcpombmfussnuiptpyoerxtpeodsbuyrtehstoudWya.shingtonWorks oocupationslshudies. I 1 Oo S S EE E = aCerE=rT nereT sB esees -- aa eyE yd c ast es yeey cnme sst emma EA. oat 20088,Commonlyaxponre opuroocanass:Rakesh beeenson. { h EEf E Eo EeR r E rem R ee | i fear cu ST ph te was ||i . _ _ p.401 b LE emon isef L io A borE sat dyeoEfao rygr--ots.o-- LToTc--roonrs--oic: | D Ce rirmae tot eoSyaoSouSosocnkh eoeosoe J3aeyaesta. oehvne GoFOeoRhegsD.to9ns e n i. Tosa oa k eh ne t koe h eeodsssweni,maeanly O | wtt--" sg AL . ; on --r | a| 062 a0rs 000220 ||| p40 -_ ---- ) Tcfrocom: [KDSaoR iknoWKBaE ornorteMs-- aodeomdoiwGbaeo-- oamhdnoi@utms-- arcdosumipeceobacenorum sOodigo --_-- |i RRBRiisoosteonoshebkeaoasaroerasem<gdaeapsionddnpooecooeocrmsccovoommioHDbaodwva | SeASnultbaic:ehcmtents: MToorrpoMhsylNeuIeoDrEn4oP2246s,.h00p70doy7orc9ete31e2rh Kathy, BAhttapchesd iuifdrsatncscvoeef.phowie lavesmee,ewotcEainledeinsMcusrphyomroreTgowiscscourterdeeiasrmgrmiooecnmiengngt.with 4McNCoarbmean&dysDsroicivaetes C6wi1hc0ah-da3de8sl8Fm-oc9rc6da2,b5PeA(@we3oar9rk3t)1h7iink.net<pA> EB pdabe 5 pig 5 O 1! wecnsonrs | _ 1 I EmmeS ats eo EEbE rEe hpEmie miSE tt ErE TbeE, `We are aware tha this correspondence is not the appropriate vehicle for challenging an * DE -iPE i o EREi IES s { ) `administrative determination and thaltheestablishmentof astatedrinking water standard wos || |