Document KJbw8pYvedQG3mOrZOJLL24Gw

vrmelia ig ' Tennant Farm Herd Health Investigation Carle Team Report R. STAHL. ' : AR 286 -- 1243 ' ' . . * Tennant Farm Herd Health os Investigation : Cattle Team Report ' ' = '' 8 2 33 ' . . .. EPA/DuPont Cate Team .. DDrr..LPiesaarAy.L DHaavbiescHkeelrler ER == 2 8 December 23. 1999 * -- DDrr.. RPeotbererG.tJ.MMouinssanon DDrr.. GRorbeegrtP. HS.ykPeosppenga . . CONTAIN NOY ry 000765 wwe Rresoo0ses -- Tennant Farm Herd Heath ivesigauon Cane Team Report TABLE OF CONTENTS re IT Mo sommry 7| [4 P-- r r -- Tr Sm-- mae-- , --------------T1 5] ] [25 [INTRODUCTION [=<] 1 rr Bo memos 1 el 6] [or Toaeteam 2 52 awmaibss 1 7] [532 | ugnowicpabology pons [325 [Api199ostevioidan ' Drs wae |8 8] nj ,,! a [[oA1T72Ceodiwaspmeosse pathology repors )\ [Ta`April 1h9er9d9sisteivoinst(Wda8t5a9 merview ' ` FT 1 epee bods condition scores. girth , A [Tc cliCmcuolcapatholsoignegy ' ) hemo FT cimelonemon ins]l is is [ie3] io] ie] 16] '' ew , [3 [Vmeelmmeowbas . Co wea 5 1] 5] Ts) ' ' [0H 33 [deere sodies ian] 1") Er E r DISCUSSION, -- ----T1 5] . [TT I pmiamikneurreion 2 * 2 . J -- 000766 -- Eo151683 RGS000886 J '! Tennant Farm Herd Health Investigation Caule Team Report *. TABLE OF CONTENTS (conti; nued) 2 Sari .. fe[c5ti0on.T|_DI--SC--US--SION tc--ontinedy ThTagoe] [| copperdeficiency [5] ' [1 odedogyisswes a] . r [6r 0| RECOMMENDATIONS 1[1 2] '' rr CONCLUSION 131 ] ? F [80r [REFERENCES 11 % ? rr 11 Per] [| Graph IIndividualProlactinValves | 30] (rr 11 ' [oo ThGuRes Si) * ? [|Fewelond?Feels Figur3e.Cornealopacity 31 : | Figur4e Delayed shedding 53 Figu5raneds6. Corontis ' [Figure Tand Calestandinginwater | 35] (1 . [oasis 75] * [TobieTReview ofTennantFarmVideowpes | 37 * [[ |T| abTolblee33: inIdinvidsduaolliAAvniivmmaaillDDa-ataw:CHleinmiactaollSoigygn(seryihron, platelets) | a4. Tl Tabl4e IndivCidhueamlisAtnriymal Data Hematology (Teukon).and Special : [1 Tables Tnddual Avimal Dot Creal Chersiy [| Table 6 Indiwidusl Animal Dava_SeraondlFecoalgExyim J . . r1r20 | APPENDICES [51 5] |SpendixA"AbbreviatedCurriculumVitaeofCate TeamMembers | 56 | ... AppenP5de7in.nxM.iB.cLahbiD.gioaangfnAoLsantriigmcealPAanHtiehmaoalltlohgPyDatiRhaoeglpn.oorsattnsidc(TOLohariboi.coD#el1pt7.9#2U5APg7r91i,9c.02U1n#0i42v9,77- [| Aepen#a9i9x0C1.43b7ryRunSafe Pian > `AppendDin FigFuigruerse1s-4432:66 PMihsceollatncoooufsgtphhero4t2oagardapuplhlshoaftstlhe 7 [ [| ISAopppeendnidniFEx_DHiecrtdAnHaeallytshiHsiCsotmorpyut(AeprrSiol8ft.wa1r9e99Sinmtieraviieow)n [i1o0s9]] .v 3 kd s 000767 Estos RGS000887 -------------------- ; Ta -awa a- wr ir- ea hess win * a: AR rodcion : | wealth : =i B d a bi fany proble on iii : Eo omilionegs on 7 zSc E " e ;Ehea:lt ast : = EE oe cont =: Ee = ' Met onesn HTE en nnan E= eS i EEn : \gs airnidt arn - = examinations. SS e i (poecHporse)seaa asn-dmethse peaLsiaiotsP ae:gthLehiEcPageltvhi= edieontor=d= er, blood ' a ' RE es1us)dleE .epnolpawngieinossS san h ai E i in deuurpe eestidpoorancroyfpdata opaos To dein e Tieennns: ry ?[Ll Fane :bpsaego= hnriend Si epsiin= :pA eoteHida ndBvwi:oshevlaynsu- (etMarela:dul fe= ilslo,wedera d= ong he we sr Dm pets = eni.naAt:inoeni xami Sg oain : a . yy . -- onsesner piinrkeye. deSbe eEfly : 2 : 1] 7 gns, eiba ei 2 = alsp& ocoppersirdefi , and = meron: o adzy peg Taniceityty J(feoas antenet `enn: ares oa rines. = cy in ox &e fa4r : p= pioE Ty ohn o oa : cont|i lusiosia nte re asfcroomsiveconditant. iat w | ii i : : : } borat - o hg edinygitiolaynn).hdreel:iflieegradtiing nel ho ag the icherd iy a ior SE = .: mn = S poiE nte -- & fic or > insoie) fl- in her = rn:icnc nt ~. ant o heher . a . o" f ot -of raccit pd . ta- ntial oy =this. mt A an xh ed a . dnd tn Des ITRisi s icity e regviain por- ickor ina~ti :o= r emivoom } i const espe . : _ . BN 000076 . so 0080s _--_-- o : .'. ' 9 ? [Ie ' ? ry o * . . . * * 1d . - Tennan Farm Herd Health Inesigation Lt Signatures i L. cbs Perry fabecker, VMD, Dipl. ACVP wr' Lisa B Davis Heller, DVM2-, J CoteTeam Regart papas Date Dia /30/9% PeterRGA. MoisanA, DeVMe,nDipl ACVP, ABVP Rosi]AMisra, Robert. Munson, VMD lay 49 Dutt i3]00 Bae Lf obert H. Poppenga, DVM, PhD, Dipl. ABVT s-3-00 Date p Greg PS fies, VMID. Dipl. ACV, ABT 1223-59 Dae s - ----000000769 E11 ose RGS000889  Tenant Frm rd Hes vestigation ' CoteTeam Repo , 2.0 INTRODUCTION , ' Tcahtetleobhjeercdtiavneodfdehtiesrmiinnveesotisgapotsisioblne wcaausse0s oefvaanlyuptrohblehmesa.lthThsaetiunsveosftMiirg:.atiEoanrlinTcelnundaendt'asn ,' edfaxitnaad.miinnTgashteainoidnnovfmearstkeilegesavtraienontcochmirmsmetionrndiatcatelidodnaitnsat0haesipwmrepolrdlouavcsetithohenerocdofhlhelaeiclsttihreopnoratn,dwehviacluhaotuiodninoefsnseuwdy ' ? 3.0 METHODS ) 31 Cate Team ' 311. Members :'. ? T(hDehuCaePleotThnaetnmntaCeanoanammtgp)eF.amaneryTnmht(eHDetucorPaxdoimncHtoel)waoalsgstyeh.lceoIcpnntasvettedhisotttluihotgeegaedyt.i0monaenmiwdnbacewslruiasdlses(deiDexgrpnsederidtSstieyoaskseeeassi..tnDebaaoRvmevipiosrnfeeHssedeilxinlsteveareat:tsieevrsMei,osnohayrfeeidaarne:s . ? rhthereperscesametenetmabeteiavrmess m(oDefrmts.hbeeHrUasnbieeteecdeiSrntcalPtuoedpsepdEennivngistr,hoinsMmurenens7ptooanrtl).(PArpoAtpbeebcnrtdeiivosinaAAtgeednCcuyrr(EiPcAl)unseVleicatedof * Catte Team ': [MePemrbsertseeter VRID DT ACV TavCohecraTiomLxcocenoislAo,NeRUn.BTooofnSFeCno.nTSschKoeotoonreVPeSesrmeRonPAT ' ' FFeebrearivMeooronVVNIDDp ACVP BT FVeedLrmenebFasrosaCtonHeTofraxoAA l TD aghhNaCnBFrRodo rn of ern. Shot of veeants vbr Keon , ' RaveorBvFVTogg DVN 770 Or CotSUn.aoTvnouonefttoenrnPen, SrcScehlhoyflVTeVFesnean tHeSedrTeoNmeson SeenCons Kemet Sw Po orNE Greg Sykes. TD Var VMD. Dipl. ACVP. Dipl. | Campin. Sins Resch Cote Neva. DE Pathologist, Safety Assessment. DuPont Pharmaceuticals ' DDDiLpLl AAACGCVYVPPE = BDDiiplmmomsa. AAAmenenercaeann bCCoonoodollrVVsleotenreiamnnagryPPpoeaosoleooFagfeidsdAre dBcCte Seco ' Dil. ABT = Diplomuie. AmeBurwdiofTcoxiacolongy ' At hefirst meeting of the cae team (Marc9h, 19), Pery Habecker was elected ScientificLeader (i.e., chairman) and Greg Sykeswaselected Coordinator. The ' . M*d . _ 000770 costes res000850  Tennant Far He Hes ovesugaion Cote Team Repor . . lecahdaeirrsm,anDras.ndSacroosrhdCiansaptpoarrw(eErPeA,inRsetgruicotnedItTo)caonmdmuRanlipihpcaStteawhilt(hDtuhPeon"tsteroirnpgCocrpooramtemitiee" .' MSRpieemkceieadliHiaottriiensoenC(hGUerSmouiFpcW)aS.l)s,asoMxniaeceradkleSodp.girsTe)nh.giesr"(sEtcPrAi-nGgEcRoRm)m.itatened"RuindcyluVdaeldenDtrsi.neC(aDspuaPro,ntSa-hl ' a.12. Cattle Team Meetiings '' The cate team met formally on four occasions, including the Tennant Farm sie visit , Cattle Team Meeting '0 Fa Y nIN 099 NewBoT loComer:ReetSep -- a] 3 Rein pe meeing PARTE Son TORE To. Fann Wo 3? IanmoadndgitDirosn.. sHeavbeercakleirn.-pMeurnssoonnd,isPcoupspseinongsa.toaonkdpSlyackeesatbNeetwweeBnolMtaorncChen1t9e9r9baentdwesheen. and ? iasnsduaUnScepoofstathlissyresptoermts. fAolr pcaatitlaendtegarmoumpedmibsecrusssiuroinlsizaenddthienftoerlmeapthoinoen,sihnatenrenet email . 32. Animal Data * 32.1. Videotapes ? ? Tapnwedosthvweiadasedojtaaccpoeelnsltewclaetnirdoefnilsolufvpaiprldeaie.eodtAatpkopeiethshoeumcgaahdtet,eheatnteadapmenasbrywraettrheeed,esdtbieyvtcerMdirn.agncEdaormilmnicTtletunednee.amnatEtoaencrhhiosffftehanen ? Tdiefnfneraenntt sFeaasromnsV.aiidteaoptpaepaersed tht these tapes were al produced between 1995 and 1997 :. #1] Terman Fr: New Enon WosdCoury WA Toray TTS,TmFromC ] :* FED Ro19r07sFa PC WooCdoOF Nor Forkof Lee rch ew Engin =] Binodtihviodufatlhleys.e Tahpeeys wweerree valiseowerde.viienwtehdearteantciarttye,tbeyamthmeeceattinegtoenamJumleym2b8e%r(sDr. Davis. . h{Hserieaecllkalttechmreondnwaottts)apwwdreeeerrsreeeinvtnee)ovd.atlefudAraotbmetudot.tahlneoosetfeme6tvsa0apleausoan.ntiemhdTa.ehlisacTpaatesabsblsle,ehar1dtaoincswgsienrncgoeotmfnproiotlmaatnaiiodmneaalodfhrcerelaaytfreieslehevtw0ptgarsouunppasalof include many assertions aug ; a I 000a77.1 Estes RG5000891 : pprimonss. meeryear cop shh berm members comet ; ' T3u2o2.pJ aDtioaglnostic Pathology Reports : Tr erlygbuesvt,s ' ;) roS aeovfriea w? o beydth(ea 4ca3t7t)lpeotneoamn.ip0e, n99i0sTo lspCprosctoemsrmeseee cS : :; ay 281590, oulmt ove cosy rer 1 es from ra t CL L e n E SrArr r wi :r cows. Mr. Tennant was sel {thecalethat e ; = :} Foitiopdaoli ogyrnd amEastca Stogeeattogy+ Cr DasHele) for : I ; I Gein Une July 5. 1999, Laboratoryof Large Animal Pathology a -- Texicology. New Bolion Ev, eon ves : si2, . Apripe! : nected :} ET er es investiga. Before proceedfiofnhge site ip het tal, at the Parkersburg Holiday Inn during whi ah ry Tail : Tecate cama psd ie a -- April 7.1999 : A ant on the afternoon of Wednesday April 7%. However. : . > * 000772 ----= ---------- --_---- : = Tornam Fam Herd Heab esi ' ; da etaindersan . i foe ols cattle pA : % Eun :ions | | ' . bd5 rea3nssdtahlilTreowdnn enleieispecinmen nceotllhlheeeB.loepafao urmEgi isitznhiaeunmEremo --et--:oa:--7.%i,SE lyE.hip Alg ee vol o-- ini i i= : i a a 5 i e : 0 Hm e := ; ' rother were :me4S1 adi vey 5 ling = n-- ot reondna smovaimo nc= gue win2a - Sey anda agent ? : ' Jhoaltuern, ia nulotcarsd nipuncty and estis faci avr Zon wleoreodrecwtaiassl.,lygHr: eadclitinegd by eral - jugula r i : nde oonFE Ei = 3 tus oe naesach3adult:. a,0p a . pe cow tiico.n,bblehe3i0p%rcocegonnas.nmcbybefa;oitysh.t- Ao,lpheaolo)pas d a iiend (Apa a pend Ce . ' p= aBlupcahti = e39%ocouw~ 42% dr sci23 = eae so individ 2 : O2 r 42)o.t 22 sis o - ; - Bb . cyst, wi ow (aims -- - --. . . = nly | cc as incised pls i 5 omen tr 5 she- peofaeoni 15 Sa prisintlco pr oe se d fciomC mnt (Ape per yin es $secin fo 2 o- r . A-du=l CotteProcedurensn eam bybi ite mer ied, SHoonins :- F = "b-- ody corDeSxaminat S- -- E E= B ESo -- -- . --: ] : rT ,; . rectal pi = a : H" e oe ie group Thema Teanant mica or ar futur :noe :. a y5were oe sufficiently i 0 aind very ne: wig dara :~ Alt , the te ge that rir . - uliy Ni jjusut- isftyfy seuutehoarnaasi and y at the wd i = | 000 773 po Sros mn 00893 \ Tennant ar, Herd Hest Ivsigion . Cate Team Repon '' sbAcylrloDlaro.ng"iyHm.aableRcbakineodlroo.gmilcByallososeadlmespctalemedpslf(eebsclaowloesdraeamnpslduebfsjeecwceetser)dewtseourbhejeetmcaatkteeodnlo6bgaycf,ekscatelorfNulmeotwacthBieoomnlitsotnryC,eanntder N. Hematol . hmaenmstonegcsoahp:asccomnicevnroainon imeeeadnncelcolrdopirsccpnusosnhemweoegimloib RTT ,' TT ies eparomE enes wise Ruled SEE FEE Genwah---- * . ? ee Serum Chemistry amino nse eto ' blood ts mecges corenatinrinee bu agen rphoosphorus - ..' CaHeiObeR -- E-- oYm BY RE To mn e pepsinoser nen w; i ++ roc a messed rom load pasa et om EDTAAbe fonder op . SeSrooSlroogey bone iFsEdeTsEeEe n Tr p AScopsreceFteumonragpbrasatien lercosioounrsdopebreo1c5n]oieee| ..' TErT ecblhuientonagu5e"7virus ru_imagidynT ET Fbprucelloseiser_(snT ) ooT . April 8,1999 ,'' E(`TaAhrprlpeeTenemdneinmxanbB:e)rasndofretcheorcdaetdtlehitseraemc(oDlresc.iMoonoisfatnh,eMu1n99s5o-n1,99a9ndheDradvihsa-Hletllehri)stomreyt with Mr. I-N bDDruesrt.iwneCgeanstphtaohrseeaT1nedn0nHatnortimpseb. itgnhaevaetnedaalltmhoemfteDhmrebyecRrausrlneweltarneedafimalbllm,eenm1c0bslecoredsitnahgderaisdvormiinnvegecttwoiuinrgtophfotthrheephsraovppeuryty . * 000774 0 -- ---- -- EID151691 Res000894 , Tennant Far Hrd Heath vestigation Cate Team Repon ,) , badejiancgeunttilcirzeeedkas. tnheeigthibmoerionfgthceatslietgvaizting, and wildlife. The landfill was open and )) , h`iaWnhcyillbueadlioennsg swtiheteer,efltcohroeal.clafcatiueenda.t(e3aansmdammmpaladenes-/gmbeaanldeeer)alsftrrooubcmsteubrraevlsae.tsioCinosrtheresgbaaamrpdmilneygasrtdo.hfteheMrnre.veiTrleoannrmngeeannrtto,ugnadve the team some receipts (dates ranged from 2198 to 12/98) from comple. mixed feed. and ,'' `mineral supplement he had purchased. Al plant biological samples bailed hay core samples and grain sample) were subjected )) p1D0reopnguartraimmteon(ntCalNoCfaPnAaSglryivsciu3sl.1tb)uyrfetrh(oeTmFaoCbrloaergn7ee.lTeTUshnteiivsneegrsLdiaattbyaortwaeteroverayulsoueftdethietnhNaeondrEitxehcseCilanrsotpolrrieonaacdoshweemtodels }ro. under two feeding situations (Appendix F, models 1.4) , The following nutritional parameters were evaluated: 2 Hay and Grain Analysis ' . "crude protein ' [unavailable protein 7S| [sl T phee ' [pouwssum [odmsedc[n copd pee r proein ET )'' Fo [ouNlE (dlaectsatiibonl).envogen hopes 1 manganese SFweear ', sodum_ ,, 324 Miscellancous Data ,' , wODriu.srhiSenadgrat1hheCcoaslisltpeeacvtriswiifhtatihtneerAveperrwile.draetMaarmniyTgefhnutntuabrneetrsewilgaensvsoaanfstkdoeidsheteaoisrnesootpisrfcoysblsDrem.mesnLtiisnoahfDitahvheiesrhd-e.HaelltThlhesernsoeresam ! ofthe Tennant herd ), BH"eecltlloweue.deynSeuyAebp"rs.ielqMu8re.natnTdeonDnenaocntetimfbbyrieonrugg2Dh3rt,. t1Ch9ae9sc9pa,afrMrot.ofTDare.nnneDaawvnbitsocmoHncesallulflewtrhesidcwlhiicnwecasw(iAbtpohrrinDr.3w1i.Dha1v9oi9s9.) ', \ ODmran.ndMDiaabvlyies.2-6H,el1l9e9r9,exDra.miDnaevdst-hHeeclallfeaenxdammiandeed acdoiawgn#o3s0isfo. Mrl.aTmepnnuandnetrltefht wriitghhtthe calf. \ , V ' )" '. _-- 000775 Eisen Ras000895 -- EE Tens Fam Hed sth nsession Cote Team Repon 325. Wildite 1sE0mPatlAhleamcnadatDmeuaPtosanmtinbeyathcthhgesrpsaoiznciesnrogirnefgidecleodnsmvmoiifrtoMcnrem..enTteTahnleasndtuatdtsiaecisanttclhel.audieTndhcnelusdetehdreestpehoerretrpsaowrptepsri,ensgssuo1pfplicd relates 0 small mammal pathology, were evaluated by the cal team Smal Mammal Studies aWonveynber. 1557|OryTVKoiogrmnCar.eatUSWEaPshAnEgmiovnonWmoenniksCoRevspoWnoer|| TNHeiisse3ipannBeVaronoipdeyenfor he 1D5e9cedorveer3r. SllCWalMsihaicnrgatoln, rWaYpUeRESfGnDryWRooanbanindd| i [TMlaermaDlosiSveoespvmonSr . DTDrhN.eRCc)rauitnmethatenedaDmrayswsaoRcsuinaatlaessrooemafathdhoeewaeWveeswrtonVofairprgeeirrpnioiroatedsDicewpedraeeremaearnieltparoobfdlueNcattiuornalsuRrevseoyusrceoensd(ucWtYed by . 4.0 RESULTS : aL Cae 411 Videotapes (Table 1) .: : c`waTiswelso)d.veidselsooctenangpewesiswtoehfrtesheepvrceerasarelnlhteotdue.rasmd'edspuirdcaittaiignongnonswiuesmrieecroromeumvseienlwtee.sdi.oansr.eFoprrTtehyseecniaintcddeiivsnicTedanubeslsecaen|nde1sm20t(h1e6. ordecin which hey were presented in the videotapes. The herd health problems ' identified in these videos were summarized as follows: : "o1.PbisKneekrrevayeiedt"i.isn:amnaCionnrfyneeccatailloul.sekeTerhr.eastsoeccawrosenajrnuendacltolipcavoctnistsiicedaseu,rsaeesddw0beylbbeaacsmtbaelnreifpaehsasurtconhsoapnsassMmo,ofrweerlel ,. . tibonavctiksh.eosfeTeGfhafeetceft.aicveeAflffyflye(ccMtouensdtcryoaloauwunetgruemamncadolniassdiu)slttpernctoabwtlieetmhweohrbeesedoribvasegednroivsneidsthoefsseehavvveiedree2o-s"3pa1i0nnk2eh3y.ee5"0 y) psoecrcormbeotliecomnsf.oanceFafcilagiuelsrfefsaene1ddiahnnegdra2dtaatmrh.ee prmreeisdnpiteascltfircvaeolnmyt.hvuisdBoeooftthacpoaefch#t2he,eysieellaaunnsditrmoaatnlisntghwetehrleeacfbraicimenafdllyfrom )) GchormoenailculKecrearotonctohnjeulnecfitveiyse.oFaigcfualrfe,3f(avicdeeostaapree#s2e)endebmyontshierlaotweesranyeealrdly central V ' ' - 000776 2 Entstess Ras000896 enna Farm Herd Hest Investigation Cate Team Report 2pm.raoybHlaaeilmrs.olohsTsa,hveeneabcleokepnaencddiuacotbailtsoeTlrihvceee,docroernmvaitychaelhtaaavilelopobefeceisnaowrmeaelsactmaeodtsetto(cef.oegns.sciuseltoesmnsytcoowfti"otsnhwiacitciyhc."e) 3a.ndPosourmmseherddsienggmoenfthsaiorftcohaetsv:ideTohtiaspcelsi,niicaclosnisgins,temnotswtiptrhommuilnteinplteinnutthreitiloantalspring dwveiifnditeceoirteancpcoeiaet#s2atshawtelwlaas dfeessccruiebemdycboytoMxri.coTseins.nanFti3gsuhra4evidnegmodnesliaryaetdesshaecdodiwngfrofotmhe 4o.ftHedaneiaprsisogcmiaetnedttwiitoh na:nurTihteiodniaslcodleofriactiieonncoy.f atnhedciastelsepehcaiiarllcyoactos msm2onchianncgaesemsosotf copper deficiency. 5f.esCcoureomnyictost:oxAicloospiesc.iameacnhdaenricyatlhetmraauamba,ovoerth3e aconroonn-asrpyecbiafincddmeramyatibteiss.eenFiwgiutrhes 5 and 6 ( by Mr. videotape #2) are Tennant in many representative of the of his cattle. Figures erythematous foot l 7 and 8 (videotape esions observed #2))demonstrat e ttFhheiesscccauotentdlmeiy'tcsiooptnroexfiecroesnicse (f"orfesstcaunedifnogoti"n) twhaeswcaotnesriwdehreend tthheesemolsetsiolinkselwyerdeiapgrensoesntof af6.ebsdcou"meHiunenancldhoeopdrhyufpto"oet otporaxiipnca,iintfbyuultcohmsaptsalnebcxee.:en Tshpiesciisfiacacllliynidceaslcrsiibgendoaf5ean maasnsiofceisattaetdiwoinothfthe c7.aseTshipnrebsoednstecdonmdoisttiolni:kePloyorrebporedsyemceodnddiitfifoenrenis: ernoolno-gsipeesc.ifiTchefienmdaincgiaatneddtdheead dicaairfthweitaoh rsermoausstiactartoipohnyparopbpleeamrss.toChoanvseidsetrairnvgedthwehiolteheorthfeirnsdiangpepneat0rhishahveerdh(acd3. fliekeedlyancaolnystirsi)b.utniuntgriftaicotnoarltionpsuofofricbioednycyc(opnrdoitteiionn-cncrgy malnutrition) was also a dSpirofomibceaubllftiyn1dw0iesnregees brdueeatslcwrFoioubelrddeixbneamtchpoelnsese,iadtpehreeesddewsaecnrreiidnbicefidfdie"cnlutulatmlpfsi"nedviiannlgauaictnoeawbnyyudcvdaiesder.eo(caAalsfteeh#wou5gc1h)attwheaeyy : wbeereen rdeelsactreidbteod laasme"nhesusn,chheadr-dwuapor'e"rd"ihsuemapseed(-iurapu"ma(tciacserset#ic1u,l5o,pe1r7i)ca-rdtihtess)e, mfeasycuheave i mawynacdsoutnrooixtniaccltoeiasnrig.s(,Acnoaorsetoht#ehre1r3i)cnodmniadviiytdiuaoalnls.ochoAawnve(icnhadasiedv#ihdau4ra5dl)wcwaohrweicdthihsawteaawssea,spaasnllttoihbnobguegrwhianstgh,celodonisasignengnocstuidsw,ith i wfeasscuceermtayienolytoniocno-ssipesci(fiicc. "summer fescue" hyperthermia), athough this presentation SL . 000777 1 i eve ||} RGS000897 Tennant Farm Herd Health Investigation Cate Team Repore 4.1.2. Diagnostic Pathology Reports (Appendix B) oOfnlsyomfeoutryopfe. MrT.heTemaonsatnts'isgnciaftitclaenwtefriendsiunbgmwitatsedmofdoerrpaotset-tomomratrekmeddicagonpopsetricdeefviacliueantciyonin swtthaaesrvtfahotrreieomnacl(oliwcy.sneancneraoglpasytizieevdde.efnoTrerhhgeiyasvbya6l&m-aemntocnatlehs.oorldpKrebrouatltleiitcnia-scfwnaeaprspgayorbmesaneltrnluvyterddiiteiindotnfh)reocomonmwlpiylniatcneairtmeadl btyhat aurnetrperaetseedntinetdesbteilnoawl:coccidiosis. These reports are included in Appendix B; summaries rLa.eapboorrtatdoaDrreyea,ddO36h--i1m0o-o9Dn7etph(aAorpltpdmeebnundltlixocfalBAfg)sruibcmuilttutreed, tRoeythneolAdnsibmuarlg.DOisHcaosne 2D/i2a7g/n9o7s:tiLcaboratory History: Gross diagnosis: Histopathologic diagnosis: 6-momnontthho;ldrebcuelilvceadlfn,oumneddeircwaetiigohnt:; cdoiamrerahleaopfaocriotinees: died. IEnmtaecstiiantailopnarwaistihtissemro(ursicahturroipahsiyso)f fat Enteric coccidiosis Keratitis, moderate,chronic. focallyextensive Db.iagnostTiicssLuaebsorfartoormy.a dC-oylelaregoeldofHoVlestteeriinnacroywMesduibcmiintet,edMtiochtihegaAnniStmaatle HUeniavletrhsity, Lansing MI on 3/4/97 Laboratory report dated 3-12-97 (Appendix B) History 4-yeoawrnoelrd,Htoilsssuteesinsucbomwi;ttdeidedby2-E18P.A97; dissected by Heavy metal screen: Coprpeefrerdeenfciecireanncgye)inlainvdekri(d1n.e9yp(p2m.37vs.pp2m5-v155,04 - 6. Mangpapnmesreefewraesncmearragnignea)l.ly low in liver, cadmium No wheaasvyslimgehttallysifncoruenadseidn in the urine kidney. (urine fluoride was 6.6 ug/mi)[reference range: toxic if = 14 pg/mL] DiagnostTiicssLuaebsorfartoomrya.9C-oylealregoeldofHoVlestteeriinnacroywMesduibcmiintet.edMtiochthiegaAnniSmtaatle HUenailvetrhsity, Lansing MI on 3/4197; Laboratory report dated 3-12-97 (Appendix B) History: 9-ye`aorwnoelrd; Htoilsssuteesinsucbomwi;ttdeidedby3-E2.P9A7; dissected by oo 000778 ED151695 RGS000898 ' ' Tema Form Herd Health Investigation Cate Team Repon ' \) Histopathologic diagnosis. (onlayndhefarreteziev/etr,haawnadrtKiifdacnte)ys submitted: utolysis Myocardial sarcocysts ' ,) Heavy metal screen: `Coppreefrdereencfe riangcie)nilaienvdenkr(icd2n.ey0y3p(2p.m33vsp.pm25v.s.1540- 6 ' MangPaPnesreefewraesncmearrganignea)l.ly low in liver: iron was ,' eilnecvraetaeseddininthheelikviedrn;eyc.admium was slightly ) Urin5e.5h5euagv/ymim)e[traelfserwcenrceenroarngmea:l t(ouxriicneiff2luo1r4idpegw/amsL] Clinical pathology: No significant findings. . ST2cehnonoalnton)afnsiVsuesbtuemesriitfneraodrmytoaMet7dh-eiyceLiaanrbeoo,rladUtnroiervdyercosofiwtLya(roegfuePteAhnnanisnmyialzvloaennPdiaa6t,/h1oK0le/on9gn9yeatantnddSdqTiuosaxsrieecc,otlePodagbyoy.nMr. 6/27/99; Laboratory report dated 7-5-99 (Appendin B) History Histopattologic diagnosis: 7-yeoawrneorl:d riesdsuceosws;ubeumtihtaenidzebdy 6D-r1.0-D9a9v:isd-iHseslelcetred by Entearbisccelsesseiso;nsoinftemsitniniamlaclocseiidginoisfiisc;anmcyeo(cfaorrdeisatlomach sarcocysts) Heavy metal screen `Coppreefredreefnicceireanncgye),in liver (7.71 ppm vs. 25-150 4.13. April 1999 Site Visit Data a. Herd History (Appendix E) MpTtuheecrhhveiorefdwthhoiinsstAcoprayrni(lbAe8p,apte1t9nr9id9bi.uxteAEd)twowratishteebnlaasrceekodcoforondutoMrfs.ihdTeeedninhnteaearnlvtteh'ntwriaoencs.olcloTenhcstepirioencsuisoduunsroliynsegacbtoshneendto,f bEyxeetceeenrpiutnsaferodyrotcnahretehfoeerswecaoannniismmuaahllasst,inoaonntedwditthihneratehnihsaandsiobmceauelmnenunntotitusisoeeneiosDft.ivaagMcncioinsntieimscaolPrammtehododilecoargtnyiodRneeswpoohrnameve:ers. hoevred)m.annaogdeimaegnnotsthiacs lnaobtorcahtaonrgyetdesstisnwceertehedionnsetaollnatdieoandofantihmeallasn.dfiTlhle level of cole ---- ---- EE------a 000779 oo " Emistess RGS000899 I-------------- .' `Tennant Farm Herd Health Investigation Cattle Team Report 0o b. Physical Examination (Table 2) 0 Age. Pregnancy Status [4 .0 OgburnlelasAt,perraintldha7.n| a19d9u9yle9at.rsst.theeercTah(tiTtsalbeilsteeaa2)hm.eredExsaotmfiimanagetededd4c1aagtaelnsei;fmoa3rl2sto,hfeitanhdceullu3td8icncogoww3s8srawadenurgleetdcesoftwrisom,mat24eadtdou(l0t . be older that 9 years. Twenty-seven (27/38) cows were pregaan: 0 Body Condition Scores '' aBvoedryagceonsdciotrieonwassco3r.e5s((3B=tChSi)n,we4=rbeorbdaesreldnoe,n a571-9issccaolne.sidSecroerdesorpatnigmeudm)from 2 (0 7; the '. Clinica Signs '' ciHhnarciolruncsioicaotnmaacsbytnistotirsmt.haaltwietwriaeessilwnatenercreperdeevtaiendddeanestmpaitbnis9ecode.fssteMhseaom4r1maaccarctutylmeug.llaaOntndieolnuamonpifsm,afilcborhnoasudissatcneonnetnpeiwcditetirhvmeal .' f(astcanre)crtiosssiuse. Rectal examination of one cow suggested the presence of intra-abdominal :. Clinical Pathology (Tables 3-6; Graph 1) , Hematology ' Earnyitmhaelosnw(eTraeblceon3s):ideRreedd balnoeomdiccell indices were generally in the low-normal range. No cLDoielfulfkeecroteninot(niTaaalbncldeellt4es)ctoiungnT.thseetrotealcwohnistiedebrleododincvealllicdoduunets10wehree 3w6ithhoiunrtdheelnaoyrbmaeltwreannge Clinical chemistry (Table 5) wwMihotishcthmliweladcstdoeuhlnyssdetraastvoianolnau.ebslywSiewnraceremi.tnhteahncedahthilgaehd.wnneoorreamcpacelenstnsoetsdolicwguahrttileny,gecltlehievnaidtcaeayldldiregahhntygedh,roacutorinsosniosfwtAaepnsrtinlot7, 3u0n/e4x1pecctaend.e Dehydration i also the most likely explanationforth elevated creatinine in cMdaiotaslgteno((s24i7/1s4/o1)4f1od)efthhyedthgrelaotcbiauoltnien(thfoartdaacletpilroeonvtaewtiaensd =teolgtealvloabptureloditnewihfni,alcewthitiohcneh+alaalblsuobmucimonrirrnealfcarttaiceotsinohnwi)ga.hslyIwniwtailhtlihn a the reference range. 00, 0780 wo EID151697 RGS000900 -------- ' Tennant Farm Herd Helin Invesigation Cote Team Report ` )' mGcouanssmcilmsetaenngetlcluryotswaiimsty,hliiwnraastnhseaflensrooarsnmeoar(lmGarGleTf)ei,nreaanlsceeonfrsaitnthgieev.ceatCinerd.eiactaiHtnooewrekovfienaracs,teiav(seCpKalr)itv.eartaendiisnedaiscea,tworasof ' maimniinmoatlalnysieelreavsaete(dAiSnT)3.3/a41lecsasttslee.nsTihtiisv miingdihctatboer forfoimvelreuaknodeymtuesdcilsesodleugteionne,ratthieonre,suwlatsof '' the 36 hour interval between blood collection and testing. ' Special chemistry '' APrcocloacrtdiin:ng tPoltahsemtaesptrionlgacltaibnorlaetvoelrsy ((DTra.blNee4alanSdchGircakp,hUn1)ivweerrseitsyigonfiTfiecnannetslsyedee)p.reasnsed. ) maviecrraoggeeaprmosl/aicttirn(envge/lmLf)or(c..a,teefeotnefnecsecumce-farne=pa1s7t1u.r6e n(fgo/rmLA)p.rilT)hweasav1e7r1a.g6e of the 41 y' Treefnenraenntcesammepalnes(1w7a1s.61n1g0/.1mLn).g/mInLcaonntdra3s6t/,41anofavtehreaTgeenpnraonltacctaitntlleevweelrfeorbeclaotwetohne ) endophy'e-infected fescue (simulated by ergotamine trrate administration) was 105.8 '' (An1cg1c/0o.mr0Ldin(ndgga/tmtaLof)Drrao.nmdSDcr2h.4i/cS4ck1h.roihfcekst)h.eefTcihanidnsienagwvseerrwaeegrbeeewhlaiogswhsltiyhmissilraeurfetporetnphceeooTfleeenrvnneladino(tp1v0hh5ye.etr8denatgvo/xeimrcaLig)tey in 3 he Tennant herd. cCooppppoeeerr:assBaylowoadscobppepeleorw ltehveellsimwietroefidnettehcetidoenf.icient range for 26 of 41 animals: one '' Selenium: Blood selenium levels were normal for 41 of41 caitle ' aPebposmiansaugmen.: waPsepesaisnuogreend. ianbl10ocoodwesn.zyomnee sitnedeircaatnodr oonfepabralals.itAe ldavmaalugees1w0etrhee within the wnoarsmnaoltrefperroebnlceemrainngea.dulTthceasreledaitnatshiuspphoerrtded the conclusion that abomasal ostertagiasis. , Serology (Table 6) ' JBoLhYne'(sBo(vMiynceoLbeauckteermiiuamVpiarruast)uberculoss antigen) 114114 ppoossiitiivvee . BBrVucDel(lBuovine Virus Diarrhea antigen) 2o0a4t1 positive .. BBlVoDctoMnigcureoplae Assay (viremia detection) 0os1t . ELeHptDostpyiprea2in(Etpeirzoogoatnisc(H5esmuobrvrarhiaegtiicesD)isease of deer) 23014112 ppoossiittiivvee . LNeopnteosopfirtahemisegrhotloregfylevcatlrueessidsuuaglevsatcecdianathieornd-tweirdseipnrpoublrecmh.asePdosaintiimvaeltsieorrsnfaotrurBalVD and .. ethxipsodsiusreeasteo hhaessebedeinseiansetsh.e lTohelddiesecrovpeorpyuloaftiwono. postive EHD titers was evidence that . . . " * -- _ 000781 Entstess RGS000901 ' :* ~ := ans-Farm ieatanoessignion Ea : bsramepldesfeToem= ase : ms, E x eselec pi SE | ,itis ,oo a . . dDu.ng be FiGrA a-, al= ypsriifE vsodod a E : 2 Hayyand Me. Tfhay fear asia -- |. Duuringhe:in; . ! - a = G. vist = gL e -t rei age nqoual . Sims : Fn ? ident go Hh a tiei15sofha dforwas. o :awson an ne pkoe gon =::ve|lof| i |? = rodtoT] a wE tn sr} la i'=.: = d: y = aT co = ia ng .uch ed atic := Thma= e - isi,fora ber a= sictivel wer ploy naly: ar cor xle vr A be c SH : fee te coa er vo To wage :PSv ; fr tence =&i et Bre yt | plle | as 1 E ont mae ae :forange - grai : :: : miapretgn:a|atof es rity :| o= pe T = oo : oHnIRE gram hy ysis = mes of ro -lurei. ning - .sel 2 Forge in Libor grai 2 Cl Nc = 1 ire ownas (mod Balen : = . ee R E E E : -- : Ln pr 5(e: grar ntlheowioicuenlraecitrat Crel n ospetrs= oils ns vi rien gaysrg a . pa rrp -- i | pos = eh =Jarfed te ce Leo s = ce. fivBe A =i2 z- . 5 EenYt oy Ro rec | por), Te orm lables; 2J rc: ein lings) i : : : = Es cir same sine EF ould ve aDlariemay|2od% uct epsa e43)5:cailbfen,= ng ofendi :i i in The moder prognan naniyocoximizing qui > 0007:82 xosas0o5s0e2n Le -- ,` "Tennant Farm Herd Health Investigation Cattle Team Report ,'! etThlheiecdiibteotssd.ywecTrohenecdoiimtmsipoadncestrceoodfret0she(hpvBoeoCrcqShourfaoslntiih)tcey efhfoefrreadcgtseweworenelltchoainsfstfeirastrtemhnetacnwodiwtsshubrtsheeetuqerunneentrtogyaedndeeeqrfuigcayitteof ! postre. ,'' 4.2. Miscellaneous Data Following he st visit, Mr. Tennant consued with Dr. DavisHeller regarding a Suspected sick animal. Mi. Tennant brought a cafwith cloudy eye" tr. Davis: ')' hhHeeilrlceehrw'wsaascslOienUiaFcsIl(nyAgpwrwiirlpoe2nd1g,aww19ia9hy9).heDre.ye,Daevxicse-pHtelolerr3eSxiamgihntemductohiecdaelxfuadnadtedoentetrhmeicneodmethsat '' mOanndMiavyc.26,Th1e99l9e.siDorn. wDaasviasspHieraltlerd e(pxuasm)iannedd scouwbe13q0ufao laalnucmepdunder the right ' 43. Wildlife '' 431. Videotapes (Table 1 ' The 20 wildlife cases presented in the videotapes were all dead and. except for one case: ' (case #45), of no diagnostic value. These were all considered 10 be incidental deaths .' Cdseiaanrtcahess.stheesIrnewfhdaiicdct,hntowhtoesaueplpddeeabarethtosouabnpedpaen1amyreacdohne(sailbtshtyemnoecscyotsinycsotnthseeims:stpeenTctiheeis,tinlhodciaevtiidorunaa,lnoddroematidwmdiinlegdocefatshee ' #49) which presented with hemorrhage from the nostrils may have died from epizootic ''* o`ffhitenhmdioisrngrdhoiasfgeioacsmedeiiseEalHsoceDa(lEsdeHcrDo)tp.opseiTrihsvioesnadalinaclgoenmonsmintsihcweaotTuileodnna:cnotrDrrhe.esrpCdornudmwi10thDxt.heSykkneosw)naenxdisttheence ' T4S.wh3.oe2a.p.atSahmonaldloglmeiisMcteas)mecmvaiapelrwreDedadttoahne hleveTeannndanKtidporeoypheirsytoilnog1y99f7ro(mU4S3EPsmAaElnlvroidreonntmsevnoclles. o TReislpeon3s91e. TNeoamsdiroantsrcephorratc.teDnrsytiRcunofCErepeakt,OWoaNiscnigytoofn.ReWpohoIdGKCiocuinytyW,eWretsetviVdierngitnia eAltrhoauggh seeveral anomalies were identifisd, nome were considered suggestive of toxic > `1T9h9e8)19a9b8scsrmeaeldl 7mamgrmoasls stbrraoprpmianlgit(iUeRsSnGtrhecinaeprtuWroeoddwaanirmdalCsly(vdoelesst,udey,wDse.ceamnbdermi3c,e) . 433. Deer Studies o. hTheeWcesatlVieragimniwaaDsempaadremeanwtaroeffNattuherapleRreisoodusrdceeess(eWprNodDuNcRti)onntshureveryys cRoundnuactcead by . aAhloaueg.h tOeneteeaammremvieemwbeedrS(oSmyekeosf)theaddaalespheheotsnefrcoomnvtehrssaetiSoondwsi.th Dr.FeCproursmwoefrtehe . w - ~ 000783 ---- R68000503 D-- e -------- Teoman Farm Herd Hele Invesigation Catt Team Repon aWdVditDonNaRl irnefgoarrmdaitnigond.eerFrhoermdthheiaslctohnvienrtshaetiDorn.y Rituwnasartehaeicnaotrdeerte(a0ma'csquuinrdeerssotmaneding that: - evidence of low fertility overpopulation; rates in young does wasprobably atrbutable o deer + epizoosteircolhoegmiocralrlhyaginicdedaidseaansed (caEpHtDu)rehdadseebre,enredsipeacgtniovseelyd;clinically and bovinefvriormuDsrdyiaRrutnh:ea (BVD) has been diagnosed serologically in deer not far rTenpaodndiietdiobne,ttwheeetne1a9m8h0asanldea1r9n8ed9 t[hSaotuotuhetabsrteearkns CoofoEpeHrDatiinveWeWsiltdlViifregiDniisaedaeseerSwteurdey publication, Field Manualof Wildlife Diseases inthe Southeastern U.S., 2nd ed.) pSoipnucleatthieornewwaassnnoot ecvoindseindcereeodf(abneEaHcoDntorriBbuVtDinogutfbacrteoarkiinntthheecTaetnenahnetrdhehreda,ltthhe deer pforrobalneymso.f tAhlesdoi.stehaesreeenwtaistiensoiedveintdiefniceed tihnatthtehTeednenearnhterhedrdw.as a useful sentinel species 5.0 DISCUSSION e"TvhiedesnixcevetthearitnhaeriTaennsncaonmtprhiesridnwgatshesucfafrereinegafmroamgrfeouerd mthaajtotrhderiesewaasesecnotintcilesu.siveendophyte hhtoiexsritdcoirhtieyca.allptdhianptkareoysebu.lbesmtmaaslnntouitnartitethietonTh.eantanhnaednstecoffpoaurprme.rcodnedfiictiieonncsy.canThreecaldiinliycaacl,coluanbtorfaotrotrhye. cahnrdonic Endophyte toxicity According fescue hay itno tthhee hwiisnttoerry aancdqupiarsetduroen tAhaptrialpp8.ro1a9c9h9e.sth1e0h0e%rdKYha3s1befeenscufeeddaudriientg otfheKY31 "sTuhmemcelri.nicaTlhesriegnhsaisnbteheenTennonsaunptplheemrdentthaalt hpaisgthulryesourggoetshterenfdoroapgheytfeedtooxitchietsye(faensicmaules. mycotoxicosis include + sthweelclrienegkadnudripnaginhoatt wtheeatchoerro(nFairgyurbeasnd5-(8c)o;ronitis) and above, with cate tht stand in +popaotrchsyhteadildianlgopoefciwainwtietrhclooastsso(fFtiagiulrsewi4t);ch; ++ bpiorotrhocfonucnedpetrisoinzeadndcaclavlevsi;ng rates: + numerous vague diseases suggestiveof immune dysfunction: co ; 000784 common RG5000904 -- EE ------ . Tennant Fem Herd Health Iovesigation Cale Team Report .. Other clinical signs that are consistent with endophyte toxicity include: ' . + + cfaotncneocmriotsains.t pprreessuemnpcteoivfec,oapdpieargdneofsiceidenbcyy;rectal palpation in cow #15; '' ++ gpeannetrianlg fianilcuorwe o#f45t,hescuagtgtelsettiovetohrfivheyperthermia; `. WeVnhasdiooccphohnpysrttoerdiufccutenisgounpsei ralssoseloiecnniea,atspeedarlwroeilstiuhdltiofneefs,ciuNne-gaemcsyetctioyo!tnoloxofilcianoesn,iuasmnbidseArNoc-rffeeomrrgomonyti.uliomkliecnoeale(knaSoltopuihedsdi.eamlaTmnhne. 0` ' eathcteqaulai,lrki1an9lg8o5it)dh.semhTaihgyehsebesetafclokoaunlcnoedinditsnraastctiocorunemsdualhtaaytt.eheignrtehaetefsetsmcauteugrriatsysosfetehd dgurrasisn.g gArdodwitthi,onally, ' ' ' gpTerhnoeedrucaoclreloydnsibtiyasretpnwrdiootbphlheyremtdeoubtcosexedircvwieetiydgihinntttghhaeei"nv,fiedosercout[eoaspfseosooft("Fwiesgiyugnrhdetrs,om5reoa.ungdhS6ih)ganiwrsacsoofattfy,episaccrauclehoeffodotbthaactk, '' taahln.edd1se9o8wr4ee)ln.aewsisAsriacnnhodinnhegoooofrvebtoshethabnradecaikrs gwlieamnsbesr.raelplHoyrytpaeecdrcbeoymmpitaahoneifoetwdhnebeyrcosiroomtnheaersyvwiebdlaelnoidtnagopce(csHuear5mskbeent,weeren ) "hunched" and "humped posture in some cattle )) ) (dPiOessrsbiiopprhanetere.alheevtaatasl.doucro1in9ns9gi2)sh.ioctiTowhneeaftphraeonrmt.itnhTgehsaiesndvpadhsreoonaocoltmiineegnobanlykaailrokeidndsocwroenwsual(sts4"3is)nudminemcevriredaelsoeatdampaebpi#li2tywa0s \ suggestiovfe the summer slomp syndrome. ' i. thhaes vabalissrootchbooenfseunurniddcoteciruosmniezcneadtuescdeald(vBbeosyltt,todhecatemarlsg..oti1ln9i8gk6e)es.tailnTkgahliaosiddimse.atyhVibageshobicynoneasntmdroeipcchhtyiatoneni-iosnfmfteshsietmeiudltaerfreitnsoecue Pbbuelpeosnoddfvoreocsmusmefelesnmtamelaedysirnfeemsduiltctheeintmhdaatetecrwrieearalesededuxrcpiionrsgceugldeastttiotaothnieotnoentwhdeeorpgehrayotwleiigndhgtuerfrietnbugisr.gtehTstwhaeetiiegofhnft.e,cwtMeorhuaesse delayed 1991). in post-partum developmenatn.d grew slower than control mice (Vamey. et al. woEifvttihhdeesniacmlielatsrhwalitytecanhffdeioscptlheaydrtgceealttyeoxa.inceicTtdhyoetianmlo.fseftsrcousemevgevreratezeifrniognramcrsayttoplfreaecmntdaiotyipohbnyeetrrese-stihpnaotdnushciaebvdlee efxopretrhieenlocses Hvaesmokceonn.streitaclt..ion1r9e8s3u)lti dry gangreneof the tail and digits (Radostits, et al. 1994; Reaipln.rcro1ed9mu9e5cn)tt.ialvIlenyeftdfheeepcrTtesesnsnfeardnotcmohtnehcreedp,itntighoeenstgriraoatnzeosifnigneoncfdaotpplahesytgturera-ezisinwnfigetsihtnefd1e0cft0ee%sdcuKpeaYs3itnu]crlefue(dsPecatueercsoonu,ldet potentially play 2 major ole in the unacceptable conception rate. A poor conception rate 2 oo _ 000785 E1870 RGS000905 \ ) " ' Tenameans ss Cawe Tesmeport s Es * i . cou . dingoc oc c uarrsy &ou e lrndatTshaitnrs nua eerdeasgseedofonsspea meLEded ep a calpucaitna ns . Iinnteerrva:l p EAPd suboya '' ni ' hee od pooos rgcaotwithootfttehhrdeeuusrisng oorcalf growth cas by SHm EA h bea liae idwSephH)eoi, Toadvvancedaze r syetion r a e pi 2 fpoideptoro Ouuf tTe:estF al i 1i995iTt)heerhspacraatffcstsiionondudeup e0hyriiodnelgse: Snsse(enridel diss ~ Sautdostadl . a lopami a pO eaase he oenndl" oyp9l)on.i s app oleproducctioin n ihe boivin` ' ' EnSdoprhy loxreictunnrouesteealsocongsiisdeRrisaod0iuaotilayfferisisneemuursnnoossuupppre effecAt y a >? phsfron piarpern perutped Sofispm-eounnyegis@foropanieedseunrnp,etsvheoeyretmmogepioerstfoncpiisehcesdsedcnieetsdii aurnse fi Prnaroeci,re (RSice. ) . fenadiookispha y e > 1t.aW 1i9n%e)eSittis deyr t gEomtron gpeenedantlshhseeihegoshn.Heifvgehsted PRvA on reDceeeibn jalresulin e ft '' ido fnearodepiaseiiaTona e I h t a bylevtaehlgeEintfa or *pa hon,iaA,Senrpvr c zet,ometal, . ' ? . Fanseeenonnndtesoanndi g otTfs mes)a ozinng heie oodeYwfsihtJhhigguahe15nboar Meeilesvels boSsyeh e mtihnesapbr odfaoi mineBwssstpisiur;ssggienstdwaerrrE eeken)SS aSAeeeddchaone Tiio joa coaieal ~ ' m Siiioppg nhn ,etteu eisroosltB fiSiSntsutuhsa gesaunmNiienrneeoredi eoofCdo1eeesarghhoncR eeov,enris,teeih onntanBe doeind mfm,ffcurSi aeisgs,dis Soeg pnkesvee 3d rene h hs ' ySFaoeceulnla iusip Bsuess s Leodee spnrodb e" lo a sCyhaeb ,vidteostaaa pmenieime oe osrlbl36e.ra1ee9nn%oofhneure n nr enan ouig Af he 1 .)' 5J ipoiin" a ctree annrna mablolwiso.,pritntghhee.TentaflooatgicySesFsoooffs|ttbpeoeMridnie!poliunntaaea .Apiroil 3 : = ' 0 00786 Cw151703 EH00506 -- \ -- = iesva ;:.. I Team a Fr--ct vei eport per asis . dot the s $90 2ssuer oS - afot = i" ; ptible coy i: ee So= f ink oe; pier = i avfifdeecotsfacefell;y infestatioS ns a se ie hi i oe g 4 SS a ution bedueaopesy hbamartes pion i sm Fr = Ma i 3 ai of pr lity wingee-yneer is fic- tpreoe ntTernenyA:aiddee4dTsaalnei ner . i> n= - _e- rdoen: i= ed a % ipeEDiE maryrreq:uiwreedia ng n19n 9 tpemlpiererde. swpece_ t nc|adllyh : pot SR . n a envi the -onditic = fie - 2 oi he 1 ne ridin = = = the , = , 5 = Moki oifio rie Hn feed rit n. gre srteressdorosrtingEE ical ass pr impressthe main L of Se w= fey : - nnant - oratori = 8yeesnkaPtfaast = 53 c:ei : orr easoww 2 on nostiE(eoaroiol sroiin his an. -= : Sm Ra - i 2 : = iee ' Toxicol Vn thoe ld pp InrgenDieagnn J of hee farm = :R: J A FHaOrber i vesohit wd Sah re conppte iTeemny ay- o-s-- = amenng = :, = "om oonte a h fs 00esvh emagus fect ical -= = i= rhe)= awndophys - cal .. Desh |ee peas 0. oyo e wahe i= hfeoaogui:lity-4 resi sec ow . inexvens c)e deer re dies. ecofr He faer oats, i 5 ow & presse LA ytoki . i ) 00078 ex one ID151704 ' 00507 ------ : i T= oonsot Frm er ct sng ' mReport : :TRn e ures elaedo . | i. ta ind ind sion ness aster we ; ar ). abe) rn ; atitoen chyibs oe) ae,ie fe pra ese I no= f ; . 199% o:e | : ash dehrsed bewgeaezn.hi Tosi gh pe9c9t9)e,d A eS seAn aL A radyisI cp-- Sto i - *. -= ' Bx =zosplogyithi seteu Re aih syn eunn Cmi n te Bohn| nhyoul nd ' a i 3 us = =Jude3 Joa Roan sityyaeda eas art o egnuivaeepdee rnns= ,oefw bowpeoe hm wiosk dmu od o|m : ; - E Z(w: se ton : Cesi S WtfHa: rmh sti= c e 5wndi:dojamaooendE i i sample C= ome {wo a c tateSereE r r rorpectsh:e on = urn fromnts he c Spy Bd Theo- 8Yespprmalreidpe ot.me: -oncer u ona As, mm t ; = =: -- 5 S : = : : or:a | bs)orn .=or gr=e:caen.rl2p(aexprla Sesseeo r"iste eHwoinAhBaeGe lsow:evs neri faultri =n- ant i some Ex Bugera = or cwlirniecaaltevacidhe ; CE - oo : E : : - pie a . (: dSoMshroifloutoyretym eionh:igoia c bnen rfomaentsh:: orhis0 ; ve per ro: fl le eff ch: r . ceve r- s. 0s - :: :: : : EZ HeEe2fl%= ee oS r= E. eh a to not fandhinpceareltuoctoiivee,arCerhe:or ie | ThehJe moRstE(COMMME! NDA' vet ratory.f~iovomessc- a- erJsio= n- romee| aTe- m h pied Ss _ erdvi img eette 'iti" onal rv a n alth - ` ot enon . avtaoiandengage veer Fi .. 0007!88 e'proe 00508 Tennant Fam Herd Weal Inesigarion Corte Team Report Endddiuerotipnbhgyuatmliel xtsioenxaigscoitnhtsey,:htahWyiiatmnhmdedpdiaiestatatureryegfowoairltahgweeoituthhlaedtrcbonenotnfao-ricnntshdeonpedahiryllutyteio1in0nfo0ef%shtKeedYef3en1sdcofupeehsyocurteea,nifonetdthheer diinfffeesrteendthfaoyraagnedspoaurscteu.re Ato sShOor%t-otrerlemssgooafltwheoudliedt,bepr(i0marreidluycebythseupcopnlteemnetntoifnegndtohephdyitte wpaistthurheigahnedr qhuaayliftiyelfdosrawgiet.h Annona-cecnedpotpahbylteel-oinngf-etsetremdpfloarnagweocurlodpboer tcororpesploavceerthteimfee,scue ' , asghaoiunldwibtehatthteemgpotaelod fudnidleurt management. ithneg sthuepdeirevtiasiroynoenfdosppehcyitaeli sctosn sinumfpotriaogne. anCdrgorpasmianngagement .' . abPotivntikesem,ypetf:erdomPbryceavarernnitearipopcnraootafecph(i0tnhkseauysleciem(pikitebsrlatethoeccaosntpjeru.enacdtEiofvffiettcithsi)vieinnffetlcyhteciooinumtsmroeoldr,giaatnthiersomfuu,gthuMroterheasshueosluellodafbe . eifnfseeccttiivceicdoen-tirmoplremgentatheoddctahrattasghsoourldsobmeeproatchteircpedrodvuerninmgetthheodw.arismpemrohnatphss.theThmeost insccticide-laden cartags should berotated every year in oder to circumvent the A dloenvge-ltoeprmmeanptporfoaicnshectthiatcimdeayresbiesetamnpcleobyyedthiesltohcealbraeceedfilnygpfooprulcaattiloen.thaAt nhaavdedidtairoknaflaces. # , tBVhiygehtsceaolftecetthimenagsyufnoprrisdeavmreiknn-tifmoaivczeeerddt.claettsHlioeo,wnestvhoeefrck.oerrwnahetiaollceodnmajimunnaicgmteiizvtiihtnastg,itsthheceadulaossmesdaogbfeyctotohnedtihuetlitcoronarvnfieroolames.tof ! rseegvaerrdelelsys ionffetshtattyiopnesofwcilaneox binetahvohiedredd, biynsseecltieccitdiengflfyorrefpaceelloalnotrshionucladteb.e uTshedusevery year. Mspaelcniuatlriisttioinn:beeaftciaontseannudtpreist.ureInnutthietiToenqnsahnotulhderbde, phlearnenewdaswietvhidtheencaessoifstraoncsesof a. Ppcrhooomtsempihonon-reuntsoc,rmgaaynndmyamlbanugetnereihsteiiroudnms.;aansnudtwresitlhioouans.ldcoTanrlcsaoecrebnemsiaandbedorrueastlsamedan.cdrvoIimntiatnhmeeirndaedlve(fecilacolipceimnucemin,ets oafre3 maitnieornalfoarntdhismahcerrod.mipnaerrtiacluldaerfiactiteennctiieosn. should be paid by the nutritionist 1 the loca! trace. Comipspseirngde{friocmietnhceyd:ietCoopfpcearttlies aintrmaacneymianreeraaslotfhtatheiNocrrutchiaAlmetoritchae.heAalsthcoopfpceartdeefyiectieisncy : onwuatfasrithsiiuogsnhpisectco.tpespdheocrulilrndaiccbaeelalmyipnarenirodarilctoysnuyfpeiparlrmeeomduennbtdi,.ocahgTeahmiiinscuailsnldeysepienctihtaelhlesyuTpeeernrtnvaiesnaitlonhceorodn,fsaitdhheeerpeirncogavtithlseeion prevalenceof endophyte. infested fescue on the Tennant farm . 2s . 000789 _ Eo1s1708 RGS000505 E -- - ) Tennant Farm Herd Heath Investigation Cote Tear Repon ' 7.0 CONCLUSION ' "sTuhlefreeriwnagsfrcoonmclfouusrivmeajevoirddeinsceeastehaenttihteieTse,nsnoamnet cofatwheihcehrdwewraes,poatnedntciaolnltyiniunteesrrteolabte.ed: ' eAnsdosupbhsyttaenttioaxtiecditbyy(tfheescculeinmicyaclotaonxdicloasbiosr)a.topriynkfeiynedi,nmgsa,lnaunldrihiiostno,riacnadl dcaotpap,etrhdeesfeicfioeunrcy. conditions readily account for the chronic herd health problems on the Tennant farm ' "nTuhterihtieornd, hienaaldtehquiantveesvteitgeatriionnarryevcaerael,edanddefliaccikeoncfiefslyincohnterrodl.maTnhaegeamceknto,f ivnacclcuidniantgiopnooarnd intemal parasite control programs did not appear to have a substantial impact on this ' relatively isolated herd eDveisdpeintecaenofteoxxhiacusittiyvaessroecviiaetwedofwihtihstcorhiecmailcaanldccoonnttaemimnpaotriaornyohfterhdedaetnav,irtohnemreenwta.s no ' 80 REFERENCES ? EndophyteToxicityReferences 1. oBnocltalDfJb.irBthowneidJg:htE.ffmeictlsk iynielpdr.eagnnadnctablefefgrhoewitfhe.rs} AgnraizminSgcif6u3n(gsuus-pipnlf)ec2t9e7d.ta1l9l86f,escue , 2. DNeeaonripshoSBd.iuAnllecnoeVnaGp.hiSaaikuenr_oKnE.. cFoopnpteernotconJPc,enAtryaatdioJnYiMn,tBalrlofwenscuCeP.: JInfAlnuienmceScoif 76:2687-2693. 1998 x 3. Hemken RW. Jackson JA. Boling JA: Toxic factionrtasll fescue. J AnimSci 58:1011-1016. 1984. : ' 4. cHounrcleenytrWatLi.onCsonasveayffeEcMt.edLbeyuntagllKf,esHceumekseunmmRWe:r tBooxvicionseispraonladcttien.mpeTrSatHu,reT.4JanAdniTm3 Sci $1:374:379. 1980, . ' pOuhsnybgsousir-oniegnifTecOcat,leSdcvaharnmdsildefsuSnPog.fuscM-aafrtrepeelienfeDesNcnu,ierRaonandmeeenrCagHlo.tlaySmictnoenertaoerltJretadtecoEofnfnesdcetloemocftsecdoJnAsunminSgci [3 70:2501-2509. 1992 ., 6. toPxaitcerossoins oJ.nbFeoerfccheartioepCr,oduLcatrisvointy.B.JSAanmifmoSrcdiM7,3:8Ke8r9l-e8y98,M:199T5h,e effects of fescue . 7. cRyaadnoosbiaicttserOiMa,, cBllavoiobdacDteCr.iaGainysecCtCs,: aDnidseaasneismalcsa.usedIn:byVettoexrinisnariyn pMleadntisc.inef:ungiA, . : % . a SE 000750 _ewsmor RGS000910 r ' r -- * . tOeMx,tbBolookodofDCth.e dGiasyeaCsCes. cofarcast.tle,Bshheesp, piidgsa.ng,oaPtsr,laenddlhoomrse1s3,3581"6ed0.,1 Radostits :', 8. eERvincadeluoRapLi.honByltoodfegehetsutemDuJos,.rSVceihtmurmIiumgnmGeuGn,reiSsnpwoemncsnkeeosrpiWnaShc,oF$l5oen5t5ge.nr3oit9n5JsP,,a1A9lm0le)bnoVpGt, mAkeermseRM: . Monocyte immune cll sponse and sopper ssn x Bat Ser om rains 1] 9. Saker KE. Allen VG. Kalnitsky J. Thatcher CD, Swecker. Jr. WS, Fontenot, JP: endophyte-infected tall fescue. J Anim Sci 76:2694-2700, 1998. - .' 10. cbScnohvduiolnptehzeysceAirEnu,fmecRtboechdrcbahaelcmhfissBnWy.,pvFerrtiobHosourmgaansHAeT,coaWeuadslle+wri1tJ1hC3,p5rOoolliyovnegr3eJdW:soAnltmemraitieonns oinn 93 11. Stueeddeemmanannn J.1A. Rumsey TS, Bond J Wilkinson SR, Bush LP, Willams DJ, Cale AfeBs:cuAesssoucmimateiroonxoifcbolnosodicheoleessterAolmwitVheocRceusrrsenocoe oofofatenecroosuiss in cows and tall : ? : 12. Vamey DR, Vamey Sg * on LA. Zavos PM. Wiglesworth MD, Siegel congenital development and pup growth in MR: mice. Tall fescue J Dairy Sci Maloun Reterences :. 13. CRihcmeNoLEr:thTAhemefre-cFtosoofdmAuniiionroensrep7r1o-d3u6ct1i9v9e1 pectorinmbaenccatee Vet : Co`opepr perDDeeffiicciieennccyyRefReefrereennccees . : 14.GAinUfhkioncgyieonuoJmnDb.esrCso.rgaahndhLR,WpDBlrheoOchcGascF:JorTmohleeererseiscotn.oinfS. mbpoeelfyrbhosomsnum smindaeuciedsocounpsp:er bovine herpesvirus-1. J Anim Sci 74:211-217, 1996. ed wih 15 Dargrr DA. GarryFB.Clark GB: Serumcopperconcentations inbeef cows an : .: : 16 DNheifesers.eSJBlA.AVlM; eACn2V1o5G:,1n8S28ao-183Kn2E,, 1Fc99oo9.rpeencJo. AnicdnYM, aBrowsnnC.P. nFeonne Soof . 2 * 000791 J. EE -------------------------------- , ' :: 17. CEGopsepeornTeanedGnpF WSoaodul1oe0f,wGSiehpsias,deBpoywheonTyTofooecstseofmcooppemriderfi!ne 4as . ISITE, 1997 3 Neto Acs Fr Wang cS : Toole sus Relceces Ld o 19. MagdSa: Fluorocarbons. In: Toxicology, IS! cd., Marquardt H, Schafer SG, MeClellan R and Welsch F, editors., Academic Press, San Diego, 659-662, 1999. :: 20. ODsiwgeirloenriGDT,oCnarosponsTLK, Beucrk oW,nVFnGaeldgerGoA, ebditors:aloardns,eCiCilael and . 21.USE PA Envionmens Response Teas: Dry Ra Cre, 1997 at o o . * o o o . . . \d > . . > .: " 2 000792 cavern ) EE ,' Tennant Farm Herd Hes vision ' ------------------------ Cate Team Reon 9.0 GRAPHS Graph 1 nttHieevapmia'rdsiunlviizsCietadtbeltohPoeldaTsseamnmanpaPlnretoslfatcaatmiknew(e(Arrepomealn4a,1lay1dz9ue9ld9tf)oattehedsunrdinogphtyhccae . * irrneeffseepsrotenensdcie(ve1m0eh5ao8nrsmnofgnoemr,Le)nprdoAolpparchtiyilnt.peasfGtrurerae.p(h17Tl1h.eu6 ansvgeitralg)heeapnladabsoemrnaadoopnrpoypl'tascct-in ? ' . hc(vTnaeeldsuodteipiahnfgogynrtoletsahnbieofsreTaostefoinreenynda:dneotDfprrhh.eeyrtnNdeecie(lm.1y1Sc0cTo.hh1tieocnsxkgei,/ctmoUeLnssi)suvleiwsrnaswstietesryieTmoeihflniaTngreahnlntnoytetsshhuseepepreo)rtive of ' . . ' . ' * * ** . * '. 000793 [ra-- Ros000913 y-_-- , ' * ' . . . ' ? .. . . . .. : . . . .. . . .. ..z , iF is 18 = EE " " < :" "rE - * " ! : Is . 23 " ! 3 ". 3 :z |i". LE2 i PEER < | $3 " otle ] ` sg o. " | {i e " .Sle lo." < a 88283(w8o 8 woer2 ois 888 8 se oo 000794a eosin Ros000914 Tearant Form Herd Heath Investigation Cate Team Report 100 FIGURES FigurFeac1:efFlayce(fMluisescaonautthuemnhaelaidso)faincfeasltfation was considered to be a major discase prMoesb,letmhios ncaltfhheaTdeasenvaenrefbairlma.terIanl akdedriattioocnontjoutnhceiicvointsstaanntdhaaprpaesasrmeednttobbye c8l2i)nically blind on the videotape (photo was taken from Tennant videotape. Figur2e: "This Faceflies cow was on the tdhaemheoafdthoe accafolwifn. figure 1. Like her calf she had severe bilateral keratoconjuncivits. (photo was taken from Tennant videotape 2). FigurFeac3:eflLieefst aeryeeaofveacctaolrffwoirtthhefabcaectfelreisaalnadgceennttsroaflpcionmkeesyle opacity m(kaeyrsptorcoognrjeusnscttiovdiitfifsu)sseuccohamesaMlorualcxeerlaltiaonboavinsd. clCiennitcarlalblcionmdneessls.op(apchiottioeswas taken from Tennant videotape #2). Figure 4: "The vDiedleaoyteapdesshperdedsienngteodf the winter coat on a multiple catle with beef cow. delayed shedding of winter 4counsu.titTihoinsalisdaefcilciineinccailess.ig(npohfoiteon waasssotcaiakteendfwriotmhTeenndnoapnhtytveidteooxiicaiptey#a2)s. well Figur"eTh5i:s Allesoipoencwiaasanpdreesreynttihemsaevsebroavlectahteecoinrotnhaervyidbeaontdap(esc.oroTniitss)A common S(ipghnotoofweansdotpahkyetneftrooxmiciTteynnaanndtisvigdeenoertaalpley2r)e.fered (0 as "fescue foot. , Figur"eTh6i.s eAlxoapmepclieaoafnd"efersyctuehefmoaota"biosvseimtihlearcotrootnhaartypbreasnednt(ecodrionniftisg)u.re 5. (photo : was taken from Tennant videotape #2). . Figur`eA u7:nuTshuraelepcraetdtilleecsttiaonndifnogrisnatnhdeincrgeeikn.water was described for the Tennant .: ecnadtoephiynttehetosxuimcimteyr.a tThpirsobviedheasvisoormies krenloiewfnfo(r0bboethascsoorcoinatieuds w(i"tfhescue \ \ vfioodte"o)taapned#h2y).perthermia ("summer fescue"). (Photo was taken from Tennant , ' Figur`eAs8:deTswcroibceadtfeorsftiagnudrieng7.instaapnuddidnglein water provides some clinical relief 0 . Ciastatlsesowciitahtecdorwointihts".fesAcluteho(u0g0h. n(opnh-sopteociwfaisc,taakpernedfirloemctTieonnnfoanthivsidbeeohtaavpieor ' ) ' ' v) 3 \ ) = ree 000795-- -- Eowmz RGS000915 ASL 3A ARAili ins. Gil 3%: a y ae [Ca Pi & 3 ' : - 7, ) AE reiE , er or ' ' fig 2 o3 T fE ota <r 3 a " -- ENE = wt] E For <n y - 2 em BX f Fh Rak kas Pmt a% 2 a Ca J A SA BAA 5S i,Bb ss. , D : g ? > 2 --= 7h g aN [RR hy feu , bye - i co is "17 . ATh : ; ne ' EE : % a ' SEE Sw EF : . = re y - 3 --~ Lg .'' REE ali * i EE TER 3 Re i aE : . CoA { yE aNTS i a jot * EE 3 hi LAS Ke wigs lat : ES a , \ : poe Clr AE Ee ' Figure '> Re = ' PRE, 2. S iS A.dul NE ,' = a e ees =Zibo = - fer AT Cm = TE 3 SSE TE saa :, E ASe oaT r ) Ta AS es ) ETAT SL SEs . v, ,  ' Teoma Fam esd Hest Ivesgsion 110 TABLES : Table 1: Review of Tennant Farm Videotapes Table 2: Individual Animal Data: ClinicalSigns. Cotte Team Repon :Ld okTable 4: it Individual nt: Animal Data: Cie Coc Hematology (leukon), and SpecialChemistry Table 6: Individual Animal Data: Serology and Fecal Exam ? . ' s s . . y ) y 36 000800 s EID151717 68000920  .' Teoma Fam He Hed ocsgion Cate Team Rep Table 1 ReviewofTennant FarmVideotapes . Tape #1 (cases 1 - 18): Tennant Farm: New England, Wood Co., WVa - ', M ASnuibjmeaclt) January & February, 1997 Diagnosis Comment Cow.Hereford [+ neck opeca sea, |= probable Te, . + + dwwescars ihbumepedd| (rowing ohntaape mpdieficdl 0-spuecpie :, Cow Fertord TORK Bulls [+ Ccormeoawl nopacity. [+ povible dicolorsion |+ [+ cpoimnkeesyeear or ios Fer prbablyeons iane of(not ct lean, .. 3 Cow Rersord|+++ 7 rd(hsoinewnoiwsningcg)arspioobrtectdh, | madesrtiyceaWtniopcnfoorbdrosbtinnesd.ouaemlmetihooundgahnedth ,: ! Cow. Retort + [+ porFoncheacdk| iangocteesuepernonoblnekvmicudaennrskeaooofepowssinble i mak :' } Cowan + (fsontowcilnagn) [+ slopeca. wl wwich, | aha Tow SereFng a pind ',' wofoxeuisccluadessti,nocilcuodses.meacndhasneliecnhiaoulme. 7c + SlowTpswiech. al har loss GerGegn 1 nowing) would includemechamel, hee .' 8 | CS [+ Gnoaw,GeTod ||i hoofoesvxceuesitoxiiceosiTso,nagend selenium ar gostiinty . : + ++ boblvaeicrkglbrorawolenwtnnshooeepoeavrcseis,ta,iels, |||. te"ecotlhdneormxal a(rposatmocreme), focal mucous normalfor stagnant mucoonfuecess. feincreectsum necropsy. moor | neclrackoofpf;sseroyus ' + sleuseiodns,had diarhes aprtobrabloyopfdhfuayte:toSetmaarcviaattiioonn, ' . ' Table1: RevewofTennant amVises a!, -- ___ ooose1 Eotsira Raso00s21 -N_ ." . .9 - . .. .. . > 2 L.d . ..a . . :.. .. s . .. . .. Tenn Fu Hes Heth ivesignon Cate Team Report Table 1 (continued): Review of Tennant FarmVideotapes Tape #1 (cases 1 - 18): Tennant Farm: New England, Wood Co., WVa - Satjeet Animals) JanPurareysenta&tioFnebruary, 1997 Disgnosi Comment Carbl,ackuhitc face T|. edcrkend:oen lens or comeat TpCEraoubsaeToblfed,cioamheaelasucnarkn(ohwarnd,o tel. Cow Tieetord [+ tophamc.ities I comeatopaiy, Copoimnekseyoep,acity probably secondary + + aanbdovheyphoaorveemsi:salopecia| + dames dilefseeiroenrsntiamnlclfaudediseactgumneeoiisciohstxmeoiofcidahsyos,ofi,nd + cmaouissetodferimaatrihtiesadauned1thuinnnkinnogwn Cow Bh [+ mk dope unokpnoiwen,ri EE ! probablee 13[|| Cow'red | Conrad [+ + siioonbgbgerr,oiunngd..Towing cud| + Talialopecia cdShiiooalbgibnneoerssiitnsegr/iaansrceilnuiadntehisinbhgiatdrifodfnwea(rrleecnsiaanld likelydue 1 indiidual com affecedr [+ eek dope |" + aiflenoscpcheuocedieoasrdsmifeefkecnrheinaotnmiaitlcodxaliiilascg.onnoassnids "neck. probable he: ilswitch short baie | a hrdifcemildigrois feisnccluuedoesrmseecheannitcealx,ilciceen, sand []Cow,red + odd chewing behavior 7 Cow Hereford| + posse nched Bak =~ rdiosrgcnoenaisrioncmluadees;hafrdrwaarem] editscealsoep(etrracuamratdisc) Tale1. Review Tanase FrmVidsapes -- 000802 3 RosE0I0D1059127129. , * `Table | (continued): Review of Tennant Farm Videotapes PEE . Tape #1 (cases 1 - 18): RETennant Farm: New January & February, England, 1997 Wood Co., WVa - + necropsy: serous atrophyoffat, : | uy intestines,interlobular emphysema : CT 7 . . . . [4 Ld . . . . . . . * . . Tabl1e: RevofiTeennawnt FarmVideotapes 39 . 000803 * ' Table 1 (continued): Reviewof Tennant Farm Videotapes PEE ' Tape #2 (cases ree 19-60): Dry Run Harrins PC. Wood Co. Lee Creek, New England, WVA - Off North Fork of . blepharospasm, probably due to a nutritional ' [2 Sorin pooty ' colored coats ' Fish (sucker?) + incidental death no diagnosis ' (accoon?) possibl. + comeal opacity. + comeal scar secondary to pinkeye. _ . car = corneal opacities. ~ comeal scar secondary 10 pinkeye. ' + comeal opacity. + comeal scar secondary to pinkeye. . (burning carcass) fly problem pinkeye. * Fle + comeal opacity corneal scar secondary to pinkeye. * . . * . . rs `Table 1: ReviewofTennant Farm Videotapes yo > 000804 ., E1512 PEE Se . . Terran Fam cd Heath nesgation Carle Team Repon . . Table I (continued): Reviewof Tennant Farm Videotapes Tape #2 (cases 19-60): Dry Run Harris PC. Wood Co. - Off North Fork of Lee Creek, New England, WVA . Townimals) ae wom incisors. cdaeuastheoufnkdnioawmnh,en, cmacaton wd . ++ edmiaarcrihaetae,d, sunken eyes| + rweolamtedi,ncisors may be age or feed > (dehydrated?), serous | + lung emphysema wasagonaland + aatgroonpahlyloufngfat (heart), insignificant : [Fe deemapdhysema [+ reidena death no Giagnoss 1" possible : : ll [Fe + dead Comet opacity T+ poinscsiidbelnet.al death: nodiagnosis comes scasecondary 1 key :: Cow Chonme apa T dcoimaeganlosseoiafsr stheecocndaaruyofTstOhReineYe condition not possible possie :a + dead + ipnocsisdiebnlet.al death: no diagnosis incidental death 70 drageons o [Tle[EST ees] ? a ipnocsisdiebnlteal death 70 dragons : 7] Newham all | Sbioghmockas endo. | + bGeciofngueni0tacl caonetracftreodmtepnedonsay : [oe ae ws . possi. a HE + dead (rotten) + no diagnosis possible. . : [oe ee possible. possiblere dames . . . Table1:ReviewofTaman FamViceotaes wr : 000805- 2 oo i eps Ras000925 . ' 0 Table I (continued): Review of Tennant FarmVideotapes PTET ree eens . Tape #2 (cases 19-60): Dry Run Harris PC. Wood Co. - Off North Fork Lee Creek, New England, WVA of PT ee o. 47 | Raccoon [*] + incidental death: possible. no diagnosis + incidental death: no diagnosis Rabbit dead (EHD). = incidental death: no diagnosis POTEE * ? 53 |Fish 54 | Cow I+ dead lumpy udder + incidbelntal death: no diagnosis + unclear from videotape . | + overgrown hooves -- toxicos--is. and moistdermaits due PT eee . above hooves mechanical dermatitis, fescue > s o . TableI: RevofiTeennawnt Farm Videotapes Ya 00030 RGS000926 ' . Ld . Table 1 (continued): Review of Tennant Farm Videotapes [] Tape #2 (cases 19-60):LeeDrCryeReku,nNHearwriEsnPglCa.nWd,oWodVCAo. -Off North Fork of Subject Diagnosis/Comments o Cows, multiple [+ above hooves: alopecia,| + hoof differential diagnosis includes. PTo 60 Cows. heifers. [+ thin. Ee [+ poor hair co shedding suggests definitive diagnosis not possible e defici Note: This table excludesmany of the clinical 151s 3nd pathological conditions that were proposed by he o speculative comments regarding normal organs. during the dissections shown in the videotapes, were not . o . . . . . . e . . . . . . . "Table 1: Reviewof Tennant Farm Videotapes: .[-- _ 000807 43 corre ' . [30 7 i] ETI eolo .3 TREE ea=e=eleelmemTa7e] HH T T1 | HHH : Rk flit Hil 2s$<I iH E IUNTE YKE E1 2]lt PO: REE JR fie hE :: hE . IRE : : 3 Ea lel = ial Ridelaeka ize = . a & i A. =i i 1 i sold e sands salad | alle al gy o $YP$0irb A hhlT r TR : [ 3 al 2lelalalalalale] a * [J s = = 000508 kad cores RGS000928 - -- -- '' o : Had] [| ET L 0*!i i | iEisTT sn | . z3 | En 7 iHLHaAg |]]| 1] | ! Hi la ig : la] i gH [ 528 Hl SE i .: Ef || ed3 IE 2ES%|]| 1 a12e | aR ZZ 435 gf Haast . W | 3EEEE a8y 08 | A BYdEe0sE0 . S EOAF Er E y LaEs EE . : Hy lea lale x 2 jleta zlelalela me | iia o a Cid =" iT id i BH *: i: AHE e I | ler lai] s a gonl, dAy re3HIn egeae: ssdd LE 2 iH | FEEFEEEFELERERE PETE P cl M[| [pedi] Ff: cd i: Arudeaedils aunnpadia-siy 8 Hi P la) sha] ii :i o2 SHE iii El || EE LEFESS i : :: r -- ] Bb 4s 000809 - -- EID151726 RGS000929 . . . . Pol $i RE 3 .eo . 3 [I TT $f i ee I ol ole 5 =| =| inlglsml 2 tlal nfl! foo) : i EE: HERE FE SEE HER : i El BEEFERARsARER 35 ee : iN IE .: iDBl-: lHeRAeRsRAAR 53e Fe REe 5 di El seEsnsedehocnias Po ln 2[J 8 SBHRL : s20 SBll] |[TTITITIAO 3 : 000510 96 cons i [TTT 3 s i ee a : :iB | nA N COAE a ( s1HNf:Hl EC e E e p5 :Hl: [ EERRERAIYRIREENRAL 3 , Ea Hs ii la vi 11 : PO dee vi Te 5 : 1 3 : ial Coil vi : EES o Ee EE aid 3 3 El p Ho B HEE sc EH EEDEREEE HE eid : TT _-- So oo 000811 ~ .; 2 EID151728 RGS000931  .. si eo L sd :i : | ET ERIISIE ol CE LEE: BE EA {14H els ) . ; A: ell PR : : Alo eet ex; : X pe : i: 1angguseh tl adadsss . tg yi: 53Jf HH EAEARRRARR . EI REE ERE EEREEE EE g Hl RES aR aaT 3. . i Rie H 2 B359ssz lel dalle ol HO2 CP di] [TTT] . ! 3 48 L-J 000812 01s ee RGS000932 -- . -- .' . .0 I || | ei CE .. :E7OP W B iuM ssadH elelablld5g e3 olf:3 o 3 i 1 gf 2FlENMck.saizk=laclenlBaiRcElaRloAlsalolal loeldl e22 5 Z| :Eo8 *: SI IH$ fEls: E i2ccr 5i5sie scAes RRssseesRete!si yT,y iE35: :J FIO OT 38 ef 52 : 2 HM 7ExIC Flr snz mssslsss elasllkls za 3es ifais sdyc y Ta : : Hl: i T 1303833 I3 | [i i Ig388% Ff : i HS esac i : HERE: REGFEEErEcrEeEeEEnR L EEETE] i EER alelolslsloisislale chloo ) [l ESSo SEE 3 fI RR te333531 P PWl ena $1 IER FE SE z Bc > H: Ei i MN iH | SEE 583 sali IH j . : "" - EE oo 00081e3 e J-- * fasooosas _-- . : A . [3] I RRRCAE fof] ele P Poi l : i: 2 ZZ a: ME oa facaan i rem Zz Pole [sealslelszle slo's Hag] : EEsEncn FER RRR RARE RE 8 ~ . i eC . : 5 oo Ee rs B fiszagzes 59952 5903 5sls gg lz] ls : i : B: 3% 222 ge eel lll fPH 1 OMWT f . 5 . 000814 corns ` * * . .i P10 i I B lial ER i " ela mlmllelale] Td] 8 P : IRRE ll ER: BE RREE mmR ma =: PE. i2o2s2o H sealnlssaae lleln l soo|oa]nooeE . : 5 Rl tM RE 4S . : 1 el : i slllicesczcssnatardinht 1f : iB lez zsclas lel silat i dg3 l oe ei : : B i272 sels solele dela 10 2 Ol s I ET Op +c i M e* SEH 2 LL PARE HE] | HE af = 3% WoRs 1 i 5 0nasauo0sm3s EE------------ ' .LJ sI 1sd7, HE [1INARI 8 a] : : H i AA defied :: iM : T eddie fedi edirs : i Hl: teaier tate ered: if iden He 2: bi SETEIP TT : oo _ 0oos16 ' z Sie -- : EE -------- , , . . yi : Il II . : I IH f * 3d . : AA . : Bo ' > EH 3 fH |: 3 N | nL I 49 i 33 ts Rl : PM 8 . : EEHEC HH [Fas jsaynnrarrdnaEeEEgErEe EEyEsERN 33a43 ' . <A Z5 ER Ladue [TTF Ed ETBHyElREH EE FET RE[ITREHERE 8E3fSa38g8 fH i i `EEEEECEEFEEEEEREIEE :.. : HH Ne i aBIdgETLTTI]TT TYEEESdReedLiPkRs:EL| IA EEEECEEEEEEEEEFERIEE : oo 3= e* ii Ts : .. Ea = ER g fedaseriaaid "Ml W f fis H Ti Ee s SARL Tal fEyEi: N:: IEEEEEEEE Eis iEd 23 000817 = EE , i 53 nasoouss7 '. oo -- -- , LJ 3 vi . NEE , : i MIT .. . :3 : :BE FE 2| ies| enazzs bi Ta Tg ty { : fH i ME 1 i iol] ! TEE les LTE : i JE RC2 |[5 aRleElsElsElsTlnElssioElel gEnela)|| r[22 .. . :3 g 5 LE R28A5R3C L5C5EsElET ElE [aEE mTeEsE g .. . E FN s E= E sHEEe SES EEl EsE eEeEo [[2s2E5E8 lg fe : PRs Cis f . ssxi2 > ti n ui Ea a - . ce ALTLTT `| 3 5 Mo. PRE 5l5lg s 228|85 ~ IE S|S!5|3) --- . _ 3ia LoloT 125 . ee g1 e 00 5 2 000818 fBaEiEl] HEisls 12iHc 1555 aE 7 a 5% ResE0I0D0159137385 a . Tenant Farm Hrd Hest Inston . . 120 APPENDICES -- Cote Team Reon \Appppeenrdix A: Abbreviated Curriculum Vitae of Cattle Team Members. . `AppendiBx: DiagnosticPathologyReports `Ohio Department of Agriculture: #4977.97 Michigan Animal Health Diagnostic Laboratory: #1792571 . Univesity of Pennsylvania Laboratory of Lcge Anil Pathology . 2nd Toxicology: #UP9902702, #9901437 e Appendix D: Figures 1-42: Photographs of the 42 adult cattle; ::> Figures 4a3n-d6c6:areMiscellaneous photographs of the Tennant Farm - Appendix E: Herd Healt History (Apel 8. 1999 interview) - Appendix F: Diet Analysis: ComputerSoftware Modelling - . . . o . . . . * > * . 2hd _-- 000819 55 RosE0oI0Ds10591m37356 ' .' Tenma: Farm Herd Health Incsigarion Cole Team Report .M Appendi.x A: Abbreviated Curriculum Vitae of the Cattle Team Members 0 * Thue Name: Dr. Perry eL_He abecke er I .. CEermtpilfoicyamteinonts.: CVhMiDo..fDPLiernpngl.eomSAacnthioemoaAllCofPVaVPtehtoelrogiyn.a Pr ryLMaedibcinoe,orfNPoaawthtBoololoognryCaonyndtrT,oxiKcoelmogeyt, SUnoiv.e .. . Blucsion JUUurnnisiiCovlnoloeeffegPPereensn(nsnBssSiy.ilvtata1n9ni7yyia2.-.19SSc7ch6ho)ooollooffVVeeerrinnaaryMMeeddhiccniene (eVsMdDon196s9o-m1o9793)2) .> - Mflinions: PAAemmneenrrsiiycklaavnnanACisaasloVcleieeanioiofnnVcoeyfteMVreeidniiaecraaylnPiAayshLocoacgnbioasnn Disgroicians Id ----DNeg-- armeees:. Dp Drr. LLisaau DDaaviisem HHeelllelrye: CEemnptlcooytmoennt. Eesciuon: DPriWva Practiorer. St. Ohio Sac Unversty Mary's Veterinary Cini. Si. Mary's, Wy . Affliaions. OAOmhheooriSVcteaatnteerViUneaneriyrnmMrrsesyeMteCdoliAlcseaeglecAnofisoVentoercinary Medicine (OVA. 1971985, rWeiirlaVonisslaVVeetleernrryyAcSupeunlciArsecSioscteiroyn . . NmDifemGMemn -- ' CFeinnitpDcoeapgormneeesns.. ~ eDVtML.SarbpoDyreiapctloiProyam,.ahtoNelooAsgChtVCPaa.rdolD iFnsiDieep dlpl AeBaroVr.om (ffmRAoaaolgedlaintsnnuAaetsnlissRpeaDcgiiasslcsb3ecDerfgcaototlsec '\ \' Educauon. EEUxCnialntenvTTcelreeunnnnyndeesSostfesacTteeeSSnCuontrmeeemsuUen.UinnCtvoeynlrlaeCiegoyell(o(eM3fg5Se,,V(eMMAeSci.rtcmor1aw9ro7oyb4Mg)eys.s. 1n1997059)()DVM, 1981, ,. Aflsins. MKaAcnmhseiarzsaaSnneSBosaUerndCiovafevrVee(trReresisn(aerRayecvPhd,reni,VesVroeminaerrymyPPeaotloops191096911998 A`AAmmmeeerrriiicccaaannn ACAssossgoocsacotifoanVooefftSBeaonirvnyePPPruaahcoecotgeaimrnnsss . AAAmceeanriieecamannn AoVfoeVcirnesnrironyn,MoefCdVoaenltseAnusimcteyisbieonrry isgnsocsns Appendix A: ABevited Curriculum Vie ofCtle Team Members 000820 - ST se Eoin RGS000940 EE Tennan Farm Hed Hest vestigion Cote Team Repe o o DNoempe: br Rober1 Mimson o o CEermtpifliocyatmieonnst: Educon: DFVilMcdDSkcIehnovlCoaflV,geC(re5n.yex1M9Ae6vd31ii9om6na7,)lRHeensntqanud ePrePAi.ty, Un. of Pen eos Atiaions: AAUnmmieevorecresanintyVAofeePesensnsyylvMoaefnidBaeoSaichPmoorelocfihVennterrisnary Medicine (VMD 1969-1973) Aeron DaySeteAsotin o . : T -- CanfNaasme. DDrV.MRoPRbe D.eDriplHo_mPaotppeengAaBVT e -- . Erploymen Edocaton: WCheeSn,etnTooriawecsolgiv.neLaaryvyeailnnooegf,iPnNaelswioBnotnoedn eTCoovxeiecso.lKmogeoyd.ienUnen..SpToafr1eP9erF7nA9 ; Afaisnorss LUAmneermmeenyVSofeTiHinnsa MCColeleegdeof SSAvieoaottnneaySMdenn G(UN81538 01978) . . APmmiraenAeVcnecaootfs MCehaedlicTAoogudoeecCompionomn pt oe .. SSSooccaoaooofffTETcoronmeermaaiommgmesenPlaTnowolsop ans Chess . Ameren Asta of Veron Laborer Disocsicres . ' CanDtNeoapnmeess Dr. Greg P_ Sykes VHD. plone ACV. Dione ABT -- . Crier. Eacaion PCaommCoerierUdinnbSeiyic:)rAiuvolmfoabnlD.uoDPnuocboCes t9a0rS0mopc9eB7aei,tcaltshCCoompmaenyw(ehno.l.DE Asn ians C AUmnantn vofePeemrgC aMnestsSC haott SaeN tconuy dneinte (MoD 19711575 . Ar rnm CScsa c ofmPmn abaloFanos . (CL Davis Foundation for the Advancement of Veterinary PaoloPans .. . AA ARoneycarlroMaimcm rBAooesosccowiipaietciae solTnSooovcfmiLeooetgyn rrntotn Animal See ' '' ' . .. AppentiA. Abbeatd CarrionVie of ale Tem Members 57 ' .. BN 00082>1 aotstras Ros000941 EE "' ------I-- REPORT OF LABORATORY EXAMINATION ue, nar 1 ors a AP.N0I.MSAoLxH3E0A0L7T6H DIAGNOSTIC LABORATORY o ai, --Si_te--wa--ononsy PLihnoinneg(,5M17,) 438835-059275 oJter Suber. sneihm JPRIaVILEnGED INFORMATION CFaasceholoroiggiiaac:: M3c5opst Client Accoune: 258983 crime: iGcaa.spaakm,aisAnasecm.ar3 om NILSORLAIA PA 19107 eo . WISTORY Wany castle on coe farm (aver 150 out of 200) have died over the past o RSyeotaoarvy.aisn.gClaoifncditchwaeelighhsatiigrnloscwosai.tn,cluNldeoecssrbolopafecykheafniiernddiinntgesetthhei,ncCpalaiultd,cehdyopvheaarcgirhra,vleohsbslaocfakndthe Kiiedcnoeytso.rstiCornisiocfalthesigmnuemisaanld smeiccrootpseysndfipnodsisnigsbleveraebodreasaclriitbieedsiniaathe J3VeisdseoeoaLtcda-poec1oauwhci(ocMvhDLv(aMs1O7L3s3u51b7m71i3t3t15)e7d1W3hv)iicthhwhidthcieheddtiiosnesdu3eo/sn.48/32/7T2i/s3as7nudevsetrhefermoemsatr4-om . tanlttee sponte to an enviroments! coscasinant fe sespecced Naim. 4.3 veme. 338 Age: ay Breed: HOLSTSIN Sex: TROLS LABORATORY FINDINGS : Toxzcoucor REsOLTS A coms . serena: Loven . Tec: TISSTN CvAAL MOLYSIS (values appa) . VC5o o((lT0oo0sne))) m3mael(Cwa1aseae))) mGmelaassa7s))) mSmili1uas3m 0) NPa l(<ao0s0 )1 csxe l(adcee)) ocTailasoaen 1) Mmgtlabwe) XC :> Test CCoopmpeenre in within deficient range. Copper deficiency causes acute . GCelaotsheaCnldedniasn6cto/lc0oo/rnac3te7inotnratoifohnasira.reMvanigtahniensesxpisecSeaerdgiroaanigelsy lov. Ocher . . 58 - SUS AN AF"PDRoIoATTEVSEApAoCmToONNEABLUTAESLTORPEPSOURLTTUNSITY RSTIUTION FR oo 000822;2 ReS000942 --_-- i max aor 5 Case Mumbar: 1792571 soacnan. xiowy * Test: TISSUE MINERAL ANALYSIS (values ia ppm ) . CBBeoaCoogneo)10 mealt ouane)) Camo) uael1m6s )0 zal ia) woqm lde21s sm iase P.*Y AxPs C(o<0a.s 50e0 ))) Csre ((<0a.2l00e)) ocmd((a0.4s38e)) mwgl(2w.0e0 s) Tae CCCooampgmpeeenrt(:<i0s. beploaw) coraal rasge (4-6 ppm3) and cadmium fe above sormal : a "oa/637 sscnaw. oan . Teet: TISSUE MINERAL AGLYSIS (values {a ppm) MC BeC(o02l 330))) ae (<0) Pp metl300953s3 )01 rl) Mcall zi 4 4) ) ow) amudonsassso sbi <oses || xBoCleoe m) se doe) omcal(<aodssos)) wmgl(waisee)| Toot HcoommMeanrtv.yosaecal02/f0o7u/n2d7 in the urine at the reported detection limits 2B00E5.6L2iR0ve0eprogsrptmea;dndcaodkpeipqdeunrae,tyes35hlaitdvoerl1om5vi0ncpoepprpmae;lr.ifraTonnhg,iess45ifsorcothCea30t6mtalpejroear;ref.incdihnigstesso . s9so:ad1gi4nuems.i2un61.0.4001000ppm1c;o300p2h0op0spppmhpomr;4unsmd,apnog1ta5an0se0ssieSu,om,421.5010305p60pmt4;o.0t3i3vs0ae0;, vmm2%o..lysbedesnassm,poms . TFo4xpiocratnetd osuctzeienn baymGpCp/lMeSssoancatlheTleipveerr viisesiasvparioigarbetsas.and will be Nutritional ematoation: Urine fluoride concentration vas .6 ug/el. . Asnciaeaa.: NHiodLsTEeImNs: 3/2 sAegx:evr:y oo . .. 59 .:. `opioTsAcmONALTESTASSLTS eo 000823 RGS000943 J ---- : roms nar or sw Care mabe: amas xsropLSaeiTcviteoirLocnGstIhCeorfeEhRevEwaRrscI,vTIadOniNvceer,d panodstakoirdtoeeny svuetroelyesxiaem:ioewdi.ih fInreseerceciineansr of hrSeoxupinaidft,iicctcslMeiapirin,doorniienat.sreacctJyiatoonsp,elcatsiNmooinucssvaomfceupoRaltieodsce,yri,eisnmdoiSecetanttiseniegnmeemdriulsidi,iagicdeoi;nfefausismsealeld, ASeiilg%lmatinatccilec.yanicneTcnr'oefsaescehediisoqausfainontfdiichniegessisso.fumsskmosaiolnvlee:mmiaalbei5rceLmteofmssysaygobefe)ib&eaPcareorsicano.cnrcteeiTnnheed Sicocyuiis ymin. : iasonarony proms oxzcoteor ssouTs ap Commits o sescnN: LiviR o Test: TISSUB MINGRAL AGUISTS (values in ppm ) NC5 oo(toaonss))1 rmelowwNeos 101 emclilmemea 10wwmaiidane Ld. A(e l(o<0Gs.5es00 1) sCer l(a0l.e2s00 1) omc(a0d s.1e19 0J wHmge(<e i00 . DDCooolpvoperernnoiorsrmmawalithttiaannnggaadste)af:)i;ciseTanrntognuTmaensgee.. TTohee ffoolllloovviinngg eslleesmeeantt(ss)) iios//aacree oer . pr -- Test: TISSUE MINERAL AGALXSIS (values {a pp) . C8 o(lai )) mEeleTnS)) aMllesa)) walC aonss RM Weo(((o ocs0o308s8))0 BsGPeei((ca1dl8e0e8e0))) cma2 l(aa 2di6o.e5e)1) wmshp (a(<aee0s 60 a MSU 15HA Ae;SBeAu0TTES aACpTOoNEmAroesstnDEeFaOsRtsUsRETY HSTITUTION BAT 000824 RGS000944  prs mer sor sg Case Mabe: 1752571 r-- Test: GRIERAL MINERAL ANOLYSIS (values in ppm) o lCLroUgwNsenE)00 pmBUiCaem Mig) iow oG amlia aae) )) 0 Gl mE agioBE rea Bx0lan) seal 5 naacue)| Mamiinae : seacua; ca Test: FLO KDGAAL ALVIS (values 1a ppm) 2 L DiAgeTn)nemionm Mo (0100) p 3 ahleina)) m ai eos) PMlCa euas))) srii( laaonn 0o) maIm al01on0e1))| sm Mn i(i<oesee0 )0 Bfoah. 1RievperoerteadndadKeiqdunaecyes hLaidverlomvinceoprpaelr.fanTgheiss fisortheaetemresjoarrFeintdiingnsdo 8sa20a0.g4imtueons5.i02u0a601,3104p0p1m30;0p' occ1eo3o0p0pp1he0rop0,rapp;h2ao5;raunteado,snp1go15ac05na0er5pespsiaS,e:om,43i.1r50o1m03,0t0poo4ma5s;.4tJotpiono3eon0,0prCpBepeo.mn;bvobesremem,ope: o JBoexirceapnocrtesdcreienn+bysupGpCl/eMmSenocnalthesuploirvtershisenisnbpirioigrperses and results will : MvSarriational eximicscion: Urise fluoride concemcracion vas 5.55 spacom. sano CLINIATCSnAOiLomLrmLPmA;acTlhHiraOcemLifiOeesGsrtYeonyicnepcrlourfdaienldgee'asv1ais1g3n5re-ul1ny43Lc0oa,wasSo1stiaigsehpmelleycosmoummweimtrsceeeaddctiaonfnroermhhicorotveea4s2i.i o . Si[4oo35.bT95uL0l9i/b(n4i31l4;;ixraucrrbiaeioffneezr(ee0(nn.00cc.14ee;8Tr5raa/enn0fgg1eee;re=nTca33ec.5e5:r-r3a5e5.ns.0co)en,lTo=asvnl1ii1sag0e1hr-t+u3lm1y<0aa3ll))oi,wmtsaehiibcvuontoeyrirycoloreevnaiceenmd SSSa1Hl4GcvEiaucLneYdcocLonrvceeantsotirnrbiaiottniooln(1d.(e76t.5ym3d/miagoL/g;duln;aEsesstaefraesctatecinevcietryarnag(ne4g'se 3, 6SsiiormilyTou ToL,3.3Seafnesirns.ce range cT1eo.tt1ae2rcee4nn7cc9ee7rr)aa,nnggeesli+-g3h40t06-l.1y2306e3)l.)e.vnatdedas1eigrnucmlyirotnovcooenmcmetntarraiteiyon10(s13o8 vuge/a:r; : MSU1SANAF2FuIRoMTATEISVEAADCOTmIOONNALGUTAELSTORFeFsOuReTTIsRTY meson bl Eoisiraz 000825 RGS000945, "v " s : : e: s .. o @ ? . ' '' . 2' ' , } comsaRroessigmiticun puchoieste tiadinge. ros Cate maar: ne 1137, sor yg, severeoe FTeE y mln Plait levelpdsornaest3. e1e4san.cs-0eas1a2c0n.0Pa.) " = 01 en. 42d he conic 511 333.5278 . His ANARTSETAE SS erymermumon - 000826 o Eoist7a RGS000946 ' -- `. e I ' ' : :> : : .' ' ? `: e .. : . : .: . . :. : * * -- Ron: EREdear QUINIC POE10. 61a 42 17 IAIN-2230-g 2RIN-223077 Animal Disease Diag>:= Lr" "story RAroerreiaomne;.: 3431707987736 OConmdenarer: GOru. mS,aeninn0esar 138 Beirne. on sane . oR15ne5ee8lOtoisnaar,vrrn spOynostras Faax: r Tas aano sSUuBSsSaSInON RTuaen:s 3sat gen SBoeeoame Amis TToE m GomSegmnpede i PATHOLOGY mee" ANIMAL 0: 1: (ps roid, Bvio, Mined Brad Bt Samet: Ded Aimar NecROsRY & waTosATHGLOGY 327.871 1:20e Netcraypey Gpo mo Aradd.sieRTnetesdmttoocmhoelMeaeterC essubd gS.o aTnhamettebiaesSndaormeriegnderdehas hed i on or [-- hTeehMaeirantmiamatanelLdeLaaalnn yeSe.TsarcmThaaaeranintaderwntodtopor.atarhaTseiheonrceaosrcncseasstas.edwitshaAtrateoTwr69TS5ec3T.edT1imhtoeeremsphiaecenrmeeye 1oni re eer ae. Wid ero be Morpraugie dogo IEnmtaesctiisnailonpawreishiisamufeuasoaiasshelf -- PTihmaipcaatrftwra1serin aiontaegxeieldSpoovewidmeuakniiporntarlsbeereetrs.inDp puriingCirnloimeBnbtewiassher sondlors fond0 B rAadratoonmaatcyE h.e.eSroeppsmamadritaetiooersoeFmarwshSoeya rwenhtv brdto5Ebtootcnssarbetmmegiusaeimrosnweatetotb.s 04 he PF] _ 000827 eosin Ra8000947 -_-- . 2 e . o :* : 2 o 'o .o o: . .o . .o .o .eo o i .. .. -- Fron + SEL mim cE hoc10. : aaima .- o Acuommaacnonndtin)nu:ed)m 44778e 7+ VeOrTnT:IMowNer,OCrdRWY e, O Gum:CCoox, eKen Pw.d . fa NEGACPEY &WATOPATHOAOGY 37471111340 Komiundh Eparr orovpneetietraosauei.ustiiseLenasarllirsntssyaitseo.nhWra+teopdathoevtlehegiBcm,Fubraasvcestmnssrie oaonldsvaibregoelriogcleeexsamitnatisonsts,e VPhauettlahenoaigrmyySaae,citbaoOlnVoAgLitPO. AVP Hitopatneoge suamosian: fSrrEeecimtnso7rg0s0gLofosi$ae0m0timi.riwcerssent+dcitoarnr.esnb,ortfwoinseea,reiApvnag.SeAounrvngvgnpeycsnoodmnlo.rsymBwioca,uiclrMeisrrmee,pciodesretsniavnage,tiimduneaondiervgairt. EI orrTas.rTeaothfeSreaownev,isaiwSrasetsnvsamvesaeorgensaaenl1sdnswirtanasnd.sbCryeomipvahseaebnarceenspensussipornhsymS.ieonhstHeasSbwoocehrdeoaomnnpses1rrBoteseosie + Multiple. poorly delaested varusies whhin thelr syteplasme. Erilsologe diagnose:. Re of, _ R-- fltte e VF3eahtiawhiiealneaGrgriyymeSasei.vniGooVnnMgi,tP20, Dipimats, ACVS. "ro atopanelgs sramiaion TAue secttinonseofo1ve3 wloeessbsasraoid.sTrheeoovePhda4nsshasnekeirneaflaetrsmass ah stud TS#rh1eraabngrgheeadiMonafinfCoobari4dnnsstdsoswaeernismmPimenwaardarirwiidtrnhee&awfre4essnwdoldeyoawhrakrgcayootneoosfanPsndrpdapolsaeasaTemmathecsoslhseriiinnth#se7o8sRotmRoeRs.roo4odnt of -- Modest. chron,Sosy sabeFaso arse VSheirarGarnimePsu,OiVgAa,t30. Blom. AVP Pathology Section qe . 000828 I oF comms Ras000948 3) meme reson _ '' . ] AErdEen 4e 87747 Vu:e Abeer Crt 3. Or Cuma, oon FICALALOTATION 2.27.4711:340Camino rica noTATON 27amr2 2L.d RoSnaLn: T oR 00m dr i.mbrof eis nd tewip age wre MICROBIOLOGY eee AL NaIuM1T c0A:uL1n: lrnecs -- orn--as -- bsv oss-- e.mei--anedd S--ect-- , Ba-- t ------em-- ai -- Frei TarnSuman Racor: Magee ? DIAGNOSTIC VIROLOGYwm O Q . r-- a rr i-- rr vo--ay--C-- or FACORONA VUE 227870815 .. Renna: Negnine T ANMACIGL 1 (vtE raved Sam, r-- d en-- d 8------ FACORONA VIRUS 237.7031 i Aeron: Nogane : FAGAROA 12707081 . . Resa: Nope racmirTosPoNOl sanavests . ` Rana: Nogune ) 3, '@ r . M' reemee eres _ anes ssssans . . ) 000829 5 ents RGS000945 '' -_ . Fon: serve Av aii POE. : 6@1140 - . 1 nem o Avesasion: 497747 Vemrinarien: Alloway. Clyde HW. Jr. Owner: Custer, Kevin Page * PATHOLOGY ::pT B-pC E-- m ------ o Auephy. Seow : = * Triahuriasia ee ee eere mmo. . . Free er, . Comment: etter12 thepreviouscommer. Thesooursabaorved ithe animal waspesbasly THU Wik be recantedinsn siden o routs - roa o : mn o . : a : Addendum: ::: EE S T E ErE . 24 8 priorcameinajurly. Cornea ifury may eauRfrompiveorsiharombosns auma, E EE E r :: m Emoe . . . . . : m > a . . . a tte Se . sr-'--_-- :' : . Ld .0 . : . ? ? 2 '? :' ; ) , . )' ) ' '' ' :' ! @ mom SS. Pr a> SF an jd NEewsBtOofLP TONr GNoewBrui eennContr Spen IALRERORD Fd Kenn Sn 7 5368 Str. De ey ctr Fre 60 45408 Fo cto 2110 clariosation nTeToi DCLaesoCoriitetn:eboyyisn 0 Res Tn Tay 4 BSr r Soran smite rr sFartatton oe Ady m[rwr 4 A OFROirens Otitaom SamToplFo e _-- HItStTd ORYe SUMMtARYL:iln0099 us ho ied gs ADOENDUN err EDnIAeGrNOsSoInsSo:fmin nce TCeoFmmtied: comopeneslpseswceunt eof opi yb cnnin 0 rns BHLiSATnBOhOPARSTAoHiTOeOLORGYwYeFeEIXdNADMoIINNsAGTSgI:OhNey mec oc Scop DPDioieeTsonorm hNoone nNSetc. or Ro11)AebtonmiasnucahnEEp2,apddiceis.pMSce uccosnMaasmlcdas, oeldord.sye mosivscn,kmdi kscspisooeoridisni"apife k nt oma pers Hater 0 QU -- , e 000831 & 0151748 Ros000951 : = NEW BOLTON CENTER FINAL REPORT ERSEY)7 TL onctoey i otor mea Cnr 3670 Set Rend AcVee cDreLNiosa UDsPuiv9e0o3t2n63 pe 1 KePhaonne:e6S1q0)ua4r1e-5P0A0019F3a8: (6109258110 Sebrizer DrPm Hater ReportAG ry un Investigation Cr * RDeupsecoSuDbuCmeoi:tmem2da:1:9575Ro2bert 8%TADPo)gpeng2n1, DY, 9 ' Species: Breet: Bovine main SePrxoductiontype: Beet Medr mDatweobtained4 ORRseterOencleLaeb: trtnoun Seaple CF - ? HISTORY SUMMARY: OO 2 Dl IAGsNnOdSed IpS:ic foDn LiuHl on 10,19. Tie bite Seg 9770, Copperdecency ' HA CerOdMarMalEL iNaoTnS:oS:oT eeudetE adspoob mpssnobofe eegso n eoepernteofpbeimasrlenepscond S ep hT e ' ccMmioetde CCDultoeoignm Com Magna 0050007 e23 2pf0tr0rwio m.gr 3 Sonpeur n Siosmp 20503100m7mm ) NJiMsiaatmne - <100ppm S0oRmeaoUme 1500300pmm ouwoige 10 Kam o0140e1 0sa . 00pm RingsbodomPl"Miner LevelsinAsadHow Bolom ,' ) LSTAuorBxgiOecRoLAoTaYORReCsYouLeFTIS,NiDItNyGS: ) Ta CopeMet Sven )\ Liver Kidney aac c0m cox \ y "8 \. 000832 Ensim Ras000952 0 4* . (TB (5 QT)) Em I NEW BOLTOIN CENTER UniofvPene nsylrvans ia,i Newt Boly ton Center FINAL REPORT sermon, . 3 &J EW StRent Semin Oxog as PKhenenne.tt(S6q1ua4re.,5P3A0019P3o4t8: 610) m5 110 er Be eryfides : Cumin coro Gowmnina G<am20 osss <re 0 lseow a mSSmoo CaLl%a CaGG4ianmies oofaomse opD7i0ds9a : NMaaiigmanarn 11850)9 pir ftp Zine. 4 190 . . ptworane oconm cloom ! ' Alma ess swe eprintwet ight bis . : Seti stom an ike se pening . Spe that Ta Onpnic Coiteen by GMS ? . BNotohy ciocnnccotmopnosn)tsextwienrecstceiosn ucdndceStPnnMeE weer wbed osnpteivbey vntdgFst sraopriemntogpy spcEEUTIOPY npn hea screen Sue Rone ) Ton Fens : [le R sed N bebiteboneae 1009p crson fo ey ors bs !' ober Pppensn DVM RD \ ) ' ) ) ) ' @ . 0008333 eotsirso RGS000953 0 4 e Dr at pn : 1. Physical orinjury fromale 1| + e Tosca n wiclaeloe an te rd Seopbh Ls nd ec 23 || (eRe Mrte swiiedato7r5 5 so sy mei | : i' . All membersof the cattle teamwillberesponsiblefor | :| i their personal safety, the Te safoeftthye be| team, and the i s :. d! | + - (PCm0habsidiecail ebytrmheiosnestradefgveipcrayeascttscicoisetmsa.echwedigsee,she.atder) will || :. 3 T. m_ Tar Menohe cate individual caitfneledeed, cre } device te. knives, ! : :| Sharagainngo,fdveatnledrsiiinamrnyptooglrs. Noecropwcsiilese,bepchsloebnotseomsics, Duh ap. is es wie picespcs |||| S 2:: E : r i 3 Biological safety a + iiSneRnCopeeroa wvcehadeT rT rsp hvarops coopnae tnda aGreetiusnsendiEoetNneeerrwalls i | i : | i available. . Bed sleeves will be used for rectal palpations. i ! 3 i Latex gloves will be used for necropsies and when i 2| PiUhnmseeat acorsrnsidrered aparip.trhoeeprcciaatteee. aammy impce |! :s*: LC i Foer i _ FSmaotlimenw ey Wks s 0 penTEdid additionalbiological safety measures. " | :. | Sor r n r ofe a uT n 5anse a \ppendix C- Dry Run Safety Plan 70 000834 - oo :' :TememHMestsi- gan an ep ? Ph oto Photogra ::? : )[Ea C SeE rTcsGes o-oEEmio ofpe - ; " si a cou which escaped -- nme Pol ination) of the cos Fens hae individu: i :: " ;) Icor SFE com ivestock Thess eit ns co ecaa lves werehati Soa n -- : or-- a elr- sior!io cxamm" o for several hours mo ag l1) :: ii: CGCooovvveeen CCCooannnceter sy 2 - : 5 CCoonn1222 MCe iasi1m dee bese :: ' MPHaEdr a sii noe -- contents drained. te rin ;: coTTOrTEeS oar hich sop e Spo m n of : ;. HoSorgut gical significanc ro sisof- epiders i -- e[nine : AE Con is normal ee: Melano km :: ' T r n EE Re tEm somantes.dr carcass ia: 4 most likely be ana funy Le : EN eck ben th anil : z57 nea na turaendalboanrgntyhaerDdfrey i Cr ne as a =. ! :o bam, func oe ; ; C EE:E r>e ee -- pho suI pplwieed. oye eer fentified cow. bull, or ow :. ArendxD: _-- 9. -- _ ] 000 sas " Rasooosss 9 :." Tennant Farm Herd Heath nssnzaion cie TeamRe- *. . PPhoottoo -- PhPohottooggrraapphh LLeeggeennd ((coontoinmued)) ------------E-- E _-- 39 .6 NeeckckTkohpaelaocpeiucniamancuonimdesnrtiefisediyanimmealn aur ge? Tr)Co : 2 Neck or aa lopeciabiniacneolunansniiodsdeienstrief(diptehhdoitaosnsiimummopaasplltli(lcpidhkeolt>yodsusuepopptlpoioileeidcaes.by Mr. Tennan " s ?: 6a o wNostseeawmwitihtchodnidfifsusfe uimteed tlhis apign(mpenhotoattosisounpiplisedbyMr. Tennant). The cau 3 * Co poe with spouymelancsis (photoo sbuepnpolrimeadbly Mr. Tennant). The` : : . Fa medw oi(CT) sigeandAastceritng7ci3o19mP5mi9gimttencttaestiioe(nStC)oFmberemobnoemrrmsael.ottnthe om oer eEionppaeTnnsgcahhncianvne)t.erDiBnrfa.rpyoPnettoxeice r Moay n(CT.er Maman :: T(BereerpaHtana/pebtheorelokgsce)l.rin(cCSaTa.nr.awhDtrC.eaiMsniprcayrhep(laSCt:hoEloPgAvistO,ennD-rmS.ereLyniesCDoaovrCidiT"inaetrore) ? : osturPpoinntabiiyolpoeagoislto;negsntspouptooenrsspiercecsaTeonettl)a)ami)aa.snntdd.NDoratDr.nsRhgHuoodwrepnrlr:egihRmud(olVpDhSerC.)a.VaGlleirUnteineSge rFneWpSybokee.sCT(CT: ((ae5s . bDuopco - . > > > > > ),' AppendiDx: Phos 1.66, - -- a0 836 72 Episirss RGS000956 S-- r ---------- a-------- -------- : 1 L& id ME ' fi : ; oo 3 NGA yg : \; aa + Ey TVR RN te Ape C EYE L prBleltgedoo 0 pa Haui1L. lJ ; S Gao s ko Re : RRRiA:: Re NCE TT blpPgEE REEE WE TC ae UN Sh E --E -------------------------------- N1d ah a : . NY eh B p "Ww H 3 i Rea i > re 4 El Ri r 3 = : WATER SS s y : BS 2 DR ay one i PPh Ls MoA re 5 oo: INE. Cea Po RTT TEL 3 Br i i es . | Ti a i gl <A !s oy eCBr. NeTh\ T "2r .: ieacl d, 1 x LE A , Dso T dpwueEo eN.,A--L NERY --L--awR --.edrU amy s EE ---- . : ' :i ; CST : i: : L > HhY ; ' . Har h pe - x 0 oi TARA a 3 , ) ) G ey ' 1 F 4 = Ar' }ryis: LYS y} . T Pe A 3 , : -- IE od Xo 3 ; pia 4 , p- i 3 A. i Lal ' ' SJEe TAEpa, | TREE ~ EEE BP PR A Ee Sers '' RAa cianeX p NA m So a ' Tphl SHEET VATE ghey 2 63 ' S" ble 4 : : hak 3 :A ' -!be Es i4 4 ' 4 TAoDi | J Se RR 5 gx | EFeEe ak s RRL ' ga BE te ace Dt 196 4 WR $3 6.) iy PO \ 3 Py BER ra p HL R x sy p4h mer i -- Fo - Ede i hy hh 2 ' ! Fo 1 "i A " hi Ph : af i : a le , Bh th 7 ) he WPT ! ' isa a, CE ' ep Tr EAE ' `e Jd 0 " ' 7 he c ' os 5 ' *' Pa c RTL gs s 43 2 4 iid, 35k $A ` To hit N A Ae i 0 LE Yeni Ek od 3 [EE 1| 4 TE g : al A[NRY naint) gli2%a.CiO.P fh E4 2 ' ' J a 4 oi 5 2 Lin a eh A i : fa Pe EE er 8 9 ia : Ba JAN CYS EEE ' pA RS he iit = x K 1i 2 151759 o y i 4 ' - 8 ,ow . N RT '. Wai p +% :/ ! Pd 3 pe SCE : aIE eT ' st A : AN ESS rdFi 2) oo) ' EGR ' . q ps be fine oC ' 4 HE ;' e4d Lb i puSnLRt fy :' 5 hI Valk" s SPorI elETuaY ] SREEe EE is ae SPeH R Jp ' . T T RE EE ial aa i cre ne td : | a Sre a rmcr -- G2R30-- OR-- M ') ; ee ---------- 15 A ; '' hd i i [3 i a s 3 v. 3 '' ~ 2 hy 1} A ' , A en i vig ke ER ' >= '' R= l JA hE poiag TR : iS Pe RR, ' - - 5 : ol "3 zZ AR = Eon a ' i SNA pi ad : y TW % Nog LH : ~~ he te he d SHY ie aHy i i Trl EMSERICrES JeTJG BN I+ NaM AA 0 EB RPRESs. ; i : 2 : E_ aS, ead re a Ai Si tM Ya aS = [ET a8 7d. } - T1E Hf Ch 1} Q - i bw a Zan 498 wa = 3 oe RE Eo 0. 2a age BG pe EA TLAENE AEP AL]he Ansan 3 sseaead a ---- ok : , Ee : y : re v f : - be | ; Kl Po, {- bs ' en rs : LPR ge ' oN : : i Ei ' :. no Gay i ' z 4 Gi ne , BA OA os43 =e SR8 bag 3 Ef "HE Ld i : f daniee } oa Ti F ir ot i po mre YN vo * ah y Ro aA ale he a Secs ? 5 1: EESSE es A . EEN ES w by g , Wh ' i "SA : ; 4 i a iCo ki eETERIgEp T ey w " bs * 7 oat H1 i= y + Pal 4 : |I | p #1 , EN " vs BC AngE TS 52DR , Me se Si Pt etPe 4 cL be we G ---- Ci ," ~* pe er : 1 . oa| . TR " a : ee | Ee Rr ' : CN PRE NEN me GE N 3 :' ` Laie [10 VC aE V ' > Ne ; #5 ! Lo AE, ' Wp RN ? EAs ..: AE -0 gt .bi3 by a PFrEeS e : , (x o"A img -i ; ! ' =faer CL '' ' : 2 2; / erwee Somers Tore = an; al J 3 Fi . bd : : -: ii ICE i L<, 1fo-- } ---- -- TE -- -- ) arly 4 ps ) = Ty gp CY : LRT "i ee ---------- * - = - 2 Wien b - fa 2 / ra - Ra 44 | Bs A wil 8a ai .A , TIRE BEE - r RE h HE . gE J EI :. FREE Spi e rR TE ; its . Bed i , f= A ' RN ! a fi x xnpo cs a ~ dy "* iCa : ; Lfe &\ Th Fong i] ERE r en y eR : Q) 2 E Eg y : po %y -- s ' : : : : , :2 To Ghar dg 3 LCi ] A---- "a Duh i ; bi3 % a TE LTTE 1) : a Ahi : EASE Sb Err Dern SAR PGA 2 ee v= i in Fo , MaaWeay Pa : 8 ! ;' FeTEENS + nee i NEE "a SERS ' ; = ; Sd Fa ay # ee a -------- a, a3FF "Ee T---- CR ' alll rsei. ad : ET LacagekA > Bot il ! oe ki ia 3) i yt' n* dl] t= 5 oa :' =TER WeT,p THEE - 8 :: TWee JeeENS a fo a Da pW, : =v : \ ag hy. 5 5 ri) Led pe pi nee Maa > Bd + ar i if i bi jig ii } - | 8 patie lt ar hy | a 7 i > # -- 3 3 ie qk ) -- ES <r "= aml --4 4 : lil, * La : - - iH , , Tr CA ptN 7 E[ELcR ye ~ , fi re v. ag! TEES \ : [ " | Hy TERRE : A CFO y hd BIN "Rs NJN REG  " tn ME EEE ': aSrLEsa jE A SE) Iubae 8s ve DONS oy 5 : r3 -oo > Re T LEoiHlEeOLT h yon IEEE BLAS " 3 gird La ed 4 y a ; Rtpweincaa tATN CHSC FFR ES bot) E 3iA = : AR Ts , mone ol od Eo 4 ' . JiHE2 AT i " i RG E TeRlE =e ANE 1 ,' E REEE oe Taai e A A by ke RRB ' Hie ages = = RR i . .. idi EE A 4 = 0; %i M .tsid , 5 rl ; Ie------ ts _-- Cd 3 Wy? pA2 HWP g Be | Ie i i hdl, FT aad | a ma e E jee -- ST ---------- =C : a oh : a. a = oe 5, 4 El ; Ea caFR CRE ES) Rg Dp = Yi + 4 PETE pret Xdn ek : ws Mae. ol it+ (RAR on Ey of iTR ae A fo : CTT RE if &l ENS Tan eye Ee e sa ie LI) ik ri :WVEY i A Pb OR MR it: 0 $a % AB a RISE BARE Ei TERETE sak Roch [ol { Sa Ven wgiEl ELe | J [3 PAIR Er : I NA ow Le BELNE E 0 CT ILRI | bo % RR PrESana iAR SOV oo ': ; 1d ; SPP N= lt GEER k NGL PT 3 5 Rie I SMW, a oko silks.pe 5 2% AE -------------------------------------- 1 EEEkl i 22 [RE iRAEEy N} i" i! da ! 5 . Tage EE oE h ai - ih Ww re % : hh 1 iE TNS Paes B4 # ' Pproc:exa rEEYSTETC WRN : Bu JER 531 i; 4oH ; is, TLeTy sk ea es [0 i { LL 15d 3 & Hc bv7 7 1 : WN nr IY ' giird i 0'5: . a. vz vg it 5% : HiPlE). i]d 4 SET plea b i - A TP i of *P ; " ol | i ey, AT 42 "' fh V2 WS Wi . e ORNATE AT by 3 I oOcodB " p hadi he : RL FRAY {3 EERE PRA RARE ag 5 3 ai ail te. ie Ta iL : RELIES The CI WE 3? > v 9 af: d haE a e >, J rai ) ALeT 5 .Re : ~) 8ioik oo , ;J.Ab Ba ; | : ; . 7 i fj 5 A, g| POR a 4i a E01! 9 "Yi ) 3 . i UR 5=. H v E, : L it ' i; e =iRae e3y 2] gs '') A 5 N . GgT.)Ea ToL y nh < ' ' : d bo yi ve : x a Ln Fr 4 2 Pe yk BO a | adi vy " i Nw . ARI K # l >, vib i : NE EEPR BARTR 'y ye Mk bi fc Di | PIE - ; ut NN } dl S N EE od Vt RT ibu S ps ioobl SfliTaS aeat3aASE PMR REE " ~ 3 nS a" es EX AE : er * ) A NN Se an ; > ve < > WE Cd yh ad )irge ALi OXlA V rn~ E por? ry A tO i ho : Pr Dk: CN BVrg 7 cl Goa EL a Je Pp wel i ka id ahd 0 EE i aS A BTLAO. ! `Cl AE SE es : 2 7 2S of 4 i i ih di(7TTIE SENNE B/N Bg oo '3 is i i ; EI a : ' ~ > ! i 2 A fi58 aO4A C1F% vf ae pei 3 bg h (Seah: i, ht Gos es ; "we e 1 : EE CEN fr Sa AE Uy at era ' i NRTA PLAFPTAE 3 t aa A ER } ET hypo 7 i BS on iYyq &r;ga Ige EakB 8 nGn Aas ba ABLA 0AMA Ag Ss. o. r ' i 18% 2 Pe aay E ; LE Ris pa % CG bv A en, x Al Koll FRI N0E, S RN a IC oh THUR KARP ER ! AE Re Der, 2) [EBA Oe AEE RY 'g ' 5 SO iTeET8 RREtiNYY REE a i be L) i] a Si Ri!SEhiiR BRNEe a SRN vi? 3 iWeSr in ERTyRocSiL pphar AeT fp Bes AI TR > ': TSg LEADSEoeNT ARO E dA e Tase h,iCa nL Loye ' .R 4 NURS 1 i] i Lo aT ANNE qi psa : soc FERTE afin Se ENt vAR a OY Boa 3 ld li | FaRR. RATLE iSdEl EP a :R dk we | a bop) SEP) Lk i TIlEeS ua ed VI A CF iS a Ries e vil paiknec s nCEape ee : AS EE ES Sc. 1 5 :y |H H3E 0 gaTE ro g" 5 | a a 1 5 ad ONE Si SiN / ed a Se Fou = * ) yet Met ah OE ETI i SI a , ) ARE A FOR , ' A 4 MT ieSg r ig, Is ngit k icln a RCR OENEEt 1 i| WARNhi fa Rear gFR in # . : SIRI ah.GO Hi A EE A------A ------ ee -- oh en A NM CY RS 's fr a . vi Sd fa i 7 " ERT. AE. 8 J oF HEN `8 v Ko Ie 2 i Eh i: CRPid 0) high 2 : bs . Jl p"'es: P3e va i 5 al N ' if3 il [5 ' yEE " ES : E 4 & PULL: i pe3oySiES. E %: grog : 2.1 er -- ' ori ' ' 3 ed dy i ; : ; 5 I i PR EH 5 tt Shi " R g * . Li a 3 ; J, i a od ARLE Fo , Cally SE ! ds 8 Zoey 4 fos ' % : awl SR 3 "8; 2i 3" > 3 agiyg 3 a Na-- " : con ASN a Eso WW. AVEC i Bet ERT fh: Cy 4 dc vs) i C3 2efai Wag Ftp eT ei 1 '4 J ; = ' ' >) = 2&2 L $9 ! ' gt i EBr 0 ye A %" el 3 od.JI: ' Bs b , s ' ' - oH prone ' :4 yi 2# i ux E ks e a eee = a Re pi  )) a : } , 8 aNeoaT nw, TA ' fw 1 Aoss e > #L 7 S ' ne Ba ") y Y ; SPO. Aor CONE | Bo RN '' ' COAL bie i ' oi a ( fe BES. vim ) 17 | Led RRA #4 ' T } Nel & Fie 7 :: M14b P BaerSSe : We 5 pe i .': soRdelA RTSN upeE r BAR RS E [2 o 1786 se ' '' ' ' ' , [4 > I : * : o :3 3S : e. Tecana FaFarm HeedHealth Invsugtion Cate Team Report NaHemred:Inve`Ws ilb--tuBrEieaerfglCaTatenttnlaeni-tDoatne:~~ April 8, 1999 Address: Rou3tBeox 17, Washington, WV 26181 {Derived fom itrview of Mi. and Robert Munson on 4/8/99) El Tennant by Ds. Peter Moisan, Lisa Heller, PARTI: 1998 A. 3 History from last calving season MoNntuhsmdobufrcieongwrswhiinchhecrod,w1s9c9a8lvceadl:viAnlgsleayseaorn.s19490.8. Numofcbalveesborrn: 35 Numberolifvec.ows calved 35 Abortions/Stillboirn 1998: or58--16._5 O%thoefrccoawlsvinegxpopsreodb.lems in 1998: None Sickcawleirven1we9e9as8k:aSncdouhrasd: enAlboaurtge6d (joNinots.deaths) -Weak calves in 1998: Several Other nesserinweuingwhetadnueridngcalnvuerssiinng 1998period:. MBoisrtthwcealviesghwterweraesslloow-wignrotwheincgalaven: Aggeeaat wbeweoaarraniinnig1n9918998: $mos... Nuomfcalbveseweanred:330or %ofcows Hinessinexlwpeeoassnede(:d 5c7a5l)%v.e_sibinn1o19999r58: A(flal) lcaarlvesslwelnruressionlgdathtewceoawnsi,ngtime.Afew B. Cows OTcuilarnidniecseoaswses:isnSo19m9e8:c1adtceiohwsavae dparpkereeaviersn1we9h9ed8n.pu in the hollow during the summer Thedarker eyes resolve when they are kept awayfromthe Skin disecarsee:ck Some with lesions around the coronary bands, Thought be "mil" Diarrhea: Lameness: ACfoewwscsoewesmlhaadmediianrcmhoelsdwdhaemnp cwaelavtehsewrere(at3h-ii4s?)weeks old. ROetshpeirrdaitsoeraysedisienas1e9:98:3 cowCowss haad transient cpistaxis ianlth1y998t.haninearl Treatmentsfordisease in 1995: Alumto cows grgaorlicufornwordms. for calfscours. Treated cowswith Vaccinationsin herd in 1998: Nvonae Brcucelclosiis natareinotdooneninWsY. DignetNconwe.o(k4peyteaorrsamgeod,i1n2dblioond s1a9m9p;lesnwleardeetnaekcernoapnsdyposioedodsersoalmopglyiwnags Estimateid bondy c condoiftoironbnrsucc coerlello(sBiCsuaSnrdsalnegpetios1p-9iv)roosfiesc)o.ws Same 15 1999 May havebeenslightlybetter BCS itnh1a9n981c9a9l9ving < ess on AppendE: Herd Hest Husory 06 -- 000870 corsier RGS000950 ------------ :Kd Teenna FarmFarmHerHedr HeHaeltthh Ineo C. Feeding Histor Cate TeamRepor Feed 0cows during calving season 1998 (Include minerals): Comsilage.Ground . 3 sE`alrcliyoghmilhwyiitghhmsourpepeptdlusreiomngnetnatg.seoOfdrsccwuhesaa.rtdh3egrrpasos/tuiomnoftgdhayi/sbrpoemrec/KoYn3.parfessocune ohayh, Feed 10 ons in winter before calving season in 1998 (Include minerals): Same as dauyr,inwgithcsavhinig smeaosornewidtuhrihnigghceordmiwneerala, n3pounds of Sri per oan Feed t0 n`umirnseirnaglcsoalwtsTduOrNingsalgtrazing season 1998 (Include minerals): Trace Feed Test Results for 1998: None. o D otter Other cohrmeamreeendtwesbrofesor2d0e1c09r9ce8oa:wsse.SdifnSrcioelmatgheSe1wp4arsoabcfleredme0ssnfit1rhs9et8ses8t1oar0vt1ee9d8iins1rh98ee8,noWtihveer,acS1rs eaoasgse i > a1mpo9pu8et8aht.tehdeOrtteohhheaarvcevoebwpesneenu(m11o57-n620di)eaw,aewdriectcohiwsrshcilviaennrgdi.anbgt,ohufeetndvie2er0d,0,acanldvfeso,amTihnegffirsotmotdhiee - -- : PARTI: 1999 A. History from: currentcalving season : NLFAineurtnmsigtbctceihaprlaovtofienfdrglc:eacosdtAsibcnoaignulvthsieenrMadgas.droinc1th9e1991,i99n5:1c1a99ls99ve99ia:ntgAfbsooenuast,son1:O9c93t89o.berNor1m9be9or9rofaaees born 50 fur * Numofcbowsecalrved sofar. 7 or_IS. 5% ofcows exposed. Abortionsssttilillblobrinrthins1s9o99faranidn 119p99l:ac1esxfoOtuhnedr wciatlhvoiuntg epraodblcaelmifsn 1999: | : OStichkercallivneesssinin19u9n9w:eaScnoeudrscalvNeospei.n 1999: WeAakfecwaolvfesLasitn a19l9s9:caNlovense sil nusing . olowwserotnhpaanstoourrmea;la.relCaolovsees.Bairrethflweyigthhtisnabrueratrhoeurnadi3s5e phouendssaondaoppear B. Cows .9 OSHckiuinlneasrssdieinnssceeaoswes in 1999: None . DLaamreneesss . APCnicE. Herd Het Hisry 107 .IJ ] Co 000871 eo Res000991 ' ', Tenant Fam Herd Hath Tvesigaion Carle Team pon Respiratory disease: _ None ' cows Otherdisease ainre19fa9i9r:lyCothwinsare healthy in 1999, so far. Owner not ices that the `Treatments for disease in 1999: None ' DViaacgcnionsattiiconwsoirnkhpeerrdfionrm1e99d9:in Nheorndein 1999: Include necropsy or blood sampling None `Owner essetaismoant:ed body condition score (BCS. range 1-9) of cows in 1998 breeding : Clinical BCS of cows(average) on day of herd visit: 3=3.5 Range BCS 2 - 7) ' Fst comsicieh 19httr nd sn . C. FeedingHistory asin 1998. No sage . 3 Feed Feed to 10 cfoeewd,s cows disnuamrweiinntaegrriabnzeif1no9gr98es,ecwaaisltovhnihni1gg9sh9e9ears(moIinnnce1lru9ad9le9 (mIinxclude minral) minerals) : Ground : Feed Tex Resuls for 1999: None . D. Qther s . Ot her cohmamseendtescrfeoarse1d99b9yto75d-a8te:0I%sseienmcse awayfor reament_No new cows ththhaeatewpabrtoeebrelfenrmospmwuirtcthhehasecldoainwndsfipallndwacSaaslhevtaaeurslsed ' . BiBuutllllhssprhweaemvrpaeentu'urtrcbehecaealnsveesdsekbinoor,19p9o6f,oorrcsboitrmaealetdoeedfr,s6, cbTauhltevcreoseualrdehraevepoberaetfn2sinnr1g99h5bors . . . . . . . . . . . .. AopendiEx H Heli Hisar 108 : 000872 = _-- Esme Ras000992  Resutsfor: Tennant Lactating beef moveL 3. (Raiion Nutrients Supplied 3MnEdARveaiqlulrMeEdRsad Difference MP Avail ow Wealw d n Meala eal5 g5a [|fpaenriceernatanietserence Tw 2s 7 ww pregnancy 1 1 20 o [[[Loaucntnatieon -01 e7 6.s 3a20 intakeeanidsPerformancePredictions [oRwelesnutveeroedm-% predicted: 66% Target ADG wiconceptus @ [V|Pi AAllloowwaatbilee GGaaiinn : | AiowavieGan 233 oss 110803% Ibs 02 sis "00.1117 Isoisisa 002 sis EPrnetde.reMdaFxorFaogreagIentIankteake MMPE AAlllloowwaabbllee MMiilkk 2Da4yAslloolwoasbele1MCiSk, o@ |D[iEertieCciovnecNenOtFrarteiqounirsesand Rumen Batances 31 sa MP fom bacteria @ I[NEOrFeciinvoetNoOnF supped o517% aOims MDiPeftt?om unde eed [[poemnee 016078 MMCCAALULLBBOOMM DSoIlPuble Protein oiet Nem 067 MCALLS OM Total NEC ination @ [P[rpeidetnReugminaiph 09 % of r50e44q18uirMemCeAntUsLBDM TPForatetadlnicNrtaebtdaiolMnaUn(Ncoteal) [[rrumeinnaal N Balance [[rimingan ue 22m 79% [ETI %ureFaorcaogste in ration Ration OM S |fimmines 220 ioe OMittain OM - Predicted Excrstion : - Nexcreton. uFreicnaalry Pexcretion: FTeoctaall uTontaalry . e[RIlactoieosnmeaComstiskpssion reds 102177 ssiwt.y TCCooossysocywat,..AMWAPEsaatlllooowww.. mmmiiilkkk ~ -. -- _ 000873 121159 MP9aRea Differgeence 054)| Twos)| 6o 2 3 s s43 112200 s3isg 1337 tsossia 133" bs 418772 ggiaa 8s6i% cOpm 2T3e%s ocpm 47% OgaM 070105% MOcMalg s11oX Maint 0012 Isbsnnaaid 50732 gIbasrnasid 28.01 3 ggnnaras 1j7.22r75 Siow Siew. 07 ED1517%0 45000993 . _ . . :: SEFp i5s3t7eEs85s5s0s5s2sReRsRe0ey8 7 2. | 8R38888888888%| 2 387 &8 ~ 8, B33 : 513038 /8888888S8E8338383335358f) =5 Roanse = zy " . i 2 i 3 ss 83 3 i"i FHEEHE : H $51E37E033388888388R0F . i 2iz3 : 1- 8E : g[eo8voR~ Po | s 8 fEzi,Eily 3 |[[FiaggEaics @SEGFsifisdifzazdzaznzazcznzaddsaanllklBoaazgyieidd . ] ___ ooos7a EE . - no corse Res000994 -- . : General FaFcatromrsName Tennant oer [INumberingroup: Lactatingbeet cow 3651 : NOFcapac UnFeiess Entry Basis LaMeadDay 1 notew 11 hEnegriessh . aeecd heLsosses s 0% l1ondymater s Animal FaCcFitlaoereNsame Ci\cases5tSuednyteerstto FASE ' mal Type ge : Ssooy gn 0 70 LMonathscbetetcaow(trciicnedmgik 4 Cow areved iType 900LeLsot many a0 1s ': BOraeoneddntiinogineSytSsetreem 32 tov tin 52atwencross aa eos : Caanmsssatmateernal wvi 17+ hhoeglsa .. : SOaurssPSroegnaCnatvey 1i8a 00 voauss ow : eRworeiaogrseHreisrod Anvecraagey(6a) 002o0lwOslan orhetreeracteTdovanes x Et (cay) 000% 38 :" eamnaggemenW RMtiellkaPFtraeocttete oirnks (Pdariordy)e assseuamne CP 502 0%1s o 1T0a35s83 : Gsavauenasas naty l ppasatusreiraelmoawsasnce 0001 Ancornees ooumeoM :: SFeleaecrtovnsPorreesssetfo growth 16407 b1OM5a5ccte 22 #aof TgoaFmeaeDsaslpy e eT :: Environments Faactnors rasp roteves 5 pn . Preovvoesss iTyemperature Caren: Temperature 040 %DagressF 20 Degrees? S : Paget srs 280m To 9` . 000875 eorsirsz Reso0099s --_-- 000 . . S . SCuntrreti 0? %enozeyes . Niagna chdtoCnooling 311ST te=rinzoenmo egm2anrim=eghewmtociotca tolinhnigonss ::. CCaotreTSesPaaenrtsinaegt(eHewateTSsespsna)ts to1l2JI STc1vi2eno02od=1arpniseshnnalowa,.3c=otpenmsaonuit s vimatAvIeymooertcesrysooncages 18slsyeedorme and sane ae : 2s Distance walked FeadbunkSaChtoaresocseistcs SFlaet s sfio e 6562 fetid 920m) inicNhs sstance bowen com oe Se race a Tat Gon : 2 Age atCa1smt caalmviengnt amen 24 months. . :: fo [Z-- s 9:. 000876 comm F-- o : FRosutsfor: S: tion NUIents [Totals 8I |SHE fain @ [percentdifference. Tennant mLaocvtaetsingb2eef En Mrs Supplied and Required cal hoals 23 Ed o"reesss 0 A: HE : 12158 Jq.a Mpg oternce a= = Eayo2= ="nM3 @ [om enterea-% predicted: 85% S88 [FE[iahesnmeas @ [Retative Omi 203 100% Iesbss SSEkRe Pred. Max Forage Intake Entered Forage Intake hheemmoer 120 sid 120 Ibsid. : oiwe [common ensue.HE mem, me oui 11 MOA Jou DF Sone 8 fn [rumNisantaancle :: [2i0gciemditieAnxsgcaLsevn :: fe [Ration Coss HE Sim 9 lowe pocucton : Frage l 4 d%ofrecTon 1380 " 017 say uo Ureacom 022 J wus Dinens pry Weston: Grany 0s2peneads xcrton: Fceh aploers E727 [T Sma oma Costicwt, MP allow. milk 0.95 Sout "3 000877 . . . 3.. _3ylgssennigssissrsissetaannecegp 3*3 3lggsAsesssssssssassy 8 : Hl! E533 EE :. g 53/e 883883523888858[51 o[Ro=n 3 : " : : gllreeeseseceeed |i] g3 i | is ' fl| eccecccccaacas 58:552 23 : iii FR3iEi5Es8 &3 g$lirccccccccccecd 288% ' :: 3; 333388888 P gt Li zg MM | sPlieizs3s 3 Uf 2 is 3 sss oT : 8 ies ' '' FE Sg a, biio is v voooEga fE i 3S| s EfSaHdEeRs : 5ciissdaadaadisiiflEssuls : vA. NE i. | `g " -------- Res000998 Results for: Tennant Ory pragnant MODEL 3 UNIVE Mbximum 1215 regrce [FS asten u Nuttaup te ae nMdeaRelgoed d MEMRaelaad PREDICTION EQuains Omifceraence MP Avail MP Read Difteronce [TPoarracant aiftrenca [PWraeignniaennacnyca Tox Ts LP5 7 [g=o ge=| ve = 121.0% LaGacitnation [Reserves "1 03 aa El 4 s 2250 38 a32) oa 2s 2 o5 is 3 FRRinl (OI[[nROMtMeaItekipenvrateeneiOdrcieMPedear.fporremcaitnecde:Pr8e3d%ictions Target ADG wiconceptus 118553 baaitaa 100% EPOrneMtde.rperMdeadFxiocrtFaeodgreaCghIeansainkete)ake 11220 0 bsig IVMEP AAllloowwaabbilee GGaaiinn [AA Allowable Gain 102234 bsaita 182 ibs MMPE AAlloowwaabbilee MMiilkk bsg 0000 steisida [A|CDoGnpcrepeigus weigh &Tissuo 005588 bibssiidaay 4386 ibs DAaAyAsiloolwoasdee1Mcisk 00 iowa NEa tOtFecitnvreaiNroOcnFs supplied0 fume ances5817% ieoswtaa OM letwe MMPPffiroomm ubanctdeerieaed Diet cp 7172 ggaa ooiieet NneEiM [Diet NEG 015097 MNCCAALULLBBOOMM 087 MCALLS OM DSIoPlae Protein Total NFC in raion s8i6%cOpM 2138%% OcpM Pred. Ruminalpi 6O4410 MCALLS OM TFoattalinNrabtaiolnan(coeta 4718% gOiMt P[ReupmtinBaali. N Balance [F2i0sdtmiimintgigAAxA::LMYEST 22 98d %roefqm uiTreements a50 em UP%rreeFdaoirccatagested MUN in ration Ration OM 07210% OMeMats 0% PredictedExcretion 1259 vim OMinain om 1.1 XMain Nexcration: uFnecaarly Toll 00.12 bbaaanda 03 banda P excretion:UnFiencaarly Total 30083 gonnddiaa 31.1 onda CRaotsiuosnayCove `Sostiot mitk procuction NA0.17 sSiiaoawy CCCoosestitsoowTnt..AMVAPEalaalolwwow.mmiillkk #RVA ASSon #NiA ; Pposvdy iow ns . re. te cme . ~~ pisses 000879 RGS000998.01  e 2f5/B8lgEersEsEEEEsseEeeLyLazyey : pNP 33 85%888888338334]s] 2 : : a ji iTsessasssszess o 133 kon 2 [5 bo ! [A ] ' 2' igimme ; osseececy 5 z| is 3 ioceccrcccccans 5% 58:2 & ' i: flrccccccceccces FEa3i2t% 3 ESE } gl! 3,315899533388388883383833838fas8l8s8l ) i ) gis ) Edy sigs sin Fre ) ggie1I8Es:E2 ) ) J fa, i ) T:5f8igEas 5 H [RH iE3:b sEEHis vo dHiBhnnnnki at ' ScifsfiidadagisisfEaseuss ) ' -- . 000850 -- 5 ne corse RGS000999 ' ' ' ' ' General FaFcatromrsName Tennant : NOautmberin group Orypreg1nantcow UFSoIRNacGe MPARRE)OImCemTIA ' Daysto feed NOF capacity 35 1 sotew EQuarien : UFneietds Entry Basis LBHeadiDay 11 AEnsgFiesdh ' ' Mik Prce Feed Losses 3 owt 0% % dry mater ' Animal FacFtioerNsame Cacasestudytest 5 . GArnaidmea Type 3SEOrnyeCroiwo FALSE SAegxe 740 CMoownths ' Body Weight Breed Type 9001 BLeoet Matty ' ' CMoanteurietoWneiSgchotre Breeding System 9003 Ltom thin 9=v fleshy 2 way cross , DDaamrrbrmeaetdernal 171 NA 1 AHnegwluosrd : Dams paternal 1v78 17 Hereford ' DOaayrss PSrrecgenaCntag 2108 Days 360 ays Ow o RoalctiantgioHnerd Average (day) 401=dry ornefPerredcted values MMiikl FPartod(udcatiriyo)n (dary) 43547000%0 812 ReMliaktiPvroetMeiinkP(draioryd) a(svseueme CP 31 %ts 1645s3 Expected CalBirthWeight 5 2) ' ManagemAedntdFiaectors 01 none ! DGraayzinpgasUinuirteSazlleowance 0.000 AOcmteisbiPOMI Initial pasture mass Selecton-Pressure for growthimik 18470 1b1:O5MSaccairee ' FFeeeeddiinngg MFreetqhuoedncy 22 #teoffoTriamgeestgFroadnDsaelpyarate 2-TMR EnvironmeCntaafliFmpalcatnotresd 1 teno2eyes PWrienvdioSupseTeedmperature 405 Dmepghrees CPruerveinotusTReHmperature 3200 D%egrees F > Page 1 1201519"871.25 Pm --- Eos 000881 RGS001000 E-- E -------------- . . :*: . SCuaormecneteRRtHios 01 %tenozeyes 3 rane En going . fe 2 Jet 2-avg 3ethick CattePantng (Heat sress) fetilc i bdh o . : AnimalActRevcityaFluTnecmtpieroantsure (sptona) NTimoerspetntostnandpingsn ces 1015o suger IS Hy 618 rspcoroonry rd saan so) Sopea feess . FeadbunkGraraceistics oe : TargetGrowth ts Lenn bowen co toe " AgHeerad tCa1hsit ncgalvniengnt 264 mmoonnthss . , ., o . ,' o Pagez 121599 116 pM ' _ "8 eorsirsn 000882 RGS001001  Resutstor Tennant Ory pregnant 121158 MODEL # USIINNGTAMKAEXIOMMUIM)DRY MATTER [FRraotionNutrientsSuppliedManEMdeRAaevalqiulirMeEMdeRaelasd MDeifaertence MP A9vdail MPgoRead Difergeance |[pFearnceennatintcieerence nancy Tz 3 Ts 81.7% Tez wa] 75 130.a3% o [n om o [mene "To 3 1` ;1 a 38%5 eo s ya 200 zm) 03 5 i om] IntakeandPerformancePredictions l[O[oMwRIerpirevedeicrotemde. precited 100% Target ADG wiconceptus 1110880.55% bIbosidd 088 sia PEDnrMteIedrperMdeadFxiocrtFaeodgrea(gCIehniaIaskneet).ake o155wthssig | OE N[vpolvouasee Gcaainn [x[0AGAplroewgabie Gan 21.1273 sbairaa 058 Rais MMPE AAllloowwaabbllee MMiikk AA Allowable Mik 00 sia . 0000 bisssa [conceptus weig& Thisstue 058 bsiday 43.86 Ibs Oaystolase 1 CS a D[[iEeetrtiteeCcciiovvneecNNenOotFrrarsteuiqmousinhrsees.and Rumen Balances 13170 INOF in ration tkbssia MPMPffrroomm buancdteegriafeed [[ooeermee (Ot NEm 63% om 016085 MMCAALLLLEBOOMM Deter SDoIlPuble Protein Doing [Pred Ruminaipn 085 039 MCALLBOM MCAULBOM FTaottailnNrEatCioni(roattaio)n [R|upmeirnisaal N Batance 646 a297d %rroefqureiernements Total N balance. UPrreedaicctoesdt MUN o [[Fmrsteimimingaa wer 1566360 visaogn Ra%tiFoonraOgMe in ration OMMant OM [PredictedExcretion o Nexcreton: Fecal Urinary P excretion: TFoetcaall TUortianlary [J oom P Sosom mik production ma0.17 ssioiamy CCoostsut. WMPE aallooww. mmikk Costu AAallow mik___ Appediy F 521448 ggiida 845% OM 230%% ccpp 16% OM 48% OM 28 gig 07362% OMeMats s1o.3n X Maint 02 snag 00.31 IIbbsshaaiiad 2028 gornaas 330 ghaid A ANA SVioorw 4A Sion ny g eee 05533 00 ED151800 RGS001002  f"pigiazztaazeaiahy 27" TM eo 4, 888883883883833 8 ev 5 5 2 2% 333 5.3.i287%E3383s388283888388a3s8s8kF| o sHeHn == [ 3%5: 1" - |JFS . g : 53 2 3 a8 } glecsccccececces 8% 3 53:5 3 i = Bil: ire ireccccccccccey E553 Ei 3, 883383388832333(lff s i zzz 5 4g F g E ise: ER gPso | LET 52, H3I s HN E [idEE,58 5cifssiaaaaaiiaiifEiteyst o. _ 000554 - H 120 cour Res001003 . 3 --- - :- 22 . s. 2 . .o . . . 2 . EE a Hers Hs csignion Cote Team Repu nk page) . 000885 RGS001004