Document Jrw4E5jV8V2361Q6p4NJ4BozZ

ARBRE _ 124-0 DRAPT REPORT WASHINGTON, WDOROYD RCUONUNCTRYE,EKWEST VIRGINIA NOVEMBER 1997 5TE RY --T_---T-- I =SZZo33n3% E3z8< PREPARED BY: EnvMiarroknmD.entSaplrenRgeesrp,onsPeh.DT.eam ap U.S. Fish WildlMiifcehaSeelrv7i.ceH/oBrnnvei,roPmhm.eDn.tal Response. Team IN CONJUNCTION WITH: Mark Huston REAC/ERT offEincveiroofnmEennetraglenRceysp&onRseemeTdeiaaml CReenstpeornse td CONTAIN NO GBI 000003 USFW 0579 TAOFBCOLNTEENTS SECTION TECHNICALAPPROACH,SUMMARYOFFIELD EFFORTRESULTS,ANDPRELIMINARY 10 IRLNTRGODaUtCeTIvevOeNeenevveeesenecererceeeeenneanneannsaessannasseasnsssetsninrneinesnseannaanseenn11ss 20 MinETHODrOLeOGnY e.vvevvreeeseeessereretrsetnsanstnsensriensnaessanssassnhruseanseonssinnsesanss 3 1 - 2T1h SRG SOISAMPLBG+ ++ +vseasroenangeiiasn e ena tran ntsasen neesssrswnene 1B 23 Surface Water SAIPHIG + <ceennnnnnnnnsnrerrennrnenesiints 2 24 25 DrBinkigng WaStperIWBeEll Samoploiongeer+er+eoeeoevenavnnannnsnnennessnensssnieiennsisireTsrieees 3 PEE THE S Veg sT esnarFsetnssrienaroaevrirsniennnestnrsenatnetraesssessasssossnosers & T5 28h A Tn CT MA naseasR seane+rmrorrreenesnosnasnmsennanrtattaesaesnsssossosoen & & 2161 A Eiseniafotida(EarwToomryTmes)s =o 4 262 Hyalela ceca (AmphTioxpioyTde) == nooevee : 27 Seg EAs A 2.63 Pimephales promelas (Minnow) srt Toxicity Tersatsme.nn.a.a.n..e.ar.e.nsosoaosenineennes 5 25 SEES CEERI NEL Doel os anes ever garrans res sasevsersns susnr nin snsnsenmearenseseesen 282 263 sFiaemlpdlSeamPpalciknagg.in2g0,8SAtsispmyetna,lSTorhagie,erses erv=aaotdHo ianodinn,cgnsen+eeS3 2.84 Heaanld StAhY orn eernnneennnaennenienieeees 8a 30 R3E1SULTYSeon, Staoshes, andaSietrritAtTnAe recnaeertreievnrearneannecnrerninrrnreetent 6 - 301 BNAS Loieeeeiienns RP Te 20039 i LL 000004 USFW 0580 302 TALMEB o.oo 1 303 PUSARCBS 1. 8 S05 Toul Foleo. D S16 ORGIES LL... sessions D S083.1.7 TWoautlerOQrguainlicl PAINTS.. CarbonandGrainSize.of Soil asnedvSeerdeismtent rere 10......10 S05 Bovine Fecal KBPS..s.s see0 32 BlocSampling 20 Tie Ai ._..._.............eusss 10 321 BebeMIOEDEo.E ooS . 522 MBE..ose esses 323 FMb.rieiinseteteense 18 324 BRUNO o.vesisese sess eee1 525 VERE. esos eosin 1 35 Hislop seaofsmallmamma eesdKey 1.1.110 34 Toe TOME esos 40 SUMMARYOF PRELIMINARY ECOLOGICALRISKASSESSMENT SCREEN... 15 50 DISCUSSION o.oo sesiesesesenes eens sscrion nt ECOLORISGKAISSECSSAMELNT .................. overs 16 00 INTRODUCTION ...ooovese ieee 16 : 12 SBMA Loses 20 PROBLEM FORMULATION ee 20 Eoogil RAKASHEEN L_.L.._.._.._ oe 23 Kenicaion of teConair ofConca .._..................17 23 ExpCo OMSGEAGR ever eerroro reser 10 26 HardChancerizaionToxky ASGSDERS 1...1.1.1... 11 240 FUME <..seeeeeeeee 242 OEMS... sesene eee 18 243 AWBINE o.oo 18 , 244 ABC LLL 18 245 Benin ee . 000005 ee USFW 0581 ee Te T Boeroentere ernr anan BE tree nD Mange over eoeieeenenennnereenn see 12 TBs NZeaemeeeee teers 2 25 Beatin Semaine Asano Te Epes pps cv eeeonesseseecrerenreeneesesasenanenssieernee enB . BCoMa alc vernBret lreaeaennveo nsnsenrensrsnnaonraenanneannasnsanssnseeeneBn Te L35i.e1HTioe asmphiopodPrr(oHfplylellfEocremrea)spsReoprensea1tivcoef BeiceIcveeoroeobresotees eB 292 Earworm (Hienfoerda) as Represenaiv of Teresa Inverbraes 303 atest Minnow (Pimephales promelas) as Regreseatve of Fish Commu n 25.6 American Robin Turdas igroris) s Represenative of Worm Bis 15.5 Rated Hawk (Bute jamacents) s Representative of Caivorous Biss 206 S07 MRiendkFo(Mi(sltlpasvivsioenss)s RReeprepsearivoeefoCafsmCirssnairvooaurosuMsiaMmmvaalases 34 35 20.8 os RSachcoorouni(ePdrocSytounewlo(tBra)r1isnRgepbrresvecnaauidvse) o3fOmRseipvrosreonsasiMvaemmofalIssesivoro3s7s 20.10 F Meadow VeeO (Hicrans penU nsianicus) 3PsORRePprePseniPveSof HePshPiOveross 305 Bo AEMTNRETTIONSRIx eesveerressersearnearensessnssenssssstssrsssrtasstansrsnntoassssessnssssasrnnsnessensscehdll ate eee ete 8 i 000006 Wy . USFW 0582 42 Ong... 43 AMDB 45 BONE. eee 0 Mange en . ANN en Vadim. cotaserettatienrtetsrains seeteararenen end AB Ze eee 50 RISKCHARACTERIZATION .............. 51 Benbic InverseCommusiy SceandFmcion go LL... 47 52 Soll vencbrat Community Sucreand Fucion 53 Fish Communes ......ooioioiene LL... ag 54 WommesngBirds o.oo... 55 CamivorowBird -......ooooe 56 Carnivorous Mammal CTemestiallyfsdiog) LL a a 57 Pscivorou Mumm... 55 Omaivorou Mammal... 59 loscivorous Mam... $10 Herbivorow Mammals... 60 UNCERTAINTYANALYSIS... 70 CONCLUSIONS ooo 7.0 72 Benbic InverseCommit Scr ndFeton Soll vencbrat Community Src and Fusion LL. 1... 59 so 73 Fh Communes o.oo... 74 Womening Bis... 5 4 S15 Camo Bis o.oo 76. 77 CamivorowMammals... PacivorousMammal... 78 Omaivorou Mammals... 3 wun wv 000007 USFW 0583 79 710 IHnesrebciivvoorrooutssMMaammmmalal......snnr-esesesneensnnnnnnnsnsnrnnenrneenennsnsnsnesseeseesneeeee 2 2 80 SUMMARY....rceeeensnnssensnnnnnnmsnsnnensnnnnsssneneeee 82 LITERATURE CITED. eee eenmsns seinen e358 APPENDIAX SmallMamDamtaaSRElEt << +e 6 APPENDIBX . ARGHRSPEI << coonesrncreeesssnnusssssnnnnnsssssnnnseeeee 6 APPENDICX Toxicity TeHSg REPOTS c cnsss sees aeennnssssn snes 6 APPENDIXD. FRINGES ceva : eeseserrenennensssnnnnnnnnnnssnsnnnnnness 6 APPENDIEX StatisticalAnalysis o.oo eee arte eaaana ree 8 v iv 000008 USFW 0584 LIST OF TABLES NUMBER IME 1 ConcentrationofBNA's io Water 2 Concentration of BNA's in Soil 3 Concenuration of BNA's in Sediment 4 Concentrations of Meals in Water s `Resuls of Concentrations of Meuls in Soil "6 Results of Concentrations of Metals in Sediment 7 Resultsofthe Analysis for Pesticide/PCB in Water 8 Resulis of the Aaalysis for Pesicide/PCB in Sail 9 Results of the Analysis for Pesticide/PCB in Sediment 10 'VOA Cosceatrations in Water n VOA Concentrations in Soil 2 VOA Concentrations in Sediment 5 `Concentrations of Fluoride in Water - 1 Concentsations of Fluoride in Soil 15 Concentrations of Fluoride in Sediment 16 Resuls of theOrgano-fluoride Analysis in Sediment 7 Concentrations of TOC in Soil 18 Resulis of the Analysis for Grain Size in Sail 19 ConcentrationsofTOC in Sediment 2 Resulis of the Analysis for Grain Size in Sediment 2 In Sits Water Qualiy Parameters 2 Concentrations of Bromide, Chloride, irate, Phosphorus, and Sulfate in Water LT. " 000009 USFW 0585  Concemsaionsof BNA'sinFesalSamples un ConceonfMtetralsaiFtecialoSamnplses 2 2 CFoncrenetraqtaioudnsAeobfunFnlducaonriycdeeoifnBFeecalcSaMmapclreosiaveribrses n Concemationsof MeiwnSmsall Mammals ConcernsofFluoriniSmdalel Mammals Lip ConcentraintMaimomnasl sue Concemsaons of MetiaFlissh Tissue 5 Concenvations of Forde ia ithTssve n5 LRiepsiodlsCoofnthce eAnnaltysaisniFfoiorsnhTAsLvMeetalsinEriwormTissue Mu Resuls of the Analysis for Fluoride in Earthworm Tissue. - 3s Lipid Cosceniaions in Earworm Tisue | EL = Concentrations of Metals in Vegetation Conceptions of Fisorde in Vegetation EK LRiepsidtsCoofnHciesonptarthactlionigolynfnsor Tthiesu(eMeadow Vol, Short shew, Meadow jumpiog moss, 22d ; Vii footed mouse " Summary of Toxicity Test Resus a Summary of Ina Risk Screen a Risk Clculaions Basedon Wet Weight "i hide 000010 USFW 0585 :NUMBER LST oF FIGURES TSaIaLpEing Sve Nip Toit - 000011 _ CS USFW 0587 GeCrioN 1, TREICSHKNSICCRAEELNAPPROACH, SUMMARY OFFELD EFFORTRESULTS,ANDPRELIMINARY Lo INTRODUCTION 11 ohT ieetiieve e fi roc ars iproviri otpctiiwonlrgki2sn psefpipoorneeioUfoSs,nfEorviciarndsdsofvorogetragdeset A mT a eEe e O Be ewescel1eoslH,ecnneldkymcosscoos,ndwnaaitmenrbesefop,drrab0sco.ero)ecwndaoeile,eeidrnsisbseiacm,pxlTeoosef Cuz TsT aiee BackO paowmotrkin beef productonfaiinmalwioieadbcWiiegatdiVcnhgairognse,dWDforeoompdanCuosurnoyiif,NnWlaYen.drTlhReeaoswvoeserd oe BEe Eea s cbDaoiyu,pRTonnho.darDndraelr.Rrnac1flnihowssneahsoucteahes leope1osfraBremerci,opparamobhipiaenrdysowsw1,iddv2dee Ge Dr Re wiih yb assotd i he sores cere i 20 hMT EeTsHOO pDOrLeOGeY nis doceEPfAlasw1e9yd7)caseacsadUn.Sdo.neEd0PA10luprolovabidreodorrameirioedngednp0oedcoomofploenetei7B5ek cealomgcl ikdEsemen (0 oo heasafc,onNdomieraeru fhne 4f5ddwivefseigKtli,n,in 5siIiloen daproonbsehse cn repo pro 0 his acivain. 20 sooitl Scunpsliinugnples wer cowlre aic4esdampilecaeosnaldongeDrhyobRuen aand dneoreferiien2nce5sl 2a5lse e BEeebC e TFesavioorptaeuiwsneamm.epolviSnaangmhaserin.ssSaswnaicdsrmscaapnmdpoolniln4cyg sasorehadof.ssnnbiwRgreerpedmlieudcesaedtreogdvisisadmnpe0ol3dibdesgysg random mmbers able SE vcsisample es wede sollgcioid iEaRgTC3IodRfeEcooAnkCiaSrmiiinanccddOvspnoeernasTsOreOc)osfwienos rSOsPpa)00F0e 1ri2o.mSeo1il )| nnn \ 000012 USFW 0588 22 23 24 tris lc`iincosotm2mp8(pooTueuAaanLdrd)sts.h:mweAoTtdradCmlisLto;iosvnTaoCleiLsloie5ple.swotarisgcAaicndoivelcsle/egPccetCoaeBmdisp;ofonruTonpCmdLlstheeB(assVawemO,epClNe,heunotortdaoseli,lhcleaofnseduost!oAcrtcoihidteoEaxnstdtfrraecnatomabhbolee(cdBmfNoorAsupss)e odes. Sediment Sampling S2ineadinamneaentaprseaampi1leLsdeweeCnrreeyeck+.olccoSanemadpmlaiensaarnsmospnlwceeersreieasatesileoocnntesrdaebdisinae.DroynSRuiumnpn,lieongefwroiemef.ecrieoncnefnseatmcptleoarraac, ceptions areas slong he Sveum bed. AATthleassceadhmipmsleaenmtpwlaseasmscpnloimonp,gowssaeesddicmioennotowcdaeesdccosonlclaoemrcitienndtgfedotomaEleRlTotCyIRsEieAncCsheSsOHuPsipn2g0a416e,cvSodmriamoemnrnsnSeyamyaplirng. dcoilvliedcetdedotino htee yao ceca wrahepfpoerlroepsnreciedatiemaeesnsat,mpbTlroeiwbcuosanrmyoeAr.s TforcaheymicBa,l AareessI., 04AcAhtoenTnV,+ for ae os Surface Water Sampling sBSaoimrlpfelaseefswoaatimeesrt.saalmspalSneauslrywasecereseawcnaodtleltercotseadmLapteleorscawpieaorsness wblhoeiicahsdcfoorersnpeognddaediGi0eo.couBh. AobfLhiePespnesveoonnosedppiomnesnst ciVonOlCslsac)mepdalnepasliyoOsens1ea0 csoaplmlepercltEeiRnagTcCsaeIcdhRimEceAantCtisSoanOmPwpalse20en1r3d,epSdsuGreeoouutWhoef rn04yS5osmmpeicnsgm.d(WmnyesFaosspaeersgoooo peiriieoc a310lTyzAueLtdmaneftHlaoelrfaendael.yssiAhsl:laasln2almhpienlehsreesmsnaismiipanlsgedwTfoaAsLmcmaentlds.wesrpeTihpeerseesarenmeeddabsyusgaharhmp0essesoem sbTruAobLmmiimdteee,adlifrnoaratyeT,sAsLsuwmafes,sre,ssnedTrCpvheLodsBpsNhkiaAetsre,taenTalCsyaLsmePsp.leeaAwcadsedFoPrnCesBd!s.,saTmApClllLefwVoa0scchh,owcnahipoorsmemrTsoeomoenrr. cPehseTorbmuayrytAe,.Tray 8, Arca 11, 3nd Are 1, for we in 3 Fpl rome ren Wt(omaUtm/eLer)s.guurcaeolntdpecamirpavemierytaenrreislwliennrbedoemsgrepeseerssecCdeeinenisgt(a-(HC)om.raipnbHoa,swda)it.sereSvqeiuddicsovnmpeeesnre.bITumhmhmemetsemr wpasobwesd OrTVah)ne.scHroiTvroeeidomfertwoeamrswteaesdicIlngiasvsorepaapnyrcieoofh1h0eesanHdomsraeiordase0c3koeFpilroadnt:gnebnnaias wies shoapri Drinking War Well Sampling W2puaumtpelhiweanasdssahafomvcpel.heedSfawremloplmlebasddreinbekeniangpluywrzagteededfowweerlaeapkenrtieoed fTofeonsmnpa3pnrt3ofuamrtmra.clayPapraeomeomteedrsedwreerecanalyzed 2 000013 USFW 0589 25 Blog Suopling 251 SSS mmaallll MmaammmmaallsSn wyre colleectf fareommeom.e iaheiotompduptbremeadoiogneelslcbaodwfyercbeucorofmnppaeroveden1laofl1TsiAsL E Tl aeeSs ac.Dak SAalniTsadhOmparpapiinng aProcceedusrewSeOeP c12o0n0d,uScail aoumrmpaiSnagplirnegseanwdesPercoocaebsbilnedoon s3eeeseesccorispdedinJgs00he 6200amofpDlyy RE easeeaewToaaeioswawbtaehrboef poraneeasdsspetwtinascsopulrldosbdceo1ardnddioarettel(ipFngpe)eg.esdteToorbsey R itVeilnwpepvaoxeenctnsaodfpewanpsmssbleasatrdforosnrsdeoa.e.tJsAelnTlgheraevoogfapstwneeW.eeaepSnadccuheeezdcfkoi1er0d a a a a innyoensRenedscoowvhivrieyd mb avieiwnea.r0e Debunreinwgelrwveiaeprcdahaees,3dp a8mpssc,owo1er3res0 sagas we or proceso FEoOr exch animal, rio eo,rnpigdesarcDhaaoetnenfitsnb.g(eAIenepecppronsp)isyAh,)a.,rdyBtnodorydroommmeeayhleswsesicpvgeehlceivmieeirneenbdnigele0dbewoabddsey - onions of the a TE gamstroinetestipnlaalstthraec0i.td5.wdIeernxOetcramewnmedorovegerdseemforvvoismeendcatfaiconohdnssspwopreeeprcsaeiedmrcevsnleu.dobmgwiiSitceescadtli10o0annsapAolyfestecshset. By or bop Eseion, The renin Gi vis R oid sra t. moann dTAL meal, oa Tord, pres mast, 20 pce 252 VVeeeggeeraeaiioonnSowaamsplcivnaglcdFebiyaPharnofdotrofe.ossrTsshdsmhoaa:yn.syhsGurdapasrnsEgurRapTssCeIaRwaEeAecCbbeSerOnePdit2ia0cl3lh8 BoEeeeexvecoowfhnbtsamtponlssFarlls.iaAnkldee.slTwheeresescwhoroleelgelrcyouzbnyeddtpooorgrTAboeLf el fone. prc mone, nd eee pis 253 Aquaic Macromerabae Sampling s 000014 USFW 0590 . 26 lui. #MT2ah0cer3oi2nifaBaveunentrahleibcmraaMceorcsoraiomaipvlmeeersrbtwrceabrtreeaiccoeollmSemacuntgsedliitfnyogrweaavsdahsuaUtm.iSpo.lneodEfPcpoAemrm(Du1r9na6fi3tt,yE1Rs9cT8r5Cu,e/ruRaraEe,dACI1n9S5t0Oh)iPs smiienlvdelisimtmeiengttaetrsioan(m,palmmi)ancgrsoilieovnceva.teiroinAesbr(taoFtiieaglsurowefe1rt,ehredeefrienpeldica3t5esorwgearneiscmosllehcattedifmrpoimogeedach00of2 f0i.v5e cvAeelgnoetntiamgtehitaoennrdslaeanddl,,deDwb-irftirhsa0ma.ne5dkmiccomkllnmcetet,sdmhiesawlsaoudsrgieundegdi.aavpepTrrheoebxrinameeatst.ewlaEyss4cu5hecdreenpttloiimcdeattieesrcsoslwliseducetbimo2en0rdwgae2sd0 pweerrefowramnesdfoevreerda0w$i0f0ormml aproelayeatdyelaecnhesjaamrpsalnindgplroecsaetrovne.d wBiethnae70ovpeerriccehnrtat2e-psraomppalseest solution. p`o1wliyttehhitenhlyatlbheeonrpeaatpno.aryn,Lwaihregtsejadumbtprelsen,wouasgtshornwiesna,saeedniaddnodcbeledeartnoewaxalrtleaornwec0ooumdspplmleatcteeerddiiiasnlpserawswiheoinrtero1fe2mhoexvmea1dt8e-frirniocamhl prheaecnoarwdyeerdeaoninddaaienbnsiopfreecatdteodofroytrhabenealnoccwhheesshdteoept.oscTilhiieeglisyaigzieodarengndainfliiesfdmest.haixstoAonlroymosircaggalenevioesflte,shepniuocmrkegeradantifesrdmo,smaatnnedd ostragtaenoifsmtsaxwoenroemiicdeknnifoiweldedugseinogfhapeprgorporuipadteatexromnionmeidc trheefelreevneclesofadnednaifriecparteosnea.tatTihvee sCuonbtsraomlpl(eQwAeQrCe)idrenetqiufiireedmbeyntssoefctohnedtianxdoinvoidmuiaclatnoalmyesiest. the Quality Assurance Quality 254 Fish Collection 2tFo5itsaphlefrwleutorhreeidemc.aonlAulfcCatcodtfuffrrleoTMrmsbDairnnsyetrryRucutpinoowntsoe.rdeedtTebhraemciksnpaeamcpbkloildneygctbtrueorasdmheonccoklneesvrieswltsseodofufsToeAdnLnedmienotdapilevsriadstunealdd foSiptseuhrnawnteeidrnegfiistdhheewneicrlfeeecdptrtsooshcheociklneoarwe-asgntadlalsooonnneobriusncdikicevtiedvluelalledpcowolislteihcdtseiineginwsatttheuern.nFieedlFdofilaslnhodwwiiinvtge csaopledlicepismineoetnn.,s tswoaelxruoetnioroemnlieacansaednda.rleyrsVeuo.muecdhFietsrohtathniesdsEudeRewaTda/sRshpEeoAcmiComgeebnirsoilzwoegedirceaanlpdrlseasbueobrrmavitenoderwyditftoohrtcvcoanlfbuioerrmsafotoriroymnafloodrfeTbfAiyedLle.d meial, oral fiorice, % lipid and % moisture analysis, Tosciy Testing 26.1 Eiseniafoeida (Earworm) Toxicity Tests msFaiemvapedloseowsilwaersreaaemp5alkeoesunlwiennrteehdetaambkoeevaned.foorwThesveaamltpuelsaittniwgonsarinreusannsfleoorangra wpDeroryrioRmdutnofao2n8dcdeanyteesis,tn.tathFewohruiercfheorfientmcheee mfmoorirosamtlueiratecyhaanonafdltyhgseirso.wetahFimignueereasch1wdoaefsctashluesbemtsihtneesedoalfsrorwwTosAreLmnutmmoeexarilacstite,yd.wtaesltEoafflrluworsoiadrmepm,li%snuglieJpoicdra,etsiaounnldsi.ng 262 Hyalllo asic (Amphipod) Toxicity Tess 0 000015 USFW 0591 FFipoveeesseddwioemfre1en0sdaaamkypel,eisatwDwhreiyeRchuamike2e0fmdooorreaevliianthyaasaroaendfegirraeaoncnweamrpeihaisepaeocdahtmoof.xbiTechyeeusstttes.setdFwioamuesrntousfnwhoaers ora. Figure 1 detals the amphipod toxicity test sede sampling locations. 263 Pimephales promelas (Minsow) Toxicy Tests ToFFioveosfutrfofaocresaawmappteeerrsiwosdearmoepfl7etsadkaweynesi,raDatxrawykheRicufhonrateinvmadeloumnaoetriiaonlniitrynfaaefnradetahgceeradaormweiaaisnsoeewaactmho.oTxfihhceetteteesssttt ae emumerned. Figure 1 das the fabead minnow toxic fest water sampling Jocaions 27 Sampling Equipment Deconamioation . Tubhseeqfuoelnltowitongsasmapmlpilnignign heqefuoiplmleonwtindgpeucmoenraimcianlatsieoqnueparcoec:edure was employed prior 0 4 12.. pphoypshiocaslphraetmeovdaeltergent wash 34. p1o0tapbelsecewnattnerircinsaecid rinse 56.. dsiostlivlleediwnateer[arcientsoene] s 7. aren 28 Standard Operating Procedures 281 Documention . Documentation was conducted in accordance with the allowing SOPs: : _""EEERRRTTTCCCI/IRRREEEAAACCC SSSOOOPPP 4##244000000215,,, SLCaohmgapbilonoeofkDCoDucosuctnuoendreyiraiPiarooicnoendures 282 Sample Packagiog, Shipmen, Storage, Preservation, and Handling Ssaecmoprldeancpeackwaisthintg,h fsohlilpomweinntg,SsOtPosr:age, preservation and handling were conducted in _"EERRTTCCI/RREEAACC SSOOPP #22000034,, SSaammppllee SPtaocrkaaggei,nPgraesnedrvSaktiipomneerdnd Handling 283 Field Sampling asd Aalyical Techniques Field sampling sci and field analyses were conducted in accordance wilh the following SOPs: . pee - ERTCIREAC SOP 42001, General Field Sampling Guidelines 5 000016 USFW 0592 30 " : Aye "~"EEERRRTTTCCCII/RRREEEAAACCC SSSOOOPPP #222000010625,,,QSSuoaaimllpilStaiymnApgslsEiuqnrugainpcmee/nQ:uaDleictoyntCaomnitnraotliSoanmples ""EERRTTCC/IRREEAACC SSOOPP #22001163,, SSuerdfiamceentWaStameprlSianmgpling ""RREEACC SSOOPP #22003229,, SBmeanlilMcaSmammpallinTgrapping and Processing 284 Health and Safery RESULTS Health and Safery was conducted in accordance withthe following SOPs: """EEERRRTTTCCC/IIIRRREEEAAACCC SSSOOOPPP4##333000012120,,,RRIEEnAcAlCCeHmHeeenaasllttWhheaaatnnhddeSSraa,ffeHeteryatPGurSitodregelsrisnaaesnPdoxliCHcoaylzdaanrrdedoIsumssplWemaernetaSriitoens 30 Water, Soil, and Sediment Analysis 311 BNAs SurfaceWater TpAnrraiolbdyuustciaesrdyofotnBhleylsooucnraeftaidcoeentewccatotineotrnasioannmepdtlheeasnsftraeonsmdtaiDrmrdaytBeRdNuA,cosntccahene.nrterfaAetriesonancmepolsftere2taamku,egna/Lni.dn tLohefeeUBCpripeaee.rk RiEendcsylululhdseixnfgyoDutpnhbkiehoaBwlNnaeAa.laklaynIesniaasndoddifatsliuoknre,fneanccueommewparotoeuurnsdsTsaemwmpealrteeisvfetolauyknednIidiennnittinhfiDserduryCfaRocumenpwoaautenerdpssrae(zsTpeIlneCtsSe,)d in Table 1 and in Appendix B. ew t`JieTsnhtte.atsSiaevmveplelyreaclthaaTrkIaeCcntseartwietzhreeedTiaednerdnmtiiafdnieendFi,faihrcomdwewasevlealrnpoarnlokldeyuneco.endenooRfedestthueelcsdteiftooenrcsttehfderocBmoNmAtp.heoausnnsadnlysdsaicrsoduolfBtdbNheAe well water sample taken at the Tennant farm is presented in Table 1 and in Appendix B. Sail FrAelnfuaeolryrseainnsctehoeftnmeehawdassuorwdfeatcaeercestaoeidlparstoadmapunlceeessdtifamraotfmeedtwhceoinsmcoeelaanttderodawthisiotnasdojffarc2eo3nmtutgtoh/eKthgseaisnnudoeanaremdboefBdNtAhae.ntdrltethse 2or6en.feeoarfnedntch3ee0stauhmrpgeleeksA.rineaoCaInrsbosaialzsmo.plleDeiwnfa-rsboumdteyrtlecpcahttehIda,laaotanenwseaassmtipdmleateteecfdtreocdmoantacrceeoannrcteahntetoern,atoiafonnd4s1woufog2/2oK,fp2h7ie.n ethsriemeatseadmpcolnecsenftrroatmioanrseaofI2V7,srnedspe6c2tiuvgel/yK.g inBiosn(e2-sEadmhpylleherxyoDmphtAhraelaat1e waansd odneetesctaemdplae 6 000017 USFW 0593 rom AvefIV,eDsiaamchtpeynlp,ohtiAahilaaneesewI,Va.ssIdeeoss,cisandlc,tohopalnse,sPirAmsHa,tTIdcCics.oscaencidawonaihonkaorfapn1vi80c presenicnita Tnabele 2fnvdiaAfplpesnmdiex.B. Resi for te BNA analysis of i Sediment ts oif 'tessfewiltasdampclesifosm hofe BfNivAe schoe mapndois.o Doifbfunspahcaimlltoceatiwoanss E Pvectedie n theArae. aa IVwsaesdidmoNereontbcbsredaymrpRsliuneanahntseadednaAievmsleeinscmtoaImispeadomspucelondendiscs.meenvntertNrautsimafomnoeopulrfeo30i3TuInaCgyns/KoegifsnBhicimleusad(iLi2eend-eg . unknown alkane, coycrlwoatarelskaBnfNeo,uAnadlakiennyeh,sealoDdferheyydRmea,no`,steLrseoalssm,pCallrecskoih,olpsa,rnPdsAceHe,deaTcinad,balnseeddoi3tmhneendrt ia Appendix B. 512 TAL Meas ` Surface Water a yesiosof mhe msc.encttobrs,nsamarmrpeleessf,aommpmeiscDerfyo,s sTReuAl,Leiohueml,esfseearrleyo,scieGss.aelaAlmw,,i n8onndyL,essrCreeee.k snd vasadum ted in ny of th fered or waired water samples. mim, bain, apinemae,sfCitorphpreedra,wloaunem,isBa,mpAlcesoF.ppeO,rF,lm0eadnglazsnienoscfeG,aepesfdouinmde,tainlSsih0in8gh,er Do un rch range, including he referee sem, hao a Lee Creek ni ium,abautmne,ceCenadclenimnah,ieoonwpspaeoff,eifronn,snamRp,lAeso.En,O,4Fhmeainiegsatnaoefsped,eipPfcocibOeeedShamiSaghrlesrso2diaiDuheme.y Fo han tos mesure i Lee Cesk DDreaiunrinesTsaboif4thaenTdAinLAmpepaelnsdisx By. s in fire nd uniered waes samples see WeelllWwaatto eemrrasamnplsedaafirromemn,et,hesbnwederlyvaoln,atdhiceuaTmdemaiwuenmra,en cnahorrtommdiweuatmse,ceacndoabliiynlz,edhmeaesrwcaenulylu.nsftiaiimepcrlkee,d e esisfoth ering tof TAL mes are presented n Tale 4 0d or Appendin B. Nw ' 00001!8 USFW 0594 Soil eTShelrlseiemrse,pmliievcaeadro,sw4ua2srseBawsleieulnseawmipdleesnoffro drTeoAcamLiedfeosnusrs.DryAocfRuutientmlye,ladscsobwmmairunsmGaneedtsye gIl,yhs0idsiInVoAfr(eVms0i.rI0i9cs0oe)m.pdaAereremdei1n1e0d1hdheaftersnooilcgehmtaassmegsaanbesstchgoamnreemsascioocmnamsuemrteeeEsieno)s c(A5opcnpseTenAadtLiaximoenslfraomyisooefarasodFraerliineshosmi8s9p0e30aewseoeanestsen Sediment Sienervteehenkrseeefdneirmneetnnhctee ssacmuspmle.ms dwAenroiefDmsrouyrbyRm,iitc,edadnfioerw,TaAsmLaekmteeearilssLaseeyCsr.i,ck,Fdaiiovvdeeroofatoewsuarpolns VihneurmhoenuorrLe,GereCerricec,knis2unaplf,e,hcIlpeeaend,rnhtoempDl,yeRcIomnlco,rcnoepoeaschm m5 pon B aannd aimi6aigiinnns,ea,nbailayksries,,.oepoemsas,,Scs5nopaedr,s,cvovypabees.eoesh,raaedd.iMnePendBgie mrceo diesrsenofwishi oncdcslsinrdisalcimfeomSahmeplHeaadt:PeFsocrees3tTeneds o6fus AppApemniae 513 esieidesipcBs Water No peesttreeeorsPoCeBsmwsenrldeCsoeei3n:thee DvryeRunn sles the Le Creek sample, or Soil nNeospdeosuiisadmeploexsPTCaBbslwee5reAdpepceinddnBy,b Dry Ru mesons supe, oin he free Sediment iNonepesrtitceirdeesnoexSPoCcBsawsearmepldeeTaebdlei5.nAhpDpreynRdumBysamples, he Les Creek sample, or sie vos Water : NCroeevkoslameplea.raoicncoarbroenfecroemepsousnudesswesraempdliec(eHdalin1theADprypRiunn Bsyamples, he Les s 000019 i} USFW 0595 : oe soll To=reaicoDhmlrooyrroofeRituuboneronmaetetwsacasosnedcewetanestctadeiedotniesnctoeprdeainnrgeiepnvlgeicrayftersoiAmlvesa0am9Ipllestootiak3sea6nmpilnuegthKaesm.3ecaodnocIeownstraaaddtjdiaoocnenno,tf oSmaepeitaes/Kseo.hfesiNtLeoaaconCtdrhreeeefkveorsleanamclpeeleso,orlgoarsniuinmcpbcleasrbraoernfeecreoaemcspeeosunneddasimnwTesaarbmelpledee.1i1eiaReneddsuiAlnpspoefohDdreiyBVx.ROuCa Sedimens aArceetnoeaneetcwtaaebsdodneacttoe8mctpceoodnuicnnedtoshterwaAetrroeenadeoTifVe0cs.ia5emdupgli/ekaeg iDcrtoyhnecReAunrtnreaastaiImopInloesfasm,7p.le2e.ugL/eNKego.CorreCbcheklrosvraoolmfaptolirelm,e the Sediment sraemfperleenscaersetprreeasmcastaemdplien.TabRleesu1l2s2onfd the VOC Appendix aBnalysis of site aad refereoce, 3.15 Toul Fluoride Wa/tWelelWarter FFiveoroidseawmaplsen.ototdienttehcetewdeliln tahmepDlreytRakuennsoanmphleesT,etnhneanLteefaCrrmee(kTasbalempl13e;, AthpepereafderieaBc)e., sail FornuAodrrieedaecIwIoa.nscdTeehntetercaetteoadnpispneraatrnhgetoeDdbrefyrnoRomusnarimlsoeiwacdaolfolw1ya8s0nidgmingin/ftikhcgaenitrnedAifrfeefreearneIcneVcem1se0aaindhooitgwahlsoafsmpo3ll7e0sf.lmugoS/roikidgle BEAveauation. Resultsofthe soil fluoride analysis are presentedin Table 14 and Appendis B Sedimens FTFrvuoonrSiadmLepelweianCsgredeeaktr.eecateF(dl0vio8nrtihhdieeghDcrooynfcRe4nu5tnr0actmriegosn/kskbgerdainnagnetddhenfrUhopempearrelfoeTrrweinbocufet2ac9rr0yecmAkgb/eskdagmspailmniptnlhgees,aArrbeeuaat FSFlouipeeriirndcetrwoeaabsseinngeontdridisecathneecedteewfdirtionhmLtuehoeeriClrdaenede,fki.lwl.hOivcSeherdaiilsml,ennofttlsufosorauimdnepdlceiondncLienenetahetCirDeorenkys.RtuennRdeCs1ru0eldesekcorrfeeaatschehe ment fluoride analysis are presentedin Table 1S and in Appendix B. 316 Organofivorides Sediment DrBEeecnsaumvsneeieoadfiflmoyertiohfnodstoohlmeoesgeysdipiarmnodeabnrltdessm,asm,oplnsepyse.acifliTichmaelisltyeeidncsooumbitptaoiuonnfidnrsggaaanrpoepfrpiorpuerosireaintdteeesdciaoinnmdpTaaosbdulsn,edss16e.cdostOlhdeF Be Ga was analyzed for (Tewafsorocthylene, hesafivoropropye. ' 000020 USFW 0596 J : - vo cChhlloorrood-i1f,l1u,o1r,o2m,e3t,h3a,n-eb,exapfelrufolruooprroocpyacnleo,butaanned, 1-Chloro-1,1,2,2, tewafiuoroethane, 2Perfluoroisobuylene), none of the ``orgaanonfiiusaorriedlpeoncyioemdpsionuinTadbsslweer1e6daentdeictnedAipnpseinedseiBdx.iments. Resultsof the organofluoride 3.1.7 Toul Organic Carbon andGrainSizeofSoil and Sediment S0udmimnarAipepsoefndtoiBtxa.l oTrOgaCniinc tchaersbooinl arnadnggerdafinrosimzaenaanvaleyrsaigsealroewporfese5n.t6e%diinnATabrleIsTe1s7oa-i2l0s 1i02T0abalveer1a8.ge ThiOgChionft9h.e2siendAirmeeanItVrasnoiglesd.frSooimlgraalionwsiozfe 1t.e9r5miinnaLteieonCs arretseoum2mehairgihkzoefd 4.5 % in Area IV. Sedimentgrainsize determinationispresentedin Table 20. 3.18 Water Quality Parameters Wteamtpeerranquurael,itybropmairdaem,etcehrlsoriidnec,lunditirnagte,pHp,hoscpohnadtuec,tiavnidtys,ulftautrebiwdiatsy,medaissusorlevdedin otxhyegDerny, RweurneCtrheaetkcornedauccht,itvhietyreafnedresnuclefastterecaomn,ceanntrdaitniLoneedeCcrreeeaks.edTwhiethmoinsctrenaostianbglediosbtsaenrcveatfiroonms `tmheealsaunrdfeimlle.ntsOtahnedranpaalryasmeestearrse appeared presented to in be in the expected Tables 21and22, range. Results of these 3.1.9 Bovine Fecal Samples Sinixthfeecdailgsesatmipvleesprwoedrucettsaokefnthteo daeftfeecrtmeidnecaifretnev.ironmental contaminants were showing up BNA Phenol mg/ks. waAdsdidteitoencatleldy,in4-amlletshiyxlpfehceanlolsawmapsledsetaetccioendceinntarlaltisioxnssarmapnlgeisnginfrcoomnce2n.t6ra1t0i8o.n0s ranging from concentration 45 of to 30 110 mg/kg. Benzoic mg/kg. Additional iancfiodrmwaatsiodneties cperdesiennttewdo of in the samples at Table 23 20d in Appendix B. TALMetals Asolduimuimn,uvma,nabdaisuimu,m,ancdalzciinucm,wecroeppdeert,ectierdon,in ltehaed,femcaalgnseamspiluems., manganese, potassium, Additional information presented in Table 24 and in Appendix B. `Eluoride Fluoride was not detected in anyofthe fecal samples (Table 25; Appendix B). 32 Biotic Sampling and Tissue Analysis 3.21 Beatic Macroinveniebrates . 0 000021 USFW 0597 - . | . cor A Otue ofT 27iseetwc.orOntioggeroodcpuhpaoscew,ae1erMypacroso7vlepal,s,sii.e| TTfttreoeorlmmlsDhairoepifraiin,laoa3cavCntrieooonssaescdeippsvseee,rd1seid,(T2awb1byelees2aeb0st.ea CE TR aE perepesoettrws.rmeaweFerreeemwpeforrhiadesiaevtsewdrebisryveew3raisbsaesgraar.bvoseuepdrsTvataeondeladoPwaeitrcneeospree1eprrrrseos,ouecgHeehdoeIabVay,iooopend . Bao rasvoetbnesetrrvveeedeearrtsJoosfhae8iroernfeIeVerrewehaemrcebaei1r1nwoofadTctweazaensacsolal,tecBIts.edI,o,rTeahosed Jocsion. use uma ber ot f naaitardeucsmpacoeoaaolIryVlppdeoirorelseriptaisenec af.rhaecgoTelmhldeeecftrooedmbifsc2o0e3marantheetecedsrceyyfoeforfrencilenydcnisvueaivddieueransl. leiedwa,d.vCPehWroheneeosnpmieptrdseaoseten,ant,eob,deylsl2eea1r3,w5abrewe39Tes1urribaniedlciaovarilidsuala,ylcsa,hniedres0mspo3ecstcsivsoeeunlmryse.reeiOxncbaelelsysy Eevvinen,.osr,v1e15Is4bnywbpeoerxiee0rrd,ep0srmedsoeaitnvtmieaddobuaalcc,oano1en3esibndy.div1wiF1drou1ear0l2,cs03ea6liminwedveil,rveyoiferdGpur,eeensd1ed2n9e1wdt3earbbleyy . eSenveerral aasna2werinedicvoildlueacltsed from all ocaions sampled including Lescricia, Perlsa, - CA hironomi iedeaene,sseansdnbtsdrAisoTecollrnnlyio,diraaeenpTo(r.chTeuasdbmsloOoeelsdit2em6hc)soo.oiumpigohnShieovo,wnenrdanaihdlsse1cSeadbixruaraaoinewonaemgroiyeebisacaenlloreutvydewcdrieornelweglaecscLctaeoeopindoelnpfh,Wrdihoeemfhoroielaual,y,l3 Oe B BBoee ElsiLimmtmsaeeiepprhhiyyai,e.LNioiSpwguongsroiuomom.pmbhyesairsdd,.aC,Daryns4ioafspieoPsnwheiy,dcsaaCtwuwieroercnresa,lccdaaolF,lolcriEeeeldxaifimnpdrll,eeo,weSEnlilruyiirddac,sd, only one lcsion FBBive eefunctionm!ihfpeaeeedimnnngocsgreoccuaptosoifocwnsesa.eeflcoAosmllblaolailunegldhofyaoeenmslslhde,nomtiDohnremaynsstiR,urysceosdrlrwlcaeianrnraegdgehatec(hTleadrdboelmereisds2aa6sn)kd ownaedtLepecphhlosna T1heancdo1miannd swcerrapeesrpveaessheencadypyrmLaleycrboych:e ShToennoveyerpalel rastcsnestsymenotnofosnlaoygeslfcloondgi]frcstmfpcaunsssoinn gheheovfalbuaitaio.n ofHhaabbiist n 000022 USFW 0598 adsatthaeapnrdicncainpbaeldeutseerdmiansaangtenofebriaollopgriecdailcptootreonifabli,olsoegtsictahl csoingdietfioorni.ntHeirgprhetqiuanlgbitiyoshuarbivteayt swiulbltsluepapnodrtohfiglhinqeucaolnisyebqiuoelaocgei.cal Hcoowmemveurn,itasiae2ndsbarbeiastpodencslteionsesmiinnoqruaallitteyr,atdioinsscewrinlalbblee cboilolleocgtiecdaltoigmeptaheirr,meenmtpirreiscualltsr.elaWtihoensnhiphsabcitaant baendquabnitoilfoigeidcaaladdastuabsaerqeuesnytsltyemuasteidcalfloyr wscarteeernsihnegditmhpaatctdraainndsdtihsecrDirmyinaRtuinngswtautdeyraqrueaalihtaysfbeecetnsmfodriofmiehdab3it5ata dreegsrualtdaotfiopna.stTahned apsrweeselnlt aasntdheussei,tinpgaorfticcoumlamrelry cwiiathlarnedsipnedcusttocriaarl efagcrializtiesn.ganThdoetlhoessr oafrgriipcaurlituarnalvepgreatcatticieosn,, btahsrosuegvherreapllcaocnesmeenqtubenycesspetchiaets srheosiusltdanbteo caodnaspidteerdedtowghreanzinegv,alouarteilnigmitnhaetidoisntrbiybugtriaozninogf benthic macroiavenebrates and macroinvenebrates in the current sudy. - q`uTahleitaynoifntshbelhe baiolboagtiica2pltapcotauelnttaiarlloofcaatosn.irTeahmeoDrryriRveurnissnaprdiymaarreialyidseitteuartmeidniend abyyurtahle eavriedaenutt,ilsiziegdnipfriciamnatriployrifoonsgorfaztihnegrcipaanreiananadr,eaalretmoauignhvheigsetaotreid,inadincdattihoenrseoafregrfaeziwnagreaarse. with a though scoommpelwehtaetlydeogpreandecda,nosuppypoarntd aexsupropsreidsinsogill.y diPvoerrtsieonasndofsptphaereDnrtlyy Rruobnusdtraaiqnuaagtei,c wcoamsmurneiltayti.vel`yThheigthaxaonotmheicredifveerresnictey aarnead.numIenricocnatlraasbtu,ndthaencdeivoefrstihtey maancdrobiunvnedratnecbreataet lTooccaattiioonnssiIn, DIIr,yTRl,unanadeIsVimwilaasr,rethdeucperdesseunbcsetoanfticaolnlya.minSaitncieonhaabtitthatecloantsiedelroactaitioonnssamt aalyl be sigaificant. 322 Mimmal aFnodurmsepaedcioewsjoufmspmianlgl mmiacmem)awlesre(mcaeuagdhotwduvorliensg,tshheorttr-atpipliendg sefhfroertw.s, Wwhhiotlee-fbooodtieedsmwiecree,. submited for lipid, TAL metal and total fluoride analysis. e`TxhieretmrealpypilngoweftfroartpprienvgesaulcecdeastslienasAtroenaeIi,mtpeoruaarneta nfieealrdesatbsthervalatnidofni,llwohuitfcahll,waas cthoemrpeawraesd `0matyheinodtihceartearaenas.ecolTohgiiscails htihrgehalt,y irFrieegludlanrecgtiovpesnietsheidseinmtiilfairedhsaebvieraalprseigsneinftisciatnet-pwirdoeb,leamnsd swihtrhewtshessammapllledmafmrmoamlsllcolalreecatsedsihnotwheedmbelaadcokewneadreaasndadjdaecgeenntertaotDinrgy Rtuenet.h. ShSohrrteawisl 3 dceonmimtoanlayrehaavleighwthabtroiws nkncoolwonr.asThcheesbtlnauctk,timpoptetdletde,etah,ndwhdeegreenetrhaeteixntgrteemeethpooibnstesrovfetdhien I wthaiss smtiusdsyinagrethneotlenforkmiadlnelyy,oabnsderavneodthienrsahrpepwesa.redOtnoehmaveeadaondw on the right kidney, independent of the adrenals. evxotlrea ksiacmopelyedorfarnomextwhae laorbeea SIuLffiacnidenAtrneuamIbVerfsorofstmietaidaolwcvoomlepsarwiesroenscaoufghttissfureomcotnhceenRterfateiroennsc.e ALricpai,dAcronecaenIlt,raAtrieoan Tcofoowmmeperaariden odtwh1e0vRotelhfeatserowebanssceersviAgerndeiafii,ncaAAnrrteelaya dIIelV,pr(aepns<ds0eA.dr00ei1an)t.IhIeL, RBceaofrmeipruaemnrceceodnActroecntath,raattAoirboensaewrIlvs,ed3sniidgnnAiArfrieecaaanItIIlVy LG 2 000023 USFW 0599 Loan (p=0.067. Sufficietnteasumcboemrpsaroifsosnsh.oTahlesrherweewrsewpeoredifcfaeurgehntcfersiomnbthoedyRceofnecreenntcreatAiroenoa fandiAd,eTsAILl cals,and fluorideinshrews takenfromthese (WOareas. R35e:3s0s, aonfdthientArpappepiondgixsucBc.esRs,esTulAtLsarmeetparlse,saenndtfbeuoydrisdpeecaineaslyasnids arcaeppprieasgcaloiceadtiinonTables 323 Fish FFoiu snIpVA,erocCcfrafei]ieskoewcrehtrsubebscRaoelnfldeercretinevcdeerfArcrhoeumab.sDCrwyreerReeuknccolhinlueAbcvsteaeadnsdnIfaaLrneiIaall,lllnd.adtCIerVs.eewkeNrcoheufcbiosslh,ewrceitvreeedr Aeeheasafmpalmead ddarmiensga,nbdceefnlltureoacrltirsdotefoinasneahrlioynlsglieser.fs,foarAntdicobolmDaprcoyks:iRptouesneswdaeamrcpeelewseuhrbeamicwtolealdsecfttoaerdkweihnnodAlurereibanogIdly2 Thiipsitto,ricTaAl LfismheKailll io Dry Run was also analyzed SSionacleysctrseeckonccaherunsbetsnaitwcee,rdeboatrnhieudoimfn,fleybreesrnpyteilcalitieiusnmgc,obmceomtbwoaelnte,noiiarlsosnu,tehleceeaodns,saemmapatlnriganaignoenlossceai,tniohWnasi,lslssvapmtei,csiiacenasld Ru Taunm amIV,.iwneLArirekeeswaiigsIaeVi,.fccaConontncyveebnriasgtebileoyr,niscnoacfdrmetchiekusmceahmunebdtssaifllrsvoeimnr acAroreneacaeInlIthlraactnrioetnehskosscehhouswbasempdwletereienrheAivsgeehrsessre {ahamsthWowsoierh IsLsoIn csopnitceenotfriaatrsiornbesesiuilnntg,AdritoessaedcIlVweiastrihgtnhiafsiifcgiansnihtflisychahanibtgilhtyeihrnighguhaepnrpeatrhmoorseueanctmheeoasfsoumfreteDarliyas en Fn pater hose to in he the landfill lower reaches. There were no diffreoce in lipid or fluoride concentration. Results of the chemical analyses are presented in Tables 30-32 and in Appendix B. 324 Eahwom TTaogseamrpelpelsic.ateOneea-rwwaoybreamntawsleyaesmnipsleeoasfrwvtaehrrwieoarnpmcresowdaeuxcspeoudssfeedrdot1mo0eleaoacochkhoffoortfhsetihgeenaiffriivcweaonstrodmlif(tfreOeraeKtnmCceensttessi.tn HiiamarsuecamoncaeennxdtprotashtuairloelnsisutmhacnontchefonsrteormaitntihAoernseraeisfneItr,heenIcee,aarr1te,ha,woobrumtthtiesesRnueedfeewr0daesnicnsecirgsenoaiisflesi.cwainCttolhbyaiblnictgrheleaersvienlings eSeeanclaeoew.ferrroemfetwrheoenrclmaensdfsitoliall.ksentChoapnpethroasendobnsicekrevledconincewntorratmiotnaskewnerferhoimghtehre ionbweorrmsoslkaerena exposures. cFoonrctehnetrrarteisonusareofprtehseenetaerdithnwToarbmletsis3s3ue-3a5naalnydseisn for lipid, Appendix TAL B. metals and flvoride 325 Vegewion 3 000024 y USFW 0800 Thclhioorgcnhaeetcerierionnenstpt.lrhioecOnaAnstseewaescaar|myopsvalseegntsehioeaatffiilmovneeoyfasthdvasaamonrpwiiilaaginnrsctgaheesaAswewarseser.see1tBd]aakar0eninduilmonIoVeckvoaefncgocheretdaaoittffitaeohdrneoe,nfabciuwevtsaesssionsiiiplglasnaiatftmiopcslanoihtnalegy. vsaiebggsaeeiarfiviocenad.ntiynCohpbilaaglnhttesrwaainsktshieignAibrfieecaaRn|telfnyehdriegorheceferer1ie2nndAcreieovaeAIgreVecvaaeig1oe.ntatMtaainongnnaGnaeesehAacrsoansck1e1mia1tiino0andnyw1aoVsf beoberareas. There waspo diferece ine lorieo iid concentration ARepspuelntdsioafBthe TAL meals and florid analysis are presented in Tables 36.38 30d in 33 Histological assay of small mammal iver and kidoey JWHuiesmrtpolinoongisicucables,aannaainlvdyeswichshioacnf:gfleisveois laomvniedcteokidreKnadepoydeesdyeimcntoiroapnhsocloooffgmhyhe.eadfTohvweabvlpiespe,ansorhfesaosKrcionscohliruenedweosdyn,etmhayenadior,ew oeaffnfdiehcte,heiBspoorwpeeasvieeharoclewoogeiacafaeleuwxntarbalaoelroteboeparrosencsehekrnetaeiidgtihhneKTiiamdbpnloeeryt3ao9nfcanenodotfhineerAsppepreoonvbdisdseersvBaa.tnieocndso.talFeulvlidseunmcemaoiaefs 54 Toxicity Tesing Eanhworm aB1ar0s0te5wdoiornnmastlhtreatsotixemidceiintnytaenrveyapolliufcatatthiesoenasoonifdlssogairmlo,pwlteehsrrecaonliglseecdntoefdreov3imdt3ehn2ec.e4Drf0yo5rR4gu.rn3o%wCt.rheeoFkrursstiuehr.evrivrSaeulsruvelfitfvseaoclftswtooesn eariworm oxiiy festar presented in Table 40 and in Append C. Eatheadminnow sUBrapfspaeecdreoTwnriehbusetaatrokyxeiAcnitnsytaemhvpealleUupawtpaieosrnSTorBfi%sbuuwrahfriaylceeAwslauortvceiarvtaoslnamiipnnldaeulsceo0deshriegnsifafaimtcphalneetasd,mmoeirlnaundyoiw.n,gSihusepspreeiafres1retnhhcases _ Cmlooircnraneilooawnt,sedripanontgaaensdysifouifmotmchoe8n7cweatitorear1t0is0oan%ms.p,lheToshweetravekeearnpptfheeaosremtcoDorrbteylanRtouiognnrsCoraeweek.nsoasSeauirvaeitfvifaeelcatlswyawSsatgennre,goaonsnwnetley pGhroeensce0en.rt1ce0adtieiovnnesTl,aibn itThhe4e0rielarnweadsinwaAapisepigrennisdfaiimcxpalnCet.s,poFsuirvtehecroerrsealastioofn hbeevfwaeoeenadfamtihenandowmeovriievlyanedtssorn. Anghioed THBryaiasbleuedtlaoarnytteAhc,e,arnedgsurAsroeoafoItfhetleo1c0aotrdigaoanyn.issomlTsihdwearpeshaiwseebrweihndooliefsfetedhceitmsseeondbtismteeorxnvitecdistayomnptelssetusrwviwitvihaelnthiaen aahnmyphoUifpppondee,r samples taken. The observed negative grow effet was significant negatively sorvlne wit Tine " 000025 USFW 0601 Da uorde, spinte,ocnalcosieumr,bemeoarguaebesibipoemw,rernveiskseo,Cspipopssfsicu1amn,icahhdros0mo.id1ui0mum,l.evCeolp.FpaeFrr,eurer,dr,hee1tsdwl5eo%ef niin et ae reseed in Tale 40 ad i Appendix C. 40 SUMMARY OF PRELIMINARY ECOLOGICRIASKL ASSESSMENT SCREEN ements and wat Gancweenrreafonesrveedrsbcyoimipand ahgeaimnsaxReigimoni1cBoTnAceGnasieoenimnegasvuraeldsi(eUxSc.h EPme Ebns wineeowaiRnegmgiosnefiTonlrsse,esdciCmhemnoat,rkmsovla,es2h.0dt waAallledctoinneahimeilainssnrfoscewehipicrnhoclmevasxewiilmlKubkme ed m3 aa isk assessmentfo De si. `Sediment T Tale e 1 tists maimoumemceo,nccocenoermmnrib,nio,sn ecoTpapoenrr,drmai1nehg,ass1,endaenqxduceiaekyde.chreiBbeeescsasfashcemtoaorksf vfaorlssed0imehnet he lack of 3 e mgS au, benimv,icanbagl, croonm,2p0odunvaarsaa.l considered 3 Tk fcors 5 wel: Tuoide, Waer iTbeLi s maim cotncoendaaions, ro. Bec bfesshhchmeaaxrkcse,oesfd3ndhsqerucableeiintynchgrmbeaersrkehvmoaalourekrs, ofosroervadtfossllccoowoinansgisdcetrosemd.p0obTseh:e3 pont ik ator ST T aoitleEe is omesoiunn,icovonnec.eyn,areoccnorsod,emdsmrfieo,lilncoowipispnreecraoe,omxpncao,enuedndldeaqdsdu,aalhimeetaynsgbiialelnnreccshaeom,anfrvakeiavsrasdlauf,eosrrafi$onskidfazccotnon.rtfsaoB3melicwlaneioasl.we CSTorte nd ioroNueroonmhemares.. th - 50 piscUsSION . ee TGdte genetearm.inSheiomolmedemaieflasosrptsrsropgsgeeisesrslyiofgdtrehospspssiendeguimwepincttenn2ncca0etlcnwaapsaioooenglsdOeiissntXaisnsceaoecfirssnoaemmdsphlwegeitdahtrncedopnslodttiweoe0inasl oeme ee ens.SepnedcofcafRlaeyrevnsaisdehoewvancssl.hfofAuulpirsscpenaaarryogshacovreeneN,iogfohpdoflsiuoonrmtiedemraeisnakdlsfm,aei3arl7ss E eE k sessmentfopihee dDryfRuurn Chreefesidefo will be fre sraied fvough a bu1s ; oa i 000026 USFW 06802 SECTION TI ECOLOGICAL RISK ASSESSMENT 10 INTRODUCTION - 20 Ie : : 2 11 Objective l"AeTgvheeelnoscbyjiencRtseoigivlei,oonsfetIdhiIimseiranitsc,konaadsnusdcetswisanmtgeenratanwt ae2vsawtloourpakrtiioonvngidobefeetpfeoctphernnoitcidaaullctseiucoopnlpofogarirctmaolltothhceraetUae.tdS.dduosEwnntvoigreroxanidsmiteeiannttgaoclfaoPnrtojatmaeiacndtafinlotn eSafonfidolrstusrewfdaaiscmeeinwntac,toerspruorwrfaeatcreeedwciaonlttltoe,citnaeadnndfeobcrioolltaoabgosiracamatplolrreyisstkwoaexsirsceietscysoltmelesetncittnegf.dorfotTrhhoeenDtianrfmyoirRzmauannttiCoarnneagelakytsheseisrt,0eddcusroiln,gsheidismfenetl,d 12 Site Backgromd "fETaPhreAmshtaaelsliefsgiialnedgwontruakmtienrcgooubnsteaceommipprnloaadniusncttasirowenitbfheairtnhmgelWdoeicsastctehdVaiirrnggeiWdnaisfahriDonemgptaaonrnt,imnedWnuotstoordifalNCaotluuanrnradylf,lRWeoYswo.unrecdTehsbeyaonwtdhnetehrDouUfp.otSnh.te cfinoorrhpihosirsahtceiarotdnl,ea.irtTodhieDrrfeyadrRymuenar.uimbaDuirinyatbaRliuentsnotfhtlahotewnscutomhneraromouiugnshantdehtaestfhtsah,rtmbealrri'nesddnpierssoscp,hearartngydedaontidhnetiros uDapnrurysiuRmaualnrnyferssoosumercsteheoobDfsuewproaancrtd RJaunndfsli.nce0thaedcdonosntrtuocttihoensoefatbhoeorlamnadlfiilsl., numerous fishandwildlife Kil have also been reported a ry PROBLEM FORMULATION Tciodhenintstairmfiiisnckaaatnistossne.sosfmCDenOutrCiwsnagasntddheaesicpgornmeepldaitrmoiisneaovranolyufarttiehskethmaesapsxoetisesmnmtueimnaltc,honetchaeenttpr0raotebicolonelmoogfifCcoarOlmurCleacwetpiittoohnrsapcorcoecmpeiseesdxpbeoelsnuucdrheerdao.arsskihetee 0Thiescoilnofgoircmaaltiroencewpaisortshaendustehdeitoapipdreonpirfiyactoemmpelaestuereexmpeonstureenpdpaotihnwtasy.sofcompounds exceeding benchmarks "wTahtieedrfenidtsuirfsiyingppootfthhenfeiiaellpdrcewolinittmhaiemnsiatrnayabnlitissskhoeafdcsstooenxsisccmeoelrnotgifpocrraoltchbeessnpcrchoomtmaepcratkirsoe.ndoBaflealnqccuhhaemtmaiircckablsisoftaoanas(lUe.ydSzi.emdeEnitnPsAaonid1l9ss9oe5ld,wiLmeeornnesg,saaennddd evMexorcreegberadanitneg1s9,b5e0an,ncdLhomdniargiekctstalwe.xeproe1s9eu9r5ae,iaPnsedsrasfyuosardffoeurirtfaihl.sehr,1e9bv9ea2nl,tuhaUitcSio.annEudsPtiAenrgr1ei9snt9gr2ie,asltSiiuontnve-errbataesnbedrdaMteaexbsproesyure199m4o)t,elCsofmorpohuignhdesr 21 Ecological Risk Assessment Tthoissieeceolloageidcaclornitsakmainsasnetsss.menTthewafsolwlroiwtienng tsoidpestweerrmeinceotmhpelreistkeasfosrocthiiastepdrewliitmhinthaeryexrpookssusreeosfsbmieontsa: (1) Asbpileoicctioeenrsc,aeunrttoertsdieeoatrnecrfhamcwitnaoesrsc_foeoncrodtusoictxteieccdoolntotogaimlcioanclaatnetefslf,efctshisotforysitien.focromnattaimoinnafnotrse,leacntdedtio.ndilcoatcoor @) An evaluation of ecological receptors was prepared. Thi consistedofthe following. , * aEnxdposmuargenistcuednaerioofs wceonrteamdientaetrimoinn,edabnadsetdheontsoixtieccoloongtiacmailnamnetclheavneliss,mtsh extent of the 16 000027 USFW 0603 contaminants. + Incictrvsereecitisswiyerce eoflocnicndhbyaasbefadosromemdaopinioehniaprbpoirmteasuhesenetonearnbdertohraapvsitaotenrndat,hleypoprveesieanlt Exposurepthway(9 were determinedforeach nicer species. Expose and ffct profiles were writen fo ach indicator species and each se conminant A visk caharsgcetrfezoaaiocnhwasspcioensdfuceodrwarhgiecohfienvxoplvoesdethse rcalicu.lationofhazard . asedaontthhhevreeosfucsonsiersvaetvivaelruisokmn,othdeeClOCsdeniedinthe nal svenwere fer ealted 22 dheenicfiocanioanonfthfePpCroensarm]ieniacnnodtnscoehfnowCewornsecdethmiefprelismiinngaryhesiraeel cionnclaumdiegamnetaslsr,ef.Trhiee,CO3C0dS Toresanofuorce compounds. 23 hET xeposburie eeChnaosfu ctehiezeixn opo1nsusrhe sceopsammeinatnss. tPdceirlmixnepohureppaayyssanadrmdeedpieandhaontuognhtbieica21hsd RseeeIin onthnseb,ssvfeoonemtchacneldmomgoiaxamgiansmkesaosisfeccsomonecnneta,nmaiiwoninlal,abnedacotdneceNlnuovdieOrdboshnemaretvneadlApoptpeisnt fect Level (NOequAalsaEeLxcee)ds1. Expose to SCeOmCsoanrp.reexspeontsaeidndrfioortuagg0ehaxnndpgeposreisyosnvoeifcewosnasvuemipatinindgocensioifodnceoornuadimgsineednftooforsangoec,ylsielomigngc.sl :. esas of hetomxisiesytvs.ente esa ivrcbrrs ad fh vas determined by examising 24 Hand ChamscerizaionToxic Assessment Fo determine hCe fhfisnnodf cshoenstyasmteimnsahotn hbeiyofetcst.esKsnoawrlyefdogeuonfdterestafndeheefemcesc,haannidsmmsodoef OTO E e s oloiteowlsifnofobmeatsitoenetalronroefaCpOprCosprdiesicfaisesedssfnmeSnetcteinodnpo2i.n4t.s, Newt is a eview 241 Fluorite regi Douurgiehcoammpaomsuipnnhdinsrgcaehdaebvpeoisciooonns.ioitnTenudlrotewo,tdhoHesoesew,nevviierro,nmanecndtcaelsploatpdhrtoocfflefuslosuroirdsieudceih, " 000028 USFW 0604 . " _-- pgreonteercatlilvyeaocfcteepettehd itnhahufmlauonrsidaescwaenllbeastooxbicertoabnoimtahlsp.lantowawnadreasnim1alhiligfhee.r Dleevnelasianids dsekcerleaasledlemsiiloknsp, lrameonesds,pusotsicufrneteasboinfoogratmn,aal,p,petrietemrism,paiirlmesnt,,deocrveaeserdgweroifgohhtowogvtaeishn,, s1e5v7e7r;e dSihaampheeat,aaln,d1d9e5a2)t,hhaIvnebadedeintiaosnsotcoitahteedefwfietchtsmkanmomwalniiannmfalmomraild,tobxiircdisya(rSeuirseo, sduesccreepatsiebdleegogshfleulolrqiudaelittoxyichiatyv.ebeMeonraeliptoyr,deedcaorxecasoeldoggriocwathl ernadtpso,indtesporefssueodriadpepeexitpeo,suarned in birds (Fleming and Schule 1988;Flemingetl. 1987; Guenter and Hahn 1986). 242 Organofuorides "TOerfglaonnoTMf,lpuorrdoespaerelualnsdeareifnrnitgevrsaarnit,se.tyAovfaiinldaubsloeitaolxpircolcoegsisceaslidnactlaudgiennegratlhleypcroondcuecnttiroanteosf eohnloirnohdaiiftliosnomeextpaonsepurreodauncdedddeercmraelasaebdsmorapteirona.l anAdcufteea(w10eidagy)ahsewsxepl,olsusraenofinacrsesasetdo fHreexqaufelnucoyroopfroapneonpeiheaxlpmoisauarnedisnudbusceeqdueannt bilnicnrdenaessesd iinncniedwebncoernofferhuasmesste(rIAoRvCar1y98c6)e.l aberrations nd increased fequency grossly brormal cls (HSDB 1997) 243 Alminum ABelcuamuisneumofhaistsosnrlyonognroeaxcitdiavtiityo,n aslatuemi(n+3u)m, h(AsDiiss nboethafvoiourndinatshea efnreveiomentmaelntindeapuenrd.s orensutlstsoirndiannatiincornecasheemiinsatlryumainndutmhemosbuirlrio.undIinngwactoenrd,itainonesq.uilIniboriiusm,wiltoahw spoHlidgepnhearsaelliys established that controls the extentofaluminum ssoluion (ATSDR 1990), fPolranpslavntsaianrrethgeyeineraalblylltyeossrethmaonveonael.umBiinoummagfarioimcsaotiilo,nalotfhaoulguhmibnioucmonicnetnteastitoin]facftooords acqhuaantgicdfooeosdncohtaisnps e(aAtTroSoDcRcur1.99T0)h.ere is no dat on the bomagrificatonofaluminum in "nTehuerofniebrrviolluasrysaynstgelmesmianyhubmeanastwarigtehtAalrzehaeifmoerr'asludmisienausme.. AAlluummiinnuummmaayccaulmslositnetesracitn WniolhinndeiucraotneatlhaDtNalAumtoinaulmeagfefencetsexrperpersosdiuocntaionndpsrfohtoeuinghfosromamteiodne,velMoapmmmeanilailaneffseuctds shavdeo baenesnporre:poofrotexdyginenmaanmdmacalrsbo(nAdTioSxDiRde n19i9s0)h., aAndluhmasianlusmobeisenkndowenntioeiindnterofneorerewgiutlhsogrly disruption. 244 Arsenic SNeevieargaul1r9e94v)i.ewAarrsteicnliecs taernedasvtaiblaeblweiwdheispcrheadidsicnustshetheenvtioxriocnmefefnetct(sWoofolAsson(Ei1s9l7e5r)1a9n8d83i,s cionmsiapnloyinbrdientagemoinxniidtnizgeAds, breidouacveadi,loarblmeobiinlsizueadi(Eesnlveirro1n9m8e8n4t)s.. PFhoyrseixcaampplreo,ceasrsseesntaeres asroenrgelaydialdysoardbseodrboendtoosntoesdediimtemhnatensotwnhietth Ashsigfhoromrsg.aniHcowmeavnere,, ssbnido.rpairosnednetpeesnadrseomnotrhee As concenration, sediment characteristics, pH, and ionic concentrationof other compounds " 000029 USFW DROS (hEeisplerre1d9o8m8i;n0a.An2.St2fo0r4m 1i0n8g1)y,geTuhsecsUwS,aErPaAad(t1h9a8t1)anrotseed t(hsasivalseenm)aetpheeniparveadloemnitn)anfts `As form in anaerobic conditions. Arsenictiovr0mo.Is7nivgfeonrriefbaircamtaeennstclaynpcgeonentcofexrniotdrmeat3(eptdeoinn1a7vaaqfluoearntitec)x.pionsvAeurrrisebertnoaitcaerssm;eanwyihcobwleieobbxiiododecyo(cwnoicnvecanelntetntrtea)dtsinbondy ibioimagnsifiacaitohenobcocuorms(oUfSt.heEfPoAod1c98h5a)n.; however, dai do not indice that significant 245 Beryllom TCToohaestmtraoojunogr.ihtdyBeeporofyslitlihieounmobenfraytsulmrloaislulpmyhee(nrBtiec)rsbiwenrayttlehlreiwuamey.nsvUitrphoornonmuegrnhetatchhiesiwntgehaewtahrteeersriulnntgodoffrsoocloc,aklbaeanrndldsioeuilml - eeersiose.likuesltyirdeea,innietdraatse,anpihnsoolusblpeahfnoadrsmtutlhefaat,tie (getneerraahlyldyraitmem)obairlee.all wHaotweerv-esrol,ubbelreyflolrimusm (ATSDR 1993) DDSuiie. tsouTrhtfesarcegefesoorcaeth,elmboiewrcyapllHlssi,iummainliadsreiitxtpymeatcoytaerldeutmmoaiihnnauvmpe,relbciiempriiyttlealdtiemudmaabmsialiynssyoblenubeolxeiplecc(otmAepdTlSteoxDeaRdss1o9r9hb3i5o)gn.hteor ' BSaenraiyfrlciaaunmttbeiis onfmioasthgieinxfpsioeafctttoewnadtweitrto.hibTnihofecoodondecgcerhneateiorntsfehtaoisxnibceaieqtnuyatfdoieuccnrdae.nasiBemesarlwysiltlahinuidmncinroeeaxsetivrniegdmeehnlacyredonxefisocsr - (ATSDR 19933). Mmsaolrseiedxaipmonesnuts.ryestreoAmulstt,ehsnofouogrshtauqsdueiaevtseirtcahleacsoetluodgviiecsaalprolteichneetuptrooaeurltsattitihnoecenlsunhddeiegpaitnbigeveneswteieoefnfnoecfstecsdoionmfaembnietrnbyaeltrleyidlulmsiouiilmn. ation and observed toxitocbeintthiyc organisms could be found (ATSDR 19933). 246 Chromium Cc1h9o8nr6vo3e)mn.ieudImntbo(otCthrhe) crfearlnaetseihxviwesalttyeisrnaaobnxedidtmaratiirvoianlneesnatsty(es+st3ea)mnasg,nidhnyhgderxfoalrvyasoli-esm2ntatn(od++6p6)r,eocbxiuiptdiaiatstimiooonnsstatrafetreteshq(euEeimnsotlsleytr ibmrpiomesretcaauenmrtuotbpairtcoiccooennsdsiaetrsieontrshe.altatdHiveoetwleeyrvmmeiirnn,oeru.tnhdeePrrfeacanipoixatinacdteaednffdCerclt"oswhoypfdHrCorcx,oindwdeihtseirroeneasm,saiCanrd"sionrhypsdteridooixnmiedanentsds. nEgearyntiesocl1u9cb8iol6mi4pz)el.eaxInindnsrgoeilsmsua,bitsnhtea3nscooelnsub,iiclailCttryh"aonuudgnhlbeiosorsagvoaaxniiildcaibiczleoidmtpytlooefCCxerrsairpvloagyuog8vhemmmoierxedibnsygigansoinffdlicapaenHrtatraionolnde {Jims and Bartlett 19833; James and Bartlet 19835). TIchaebeowrilsveianlsteminlt(Ssetaletevemeenissnetthaeilnf.omr1am9m7u6m)sa.allsClyhbrfyooummniaduimnintiabsiibnoeilnoneggfiicecafilfailmcabietuntetrnigoslt.uecsosTseheni,tsialfliopitrdom,hfaiugnnhdcetrpirpoolntasenaitsns (Eile 19862). The biomagifcaion and toxciyofCr" is low relive to CrTM because of 1 000030 son USFW 0606 . - so ecisinmloldwaotmeocmnbrubaynsCeelptreem1eE3a4i60lr,yhaaondhiePs aBsesonecsocdmaisnviny.aofnHcoeawelvvaerei,ronSheogepisdeevgErseYof a Chromium is mugen, angen, rag, with xbibiingte gress EPntoxirecmityod;ereglwartiiehvelpsynlneeos,,srimislkabncoiewnnnbabooeuptotymhpe,altiobTxniceiStoy,oufcdCSr,". ihSAdtEBhio,ighnncgotln,coePntvNraAtTioonTss,pCerA,i1s aRCacboobmipsooafcd1a9d9hi.iaerTysiCirnsuacmeustmouiltntetdHsob,kyecdrubnoton,d,e5harndwraasairn,ssWeurahso,1(sanpdhernreavanad CoiFoemaeortneodihocvnoanwdlsoss4coSevnenEnienDdgrBeoefPnBrna ropdrueoifonmehRACOnEe fHE n08 10 CmCiseomTtiouamnaltlheosreielsp,oesrghrcotn(mveaegnenvdeviiDsnw5.7e36lm)andpossaofmeitho,othe2f28 orsoof hrneecenprcreholosnpeid,amylnosteagp,einSyChrihenadihcsepad reoelpnactfhamayntcmeanocearPi:sspcanideobln nn1 obne trhse ssfaoeitsnodof emiernes emelclhWahnysarpoenaassAi sEn rerportt (Spvernods31k197e6) 247 cope Copper (C3) dos nxppsthe msec oper RIS 1990) bt ets (RTESCeSe19e91) yandiaprossmiblae caercidnog0en (sVenrugaoppalsaGnd Lhuck1ey9710978). Copper is caustic, rCFoeppiryins nanasmmeeaenlo(srDeenmmeanyysocrliil1o98n3ndC.ocnoemaapvkoenotennotioff aarotyr,m1eawdlilogimneossin1oddn CenasegmoraaeabndelLysaokfeihsgeh19tn7i)0s oEfCx4easmCaosmtpecaaomJaeattsCoa1.0boeWhu(emnrloatotksoo1n98mn8)eawhnnch eaiemsCsocesoweemsssvlwehlehbeoeoactloscaeulmmdeil31e0 s3botmoveossca(sDiaenmgires loeaso1n49d6DneeTro,aw etal. 1982). rAFtebopouogishmhpoeaammeacnnamfoefnsccaihoban ooAfBiNAkATDyYHCoyotmoprs ihhoulclyosowicenogmsmeedsPhsaDnrimWosbtoaf]vmeibse1ean, mcoantneotroo(nReimnass3316 315548)unabnmiofisn wheeenOus cromlplne18d1) 000031 USFW 0607 g . roti ligands, protein cytoplasmic arganle Demayo eal, 1982). RR urminanisa arthe mthdsrenaivnetmaamnmdal smprescsi0eCsuit1oxicCvousits.xeYoung(aVneinmgalosprle1indn Luckey 1978). 248 won ron (Feis cioempmroonde ly deom fctde naaa cnnoddnscoeecni rsaeianoinlaslo03pfo$wlaeypnelrsscnend3tajonrimrmarleseisonssoouiw.ferlyId3srcoiguesegend a onekb tienccaolrhrcooae x0idmatipivnreiopcsroscheosfosyesoo.tTh.eGedinTseorrsot,ieoanb,ooufitio2nog0ensct1ee3dnpvaeriocoenn5t aotn eabbaotnyrowsa.rfeonmTpoeedmooe.chaAendisvmseofeoTcxtacs,yonfbdoisnaismxiwaictthioamciaustysepcmplurucodxoiesmaariecealyl capl doamange taofthcovwrs(oSnhsacdkleeyandimBooGsyeul1a98,4).resuing in caplly 245 Led Le ex dos sntsbaoympseaaileyyxcetonrsovaetynhedotagceuetmnsietnnfiseoduds(WcPihsoisoo,nngaalentndhroDtugoahnssa,c1uw9m9ii5l,atEthieolnmrbay1jp9o5a8s)osf ion ih ony dstofvencbraes (Els 19889) redheiersecnicaumniulaeigionnn etaonrdoboasxramineclseosfa,dPboyciois meGrpiaocufinuodnssairanmemooirsnsfpxehcyetsisctash,arnhniefnmouringcacn,eidcaPnood Ee anmd.csPoihnos.miitmgyrhmoicwahvpynrehendtoPMoAhskIuDGe1pirSbeldiuec,e1d0 amfsotsfsee,catdnsd(1Ew0salheeer npbiv nesensGol ngdroHupasppbl19i75n).g he Conversion of saproparphyrinoen 1 TTThesetox:iac feemuecetsdafPsrHowownesvaneqdru,armeaapnnrydoedeuecrseeucsphr ,ibslnoa oedrclahwneeemnxisseahlesavonie,dmeaeincdnhsca,niidnsmed esaaly:inetmmatshooohdteectfchoromraagtain0nosnhgEeoicfseelhenersrml1,5n5ea8)do.eurssAcSlyiygamiheeactocsnecrleopnraiidtoiroc0nhsdeenmseiatr,Elevatenlds fe pB as camn ui eptakoe PmehogfLheluafotantcoemupdkrpsoeOsPobnIfonmEisnl,sdustP,waeTrdsTesoltlyhro,ewbtyeeuptRa5k0eO1tpPrfou.agnhd 2400 Manganese Fon u 000032 . USFW 0608 - * " nMuamnegraonuessemi(nMeara)lsd.oesEnloetmeontalc8m5acanfgraeuneemseertaalndinitnhoergeannviicromnamnegnatnebsueitscoamcpoomupnodnsenhtavoef inengdluisggiiballeveampiorspsiroroenthssesebruuotsmiroanyeoefsxsoii,slt. nRareasmsousrvpoemnadtehldepaartimeouslptheermeaitsemrodsetrliyvethdrfouogmh irnaevsioaltiuoinllysoefetihneg.spTechieficacnhesmipcaaolnrfdorpmarpireosneintn.gTofhmeanmgetaanlemsaeiynewxist ainistcetornlie nlaendyboyf wfaotuerrosx(i5daHti4o1n0s7a,tebsu (m2,ay3b,e4c+,oorm7eo+x)i.dizDeidvaalteanptHmagnrgaatneerseh(aMnr8+o2r),prMedaonmgiannaetseesiisaomfoisent craonmsppooruienddisonamdosvoirngowsactielr aandssuesdpiemnednetds dseedpiemenndtss.maThie notenlntdhyeenccytioofsnoleuxcbhlaenmgeancgaapanceistey abnidocotnhceenotragtaendicatcloomwpeorswiotpihoincolfevetlhse. sHoiol.wevMear,ngbainoemasgeniifnicwaattieornimnathyebfeoosdigcnhiafiincamntalyy not be significant (ATSDR 1990). "nTohteaappemar toobofmueaangmnaanrektseed daibfsforrebnecdeabcertowsesehnemgaansgtaonienessetiinnalgaecsintisfeovaodrdioablei.n wTatherr.e dOonces oleatfhdinkgeytodeitnecrrmeiansaendtsmoafngbasnoerspeioanbsaoprppetairosn.tobTehdiietiasrypriorboanbalykebe,cawuisteh lboowthroinronlevaenlds manganeseare absorbed byth same anspor syste i the gut (ATSDR 1990), 2411 Nickel aPsurseapnliceksesls(eNei))asnadhNairc,owmhbiitneedmewtiatlhtthahtriseluesamlelnytiusfdouindhien aflolromlast.ionNoicfkaellloisyshe(s2u4ch bmeosrtelaebausneddaninttoeltehmenetnavnirdoinfmeontutrinontuhdgeh emnivniinrgo,nomfen-tbausnicngxpioowredsrulpefliadsenss., cNoailc-kbealrmnianyg hpoowseercoplnatnatisn,iangndFeincoirnemraatnogras.nesNeic(kMenl).willUnadaecrhactiodiscilcoornsdeidiomnesnNt,ipamratiyclbese,ceosmpeecmiaolrley 4mo-b8i0lemialnldisgereapmsnpteortkhielgorgoruanmdsw(atmegrg.).ThThtyepiscalpNiecoacncnednitprhaaytsiotinorciehpeoomrtiecndailnssaoeloifs Noimis imporant in considering is behavior i the environment and is avalabiliy fo ioe. i"Tnngeesmtisotn porfobNaibcloenetxapmoisnuarteerdoustiels.ofNTihaeertehsrpoiruagthordyersmyasltecmonitsactth,einphrailmaatrioynotfargdeutsot,faNnid Xmeixa.pcorsoAupnrhieamgfaoellshlyoepwexirnppgolsaiesndhiaal,taotainNodni,itnhMcraroenuaigsfehedsotlrauatnligoewnxsepiosgsuhuctrheahiawnveefrlebaemneomntanetoditfoeodnhioanvaefnheiImeiahlnasgrsea,xy,pforasooesdtcs0,, irregular breathing. salvation, and squinting (ATSDR. 1996). 2412 Vanadium ffEuelenelimsl.eznrtsa.OltTvheahrneapadrmiihuncrmiopdpaoolegsuensnoiotcfocsvcoauunrracdneaistoumirinaslca llyudbaeutaailctliccoda-onmniesnxetintleeiannc0hta,ted,sipfesfceeirwnaatlgleoyrissnluatdengede.,foTashsniedl Tadhditaivoenroafgevcaonnacdeniturmattioonsioeeflvraenmoavdeisuiomnxyhgeeneaarnthdsncirturosgtesn,15w0himchaigmparnodvensthheeUs.Sm.egstihl are 200 mg (Byermu etal. 1974) f"Tohemrseolielaseeroosfiovn.anTahdiisumprfoocweastseursauanldlysiclonovcecrusrsth3es e3sr.essuoltloufbtehbeivwaelaetnhtefrionrgmoofrtoeckmsoarned 2 000033 USFW 0609 soluble peteneaviawslnitnefoirme.eofaTpdhnermaomsbcoi,lbiioRfdelveaarninasedisouommbissn sciolnesissa,f(evAcaTeSndDaRbd.yr1pH9,1m;breiVdlaoenx Fineren Sashes and work 980, 1 th emesis seysstmoemsmi,eHooacmnoicieionnmpal.ianoVn arfsendmeosprenadceonmptmooonpnoeintelmporoaewuseennrptolrafnsltwalsepersc.iessio.ullIen EE a ohmaeniosnlsymefousndsloebeleorwapdsdhiecilon(suleismi,(TSThDeRhi1g3h9e1s,t Vana isveeypnsarysnsihreeysdammacohpehgveisfosibTnoysidienerlemsantlnt(hdCPahaessotronoxopivhcaamgetssahlm.em1i9r8a9)no.ef . a escarviomeps igepsssinAh,TisndiaibvthyytohfweFiccphhibaroronrmsyafhoesyslademsf0ofcvploiasdeielo Ee unde o97t8) ee fore ptofmel 1s ol membranes (che 2415 Zinc Zaint(zie soeasnissoffor.n4ormbaMoltgervoweltrhobansdbeaanpodrovndueceiiromnipboisrnsl(OaZbsns ranadga1.sih1le9s8s).nadnZdisnide Fos ahmeesdancanafoodmcoii,bicons is eurebybay nd xcs ZDinehatepriCmoardhyhmaietenanabcoilyiccanf(dfRcetAran)iZsencdweispnhdnmddaeenaennlzosymnoefs ahactrcemAuDs(NCeaA))hn.ebdHFiiegon(lmGeoveyelessr Caeomtscsan n9al8necvoKnnattoaecdeosanodbvpatlhVesiper:ivm1aa9rt8yo%l,tattZosen,opfcrZeenflroanixaatlyoypsiycn,ciaudnmsldiacensld arenioaacsveosnaeanseylom(acdsfum{2scs,ioo9n8r8oi,f oiflbcoppnupilceuismltnsid hseuredmepreoynxre(otfSsCpioe Ben 25 Selectionof Assessment Entpins TTG h iEnformatE e iuonpgsaha tohewreedd douErrihaneg asamssheceoreeccoocfnsnoasoimtsimsoaennmcreenamnndd dtuhrdeinRgiehgpieonfcoiImillswpBoaironnkld,oegaidncodastlshuTebesceahqbuneiantlt abcywRuin a Cgoaocasekee smee.enadoTwfhsre.,esiohd1rsscdho,mwapdrasoyocfLicaawrr pcoofie arbassa .niAdnbcvll arurdiiientgy as ons ofhee syne. Torre te ese ndpoims : feocuesed toward these wfaiuenael geroudps. sVeisabailmiety osf atemiesstialo,raiviano, kansdsaoqmuaetnic,poLpuiladtioensvaend We 000024 USFW 0610 26 Rtabin the specific assessment endpoints selected for this ecological risk assessment. "Ten assessment endpoints were chosen to evaluate the riskof contaminants at the Dry Run Creek site 1)protectionofbenthic invertebrate community structure and function 2) protectionofsol inverebrate community sructure and function 3po)tepnrtoitaelctnieognatoifvefiishmpcaoctmmounngirotwiateh,sosensuurre tvohrariedpivrreocadtueclxtip,voesusrueccteossc.ontaminants does not have a 4a)poptreontteicatlionneogfatwiovremi-mcpaatcitngonbigrrdoswttoh,enssuurrveivtahla.toirngreesptrioodnucotfciovnetsaumcciensas.nts in forage does not have. 5po)tpernottieacltnioengoafticvaemiimvpoarcotuosnbigrrdoswttoh,enssuurrveivtahla,toirngreesptrioodnuocfticvoentsuacmcienssa.nts in forage docs not have a a6p)portoetnetcitailonnoegfactaimvieviomrpoaucst monagmrmowatlht,soesunrsvuirvaelt,hotfirnegpersotdiuocntoifcveonstucacmeisns.ants in foragedoesnothave )apoptreontteicatlionnoegfaptiisvceiviomrpoaucstmoanmgmraowltsh,toseunrsvuivraelt,haatndingreesptrioodnucotfciovnetsaumciensasnts in forage does not have 8ap)optreontteicatlionnoegfaotmivneiviomrpoaucts mon garowmth,m0esunarsvuirvlaelt,hsaatndinrgeepsrtioodnuocfticveonstuacmeisns.ans in forige doesnothave 9h) praoatneecvgtaiotneiovfe iinmspeaccttivoonrogursomwtahm,msaulrvsivtaol,enasnudreretphartodiuncgteisvteiosnoucfcceossntaminants in forage does not h10) paraontevegcattieiovnoefihmeprabcitvoornogursomwtahm,msaurlvsivtaole,nasnudreretphartodiuncgteisvteiosnuocfcescso.ntaminants in forage does not ProductionofTestable Hypotheses. "oTnhethteesmteabclheahnyipsotmhoefsecsoanrteamspiencainftictroixsikciqtuye,stthieonnstuhmabtearreofebaxspeodsounrethpeaatshsweasyssmetnhtatenmdpaoyinetxsi.st Bfoarseadn assessment endgoin. endpoint, or other factors, there may be more than one question for each assessment Are levelsofsite contaminants sircrure and function? sufficient to have negative effects on benthic invertebrate community Astrreuclteuvreelasnodffsuitnectcioonnt?aminants sufficient to have negative effects on sail invertebrate community Are levels of sie contaminants reproductive success? sufficient to cause direct toxicity to fish growth, survival, and rAerperodluecvtelisveosfucscietsescoofnwtoarmmi-neaantiisngsubfifridcsieuntettootchaeuisnegensetigoantoifvceonitmapmaictnsatoend fgorroawget,h,sols,uravnivdalw,atoerr 2 00003s USFW 0611 on these? aure lev vels osfucscietsscoofncaammiinvaonrsousubfifdiscdenuttotechaeusiengensetgioaniovfeciomnptaacmtisnatoendgfrrowaah,,sosuir,vnivdal,waatnedr on he sie? FArveoileuvielvseosfusietscoofcnammiivnoarnotsussumffiaciemntmtdouaecatluosetsheneigantgitveonimopfaccotnstaomningartoewdahf,orsaugrev,ivsaol,l aanndd . ater on th ie" FAsiemoluesveilvseosfusciceescoofnpasmeiinvoarnosussmufafmicmiaenlts0duceatuotseeneigatnivegieomfpsaccostnaomininogartonewdthf,orsaugrev,ivoail,, aanndd wateron th ie? rFeolieveles osf esictescoofonmanmiivnoarnosussumfafimcmieanltstodoocatusheeneignagteisvteioinompfaccosmomnigtreowdchf,orsaugrev,ivoali, anndd - waonttheiet? rceilneveles osfuscietsscoofnsaemciinvaonrsoussufmfiacmiemnatltsodcuaeusoetneegiantgievsetioinmpoafcctsomonmigtroewdh,frasusrev,ivsaolf,, a0ndd water onthe sie? tpreaaletvielvseosfuscieesscoofnhtearmbiinvaonrtosussumffiacienmt omduceaatuostleheneignageisvteioinompfaccotnstaomningartoewdthf,orsaugrev,isvoali,, aanndd water an th ie? 27 Concepmal Motel PTFnaeeycaconsocerpfaoiuhnaelcomsnottdaeectledrweilmtiheessossunrbescumorefnnattcaemein(ndcapanorithnatsnso.drmhAsat)bihaeaDn:drchyaabroaRvcutene-rgCirsrtoiuecnsditoteiedrecneotisnfaty acrrmeitciiecnpatliaoernsxtph(soessmouarliel TTsiaaimmpaeolrceiasseishn.heashbeeitaiirnnegaesntihmeoanywaboloedieenxgdep,sotwsieeotdnlaoonfdss,oeia.ncdoAnobtpoaevmnien-faginretdosuahnrodeautsgeohrftidhiaerelcsittrece.ocnetpSatucobtrsswuimrtfahayctebhetsreiexls,ptoiasaneldd liTonoeacdoimnhgamemssit,niaonnatnosdfhhtoehueignthaebndotiviroeenc-atglrcoionnutgnaedcstttiwoenishoftthsaeurofriaecceetpwteoairtnsg,eetsrhtoimoinncoainfdyeosnutfbatslhuirnfgaoecns-etsitioteneessotufrisfaialcleoarddgrhaaeinrnieasgdmesst,.o Tohnveiowsroiaoldofehedeeashriaerbsii,taaatlrtayinpadesna,vawirahene,rreesscn,edpoamrnes.ainddoFiowvridaeuraexlascapamrmiopvvaoislrdmoeaudl,silsmioanmmtnmihvaaolbriomtuasypmeraesmgumtlhaaarltlymmaaavyyesOrucspcepuoparylt {CChoromesanmbtianbuainmetsispdnIransslmy.euihcdesheiatnrecchseoanfmaefoiwonadgeyestm3i5so.nanofsAavbeioavdneigprimoscueinnvdrtaetsne,rdaetnhsdeicacoalnmsirevucoemrppteoisro.mnaoTyfhbesecfeoxncpsouswmeapdttei1ro0mnsaioty.f ransfr contaminants 0 these receptors "FDThoaericsosn,ycesprnnodahlweimeoshdelelelocotrefedloiremsoemaoesnutcrhoeanmnteeanmtianeantndhtpeoaipnnrtdismh.aarbyTiahc:eocpnhraaermlaicitmaeinrniiassrtyiecsrxic1sekeisddciernnegteinfbyeinrdceinhtamiaflirekedsxmpieostsauSlrisec, Sediment, sal, and water. Benthic macroinverebate, fish, and enesial invertebrates may be 2 we 000036 USFW 0612 eCxopmoesmelednndtocwhoienhcaoomeiayaheasdlosvmelosdfiemeswnaoose,aiuonrrthsfellcoroforcueengshcpoddinedoonune di.esFterisnoh heedrpeawrpy ta,soonfistievsniisek CFEoevmmaeimnitnasnsfbyfoeerdeinygeeosnfGtlEavIeSA nwhdiechN maayebecutmkaT i.neTdeCrOeA CsirseepTpeAtstNssyI, F,beeesxWpmooops oFFFraseteoaiye1d0ihmeesnrndsewem atesraJsom eeaPambawayy nfo hve ernoucnderres sspowre.1Tshktionn:inBgopeecre I BEE enBecn a e vto ee die [Rr T-- a) Direct exposure to soil wo F57n Dietexpose ovate WV. 3Vomeainnsgsibiorndofcashworms 0D iTnncdeennaallignepesotnioofroswlnaler V. CR BDamivorR Ionucsdbeinnat-- mpenionafsa 0 Incident nenion af water Vi C5amiveoamraeornooisfsomanll mammals 0b) IInncciidednetnatl iengnesotinonofafsowaitler VIL Piscvoron nsmamemaolffeorage fo 0b) IInncciidednetnatl mnion af wat ingestionofsediment VII. OBDmnivoroaIunsgctmeeannmamloafilnfograegne fohfsetiment < Incidental ingestionofwater IX I3BDseeivorTionnugcseiseminoanalofmmaehnwoomfssstiment 0 Inidenalnenion af watr xX Hebivorous mammal x : 000037 USFW 0613 4) b) IInncgiedsetnitoanlofinvgeegsteitoantoiofnsediment Incidental ingestionofwater 28 Selection of Measurement Endpoints sCMheeaasrsascumtreeernmitsetneitcnsdespneodlpieocnitbtneytdssatshaeraemsesmceeshasasmnueirnsatbmolenefdtpeoocxioinlctoisgt.iycaaMlenacthhsdaurrarceotmueterenisottfieecnxsdppotoshaiutnrteas.resMheroaeulslaudtreebdemteolnittnhkeeenddvptaooliuntethdse raseseusssemdeontdendepoirnqtusai.ntivtateive estoifmpoatenttieal effanedfcortmasbas,is for extrapolation ( the Mpfoeotaresnmtuairtaelimoefnonrtoneenxwdphpoiosciuhnrtiessktwoecracelocnsueallameticintoeandsniocsnoutolhdfebcbeoabnsaciseoerf.dpowtaeTsnhatelisaaolvaapinrleiasmbepinolcrtetyoanoftfrcetochneespitadoperprrsaotopinornis.aittEe,ntdaopnnodiicntithtesy - Selected were determined to be representative of exposure pathways and assessment endpoints identified for the site. Next sa lstofspecificmeasurementendpointsthacoresponfdo th assessment endpoints identified in Section 2.5. Measurement endpoints for assessment endpoint: protection of benthic inverebrate communities sructure and function TfcioovleleevlcaotcleadutaoitonmtshebfyisvtedreultcotecurarmteiionaninsndginftuDanrcxytoinRoounmn.oifctEhdxieivsebtreisnnittghyciaconmcdmoutmnhmirutonyuigtshyu,uacntbeuevrnaetlhwuiaactsimoeanvcoarfloufiauntnvecedtriiatobnreaaaltcehfosefewdetirnhege groups. Sreedciom.enTthweaesnadpsooinctolsloefctted hinteeesatcshsowefretehesufrivveivaarleaasndfogrrtoowxaihc.ityCteosltliantguesdisnegdtihmeenatmpshaimppolde,s wHeyraellaellsao CSiozlel,ecatnedd atnotdalanoarlgyazneidcfcorartbarognet(TaOnaCl)y.te lTishte(TcAheLm)ismettraylsr,sBuNlAs'sw,erPeestthePnCBcso,meVlOaCised, wfiutorhiodeb,segrrvaeind adverse biotic responses in th toxicity testsi ordetro determine risk potential Measurement endpoints for assessment endpoint: protection of soil inveribrate community structure and function mTTheoeasedevoatlweusstlstoewcaetthrieeonsstsurrauvcnitduvratelesaatnendddufgsurinoncwgttihto.hneocCftoalhrlteohcwbaeotnretmhd,iscEoiclsoemsnmaiaumpnfolieetrsyi,wdaesroiineltawolxasisocicctooylllelesectctste.eddTafhnredomaennedaaplcoyhiozneftdstfhooefr larger snalte ist (TAL) metals, BNA's, PesuPCBS, VOCs, fluoride, gran size, and foal organic carbon (TOC), Measurement endpoints for assessment endpoint: . proteFcnetgiatoinveoifmfpiaschtcoonmmgurnoiwttihe,ssurveinvsaulr,eatnhdtrdeiprreocdtuecxtpiovseursueccoescs.ontaminants does not have. what " 000038 USFW 0614 - | : iFnaDtrheyadRumni.nnTohwe,enPdipmoeipnhtasolefstphreoemteelsatssweirecysutrevsitvsalwearndugsreodwttoh.deCioelmlicnaethede twaotxericsaomfptlheewsawteerre garsaoicnoslilze,ctaenddnodtaalnoarlgyazneidcfcoarrabogne(tTOanCa)ly.tTelhsetc(hTeAmiLs)tmeretsausl,tsBwAe'rse,thePesctoPrCrBelsa,teVdOwCisth,ofblsuoerrivdeed, Saverse biti responsiensth toxicitytestinordero desermine risk penal. Measurement endpoints for asessment endpoint: Phraovteecatinoengoafivwe oimpractmonb-ignreodwsts0h,ensisuurrvneitvahgl,tagnedsrteiproondoufctciovnetasmucicneasnst.s in forage does not 2F5oaofdeecdhianng aacrceau.muTlahteiosenlseuctdedsmweeasruereemleenctteedntdopeovianltuaetcerpioskrtsopeacviieasnissptehceieAsmewrhiiccahnuotibliiz,e tTheursidte imiigrraytoreixsp.osuArpeoprforpriesecfoeraogpceosntpteacomiiesnra(nestasrtwhawosrqmusa)ntwiefrieedidaenntdifcioemdpoarretdhetaobeoxviesriencepttooxri,ciaynddatthae Tor these, or other closely read specie. Measurement endpoints forassessment endpoint: Phraovwcaetinoengoafticvaemiimvpoarcotuosnbigrrdosw0th,enssuurrvievtalh,atainndgersetpiroonodufcciovneasmuiccneasn.t in forage doesnot aF5oodfecehdaiinngaacrceuam.ulTahteiosnelsetcutdeidesmewaesruresemleenctteedndpoeivnatlrueactepilsokr 0spaevciieasn sisptehecsrewdh-iaclhedihlazwek,thBeutsetoe Jhaemacdiieertsairys. exAppopsruorperoifatecefpotraogresspteoccioenst(asmmianlalnmtasmwmaaslsqu)awnteirfeieddeannidecdomfpoarheed aoboevxeisrteicnegpttoir,ciatnyd a or these, or alrclosly reaed species. Measurement endpoints for asessment endpoint: nProotthecativoaenonfecgaamtiivveoriomupsacmtaomnmgarloswatho,ensusruvrievatlha,tainndgersetpiornoodfstciovntsaumcicneasns.s i forage docs tFohoedschainnd aaccccuemnultaatieosn.sTtuhdiesselweecrteedsemleeacsteudre(m0eenvtaleunadtpeoirinstkrteocempatomrmsapleicaiensspetchieesrewdhfioc,h uVtuillpiezes ivutlpaers.y eAxppporsouprreioatferfeocreapgteorsspetcoiecson(tsmaamlilnamnatmsmwaals)quwaentriefiiedde.ntified for th sbove receptors nd the Measurement endpoinis for assessment endpoint: nProotthecatvieonaonfepgiasicivveoriomupsacmt oan mgromwioah,lssuurrsveivtahlatainndgersetpiroonodufcciovnetsaumcicnesasn.ts in forage docs Food chain accumulation studies wer elected to evaluate riskto mammalian species which uilize tvhissoni.teaAnpdpraopcricsteeanrfeoatrs.geThsepseeclieecste(dfismhe)asweurreemdenetneinedpdoifno t rtehceptsobrosvpeecrieecsepvteortsheamnidnkth,eMdiisettealray exposure ofreceptors 1 contaminants was quantified. Measurement endpoinisforassessment endpoint: rz . 2 000029 USFW 0615  nPortothecatvieonaonfegoamtniivveoirmopuascmtaomnmgarloswttho,esnusruvrievatlh,atainndgersetpiroondoufctciovnetasumcicneassn.ts in forage does. Fthoeodsicehaainndacacdujmaucelnattiaorneass.diTehsewseerleecsteeldecmteedastureevmaelunatteenrdispkoitnotmraemcmeaptloirasnpescpieccsieisswthhiecrhacuctioloinz,e Pirdeonctyiofineldotfoorr, athsea maobdoevleforrecoempntiorvsoraonuds mtahemmdailetiaarny sepxecpioess.ureApopfroTpercieaptieofrosra1g0esCpOecNiMeIsn(AfNisIhS) weWraes.. - quantified Measurement endpoints for assessment endpoint: . oPrtothectiaoanonfevgiantsieevcetiviomrpoaucstmoanmgmraolwstht,oesnusrvuirvealt,haatnidngreesptrioodnuocftcivoenisaumcicneasnsts in forage does - Fthoeodsicehaainndacacdujamcuelnattiaorneass.udiTehsewseerleecsteeldecmteeadstuoreevmaelnutateenidspkoitnotmraemcmepatloirasnpescpieecsieiss wthheicshhourtti-laiizle S<pherceiwe,s B(lcaarribnwaobrrmesv)icwaeurdea,id3e5ntiafimeoddfeorl tfheoaibnosveectrievcoerpotuosrsmaamndmatlheiaiencsapreycieesx.posAuprperoofprrieacteeplfoorrsag1e0 contaminants was quantified Measurement endpoints for assessment endpoint: - Protenoctthiavoenaofneghaetribvievoirmopuascmtaomngmraolwsthto,esnursvuirveatlh,atainndgersetpiroondoufctciovnetsaumcicneasnsts in forage does - Fthoeosditcehaanin aacdcjaucmeunltatarieoans.stTuhdieessewleecrteedsemleeacsteudretomeenvtaleundaptoriinstkrteocempatmomraslpeicainessipsetchieesmwehaidcohwutviolliez,e - M(viecgreotrautsipoen)rsywiavsaniidceunst,ifi2ed2fmoordetlhefohaebrobvievorercoeupstomrsamamnadlitahne sdpieectiaersy. Aepxpproospurrieatoefforreacgeeptsoprescie1s0 - | contaminants was quanified - 29 Life History/Exposure Profle Information ; : Rexepcoespetdortospceocniteasmwienarnetsbeeleccatuesdeoffrosmpecsiefviecrablehtarvoipohrisc, lpeavtelise.ms oOfhragbaintiastmussew.hoirchfeweedirneglhiakbeiltystwoebree Selected for "which risk ecvaallcuualtaitoinonisn thciosuildskbaessbesassmeedntw.asThaelsaovaaianbiilimcpyoorfinatpprcoopnrsiiadteerattoixoicni.ty iTnhfeortmeartrieosntrioanl Sipnevceireesbrsaesleecrteecdefpotrorthsieslercitsekdafsosretshsimseanstsearses:memnetasdotwhe veoalret,hswhoorrm-.aiTlhsehtreerw,striaaclcovoenr,tembirnake,raencedptroerd hfoax.wk.ThTehaeviaqaunarteiccepvteorrtesbpreactieesresceelpetctoerdspfoercitehssfoirskthiasssiessksmaesnstesarsem:enAtmiesrtihceafnatrhoebaidn mainndnroewd.-taiTlheed aquatic invertebrate receplor is H. aateca. 29.1 The amphipod (Hyalela actece) as RepresentativeofBenthic Invertebrates ification Hcyonatlalcetlawiatzhtseceadiwmaenstfseolrec2tseidgnaifirceapnrtespenoiatrioviefotofhebnientIhiiec ciyncvleer,teubbriaqtueistdouuse d1i0sttrhiebiurtdiiornecitn aquatic systems, imporaasnfcooed item for aquatic-invertebrate consumers, and ase of . .' 000040 USFW 0616 - a usseediimnelnatboartatthoeryDtryoxRiucn Cervaeleukatsiiotn.s. These species reals likely t occur inthe surface z "riTvheerastmhprhoiupgohdo,uHtyNaolrltlhaacnedcSao,utihs cAomemrmiocna.lyIfnopurnedfeirnrferdehsahbwiattaetrs,latkhees,y sareeakmnso,wpnontdosr,eaancdh daenndsidtiitecsheisn,ebxuctegseonfer1a0l,l0y0i0npleorwseqruanruemmbeetresr.(UT.Sh.eyEmPaA.ya19l9s4).be found in sloughs, marshes, H`Tyhaelylteyapiecatlelcyabarreoewpiinbtenotshuircfadceetisteidviomreenst,thaandfaevdoiodnbcroigahrtselipgahtr.tiBcuelcaatuesoerogfantihceimfateeerdiialn,g. afrnedsbhewhaatveirorsaeldicmheanrtasct.erisAtviocsi,datnhceyeaorfe liidgehatl ebsytmoorvgeanmiesnmts finotrototxhiecosleodgiimcealntevkaeleupastitohnesoef organisms almost constantly in contact with sediment contaminants (US. EPA 1994), R`gerpartohdoupcotdisotnhatatrhispcrreussutmaacebalnyiussseedxfuoalr.hMoalldesitnahrgeefaermgaltehdanurifnegmaslesmanpd aalvnedecolaxprugleuartfisroonnt Dseuprairnigeasmtpelmepxoursa,ritlhye mwhailleeanthefefemmaalleefgeoedstotgehtherrfoaormuaolgpienhrgiopdeorifod. uLptonomneedwieaetkl.yTafhieerphier mthoel,fethmealwe'osremjaorisnuapniducmo.pulaTthieon fbeegmianlse. sDwuereipnsg ctohpeulastpieorn,mthienmoalheerrelmeaarsessupspieurmm, naenadr sipmlauclei.anTeohueslayvreerlaegaesebsroeogdgssfizreomfohrerfeomvaildeucHty,ailnltolathaecmtaercsauspiu18m,ewghgesrpeefrebtrlozoadt,ibounttatkheiss number can vary with environmental conditions and physiological sess (U.S. EPA 1994), uDenvdeelrogpoinegasesmebcroynodsmaolntd. haAttchtehdaytoiumen,gtahrejkuevpetniilnesiHdyeatlhleefleamatlee'csamaarresrueplieausmeduinnitosthhee sounreroburnodoidngduernivnigroenvmeernyt.teUnnddaeyrftiamveorpaebrlieodco(nUdSi.tioEnPs,Aex1c99h4f),emale producesapproximately Hfiyvaelsltealgaesaaerteecajuhvenialemsivtnagiemse;uminsotaf9rs insatnards,7wfitohrmSttheoapdroel.ersecperntodsutcagievse; satnadgess.tagTehse8farnsdt higher are considered adult (fully reproductive) sages (U.S. EPA 1954), `ExPropfileoforsHalulelarGieteca Sroiuntcee odfierxecptoscounrteacftorwiHtyhalcloelnatazmrienactaedinstehdiismreinskt aisstehssmteonxti,citthyeerveasluulatstioofnithhteestpriilmlarbye used to indicate exposure. 292 Earthworm (Eiseniafoeide) as RepresentativeofTeresrialInvercbrates lustification. hEaabrits,hwuobmimqsuiwteoruessdeilsetrcitbeudtaiosn rtehprroeusgehnotauttimveaonfythearbrietsattrsia3lnidnvseoriltecbornadtietsiodnuse, oandthiemipfoereadnincge. maiinpcportroefonlvtoiirdaail,ngalinnadk fmboieocnrdwobefaeasunenasfo,oircl omcmoabnnitynaemsdimnwaailntlth-stdoairnmedcetdsciooiunlmti-anscvitezrwetiedtbhrptarhteedasctuoomnrsso.uumneAdrisnd.igetoIfon,fapddredemisiteninuostn,s, 30 000041 USFW 0617 ciea.rorms were observed i both the wooded snd open fled reas of he Dry Run Creek LiE EfaerHwisoe torrmy,efeaietdouo1ntafdoneoaadd.haTndshdtmecpaoyaiInrmgppalsraunatnrtaenrdoefqaufnioiremdmaienrteemisasdiandpselqaaunnadtmeaotnmerifiraselc,e-ei.svpiencWgiaasltolieyl e BeHboyrwoaailsolemhistcahreetapobotrelry dokeevpwetlioohipeh.:igrheEsalpriytraotcwiooornnntdseepniwetendrgseengoeinroandlsilfoyffuahsbiisogenhnotrfaoirgnafrsaaelzsle:, sis wit Hoefs than 4 (Lee 1985). . Ertwoarmslarceauhnesma,uphprroooddviuadcteee,canovdcoimodonsosepsapaercnhideesnparogeespnrseoidlcihyeaclbvyyicsSreaox,susabflueriemlpazrlaoedtuaocrntg,iaonansltacharonunngotht CE pulaon afan carhwormh Species at any one me consis of young aimnmaaLtuorfey, 197 well-grown immature (adolescent), mature, and senescent individuals (Edwards Exrtoormsnehasvebsaievneedrnaplewcraaaytsauonrfdeseusrxvtti.evimInegseadmmveisrcshoefpemonopvruielraoentamiseolnnytastluaicnvoanmlda,ittuohrneescisonucdcoihovinadssuascolaisln.. me aheoonsgfvaora1bldeoenpeerasgoailno(Eudnwdaerrdgso snadteLsooffyin1a9c7t7i)ve unl envizormental B Someesppeceisoetsmeofhaewpaaorwmlisnmgrraoomwnetlhoorfsoceuaggthmoeeusndtttihsneuosptolniovafecshrbeiynsngcusoa.mnduOtnahleeyrssepaedcdiiinensi,gzuesehWgimhe3sonutEst. S et ys 5 earsafunsdeer nab.oratoTrhyecfoensdpaonsofEEdiarednsosendidLeowyas19r77e)p.os 0 be ExD fpeoseurce eoPrnocfiwlietGhucointaamainnadtgerdoswoitlhs enhedpprismalrlyorwoiutnegofeexxpsousr0foirteswsorwmilsbie nussed demtio vsexepaorsgreaa1mah.ighTerspehriesiedveelanoarlygsaisnwsi.l sobe conducted on the 253 ahead Minnow (Pimephalespromelas) 3s Representative of Fsh Community Justification TTh fae thmeademeinsnmopwceowramasnasceweliet4cht5etdfaeosodrrehopeurmgehs{nootruitivoegeoafinofmgayiecveoon,rsuuombseiqrfusih,tondudsedatiossicsoufituoeenrian obarory oii evalustions LifeHistory. ; u 000042 USFW 0618 iaTnhcneryfeeaonsfaodfimmiatndneohw.,strdaSmelgth sE,aeidsaewi,sd,peloylnddi,esnibduutreldoilfn ikNogerht.hseAmmpeerriuacnanna,cndogihs mfomunmnardobi:nne `and low oxygen concentrations (U.S. EPA 1985). eT`Tohoespflaptihoeenad,msAdiaelniesnpntriaomonasrwiplayoteormsnnisvdooerocottus,s.WooYoerunnfgrotylcpitcacFllooysafneededSeoinoderiituss,Eaologaeon,aaennd vE Adulst ftofhbeaed Smianlneoswsa T spawn E te lsplricneg asndofcdontdinTt,o parwsnkthyromupgmhoount mapottotfythee afSehmvaclaeesghgmsaaumytananye,4dTy0so.0enODmaSe5g53h eprrsa pofny.pHHpeorlhspanmoetdniveer fdeempaelpned oeoveeep15o0rasm3yto20 - SE em `earlyasthe first yeaTre.E,InSuvabe ot vn cooler water with amode re eee rate food supply, spawningusually occurs Exposure Profile oCSilneciexgdeoitertxcoproonFacsbewuitthicoonanmisntesd wkaiAthteeexniecekoy eevaltnioofn i tee prrimaory route 254 American Robin (Tuasmigrtois)as Representativeof Worn-esingBids Alugiification . S"ETehcenaAsmeeeroifrc5ano5uobbiqaiuiwtmoaussssdeslevtdaeedtilanopwarsnedsednpeateyicosoomofpoobnntmeiiovnro:ousoTahpndpssraoemeinveosrrosrbiorddas Camivrous Epon ns Fk Smet, Te pi+aHeThsais a Fon Crk she on iChnaecnraAedma,esrwinicananpinbegibinbdlthssoatndnmiagwrnabt,olrhieoa oorwUsS.rreoMeufegihcneg,stranmndgsetCookftcxpoaonntmngdeaeCUoSe.rnnnd fnmoeirsens.tgs iwasnaeipnduoprpreeomdwueinvteosForoorgSiaennegdfdwiepnaieg.rarpTnehseseseresel.qNouoineetmeesi"suBvmonmnmsteemeoee Rains though provtio fl bainen ofmr bmp 2vThieenplrgimTairoy oorabgiirngithetcohGnniugquhnetoteresrocbeoiemndmiionsgnotsheoaupncshocfnoognsteihessgmrooaubnnydd aionfsbaorrecnhesohfegrnreosodw SCoomeniual,oiw dkigesbieshricaonycyofoor onSahpeeSdy oofoyan omoAfbOMiE mnotg mree oeosn sr 2 000043 u CL . USFW 0619 Bt`oerrmeifefodrfiioneogsddtruereritsnogotruheerscabaerrreeseeedlsiitnmagibtlseiedsa,hsaeoddnbu;lyhtorwmoeabvlieners,riwofiblidlaesnl.seiaMtvioeessttoofftroeormbapigonirsnagrrieolhcyciugfrohsriacngleoagseeilvsteeownhtaehrreeesea.. O`wuittshiidneo1 ftto3hekiblroemeedtienrgsp(ecrimo)d,ofotbhiensesartyepaisc(alUl.yS.rerEuPmAto1t9h9e3)s.ame foragingsitesand roost - ExposureProfile Ae(Udr'uisl.ttoErAPymAesri1i9zc9ea3)nv,arTroyhbefilrnoomwaer0es.t3rr0epeo1rpaecdroebt,oorwdwiyteiwhiegefihogrdhfatrgio(nm7g7.7h37o.8m3)eatnordat1n3hg5ee.ss8mraglplo(erUsiSte.dreuEppoP(rA0e.d21h9a9co3r)me.es Fangeof(0.3 acres) were assumedforthis isk assessment. AABfWomodiaiernegdreorsrbetiaipnoocnriaytrenadbfceoeoreftxah0pi.se8cn9stpee0dctieo1s.c5(o2Un.gsS/.ugEmBePWAi11d17a9.9y55)ga./nddAayasoswfauftmoeirondiganagn7e7ds.t31io0gn.b8roagdt/edyoafywo0ei.fg1wha4tt,egargn. T(S6uh2me,adcsi,eatnhotafcwtkohbeerrmArsimc,esr,sincraaialsnsp,breobrberieintelsce)osn,(sUic.asStt.esropEfilsPleaAarss,1o9ns9ap3li,ldyeErivsva)rliiaacnbhdleeftrpurialot.p(oe1r9t88i,8o)nd.soogDfwuoirnoivdne,griccshbperrrairtnyeg,s, S2T0uov0memre7crb,preaartncedesnftianl,fftrauhilt(diimneitgatrrhayetcoosrmpyprosisenaigstoi(non)ne.stTiihrngeessuepamsomoentr)orcttdhoiaeent5gda2erypfeprrroocmpeon9rt3tipfoerunrictiesnatrneidpnovretretpdeebr3rcsaet6ens8t pSeirsceesnstmefnti,taadnidet3o2fp1er0c0e%nteianrvtehrweobrrmatsewsil(lUbSe.asEsPuAme1d9.93). For the purposes of tis risk AHWonowoiednvcceiodrce,kntaawlisslaoibileiinungsgeeessdttiiaosonnaarstautbefsotornftuht1ee0A.i4mnegpreesirtcciaeonnntrroaobtfintfhcoeroutdlhideetnAomrteebrpeiocrfaeondunrfdoobriinntthh(eeBeAlyimteeerrraiettcuraaeln A19m0e4r)i.canAsrsoubimninisg1a2.f2ogo/ddaiyn.gestion rate of 117.5 day, the soil ingestion rate for the 295 Redtaled Hawk (Buteojamaciensisa)s RepresentativeofCamivorous Birds. Justification. TcGhormeepeornseidsit-teit,oinl,elidsrhdeilaeatwiikavlewlaoawbssusnfedolraentcthteeddiesvatasrlirubeaupttriioeonnso,enfaicntodinvtieoakmefliin&nacotaoidmoinovfoinrooscuicseurbseoiinrldcs.eduaIetn t1ahdediiDstirdoyine,Rtaturhnye CGoonsceenttoratthieonroedf-tcaoinltedamhianawnktswhficoh auilnlsnomwasdlflormtahmemeavlaltuiastsiuoenwoilflcaolnstoapmrionvaindtes ainn athcecufroaoted source LifeHistory Ro1e9p7de7en)t.salnTedhd.ehiTrahwhekabysitaaaletsostihnhehimgaohblsiytlvcaaoirinma,mblepern,aibarunitedtgwhriyodveaesr,peracenaoddmdmAeomsneerrltiyscifanonutBhneudtWieneosw(toBeourldleUdanniatdreedFaasSrtrnaaetnaedrs RforSest 1A98n7).oppTohritsunsistpicefceiseadiberse,entsth.e hroewd-eavielre,dfhraowmktuhnudnrtas,farnodmraarpeeirnchexotfenosnitvheewunibnrgokfeonr aro 3 000044 USFW 0620 fdwoeoldliitnegmsspseucicehs)a,srsempatlillesm,aimnmseacltss,(aen.dg,ocmciacsei,oncahlilpym,upnrkesy,srpaebcbiietss)t,hbaitradrse(tuosouahlelayvgyrotuonldf-t offthe ground (Burion 1989). . Tahpeebrrceheadnidngnseeasstonbsutaitlsbwydibitonhtaghersieaxlecso. urNsehsitpsadriesppllaaycse,dcoimn mtoalnl leyefso,llhoiwghedrboyckmlaetdignesg,oonr aotlhrcaeceteigagnsd iasrceaorfiteednoruetfubrybibsohtehdsaenxneusaalnlydfoarsussfeorianpcpornosxeicumtaitveelyye3ar0sd.ayIsn.cTubhaetiyoonuonfgtawroe able to feed themselves at4 to 5 weeks and ledge in about45 days (Bull and Farrand 1977; Burton 1989). . - - `ExposureProfile Adult male and female respectively(DeGraafand red-tailed hawks Rudis1983;U.S. are EPA reported to weigh 1993). Homeranges 960 g and vary from 1235 148.26 g, to 3Sm9a5l.l3e6starcerpeosrt(eKdirhkowmoeodra1n9g8e0)o.fT14h8e.2l6oawcersets rweeproertaesdsubmoeddyfwoeritghhitorifsk0a.s9s6e0sksmgenatn.d the Tihmepodriteatnocefawrietdh-tsaeilaesdonhaawnkdcaovnasiilsatbsoilftyma(mU.mSa.lsE,PbAird1s9,93r)e.pilFeso,ratnhde ipnusrepctossewshiocfhthviasryriisnk aFastseessasrmeenrte,ptohreehdatwokrawniglle bferoamss1u3m6etdot4o0c0ogn/sduamye(K1i0r0k%wosomadll19m8a0)m.maTlsh.e hiFgohoedstirnegpeosrttioend offooadppirngoexsitmiaotnerlayte0o.f045090gg//gdaByWw/adsayashsausmbeedenforeshtiismaitsekadssfoerssthmiessnpte.ciAesw(aUt.eSr.inEgPesAtio1n99r3at)e.: Treopeoxnperdesbsodthyiswveailguhet ionfu9n6i0sof10g/ydiealyd, tahweawtaetreinrgeisntgieosntiornatreoaef w3a6.s6m4ulgt/idpalyie(d56b.y64thmeLildoawye)s.t Athesoailmoiungnetstoifsonoirlateprfeodricttheedretdo-tbaeileendtrhaaiwnekdcionutlhdendoitgebsetifvoeutnrdacitnotfhaewhlisteera-ufroeo;ttehdermeofuosree,: hvaass buseeedn troecpaolrctueldat(eBtehiyservaleute.al.A1s9o9i4l)infgoersttihoenwahtietoef-lfoeostsedthmaonu2sep.erceFnrtoomf tthhiestvotaallued,ie2t cFooontseedrvmaotuisvee.soTiloienxgpersetsisonthriastevaolfue1.i9npuenrictesontfogf/dtahye,otthael sdiielt iwnagessatisosnumraetde ofofr t1h.9epwehricteen-t w1a9s93m)u1l0tiypileileddabysotiheinfgoeosdtiionngersateioonfa0t.e0o9fgt/hdeayw.hiTteh-ifsoovtaelduemowuasseas(4s.u5m0egd/tdoayr)ep(rU.eSs.enEt PthAe acomnosutnatntoofvesoriltiemen.traTionedexipnretshse 0d.i0g9esgtiivneutnriatcstooffgtrhaemswhoiftes-ofiloopteerdgmroaumsoeftmhoatusreembaoidnys e`miougseh(tthMi,ervaclu1e9w87a)s tdoivyidiedbaeyvlatluhdee olofwe0s.t00r7epgo/rgteBdWb.odyThwiesigvhatlu(e13wag)sotfhtehnemwuhlittiep-lfioeodtbeyd the food ingestion rat ofthe red- tailed hawk (400 dayt)o yieldasoil ingestion rateof2.8 eiday. 296 Red Fox (Vulpes vulpesa)s Representativeof Camivorous Mammals Lustification. Tcohmeporseidtifoonx, wraelsatsievleecatbeudndaasntredpirsesieinbtuattiiovne, of a and lciakmeliivhoorooduosfmoaccmumrarelncdeuea 0 its dietary the Dry Run Ccroneceekntsrita.tiolnisodficeotnatlalmoiwnsafnotrsthfeouevnadluiantsimoanlolfmcaonmtmaamlintaitsisuoen wiinllsiatssooiplr.oviIdneadadnitaicocnu,ratthee. soe EY 000045 USFW 0621 dose tthe red fx wich allows forthe evaluion ofcontaminants inte food sce. i. Redfo inhabit open meadows, ich bank, fed and wood edges, encerows, eam and rlthaoekueenbxodcr(edpSetrcish,ownaanodfftaanerdmrlSaeneddasir(nHsofs1fem9ae8si1os.tneAr1dc1e9n8f,9sx; JhlovnyeesRamonOdpBBeieTmdaenyfeo1n9m8h8i;onmMxeerirbintatgl1w98po7)o.doneWitttheh Difvoi d1e9n7,0i,s dTohgersienegtt.hme bhrecddidnesneasvsoe alnid xpcsepriooomnsl,yncaondcweinaensd(rBiastoloeundnindg Cloesnan1d0emnhtisnwgilsfeesnSdchhiwsaeam gShedcnin19g81r. i1raSdomnnfeosthetrss dCleonne,sbntd Bimey 1988). . pheorsedsfoxmiRpri,macSykuannko,pdpeonrtnsi,sibcidcsa,m5ivo,re,Gcoonns,umEingefoeod ,eskesusc,h a1s0rabFbOiEsS, l(SBiuaoprbpcoyounrtshauenmdreDeddavwoihsxen1w9f7in4l;ebMauearrrynitptol1u98ns7)1.TeSoodBmreseveyegem1t9a8b9lt)eo. mfaoDtrutreSrionnsgusciuhmmpassiofornfusiattsha8unednnrtutsfmoaoered har snd Schwarz 981). Salreosnndlfienmtalperfoyxaesrpsasaolr fbeo,weemniiManrgchongdcAprr]oMmmEiTd1e98to sGumameir,nFpermaoldess T1heopumpsaabowte9e1d0s6hayost, 6w0idamyo,stIvuerhmei6n 53rdra.ysuSrchnw,arazddnardeSsceuaarlsy m1a9n81n)e Rhaeainvfdsotwiwliarnd(piees19c8o7y)o.teNs a(errpsre1d9so8n,sSocfhw1adafnodxSweemoawnau1t98i1n.clRuedrfeox may Ive from $i 06m yers a he wil (Schwarz and Sears 1981) ExposureProfile. AHidemueeadngfeosxvwaeirghrofmom2425.71001723k3gs(rBsar(beuiatn 1Da9v8i7s 197 Jones and Bey 1989) T19h0e.f1o6odinBsWioday fesofra vhenrtdeo(xUSa,nEePrA 1m993)0..0T69ogelwBaWtieaiynfeosriaonnontberefoirnagnaadlul.t hnTeeddsfhovxeastttseiimnaiutnneisdtiooofnbgtaaeyp,rofothxe0iR.mOiagtBhe5ltSys0oB.0lr8eeiygwfBeorWdeInMypeu(iUoSi.n tEebPyAofh1e99l90o1)6w5esTtoBrreVpeoersyt Bio1ndg0yt0ow%enisagmhtatelolof5mf2am.27m25alds(y7wi0l2l03b82)2a0smsuymeisd, fFooord ngpeusripoonrtaseofo4fs4F5kdsoeysanmed 3 datter {Anseoeildnfgoxs.iToonerxipreossf2.hipevracleuntoifntnhesioaflddia,hs bseoellnienpoiroend (aBteyefr2a.p,er1c99e)wfoas iiplied by he fod gestion esof45 ey tii 3 501 mgesion te of121 dn 20.7 Mink (Mustela vison) RepresentativeofCaisrous Mammals Justification 5 000046 USFW 0622 . p2 ne Tne mie nk wais eselsecotwsedhsu8fnodrruenhepdrcessvrelinmoainiovonen,oofnf dc8 occanlmihtvoaoormoduisoinfomacaictmumiroaeollnnc.deuIeant0tdheiiDordyineRtau,rhnye Ct slkownhaicmhnl ant ffol ro(hueinevncas llaudmastinondoffcsontaamsienawnitlsanlstohperooovdisdaueraeccurate LiifekHairsetoeodry.uminnsodvtrmtwiuvecsithr1oaf0lbCloryoerarliyNnao,bsNaAemwceMroeimx,iiosn,hpaaenrdrmaTdneexrnatsow(uiogenshuatsnh,dehsBciemaerrye iy aofoneixntepnldanndtoremaisddaoyn(sHaonfdfmBeiimseiyr 11998889)). Albough primary octumal DDeensesnhayaesarrevavsedarB,imasnedybh1eye9y8f)ea.uneaMluaslis(eBsaaelbenaodynuorodalvdndemDsiaevhissis1b9uo7r4wr)nowbHuoorrrmcoeownsrsawnughceesidtcebrnheyd aa ini noovbenrysfplroaeywinags(hroiran o1987)n.anedBosny 1988). Mink re sary Seasons foeodovfacioly1g9.3,orSveoin.eeoFdrmhi,essnasdrkyScsoc,mapronosido1s9n,8()r.aBbbCaisrr,aabxnyddoDapaulravnrit3sm1aa9jm7oa4)rn,gorToibhoeenr Bimeso19e88 Merine198y7)egions ofNoi Aaica(Babour snd Davis 1981 Jones and BB reeding occuoy rosmfseo(m(MJBeuaiobnue1ru9p8a0a7rn,codradSrDuylcacyvheAiwps(ae1lS97wnr4idlahHSiocfaghfnhmwdleyaiSvrscazthrewir1as9b1r89l1z8e)51s;9A8ao1)nth.ieigsAhnlvayenprdevaargBrieiioadmibselereyasn1iig9nzi8gne8lgs;e ase svenloyaonnmedaowSnboeTohmrsam1co9onn8pes)s,(Yobiuobnctaatse1,9a8wn7e;daSdnoceghdswswairlszlhpaornuedySovcenohmwsianrsz(w1i9e8er1k)is aedwwao yrer19of81ageAkInhtouhgwhisdom(eScihnwdarizctansdaSvcehwvaerdz u19p815). Years, `Effects Profile. dfruolm 1m91i0 1w5ei0g0hsoems ($U20S10E1FA 719g9(95)er0 1987 US, EPA 1995). Home ranges vary nB yerode undofroed.yibngaetsthi1o9ln9o5is)etToroep0oe2rxtperd/egsbohEyWsiwvaaeylluhai(ns5ub2n0eins1sof gmalyde, ohfeoordbfnotgdhesimnilgoeenststinoedn aheaaebTysenre19l9wo3)as.ttTneopgeosnxoepdnrebesoesyofvweaigl0.h1iu!niogufnB$i2sW0of0asy3wys1irs1ewptatr4eeer fiinonggeaesstiimoonn E Toh willo be sumed5.72 Lido). Fo he purpoosftehiss risk ases3sdimteof1n00,% % 000047 USFW 0623 CrAeidninieaddycehee ne(iahnynegnsa igoensrtieoonrotsrseekviansanmxesnmaal,ylbCeorfnrsroeimmopheoetnroorsg;pstyhersry,s a GSsreorvmbkaeaaniocbfheeerpreydmdecehnaeby dwhc0h mak amy pnienviaonwsoompsioennof.14To5e TSLieitnenssttoofrsiyinefmoaremmatti1ao0yn0b 1f3or2t3h0eE mbmlPILoTnmki1s9i7m5caSceoiho1o9)%.FwasIhnwKeedApoiiogpwheatihhee CSClooidnrsgetsnoofep10o101hm1ovnfisendkhnhwsaomwEeiAnEgh.eEamToahe weedggoonfeg hv10t0 oeoseiSdhfeelgilomwweeesr 1982): - log Weight (g) = -5.374 + 3.316 log Length (mm) (AE1li1lmsfafh.oooAi1s9n7c2g) svThiaitserioofio1d.s75ssoppmerarcceihnttceBoWniaedksaeyofbta5se3bge0e33ri5epofrreefopodorsphraeds mge1iotl3s CoConimeiofnrGgeodssisdampnhiotsne5mmeeonfhbtte s946sppmeareynrocfaohfcnen 0ef0l3dd8nofgiKsSmmseeaeios1ss1ge9d7ei0m)nenet, - vom riFoiretrhseepuyfropeoraseoyoffwiesgmrea(sl1i,8n1scBvoiansotsaruimoesvdheh.tmheTehsvvvlelosf(s0d505imhewssictodneinecdybien ehse oortkkism1eo4nftgyrasmsooyf0eslrhidmiecWapdehae vmeoftonhsbdm oy wTeitghfp orTHsipokrodvpeiaehseoocdotomefmoovfn7 Shi a3 po 2938 Raccoon(rayon ot) Reresnaiv of ives mma Austification TCChoremeperectshcies.oonn.Tiewatvsssellowsesoduonr3dshsreeScpsroeemsiinsoninnofcsonofdseammilnaidoonuo5f mcaemumemaedlneeune.ttvo1s iDiyocRneys - ISnceonendoee4ohf CtmeamaArwshioh Husofar.Toeviaeluadofscrsmwoan powfod rk Life History, RReiaciacasnonnss pnsrcdefssmemscaiisonhrcvessiPz(endKu,atmpaou1s95t)sndRVsreodsbdcunvasaewnoaomrype,nhgofhposooeddup:eNiloi,reFeAnreitsc es nd nes. RacFoe eobn) oh Sue war fr Fon rte k sos " 000048 USFW 0624 - - o(Sf5dS4a3rdbeiusrnww1ai9tkl8e7.ki(eSFrneorwtegehxeraim1p9al4ce3ti,)v.ritaRicaeccsocootnoosnasvpaipenogarcuetniaivrseiacpsaalrtymfaieresfdmhoommanyduwbrhseakctioetovmldeerawcyinsia(vvSadieulvrabielnreg o fect prto oitmkaeroayndvEavnita,gneotf,feaecdoirnsg,gorpapionru,niinsteecstsd,ufrrionggs,locwrtiadeyIfvaienyse1gh9g4,s8)(.PaRlamcecrooannsd Fawler 1975). Ri acncioeoo(nsKnianuetthmceaasrnooeu1nt9oob8re2mr)n.anlrlseygaitsoilnngisooacrfycthuberuUstnwiritolemldcMoSamtrecehstotagoreJetuhanecreiivfneoryseohauortrhrteporeunrnairdoed(assGaoolnfddtmiaemanecdh1u9mr5a0i)ln.eg ToSuammeaerr,ewwnhiotirhemsafelveeymraanlloetfsesmmeaxluaeasltldiyunrmutihnagertefcieuhsintrsteyheaeesaorfni((rsSStaabnnrddeeeerrdssioonnng 1s199e58a71s;)onKabuuttmmaannu1r9e82l)a.terYionutnhge "TTehvemcohneo(mS2ea5nr3daefnrogsweontoh1fao98u7sr)a.ancdHcoohoamnehdaervpaenegbneedsesanroernottryhepadinci(maSaallnf'ldeseywarshgou,nndh1ra9e8b7di)a.h,ecPfaoorpoeudsl(arnteasi)oounbrudcteesrs,ainaigneedss herthpaearnedcosrmomnogny(oHnotfhfemaanmoaunndtoGfotresscohuarncges1i9n7t7)h.earea. Numbersof0.1(0 02 animals RPKoielaoergccraaasrcmefd(okouren)edo(anmeeaanr(nSea4vsn3edr1eyrksaeqo)unwaht1ii9cl87eh)a.dbuiIlan.AfDelumarabliaenmsgac,tahandewuealittgmhSa0lueyperaras5or.a9nkcsgcow(oemniepgaonhpeu3dl.a6tu7ipkonetso) i0.c5khngsoofnfo19o70d)p.erAddaayl(rNaeccwoeonlslweetali. g1h98b7e)t.ween 2 and 12 kg (Nowak 1991), and consume REvaeicncFogoantihserfse1eu9d7mp5r)eimawIrnaialsyMporanirnyfclupaliny,dmnfaoudrtee,stuaepcdoobfmison,osegmrcatilsnasn(,d3,i9ntpsheecrtcdsei,netfa)rr,oygWsc,iolcmdrpaocysfhiiestrhi,yone(og1gf7srpa(ecPrcacelonmoten)rs. TOSSiopkneecrbkmeabrnetynyi(o(eLd1ise6enpwteesrlcy3ennptae,rnccdreanUytf)ei,srch o(m819p5(e21r).cpeernctAe,tnts)Wn,aaiaslshni(5nragpcoeerncaesmnio)su,tnhtetsripdotefiSwlaeitsea(r5rap,reeraacceanoctm)cs,ooafinnssdh rFiiepasve,d tshhrifmoplaonwdincgradbiset(a2r5ypceorcmepnot)s,iofins:h (m9oplelrucsecnst,),mmuasrsienles nwodrmosys(te2r0 (pe4r4cepnetr)c,enatn)d. Echiurdaworms(1 percent) (Tyson 1950). Toehroeanhao3(mfSeaenrdwaenrtgsheoonuos1fa9an8dr7ah.ecccHtoaoormnesedherpaaenvngdebsseeaonnerttehpyerptaenidicm(aaSlal'fnsledeaywrgesh,ounnhad1br9i8et7ad)t.,hefcTtohaoerdehsroebsmuoeturrrcaaensng,gesafn3odsr Soteemhae1l97eh5o)r.macePcoropaonungtefioofunondaddieunlstcoifaessmtaaallelGsoeiodnretgphieeandsraascmtcreoaoonrngelsayiiosnaaptpphprerooaxxiimmamatteeloloyfy6r35ue9shhoauanr(Gc=:est1i186nSStEEh))e Co Numbers of. 100.2 animals per hecistcoammroen (Hoffman and Goruschang 1977). Exposure Profile: FFeoosrrtdtshae,npauntrdepoasoedfsios4fofph8eir0cerpnietsrkocafesntstheefsosdrimeaetgneth,aissahbbeoaendndyre2wp0eoirpgtehertdceofnotfr2crlakacgm,cosaonwnseine(gBeeasystesiruomneetdr.aal.t A1o99fs1o)i.0l.5 Mliplyinthge ingesion at by 9.4 percent yieldas sediment ingestion ate of 0.047 kg/day. 38 000049 USFW 0625  ; FATS AeqduaatliyownadteerriivnegdesbtyiConalradteeroafn0d.1B8rLaiutner(s1p9e8r3d)a.yA(dUideatyo)fw1a0s0c%alfciuslhatweildlube saassnuiamleldon.metgric 295 Shortniled Shrew (Blarina breviasRcepraeseuntdati)veof Insecivorous Mammals Lusificaion `itTshedsiheotarrtytaciolmepdosshirtieownw,asreslealteicveteadbuasnrdanet ipsirbuetisoonfieinnsbneoctttihvoimrooiuvsst manadmmdraylhsabbietcaatsu,seanodf plliaknetlsih5oowdelolf oacsciunrsreectnsc,etahtetyhteeDnrdytoRufanvoCrrseoielkisnivtee.rteAblrtahteosugwhhethnetihredyiaetrs minayabcuonndsainsceo.f Hasseessmnbeyntac,sstehuimsi,snpgectiheastmthaeyirrdeiptraersyenctomapnoisnisteicotnivcoormopursismeasmmsoalle.ly invertebriantehs risk LifeHistory `iTthsersahnogree(aJloendessahnrdewBiismaenyex1t9r8e8m).elyItacoticv,clauragpev,iaarneidthsyoefamovisyt a-nsdbhrcoerwydchaoibmitemaotdsnswuicthhians mweaerdsfhieesi,dsb,ogasn,d mpoaisstturefsor(eBstarfbloouorrsanwditDhavaimspl1e97d4;ecJaoyniensgamnadteBri,mebyru1s9h8l8a)n.d,Sfheonrcieariolwesd, ssuhbrneiwvseaarne(aMcetrirvietbo19t8h7)d.ayDuarnidnngihgahtrsthhwrionutgehrosu,tthtihsesypeeacri,esalmtahyouugnhdemrogsot opfetrhiiosdaocftitvoitrypofrs (Hoffmeister 1989) - "aTnhiemahlomdeensriatnygmeaoyfbtheisgsrpeeactieerstvhaarnie2s5wiinhditvhiediuraldsrapmartiaccrpeo(pSuclhawtairotnzcaycnldes.ScIhnwparazk 1y9ea3r1s), I1n98o7th)er years, this species may have an animal densityofone individual pe acre (Merritt Aanldthwoiulglhvosrhaocritoauislleydcsohnrseuwmsestwrhoantgelvyeprreffoeordaniimatlarmeeaittnemramtsphleyeasvuepopplpyor(tBuanribstoiucr oamnndivDoarveiss. v1e97g4e)t.ableThmeatsteerf,osoededsi,tesmnsakiensc,lsuadleameaanrdtehrwso,rsmmsa,llsmluagmsm,aslnsai,lasn, diynoseucntsg, bairrtdhsro(pBoadrsb,oufrunagnid, Dcaovnissum1e97d41;0J3onreessaenrdeBxtiemnetiyn1w9i8n8t;eSrc(hSwcahrwtazrtazndanSdchSwcahrwtazrt1z98119)8.1),PlaInntsmoamreerreigsiognesn,erpallalnyt `mSaunbemrasimlalyrycognlsatnidtustperoudpuc10e 2a0vepnerocmentthaofquthieckslyhriemwmsbidilezte(sBatrhbeoiuprreaynd(MDearvriist 11998714)),. Prey temsthatare not consumed immediately are sted in 2 cache (Merit 1987) Usesnisnegoefchsomleolclattoiolnocaantde sfcoeondtmaanrdkitongm,ovsehoar-btoaule(dHosfhfrmeewisrteelry h1e9a89v)i.ly Aonn tehleaibrohreaatreisnygsatnemd o(fScrhwaurtnz awandndaStcuyhnwneaslrszar1e98c1)o.nstrTuwcotetdyupseusaolflnyejstussataefebwuilitncbhyesthbiselspoewcitehse,garborueneddisnugrfnaecset ahnadvae mreusltiipnglneeesntc.ranBceosh. nTeshtesabreebeudlikngunnedsterigsrtoyupnidcbalelnyelaatrhge2r otgh,anrotchke,roersttinhgenrecsotve(Mre,rarnidt 1987), rBergeieodnisn,gbarpepeedairnsgtomacyomsmuebnsicdeeinineaeralrylysparnidngmainddseuxmtmenedrinbtuot tpheeafkalla,gaalitnhoiungheairnlysofmael. (Hoffmeister 1989; Jones and Bimey 1988). Gestation periods are approximate2l1y (0 22 39 000050 USFW 0626 - 2daaniydsSDcwhiiwtvhairlti1se9r714s9;8iS1z)ec.showTfaahrpetpyzrooauxnnidgmaStrceehlwyfauflrlotyuzrma19t8ut1re)ne. yrooBumontoghn(esJteoxonetessrmeaaneydmBobinremtehedsyoth1fe9ai8rg8;efi(rSBsctahrswpbraoirunzrg (Schwartz and Schwarz 1981), `OoNrpaeodtrauetruoamrssp,rderodanacotctoorocsnosno,sffuotmxheeest,hswhesosshreralesiw,lb(doorbcsaahttrese,swstkiulnnlcklosuf,tdeahnfdisseh,rraeslwn)ackibeses,c,aauolswtlehsoo,ufghthahewmikorssd,tisostfhatsitheeefssu,el FSrcehowkagrhzan1d9s81()B.arTbohuriaendexDpaevcitsan1c9y7o4;fJaosnheosra-nadilBeidmsehyre1w98i8n;thMeewrirldii1s9a8p7p;roSxcihmawtaerlzy oannde Vear (Schwarz and Schwarz 1981). `Expoure Profile Aa1d5s8uh7lo)t.resthHaoiortmetdeasirlhaenedgwesshcroveuawlrsdy bfwreaoiimgnh01.f0r00ompe1 1ra2ccer0net(3of0Miegsrrdatimest19(f8g7o))m.(ftTohheeesccoeanfntodarm,Biinirtanwteeayds 1aa9rs8as8u;(mrMeeedsrtruhisacet ctor af 1, since th area comprisitnheg on-site sampling locations was approximately 20 BFoWoiddainyge)shtaiovnetbeesenrarnegpionrgtefdro(mUS0.49EP10A0.169925)g.ramAnperavgeraamgoeffboooddyinwgeesitgihotnprraecoyf 7(.8985 a"onmytuhoalsflabdlyseaotydbheefeolnrorwceeopsmotpratrreedpios(roUtn.eSdo. bEtohPdeAylwa1ee9i9rg3h)it.ngoeTfsot1i2eoxngrprrtaeemsssttthhoeeyffiooerlrdmmeefrrooifdnogoiednsgtieinsogtneisortnaitorenastwreasetreoesf To8rt8h10p7u4r4poisdeas.ofOtifsthieskevaaslsuees,smtehneth.ighest food ingestion aeof7.95 gday will be sed A{bioswdayvtaweleuieinggienhsutonifiotns1r2oatfed1o0fs0y,2i2el3tdhg8/wwgaatBteWeriridinangygeeshstitsoinobnaeretanterwoeapfsor2mt.ue7ldtg(iUpd.laSiy.edE(b2Py.A7thm1e9i9ll3o)t.weersTtsorpeeepxroprrdteaesdys [mLidas). . sh{hooerslotilinlgneedsgisohenrcaswrtaestifencorofttthhnheeeysohproeobsrosttuemhdwopasphsorruetswuendwi.asstTihnceooomapnvaaiisvlsoaurbmel'essfwrdioihmtahsi esolimenisltaprr1ee0,ftethrhaeetnrecoffeotrfheoe,r "Vantirmepmoanendef(orScthhewaorpzosasnudmS(cBhewyaerrezta1l9.81)1.994A).saTlhinsgveasliuoenwraasimofu9.l4ipperlbceiynettohdfethhiegdhiecstt fg0io0oadyp.einrgFceoesrnttitohonfetrphtueerpodofisetethsooffsththhoeersafhiooloredtdtcashialhenedwmso(hd7re.e9lw5nwdaiasysc)ormitpsokryiaisseseleddsasomfseeonalti.ihnwgeowsratmissona.sastuemeofd0t.h7a4t 2810 Meadow Vole (Microspennsyvanicus) as Representative of Herbivorous Mammals Lusifiaion Tdhiearmyecaodmopowsivtoiloen,wassunsdealenccteediansNorreptrheAsemnetraitciav,e porfehfeerrebnicveofroousmomiastmamraealss, abnecdaluiskeeloifhoiotds of occurence atthe Dry Run Creek ste Bea 000051 USFW 0627 " "BmToihimesmeteymae1da9od8wo8;wsvMo,elberogrssio,n1se9w8oa7f)m.tphseA,lksairegoeaustgmhabntadhnkmesoy,sataraenbdmuonlardkeaenschtoavrmoemlse,osnthlineyyNhfoaorvutnehdAalmisneorhaibbecieatnaJtkosnnsoeuswcnhsnatdso aaipnnhpdaebaBiritsmcoeulyibve1a9to8en8de;ofMfeeitdrhsre,irmoa1aj9do8sr7i;dperSedcrihetwqcuahierssti,ztaeasnndfdofSehcnachbewirauortwtiszo(n1B9(a8Hr1ob)fo.fumreDiaesnntdseerDav1ve9ig8se9t;a1t9Ji7ov4ne;eJcsooanvneedsr Bimey 1988). ``(wTJihotenhehpsoeamankedprBoapinurgleeaoytfiot1n9h8ed8e)mn.esiaPtdoypoluwelvaevtlosiloenxvscaertieeendsdinitgos1fi0zl0euwcviaottlhessdepraeasrsotanic,craehlal(ybBiaertvb,eorauynrtdawnpood1pDpualfvaitiviseoyn1e9as7ri4sz;,e raJulotnnhewosauaygnhsdtuBnsidregerreyavte1eg9se8tt8aa)tt.idAvceatiwcvoivatenyrdocadrcueusrkdsi(sdBiuarnricbnoiguvreboaotnfhddmDaeayavadinsodw1n9iv7go4hl)te., aiWnnedhlatlbh-trwaotouirgonhnonu(etJrohnseeessyeuaannrdg, Bsiomceyko1f988g)r.assE,laalbtohroautgehspuhnedreircgalronuesntdsnaersetscaormmaolnsolybbuiulit lin adbrioevreagrreoausn(dBainsbtohuercaenndteDraovif2s 1974; Jones and Bimey 1988). "riTonhodetisvmie(dMuaeadrlrosiwt(tBvao1rl9be8o7iu)r;heahrnobdwiveDovarevoriu,ss,i1nf9se7ee4cd;tiinHvgoofrpfyrimmaeanirsditlecyraonn1n9ig8br9aa)ls.issemBs,lhuseaegvdregaesbsseel(nePgoruaempesospr,i.ebdiesriansm,saoajmnoedr. scpoemcpioesnehnotaordfstfheooddifeotritnhseowmientreergiinonasbo(vJeo-neasnadndbeBliowm-egyro1u9n8d8;caHcohfefsme(iMsetrerrit191899)8.7)This `syTeuhacescem(sJesoaindoensowa(nBvdaorlBbeioimusreayanne1od98fD8t)a.hviesTmho1e9s7gt4e)p.sroaltBiorfinecepdmeiarnimgomdaoiclcsau,rbspordouud2rt1uincaginytgshelwiwivaetrrhmaiefeerrrmlsoiintzteehrssrionanfrgaiptnhiged. fD19ar8vo8im)s.111T90h74e1)1heylopulnesgs(yaovuernaggminagtufroeurratpoisdelvyeann)d(mBaaryboburreaendbdDya2v5isda1y9so74f; gJoene(sBaanrdboBuirrannedy f(MoBexaearsbd,oouwwreaavsnoedlleD,savmaiirsnek1p,9r7ce4ay)t.es,d Truahpceocsoneonpbsry,edsnaektauornrlksysi,anlocllpusodpseescuoimweslss,,osfhharpwerkwessd,a,tnsohrdryksebnisar,kdsebsuac(nsBdaayrmsb,aomrumorawalsns,d pDoapvuilsati1o9n74e;xcMeeerdrsitstit1y98d7a)y.soDfuageto(ShcehawvayrtzpraendadtiSocnh,woanrlzy 1a98s1m)a.ll proponion of the `Exposure Profle riAat ndwguaesomfeatahsidssousmwpeeadclieetshsavtwaeraiigemsheffarrodommowl2e0s1vso0tlh6ea5ncgoorunalemdascor(beMuea1i0rni3t.1210a90c8r7pe;esrU(c.eMSn.etrEioPtfA1i19s98973)d),i,etTThfheieroemhfoor(mehe,e cloocnattaimoinnsawtaesd aaprpearo(xairmeaateulsye 2f0toacreosf 1), since the area comprising the on-site sampling 0iAn0uf.no2io1tdsoigfn/ggedsBatWyi,iondtarhayteeihrsiargnhegepisontrgtrefedrpoofrmotre0td.h3if0so1os0dpe0ic.ni3ge5essgt(/iUgo.nSB.WraiEtdePaoyAf,01a.9n39d35).g/mgeTBaonWeixwdparateeysrsaintndhgeetsshteieovwnaalrtuaeetrse . a 000052 USFW 0628 EiI ngerstteoifo0.no21g/gnBWowie3red0mgualylyesdkbymtheslopwes:oreporotetdbo4dy3weight o(0f230 mle) phAeesrcomenatinwdgaesostmiolvnoirpr.tleieo1fd20.bc4yxptpehrsecsfeonhotdiofitncgheoesttniooe8ln tidsessoofno7af.p0egnigpdhtenvsoiiel(lBiEnYoiEieoTfSnle.as1eo99on4f)2Ffi4oer of0.17 gay. pFeosrcetnhteopfutrhpeosdeiseotfwathse cfoomopdricshaeidnofmopldaenltsi.n this risk assessmen, twas assumed that 100 50 ASSUMPTIONS ""TThhiesfroislkloawsisnegsscmoennsterevvaaltuiavteesasesuxmpptieonos wceornteammiandaenttsotcroonudugchtftohoisd iasnkd ainscsiedsesnmtaelntseidnitmheentasbosielnciengoefsiioenspecific daa uTsheedmiankriismkucmaolcfultahteiocnosntaminant levels measured in sedimen, sil, or water colected on ste was bTeheprmeasesnitmsuimte-cwoindceentrations ofCOCs reported in sediment, sol water, and bia were assumed to Ansrea use factor (AUF) of 1 was assumedfo all specs usin the siefo feeding. Comsminants were assumedto be 100 percent bioavailable. sDiimeptlairfyiccaotmipoonssoifiocnoimnpfolremadtiieons wwarseobpseirnfoerdmfedomfotrthheItreercaeuptroerfso.rthe recepor species. However, `Awlhieenriannguesetesdeabrychthwaisndciocnatdourcstpeedctso.deItfenromionxeithieycvharlouneiscctooxlidcitbyeolfotshaetedcofntaohmeinraenctespotofrcsopneccieersn, dVeatleuremsienpeowrhieetdherfosrtuadcydleossilgyn raenldatmedetshpoedcsiewserweeraepprusoerdi.steA,llWhsnednievsalwueesrfeorcerhiieoalnliytroexivciietwyewder1e6 nfoatctaovraoiflab1e0,0 LvDa,s, u(smeeddi10acloentvhealrtdotshee)rveapluoersedweLreD,usetdo. aFNoor pOubrspeorsevsedofAtphpsarreinsktaEsfsfeesctsmLeenv,el ((NLOOAAEELL)).to ANOfAacEtLo ,ofa1n0dawafscutseoodrf to10cwonavsersteadtroecpoonnveedrtLoawreespotrOtebdseLrDv,ed10A8dvLeOrAsEeLE.ffIcftseLveevreall c{aolcxuilcativoanlsureesgwardelesrseopofrtoexdicfomerchreacneipstmo.r spTeocsiiesc,kyhevamluoesstacboansienrdvafirvoemlvoanlu.etweams ufseeeddiinngtshuedriiessk IWnecroerpuosreadteindpirneofehresncreitsok haossseessombueanitned from sindogs loreal suis. No oer safety factors were Insome cases, contaminant doses wer reporatspeardtpermilion contaminant in dit. These were fcoornmvaelsn:ed to daily intake (in milligrams per kilogram body weight per day; mg'kg-day) by using the take (me'ke/day)=Contaminan: Dose (mee diex) Ingestion Race (ke/dayx) VBodyweight (ke) fant dai 000053 . USFW 0629 mime SE oven lowsdcngiy ify lvls ied roesee.s tobe cmd1032 lydiy ddoese for salinentth mgestionasiheEi L ia he tvoalnudehemro iek 0htehorslpedcilesak0espoercific on + Si omecoamnmemiinnmgnenosfceenpr(csg. heuvmsm.)se not odcha cums,bt nsd re ek 40 Eao FnFyECcTSoPmROmFk aILsEdecd iaenDerryskR,wnbcuCstardmkennsooiethedexofcsolluldoehwaihvngersbcepnocehmmnarakpslw.orTcehouinscaonemnxsicindldauedtrseseddoCefcOomCnscfernno,dm BeadCo onoe ep o mreelihRovhadin,nawd,cinedho2ln moDoidreesd.ooCoeunmtaciomhiunera,mnatiossneenxmTcc,esbeede,iynhlgiuhsmaei,ccnorhmerspeopoemucint,uidmvse, be oe squat aneeirnseeccoosnystsepmescishaendDnreygaRtinvelCyreiemkpsaecig species, populions, nd 4 Furie MDoourD n 1 (1o 590) dateifbiowemedehkhse.eLOTahAeEnLLdOwAdeEnLiianlKsesnbknnctpogiraemdlinceoisnsvienrdsriytonhfwtcarsw&eormfeg1e0Fx.UpokBsgeesBdeW0dodsnaoyhd.ieusAme = NE he vik poosfemd bgy ariBdWedemyaamnmadalsnncriemsearNOAEL o0f 41 BWiday will be used to . Fein3,(1t9a87)efvonifdnsui.genifNirocalc:sgcrsiowkwheirine gcreLeOeAddEoLion1cE0fuimr1o3epomFeanikngssBlBWiWinidgdayaed aAansddisseuNcchOoAtnhaEisiLiinsogkf omens Bday. 42 Orpofiorides NSoorsienpersinoiunngd mtheediraaryrxeii ofihlroloromethnorayother forint organic 45 Amini DDisOoneOal.Be(s 19a79) mcwontTdossotdsfeyodrwo5e0nsidattuuyhdcsyeptdprhit1Gr0ev-ytdao(ablmyriekdGdisinngtBk.hYienWTegdhpeweryao)itcgesuhncsdtsvtyieddsoiunsnecwtehsisrcesdhsuolmft irinaiwsreesxrpwprraooessdxeupe7codd1is.ve0ed iloonnbinoafspheaommsainnceomBy.asseoAdctoomhnaisttohdrossa,rvebiseishsa,vaianodrLaslOigAenfEiffeLicactasfntw5ed5reemfoybisseirnvBesWdc,iudiissnciyliuondnidnngad2n imiEneLsaf (T5ameai1)s BWiday will ews 1 vant he risk posed by aluminum 0 Sa " 000054 USFW 0630 N'BoWiedfafeyc)tsalwuemrienoubmseorrvfeodurwwheeenksJa(pHaunsesseeinqueatiall.we1r98e8)f.edWadhieentcqounaitlaiwneirneg e0d.0a5 dpeirtcecnotnt(a8i4nimngg/0k.1g pFienraclelnyt, w(h1e65nqmugai/lkgweBWrifdeadya)diaeltucmonitnauimn,inag d0.e1c5rpeearsceeinnte(g2g57smhegl/lkbgreBaWkiicnagys)tarleungmtihnwuams, aobdseecrrveaesde.: iunsibnogdcyhwiecikgehnts,ceogngclsuhdeeldtehnagtidnia,rayndleevgelgsoshfe2l8p4romdgu/cktigoBnWwiadsaoybsaelruvemdi.nuAm r4e5s-udlaicydfiendaidnegcsrteuadsye (inHuwsesiegihnt g19a9i0n),.feHdoiwnetvaeker,,aonndyptlhaesamlaiienroerdmgaentiacboplhiossmpohforcsa,lcaisuwmealnldspahonsipnhcorreausse ciouplldbasemaarciabluctieudm 1B6ectahuesdeiraecrtaenfgfeeoctfscoofncaelnutmriantuimo.ns wTehreeasussoecdiaatnedd tNhOe AenEdLpoifnotrstwiesreeffeeccotloigsi2c2a.l8lymgsi/gkngifiBcWaintdaayn.d rLeOlaAtEedLovaltuhees.doAse,NtOhAEsLtuodfy8b4ymHgu/sksgeiBnWeitdaal.y(a1n98da8)LwOaAsEuLseodf t1o65thmegd/ekvgelBoWpitdhaeyNwOilAlEbeLuasnedd 1 evaluate he risk posed by aluminum to avian receptors (Table 1). 4a Americ Saetvserianlisctauedidestwehraechalroocnatitecdorwahlictohxidceittyerdmoisneedwtahse e1.5fmfecktssof ABsWitodmaaymm(Paelrss.hagAenstaunddy Vcaobnideurct1e9d79o)n. ILnDad,ditthiaotn,raNnagteiornaolmRe1s0o1u0r5c0esmCgokungcoifl lofaCdanarasdenaat(e1.9A78)stsuadytscotnhdatucmtaemdmoanlmsiicnegnedneircaalehdaavne oorraall d1o9s7e7)LDF,oorfth3e9.p4urmpgolskegsoBfWithdiasyisankdaaseosrsamledno,sethLeDc,horfon1i0c.4vamlgu/ekfsorBtWh/edcaaywaafsterus9e6dhooucraslc(uNlaAtSe HfaQcsorfoorfm10a.mmals (1.5 mes BWiday). This value was converted to 8 NOAEL:by dividing by a . EIinsolregran(i1c98A8s4)isrmeovrieewmeodbsielveertahlanstourdgiaensiicnAwshaincdhmtaheytpooxsiceigtryoeafteirnorrisgkanbiyc laerascheinnaglisntwoesruerfmaecaesuwraetde.r Sthtautdiseesnwseiriveealsspoecdieesscriinbceldudien wthheicCahliofrogrannioaarqsueaniilc(aslicngolmepooruanlddsosweerLeDmyesosfur4e7d..6 mSetu'dkieesBiWnIddicaayt)e (puHrupdossoensoefalh.is19i8s4k)aasndscehsicskemnaevsnailntuge,leorfa 3.d3 mogs/kLgDB,Woifd3a3ymwaarskueseBdWitodadye)te(rNmASitnh1e977H)Q. tFoobridtsh,e "This value was converted 0 3 NOAEL by dividing by factor of 10 45 Benim T`wGouasexparals.t(e1c9h3r3o)nifceddliaertgaeryameoxupnostusroefbsetrudyileisusmincgarabtosmarteptoortreadtsaimicloanrcemnuwscautlioosnkseoleft1a0l,e2f0f,ect4s0., 8o0f,t1h6e0,bo3nneds2v4a0rymign'gkgdiBreWcItdlayyw.itRhattsheferxopmoaslulreexpcoosnucernetrlaetvieolns.devSeilmoiplaerd rreicskueltss,wweirteh trheepofrrtaedgiblye Jleavceolbssoofn1(21193a3n)dw2h42o mregp/okrgteBdWsiedvaeyr.ely weakened bones in rats fed beryllium catbonate at dietary Fboerrytlhiisurmisoktahsessshmoerr-sa,laddsiheraerwy. eAxpNosOuAreELlevoefl 0o.f1010mgm/gk/gkgBWBiWdiadyaywawsadseurisveeddtfo oesmtihmiasteLOriAskEoLf using an accepted conversion actor of 10. Nlioerasttuurdeies pertaining to the dietary toxiciy of beryllium to avian receptors were found in the 46 Chromium wt " 000055 USFW 0631 ingand Haseine (1981) expose 2 to 3-year od reding pairsofblack ducks (rs rubripes) etfe o a dmoieeto ecosmnntasyiinsniingnggv0yh,rlh2fse0e,ipmtoarl1ur12e.sK0s.0.wNmSeogHr/nOekeeogeN,dfd.wDtehSute]cweCleriivogncrhgoatpsc,ee(wro0nl.eizdoe2acd.ihho7oi7fc,nnkasosperrrwde2ors7suae.il7mmte7eaadtimheigdl/iyhkftgoverecBraWooiminndadnariayosnf)nog,vfobhuedeCnhraaisnvmihcoaeeesr. behavir H5o0wmeveverk,iaoHfamgsealontsiufnnnesfpeeeotcfdailt.frhie(ee1dd9ua8cC5er)dr,esicrnvogaimnrvpaeuolnuwpnnuddpbleiisnshnheterhsdeediswtgdeurideroytsw.rnsoekTppahoaverratipebaeenybrdlcweeEhniitsenlnretreeid(xsu1pc9pot8uis6oeb3ndl)iitnnososh1tuee0rsdvmitvsh/aatlysba.lnaadncdka Forth pooTvsSeeVsOsoRaEmfLeisfsorriyhkenasaseivsacmehsnptech,ieeds.eLaOHrAowEeeLvveewrsa,sofus1ee0le1cmtendetkoc(mo1napfnlkaign3BedsWeseA,s)oofNfcOrnAsiEsntLepwnracysy . iVingeconvoeerCssiosnpefaccstoervolfun10e.d. ANOAELof01 mys Bday was derived fom the LOAEL . 0mA2est5eudnwyeGcroernavduec1dtoef7odet.whiteFhordeotdghsefopixn,udrripcaoatseced tcfhaaohtnid2os.5minimkn,gk/aksgs/sdsaymeonf,Cr4iLnOgAesEtLedof0in.t2h5e 1didet acaNusOedA.EdLeatohf 47 Copper : OCneNsEEu5Ld0woamfs10loigcategdew0ho:iyncohwgdsectaevrsimeeiddne3ddneadtthNhe (eOffOAecHEtsMLofio1n9fg8e7|s)m.tFigooknropfdheeCyupuwtroaptmoesaeusmsomfdafliosrshipeseckiexes.psAonesor,oalf ; mammals o Seve suo dies weecleoecadted3wShiigcnihfidcaenttdeecrresmtsheiefinneegirdoowCfandonfocohdicckeonnss.umAptidoosne(omfi3t5h0 m19a6k9e) . NAonOoetEheLrss7t0umd.y2nf3o5unrmdtkthraetsapaidyroastweooreyfep3rs2oe5bdlmegtmo/skegare(m2a3i.n5nsemtg/ieksgkf/oidacys,)vic3aanLussOepAdeErcLe.spoifr2at.o3r3ympgro/bldeamsy(Haantdcsh a hen NToiseurcises persiin 0 the diary xiofirn to mammal or avian repr wee ound in he a Les hEe giasewiceremakotstdfolieoowfwiaisnlvtiemsldoeesd,antNhfreoeiumegahrltcheeosdnecodfesnuatrwehklay6a4riym0p.c8l2aenatneddonr1.aa6ss4dimucgcePcsoknftgoacrB8iWopenIrssiooydr eTPAgeessi trdioncoeofnduunsdc(fitohgeeidseiotrendsarmeenactaeeTrleieacmdlpohpeealnl1ven9ts8f)(us.LnnaddwAalaehsrteimaeit3dallma.ereshr19et9o/1y)d.dyfiooufnnPdcoitchvaai3styed(mOgtshhbegocr/lnareycealfle.dsyt1mo9p8l3t)io.mnsFgoosxf o 000056 USFW 0632 sthpeecpiuerspaonsdesaoNftOhiAsErLioskfa0s.s3eswsamsenuts,eda.LOAEL of3 mg/kg/day was used to determine risk to avian (cSCeolvnaedrrukaclt1es9dt7u9od)ni.emsicAweneoritenhdeliocrcaatstetdeuddthywahtfio1cu.h5ndmd/etktheaytr/m2dia2nyeodmfgt/Phkebge/cfdafaeucystescdoaafuPsreebdducaitnigroeensdtuiicnotnuiocfneoemisnsatmohfmieamfplrlseaqnuAteendcsytouvdoyaf uppusrreepdgontsaoensdoceyftetwrhimesinnreitsrhkieasskdsotesosesmmawemantms,aaaldsmNiOniAsEteLroefd 03.1to5 5mgd/akygs/dfaoyllaonwdinagLmOaAtiEnLg (oCfl1a.r5km1g97/%)d. ayForwetree 410 Manganese amTayhnesgaeexnfhfeiesbcetistteedlsetrevdee.ldsuRcfaeoidrstemesxatpnoogsstaeendreotsnoee1lte3ovxemilgcs/i(tkLygavsBakWre/yydewatiaydloe.fl1ym9,a8n2m)go.astnInelsmieikcealesy, Maarndw3ei0cbur4tyailbneltvheetlioorftdhi1ee4t0ffomorrmi23go4f - dhBioWgpihademariyen,xepaollsseouvreolefsc(oMGnnicae3nnOturt4astofiosornao9n0fddaM2yu,3rs0rr0aeysmugl1/t9ek8dg2i)Bn Wde/cdraeayosefdmacainvgiayne(sGeraays aMnndCLIa2skreesyul1t9e8d0). reAdruoecckd. `oIdnnerctmaholen, rsaestnpdilroeavcteuollrsay,rascshayirsdgtiheoamvssao9sfc3um0liamrcg,e/gk(agsHBweWoiijmdmeasayionnfelcm,tiaahlnk.egmaa1nt9eo87ls)oe.giascaMln, SmuOs4cufloorsk1e0l5ewtaele,kshehpaatdicn,o reefnfaelc,t . dFseoirrmiavheitdsefiisrsokmaostfshimesassnLmgOeanAnteE,sLaediu(0esittnahgersyealneexcaptcoecsdeupmrteaemdlmecvaoelnlvioeafr1ns3iroecnmegpf/taockrtg.oroBAWfNiO1d0,aAyEwLilolfbeu1.3smeed'aksg B8WL/OdAaEyLwitso lNioersatruurdeies pertaining to the dietary toxicity of manganese 0 an avian receptor were found in the 411 Nickel - lSfeeevdveeNlriaolsfsNunifususlifnwadetiercectaeauvdasaieldNabOalAe27EwhL0icoh2f9d1e8p7te.er5cmeimnnatledkdegtc/hrdeeaaeysffteeodcmtbsoosodtyfNsiywseitineggmhestste(ixoAncmetbporomfsaormembeaotldsay1.we1i9Wg3i6hs)t.a.rTIronats3s * Tsphuiirmspiolvseaelssuouefdwshaisistcihosnakvbearstseeedss1am0ae3nNgtLOaOANlAEEOLLAeoEoffL6,2o5f.626.502m.mg5e/mkkgeg/g/k/dgda/aydyawbyayswmanusolttueidpsl(eyAtidonmgbdrethtoeesrNemOi1naAe.EiLk19b7ty6o)am.afamFcmotroarlhosef 10. sNpoecsiteusdifersowmeriengaevsatieldaNbie wtihlalt dneottebremidneetdertmhiendeod,seofNi to avian species. Therefore, the isk to avian 412 Vanadium cd`ooGnsavevearwgsaeissornc.doinevTsehriitnsemdfio0coed8hdLaovOseeAfEwoaLusnodcf3ao.nn1vLeCrmtSeOydotf3an1ddmaaglNyVOdioAvsEeKLbdoyieftmu0(lS3tc1ihprulosyeiidnneggraatnnhedaLcBcOaeApltEseaLd fo1a9fc67tN)oO.rAoETfhLi1.6s icnovnecresenorfaihoen bbyoday wnegiegshito(n0.a02e5 cKoEmNmRoTnElyCoSbs1e9r85v)e.dTihnimsiccaelc(u0l.a0t0i3onkseosfulfioedodinday)LOaAndELtheonfb0.t375. 3 - ro 000057 USFW 0633 1 VicmBatyinacnaNpOAsEnLi0s.0i3k72semsgsmVeingtBy. Ths ss ill be wed sic RBeesomes 1960) xepdshoimvkiienstgsvcanyoonfegr0cd0retmoeoals,fnevimionrsosaoamiflniuoveyaknfwaeoadrrdisunmdp.oerpcrTodehdsensis(lo2nd1ctvdwyokEsl.iveehsTdof,feanSTg2yhde o subors epored av t 5nestvoc1rlcioiomyi2o00n1ome4s0lyskdovfli)edLOnbbyeAdEtmhLlunfrtemirwneiVhgvisgeoedrseeGsnolfycanontbndnocseyNeetOfnAechEbsLy e OE she value ile ed o etme sk 03h re5epr an zeSmvneteese wre lschdweahsircsersceomniernnordawhieonnfdocmf36io1fnmnygkcsyhidcky2encsobi(aSahasreAeadl.cund1cc9e8e9in)n,nbiIoonyn8 aenineu,ntsyALcOao0AdEnrLedd3NouOcenA9dEfLpmoodfan1a3g.k9gesmlgwH,iikscgwaoniydnecCbdyraidsimeivianmdisingn11h5e8h56eLn)OsAgFEorL)1b0y BTieaaorot mio ar study conducted CA I oi en doegs,npmianedrioceafstodexdfn heasth1e,kmd 0o0au0wsmmeeE.keLgsoInnf.a(23,s75umDvdseakLcoOyinAadddEeybuLt)eocoiceeaer2oue5dssnm0edfsi1ne2no4eie\stfNfk,erOctd1AsoEsatefLetoemfr1io27nkie50. awed and ANOR So RnIeSfKoCllHoAwiRnAgCmTetEhRoIdZsAdTeIoOdN rcooliyfccpoimkp.oarTseos sxctpnioemnseocnosnocendiwotobineisoeehlmeoigmnoiedn.enyTepsHnQwhciohndg2 D E tatEa eC s elnos wn. Toe conprions e eprsd win of pcm vss 0 `Hazard Quotient (HQ) = Te GMoemaneEsxpAovsuerecCEonfceenteravteilon(--VOAEL) HA Q peeronds. Tofosscoposromofateoeekacloacnhafmisin.a brTsh heHrQpesirhaoeulldsbeeccurrseaddibeasfedionc0o 51 BmeenibcevcenitnrvicerCtomcomemumuanniSetycfn rDcroyamRndamnuFnsnpceiwaoornrsaomvbiicaldteeiiskBtyfoirstdvisheuohnendsaa.ncsTnheenDbgyeSRnouehn ens sve. Ses a 2 Te - 000058 USFW 0634 52 53 54 55 56 [CTS sptrreesaemnst,itnhseeddeicmreenatsseiinnDdriyveRrusni.y aInndaadbudndaitnhcteeaiimnpoDhrinypoR,duntomxaicyiybteesatncrlieabrultyeddteomcoonnstiraamtiensattihoant acocnudtietieoxnpsospurreesesnutb-ilnetThrailbuetfafercytsAcaanndbeinpArordeuaceILd. inThteheobbesnetrhviecdcnoemgmautniivetyg,reoswptehcieaflfleyctunwdaesr saingdnifsiocdainutml.y negFautritvheelry,cotrherreelaweedrweitsthroflnugorniedgea,tailvuemaisnsuomc,iactailocnsiubme,tmwaegneetshieumg,ronwitckhele,ndppoouinstsiaund,. cthhero0m.i1u0ml,evceol.ppeSri,ncleeatdh,easneddizmiencntcsonccleonsterratthieonasn,daflitlboaulgohngthtehreewlhatoiloensDhripys RwuenrerenaocthSaigpnpiefaircaont baet. enriched with metals, the observed toxicity may represent significant threat. Soil Invertebrate Community Structure and Function `RTuhne.soTiheinveearrttebhrwaotremcotomxmiucintiyttyedsoteisdennotitfiaepdnpoepartroobbleeatmsriswkitbhasseduorn cvourirrgevnrtoaswotlihl conditions at Dry Fish Communities "tThhaet wfiasthecrocmomnduintiitoynsatinDUrpypReurnTmraiybubtearytiAskin.duRceesmuolrtaolfitthyetfoahlaeravdalmfiisah.noTwhitosximcoirttyalbiitoyascsoauylsdhnoowt dciorrercetllaytebdewaistshocpiaotteadsswiiutmh acosnuciteentorfactoinotnas,miBnoanwtesvearstihnitshecoarmrpehlaitpioodn tweats, bpuottssutravtiisvtailcawlalyssnieggnaitfiivcealnyt catontcheeni0r.a1i0ionlesveiln.theThietreerewdaswaatesrigsnaimfpilceasn.t pLosoiwivsepeccoirerseldaitvieorsnibtyetawnedeanbfuantdhaenacdesuorbvsievravledandduriirnogn the elecroshocking effort maybereflected by the resulsofthe toxicity test. Womeeating Birds ARucnonCsreerevkatsiivteerhiasskdaestseersmsimneendttmhoadtewlorbma-seadtoinngwebti-rwdseimgahyt cboenactenitsrkadtuioens1o0fincgoensttaimoinonafnctosnftoatmhineaDtreyd faonrdagfel,uosroiild.eaanrd wraitsekr.facTthoresmboadseeld pornedciocntssetrhvaattailveumiinpnuutms,. cBhyrodmeifuauml,t,cobpepreyrl,liluema,d,irvoann,amdainugma,nzcisnee,, nciocmkpeol,unadnsd.wiFcoholdorcohfalinuoirsokmceatlhcaurlneaetiroinsskfaanctdorressudluteanttohlaazcakrodftqouxoiticeonltosgiacraelpbreesnecnhtmeadriknsTfaboleth4e2s.e Camivorous Birds ARucnonCsreerevkatsiivtee rhiasskdaestseersmsimneendtmthoadteclambiasveodroounswebitr-dwsemiaghytbceonactenitsrkatdiuoentsooifncgoensttiaomninoafnctosnftoarmtihenaDtreyd. faorreagrei,ksofia,ctaonrds wbaatesre.dTohnecmoondseelrvparteidviecsintphuatts.aluBmyinduemf,auclhtr,ombeiruyml,licuomp,peirr,onl,eamd,anignacn,easned,fnliucokreild,e vthaensaedcioummp.ouannddst.ricFholoodrocfhlauionroimsektchaalnceulaarteioinsskafnadctroerssuldtuanethazlaacrkd oqfuottoixeinctosloagriecparlebseenntcehdmainrkTsabfloer a Camivorous Mammals (Terestrialy feeding) ARucnonCsreeerkvastitrieivsheaasssdeestsemremnitnemdodtehlatbacsaemdiovnorwoeuts-wmeiagmhmtaclonscemntaryatiboensaotfrcisokntdaumeintaonsinfgoestthieonDroyf contaminsted forage, oil, and water. The model predicts tha aluminum, chromium, copper, lead, FE 000059 USFW 0635 TmFeaonoogdarncoehfasieun,ovrriasonkamcdeailtucmhu,laaaantrniedonfislsaoknrfdiarcdetsoaurrlsetdrauinsekthftoaaczltaaocrrkdsobqfuatosotexidieocnotnlaocgroiencspaerlrevbsaeetnnitcvehedmiianrnpuktTssf.aobrlBteyh4ed2s.ee fcoampurooulnnadtns,.d 57 Piscivorous Mammals ARsoicnonnsCaerrteveaektdivsetfeoirsahkgaeas,ssdsoieeltsemarenmnditwnemadotdete.hlabtTahpsesemcdoidovneolrwoeput-srwemiaegmhtmtdhaacltoinscchecmrnatormytaitubismoe,nsoamfracisoknntdagumeinaaa1n0nntdsfiflneougreossrttihideeoeDnar,royef oDektaiTsoeto1rswbaassemdotondetceocntseedrviantisvieteisnpeudtism.entTsr.ichFlooordofclhuaoirnomreitshkacnaelcisulnaottiocnosnsaindderreedsulatrainstkhfaazcatrodr quotients sr presentedin Table 42. 58 Omnivorous Mammals EARocauomnnisCemrraevteakteidvsieftoerriashgkaesa,ssdseeostlsemrnemdnitnwemadtoedrte.hlatTbhaosemenmdiovodnoerwloeuptrs-ewdmeiicatgmshmttahcalotnsacesmnetnariyact,bicoehnsraotofmcrioiusnmkt,admcuioepnpatenort,sifmnogaernstgthaienoenDsreoy,f momaemi,dearaneidssfklufoarcitdoer abreericskiaftawcutaosrsnsobetadseetdeocntecdoinsnesrvtatsievdeimiennptust.. FToroidchclhoarionfilsukorcoamlecutlhaatnieonis annotd fesultant hazard quotarieperensetntsed in Table 42. 59 insectivorous Mammals nRemncaomnCsiernreaveatkteidsvietferoirhsakagsea,sdsseeotsiels,rmmeainnntdemdwoadttehealrt.biaTnshseeedctominovdwoerelotu-pswrmeeadgimhctmtsacotlhnsactenmatlaruaytmiibonenusmaot,frccihosnrktoadmmuiieunmat,notcsionfpgpoeestrth,ieolnDearodyf, meoamhnpigooaunrenosdfeso,.rvoamFneoatoddhiaucnmheaaiannrdeifscikovnocrsaiilddeceuraleardtirroiinssskk faaacnctdtoorrrsessbudalusteaendotanhlacazocaknorsdfertqvouaxotitciieovnletoisgnipacueatsl.pbreeBsnyecnfhtmaeaudrliktsTrfboore,thne4s2de.: 510 Herbivorous Mammals ARFcouommnasmCerirevmeaskteidvsieftoerriashgkaeas,sssodieels,tseammenmnditnwemtdoedrte.hlaTtbhheemrabooidnveoswlreopture-sewdeimciadtgsmhtmthacalonsaclemuntmariyantuibmoe,nasochfrrocimsokinutdmau,mcilnefaaodn,timnfogaensgttahineoenDsreoy.f oeCboalmoporuuoonfrdli.udoerFoaomroeedtrhciahsnkaenfaaircsetkocrocsanlsbciaudsleeardteidoonrnsisacknofndascreterosvruaslttdiavuntee htiaonzplauatrcsd.k qouftoBotxyiiencdtoeslfoaarguilclparliersboeenn,ntcevhdamnianardTkiasubmlf,eor4at2h.nids 60 UNCERTAINTY ANALYSIS Thee Ee eavreedfawchteorns iimnehreprrenettiinng trheesulrtiss.k aMsasjeosrsmseonutrcpersocoefssunwcheircahinctoyntirnicbluutdee tnoaurnucraervianrifaybilaintdy,neererdor,toanbed insufficient knowledge. ErPrarocoerscianinlbiogehiftnoocfodnhuceuclneucddeirbntygautishnaettyonfoaisnrsvioasclkiiaditsaepdsrwesisuehnmtpwheihiroeinstnkhhseaescsaoenstcsemapecrnuttaapllrmoyocdeGesolse..s TCehoxniisssewrevagast.divoeenleiamsisnuammtpiitnoiinomnoisfzewfeitrlheee Poenies), Whenever posible, ris calclaions werebasedon conservative values. For example, NOAELS tora o 000060 USFW 0636 used to calculate HQs were the lowest values found inthe literature, regardless oftoxic mechanism. Animporant contributor o uncerainty i the incompleteness ofthe data or information upon which the risk `assessment is based. Riskcalculations ae based on maximum COC levelsinsediment, water, and oil samples. : iLdietnetriaftyursetuvdaileusesusfiongtchleotsoexliycirteyloatfedCsOpCesciewsetroemnaokteaviaislkabelsetifomataelslfroretcheptosreslpeecctieeds.recAepntoarsn.emSpptecwiaess rmeasdpeontdo : wdihfifcerhetnthleytooxiecxitpyosduatrae atroetroexpionrst;edr.espMoentsheosdotoloCgOicCaslpbryobthlemisndwiecarteorasspoecaipepsamreanytibnesedvifefrearlenotfftrhoemsusdpeiceisersofmo.r wfohuincdh NfoOrAsEomLesofwetrheeosbetlaeicnteedd.rUecnefpotrotrusn.ately, snudies which were more suiableforthis assessment were not AValliueersatuusreed stoeacraclhcuwlaatsecHoQndsucwteerdettohiedelnotwiefsytapvparloupersifaotuenNdOiAntEhLSliatenrdatLurOe.AEILnSmafonrythoifs rtihseksatsusdeisessmrenetv.iewTehde, - - `aapdpvreorpsreiaetfefeNcOtsAwEeLrSe foobrsesrovmeedraetcetphtoersl.oweIsnttehxespeoscuarsees,co2ncfeancttroartoiofn.10 wTahsisusmeaddteo ictoinmvpeorststihbeleLOtoAiEdLenttiofy 'NOAEL, which adds uncerainty to the NOAEL-based calculations. cDoosnetsamiinntaonxticsolboogdicyalwesitguhdtideasy.canAlble droespeosreredpoirnteudniass mogf/mkggicnodnieatmiwenraentckognvedirette,dotro iunniutnsitosf omfemgg tBhWiisdcaoyn.ver1sfiboond.y wOetihgehrtwsiswee,rethreepboordtesdwfeoirgthhttaenstdaninigmeasltsioinnaragtievefnorsttuhdey,sptehceiseesvarlepuoerstweedreiunsoetdhferorltmearaknianrge sources were used. Afnrootmhseirngsloeu-rscpeeocifeusn,csenrgalien-tcyonatriasmeisnfarnotmatbhoeruasteoorfytsotxuidciiest,y vParleudeiscrteipoonortfeedcionstyhsetieemraenfufreectwshfircohmaleabdoerraitvoerdy satduddie1s0 ithdeiffeifcfuletc.tsLoafbocroanttoraymisntaunditesstcraenssn.ot aNkOeAiEnLosacwceorunettgheneerfaflelcytssoefelencvtierdonfmreonmtasltufdaicetsorusswihnigchsimngalye ccoonnttaammiinnaanntts exposure scenarios. Species utilizing the Dry Run Creek site are exposed 10 variety of : f`oTrhewrielsdlivfeersyplecnilees.infIonrtmhaitsiroinskaavslseasbsimeinnt,thmeolsttorafttuhersreevgaalrduiensgwtehreeabtasseodf ionnciedsetnitmaaltesosilrseepdoirtmeedntfoinsgpeesctiieosn simitloathre indicator species dEextpeocstuedreincosnitceenmterdaitai.ondsaiwleyrfeoocadlciunlgaetsteidonfoarteeasc,hintcairdgeenttralecseopiltsoerdsipmeceinets ibnagseesdtioonn rlaetveesl,soafndcbonotdaymiwneaingthst. reported in the lteraure. i"Tshkiseevcaolluoagtiicoanliit siskcaosnscelsusdmeedntthwaaastc"opnotdeuncttiaeldewciotlhotghicailniesnkto"fexcisotmspilftethiengHaQbacsaellciunleatreisdkfarsosmestshmeenmta,xIinmtuhims acarlecaulcaotnicoennstrwaetrieonmaadnde tuhseinNgOLAOEALELeqtuoaxlisciotry ebexnccehemdasrkonse.. Within the calculation spreadsheets, atemate 70 CONCLUSIONS 7.1 Benthic Inveniebrate Community Structure and Function mDaatyabferaomsibgontihfitchaentbepnrtohbilcesmurinveDyraynRdutnh.e oNxuimceiryotuesssfiinsdikcilaltsehtihsttofrliucoarlildyeraenpodrmteetdailncDorntyaRmiunnatailsoon. "os 000061 USFW 0637 provide evidenceforpotential fects antebeni communis: 22 Soil Iavercbrae Community Scrand Fncion Th suae fmamenafgfoeuubnnatsiaootnfhsoeofDmtreyhaRfurnigvse(Cor.eer.ks.AmHocewreoivcmerm,osiabncied,oesehstonrhoopssehrceawo0,6bmecpa)trfSioisgoikndifucsinhcdaaeeinrnt Foi modeess,eaaptpearrsothct iosnmaaybnetbhiencaisee.d up n he earworm is. Based on ar ood 73 Fish Communities twas showrnehoonufgonhnetbhepreressesenhteeorfarbhersta haodmen iosnuntoeawsd tabs,iorWshl eyaeRye,nho.aTxthiiascvawlnadsiinsgGhwshseferarevrdeuss1cse1ppoblrstme0ed - Eovoeaefsprioero.ioofRofeepmorasmioihfmsaftoesdrboanes tihnhDbreinyltshRiacrnec(sosmbomaeunintmiphomriatayvnetdirrpeiccetcrleyaofaemesaev)iydeainlscsheo em otoauppter .vlIcnoandsduimieorms, huieghteovdelaoyf moextilcs were nedin he fish, which may 74 Wormesing Bis RBesseof hefvoedaclohlilfnlamuioddnse,ifnsdonradwnoowierobmrlnrianflsgueobr.iomseRtsehcpahonen,sohfeThAiissoirmicklewIasiiardsnseocdikiaiitlecdceswasoipahosuegtnnghaesslet eatogica ik to avian receptors. 75 ComivorousBids - RBessO fhoe foomodarcsh.ilnahnmmdoadwemclahnoolcraotmfsiwvero.armoReueisphoarnrt.dsofTshhciisshtfairsieailrsweadissdoceihatkielkdlswiantlshito chssegeecspotnoaecmnoilsnoaginictasl 2 76 `Camivorous Mammals. RBesuletas ofnoheaafmooidnicahkininduntetmossdoesmloetfoaareln,oreirnisdsmea,lalfdmiainhgmlomrcsaoamfeiuvlo.orroomRueestphmoarnaseo.lfhsTihtoisrcraicslakwsfihsthalesdroeecdiksfioelxd i gsc ecoogial oko mammalian repr. 77 Piscivorous Mammals RBae.esoTfeshoe foroosdntchiinndmaaswece.hlfooRroeuppaarrossmoeftchNaimsinea.rmivTmclahlwsasitsudkrceshaoKsitshsuesmoiisncskuwgisignehdseithcsedtseeaopcgtoienenalimsirciaksnkfso aman ecspiors. 75 Omaivorous Mammals te ot * 000062 USFW 0638 p- Riheanuehmsmooieafl,reodeTpdriinacnhea.fidnnmsodee.l orrRoeopronroitmoetfisaPnmsea.amTtmhailwsriscdtheaasishoseccahocsnswinpsib tce pone tss 79 nscivorous Mammals SCeo Reuros fion nfkhhdienutotrhtdeel oimsihalaitenmsnmrToiiunlScreo,,nrraannssdceocibveo osrreoss.sTp Pmamoealto. hmneu.cmhaTneeaaotisesmtlsroslsneseenwonsc 1Sl5skeio,rTatHhe ScthoorGledwr,rySeom0eeXopf.ersRenop0oiOsmloTfdsssihflnowmineieKnet4fa5 pmhtemrrrmTS - `mammalian receptors. 710. Hotbivoros Mammal SCoRooemnnseaoslmftiohnifeaksiseedinofholooedsm3heahia,nndomTirgouhrlpeco,fnaarcedhnheknetio:rnasr18o6dfrmmoaemmmlaailstnnsodesF.cdhTorhsop tpeinmsesnsdoow n vmole nice 8 oE ii Ri epoofhs rortis]hws eifeidrihvl asho e ndae esglr omperape 80 sary sileBDnvuleiciarnnmsctcrhecnips,sneatnddevhrsrolicsghsnaymdevsose,er5,lafyTacrrroimeeetspreerwmeeshorsmraaiesb5ioscrcs,aalSesn iloosngpoorhfentt tbsAecoh otnfhDoray pRabGerree cohrbos LeeEpoorr! . DTcnrieyideRulduonu0csCrcoevrehiekcs,hnfiddmrelmavnDdmlorsawyoy,gRbfuSemnuh.ceaTvnshi,,engnroedasvrperaseoeif ninrdbrtoTknahosrhssoeKcsTsummemeinenmeocoeyppnFoenooerp msmsenptsh obne meen97.4)61 CTToIennkdmsiaitsctsymwieGgnieeT.hnuimt aernoCcuioseoa mneprfohoeeui pbOne dNSosArwen ssecsmr.ahTts, bboyDudhyheRrbodoespnceeemcamoer roneae1 a 02%8 iynaDlrypRrasnnhieaensytospbeenstysso,rneeorfHhrohueroemeoenstoohssTeoespt Eraohn Sn . 000063 USFW 0639 LITERATURE CITED AJgeGnectyafcoersToIrmiecrmSruibosntaalnceInsc.snUdndDiesreaU.sSe.RDeegpiasme(AnTtSoDfR)H.eal1t9h90a.ndTaHxucmoalnogScearlviPcreosflCeofnogracAtluNmoi.nu2m0,5:9P3r-e0p6a0r6e.d Research Triangle Park, NC. ABgeCncypefeors TomxeicrmSiubosntaalnceInss.andUnDdiesresUe.S.ReDgeipasr(mAeTnStDRof).Hea1l9t9h0.anTdusHiucmoalonicSaelrvPircoefsilCefoonrtMaacngNaon.es2e0.5-9P3r-e0p6a0r5e.d Research Triangle Park, NC. gOSeeneenfcoesToIxmiecrSmuabosntaalncIensc.anUdnDdieseUaSse.ReDgeipstarrym(eAnTtSDoRf)H.ea1t9h91.andToHsucmoalnogScearlviPcresoiCeonftorracVtanNaod.is2m0.8-9P5r-e0p6a0r6e.d Research Triangle Park, NC. AOgEenncyefeor TomxeircmSoubnsatalncIens.anUdnDdieseUaSse. RDeepasrme(nAtTSoDfR)H.esl1h993a.ndTaHsuimoalnogSiearlviPcersofCloenftorracBtepNlol.iu2m0.5.9P5r-e0p6a0r6e.d Research Triangle Park, NC. AgeencmytforiTooxinc SsubsIntea.ncUensdenrdU.DSi.seDaespeaRrmeegnitsofH(eATaSlDtR)a.nd H19u9m6.anTSoexrivciocleosgiCcoanltParcotfNloe.o0r5-N9ic5k-e0l.606Pr.eRpeasreeadrbcyh - Triangle Park, NC. Adomgbsr.o"seJ,. FAoMo,dPSSci.. TLeacrhsnono,l.a1n3d18J1.-15B8o7r.zellca. 1976. "Long-term toxicological asseofsnisckemlineratnsatnd BarRbWo.aundrW.,H. Davis. 1973. MammofKaentlucksy. Lexington, KY: UniversityofKentucky Press. 322p. `BBaamthoeusne, LtWa,muG.fWo.EScuteor,lMo.RigBsakrieAlslcs,e1s.asmBleena.uPchaump,bRHlN.umGiabredcrn2er6a,7E9.t,LOiRniNdeLr-o,62R5n.1V.. OENneviilrlonnmdentAa.lE.SeRrovsiecne.s Division, Osk Ridge National Laboratory, Oak Ridge, TN. Beyer, WIN. EE. Conner, and S. Gerould, 1994. "Estimates of SoiIngestionby Wilde."J. Wildl Manage, 58(2)375-382. Bherpoaotkost,oxLi.city19b8y8.copp"eIrn.h"ibiPthi.onD. oDfisNseArDtPatHi-onc,yRtuotcgherrsomUneivcerrseidtuyc,tNaseewanBdrunasRewniucakt,iNo.nJof acute diethylnirosamine BYourlkl,J.NYA:nAdlfJ.reFdarAr.anKdn,oJprf.,1I9n7c7.. The Audubon Society Field Guide 10 North American Birds, Eastern Region. New BurtonP,. 1989. BirdsofProeftyhe World. New York, NY: W.H. Smith Publishers. Byerrum, RU. RE. Eckard,LL Hopkins, 1974. Vanadium. Washington, D.C. National Academyof Sciences RETR " 000064 USFW 0840 . CPahlsdieor,loWg.,A.2,4a4nRdEEO.11.-RBEra0u6n. 1983. "Seling of osmotic regulation in mammals and bis." American Journal of . Casranova, V., L. Macrophages and Bowman, and LR. Wright, Alveolar Type II Cells" J. 1984. Toxicol. "Tricity of Meallc Ions inthe Emviron. Health 13:345-856. Lung: Effcts on Alveolar SCelikT,ecDh,R J1r.331398753.41".Lead Concentrations:Basvs,Teresaial MammalsCollected near MorHighway." Erion. DCehainc,ksC.E,TaBsiMco.l,HaLregeisra,nd$P7S:,30H5a.r3g1i8s. 1991"Effectsof Zine Toxicity onThyroidFuncion ndHistologyin Broiler "DTeoeGUranf,iRMv. aoenfdMraD.sDss.aciRhuudtsie,yrs198P3r.essN.ewEnglandWildlfe: Habit,Naural History,andDivision, Arbherss, MA. ~ TDeMeayro, mAP.a,neMt.sCs.anTrdaAyqliuoartlaincdLKi.fWe. TCaRplCrC.rii1c98a2l.Re"vEifefewcstisonEfnCvopiperroonnmHeuCmnoantnrsao,lL,ab1o2r0s)t1r8y3:a2n5d5Farm Anil, DiExnvoinr,enmReLn.talRJH.eaSthherPnesr,speacntdivLePs.. 3Le0e-.53-169879. "Assessmentof Environmental Factors Affecting Male Fel" Edwards, CA. and LR. Lofy. 197. The BiologyofEarworm. John Wiley nd Sons, New York, NY. Evlch, PR. D.S. Dobkin, and D. Wheye. 1985. The BindersHandbook. Simonand Schuster, Fireside. New York, 785 w. SEeirsvei,cRe.Bi1o9l8o6g,icCahlrReopmoirtu,m$5H(a1z.a36r)d.s 6t0op.Fish, Wii, and Inveribrates: a Synoptic Review." US. Fish and Wilde SEeirlvei,ceRB.io1l9o8g8i,ca"lARrespeonritc8H5a(z1.a1r2d)s. to Fish, Wilde, and InvertebrateAs: Synoptic Review: US, Fish and Wilde EWiislldelri,feR.Bio1l9o88g5i.cal"LReepaodrtH.az$a5r(d1s.1o4)Fish, Willie, and Invertebrates: A Synoptic Review." UnitedSites Fish ond ImEveasn,,AP3.07a0n4d7W1G5.In:DSatile.ve1n9,74.1.0".T,heLJE.fDeacvtieofsS,oEdXi.uStmanClheyr,RoAma,otnAbtbhoetP,roMx,imIanlhabt,aL.leBsidoefrtuhpe, RaantdKJiFd.nJeayw.o"rsLkaib.. 1676. "Effects of Chromium nth Canadian Environment Nat. Res. Counc. Can, NRCC No. 15017. 165p. FCloenmcienng,iaWi.oJns,ainndJapC.Aa.neScsheulQeru.sl19"83E.nvIinrfolnumeenrctealofTtohseicMoeltohgoydanofdCFhlueomriidse.Ad7m(i1n0)i8s4i1t-i8o4n6.on Toxicity and Fluoride g FEluermoipnega,nSWt.rJi,nCgEs.ArGcrhu.eE,nv.CA. CoSncth.uleTro,xiaconld C1.64M).: B4u8n3c-k4.901987. "Effects of Oral Doses of Fluoride on Nesting : GMiaangnauntessoesGA,.dmainndisMaTi.ionM.u"aNye.sro1t9o8s2i.co"lAl3e7a5-t8o1nisn Brain Dopamine and GABAFollowing Inorganic or Organic Goldman, E.A. 1950. Raccoonsof North andMiddle America. Washingon, DC: US. Fish and Wild. Service, s 000065 ~ USFW 0641 `fects onAquatic Biot: 1994 Revision, ES/ER/TM-96/R1, Marin Marita Energy Sysims, Ic. - Suttie, J.W. 1977. "Effects of Fluoride on Livestock. * Jou ofr Occn upaa tionlal Medicine. 19(1):40-48. Tyson, EL. 1950. "Summer Food Haboifhse Raccoon in Southwest Washingion." J. Mammal, 3148-49. 0. EnevieronnmesntalanPdroStaenctdiuorndsA,geCncrye(USan.dESPaAn)d.ar1d9s81.DivAisnioenx,pWoassuhrieangridoni,skD.Ca.sseEsPmAe-n4t0o/r4-a8r5s0en0i5c. Office of - 5M.atEaovinrouamnednaStlanPdroatredcst,ioCn Agrencniyd(SUuSen.dEaPrsAd)s.D1i9v8i5s.onA, Wamshinwbgaitoenir,quDa.eCl.i nerite for arsenic. Office of Wes 0E s. Envm ironmentNaolrPmrotOercgtiaonnisAmgse.ncUyni(tUeSd.StEaPtAe)s.En1v9i8r5o.nmMeentthaoldPsrfootrecMteiaonsuArgienncgyt.heEAPcAu/eGOT0a/x4i-i85y0o1f3E.fteris 0 - + 0Wsas.hiEnngvtiorno,nmD.eCn.talEPPArYoSt4e0c/t1i-o3n9A/0g0e2n.cy (US. EPA). 1989 Risk Assessment Guidancefor Superfund. Volume | N L0i,e EFendveiroanlmReengtiaelrPoVsoeliuomneAg$7e.ncNoy.(U24S6.. EDPAe)c.e1m99b2e22rA.mbien Water QualityCrieifo th PrtecionofAquic E5.eEnvisoumenial PrnoteecctiioonnAgAgeennccyy(,USOf.fiEcPeAa)f.Re1s9e95a.rcWhislndidfDeeEvxeploospumreentF,ecWtaosrhsiHnagntodnb,oDo.kC.VEoPAlGOuOomRf.Ie3.1U8n7itse.d 1sS. Ee nviroe nmentadl ProtCecotitonaAmgennocywni(stUh.SF.reEsPhAw)a.te1r99I4m.erMiectbhaoidssoUrnitMeedasSutreisngEtnhveiTroxciscmiteynaanrdBeiocacocnumuAlgaetnicoyn : EPA/GIOR 94/024 UResg.ioEnnv1i]roBnYmAeGn.talTePcrhontieccatlioSnupApgoern:cSyec(tUiSon.. EPPhAil)a.de1l9p9h5i.a,RPeAvised Region il BTAG Benchmark Values US. EPA VaanE Zinderm en BakkeCrouanncdilLFo.fJCaawnoardskai,.As1s9o8c0i.ateEfCfeocmtsmoiftVeaenSacdieinutmifiicn tChreitCerainaafdoiraEnnvEnivriornomnemnetnatl. QuOalniatwy.a, Canada: PVleennsugmopPar,esBs,aNnedwTYDo,rkL,ukNeYs.. 1978. Metal osiiy in Mammals: 2. Chemical Tesiiyof Metals andbfealods We iebelp , .,3r.Ca.m LReouttTzi.ssLu.esD.isDmiofnfdraenndalHVi.nGieltboiinon.nd1S9i7m1ul"atAiroyn bHyydBreonczaorfblaovno(nBesenaznod(@Orpgyarneincs)SoHlvyedntrso."xyAlrcihn Biochem. Biophys. 1447836. Wisson, B.G. and BE. Davis. 1955. "Lexdin Soil" Lead in Soil Tsk Force, Science Reviews, Northwood. 152 pp Woalson, EA. 1975. Arsenal pesticides. ACS Ser T:1 + 176 as cited in Eile, 1999). esi 000066 USFW 0642 SL 7 Le WE ES fac Sm Fh Jan Al i, oR wD SIAN } 5 NY1% bt oe So Ha PEARSE SS hf ON EAR oa NECA NTA = - NAY Zin Care| ---- USFW 0643 APPENDIX A `SmalDlrMyaRmumnaClreDeakasiStheeets Washington,`WNooovdemCboeurnt1y9,97West Virginia 000068 USFW 0644 SMALLMAMMAL SAMPLINGANDPROCESSING `Small MamDmanaSelct sueumeDiagBuin Locueao TI=B1C umpedo______ PrCoocteescorr_Rboveie:n DDautee CPorlloeCcc2e7ed0_,s_/7(eG/7 1d0 TGoeWnuuelsniismgpme)c)ie5sL0BTle = TLaalc(lramv)e_n2d3erPinTdrapFoToytpp(eam.ni)r hai m(mic2 eone) gLiveE (Dead) (circle one) EBnodooppaurssiieesss YYNON SSawvveedt DDiisscaarddeedd ((ciicvliecoonnee)) (me 4 "Tesicle Weg) L___R____ RLTTeessttiiccllee ((mmma:) L LS&W W22. _ SEpeimdiindaylmiVse:sicCloe:n.SmNaollt CLoanr.g(ecicricrlceleoannee)) = Ovary Weight @FL____R. LReighhOtvOavrayry(m(mm)m:): LL__S__ W_ We EmPblarcyenotaslSoeaa)rsL L___R.R MVRaaegmpimrnaar:SiacgIesn,:sciNSvumeailCloSmeiLmfaiiregMdeulTLuiargci(icdinrFgcliegog(nceeidr).cleo(nirec)leone) UtweiOvrarieus(s)___ wlo Ovarie1)s - onGan WEIGHT (2 comments LiSvpleeren a = - KAiddrneenyal iw Re ----== Thymus -- IIACER Dora Penge ColorS11Ven! Pele olorLoiPenge Coor_L12 pic So `AApgeeBBaasseeddoonn BSeoxdyOrSguzaen.s "(svaens SSuubbaadduutl AAdduellt ((ccnicrcllee onnee)) `Age Based on Pelage. Goze Subadult Adult (circle one) Comments 000063 USFW 0645 25 4 SMALLMAMMALSAMPLINGAND PROCESSING Soa amDor Snh ColesrBat 0 a Tamas Wm Som EE deo) sue Name Disa Roary LocsinNo = BS SempleNo DazeCollested__Lal L ie Collector, ine re 20 0s adie nuin. Topeua S20 J Live@8geen) Tomlmmns Tal ma) IS-- "HindFoot LS Ear(mm)ld rr -- Eetoparasites: (ooo Saved Discarded (circleone) Testicle Wt (g): LeRee s A et SS em Veil S Small CLoargerceeno)) ee P a T -- I V-- OvaryWeight(8): L------Re J pe marmrCOtorse TLaacdinPga(tczic (oneoexe swOvi Repr. Sage: Full Semi ) MuWl o(cOirScle0n)). = ORGAN WEIGHT(2 COMMENTS LiPapvelree nm TeS 2m en - _ om_ee-- -- = = -- ---- e-- e -- VespaCalor S25 eeClr Lb: vee Cot aPo otonlsolrs (JSnl e SbeApce)n) I -- 000079 USFW 0646 4 SMALL MAMMAL SAMPLINGANDPROCESSING `SeoulMamDme aShle sien 20y Rul) Loosonro TL=C2(0 sempena2373-02107 PCoolleecstorolRo_vZeEe/fREMithiTcrada DDauteePCalrleoascsd4_e[/s94//s55e77d geTnousls(pmem)ccinSbBarcTaiLr lA(Amem)_r24eHine d Foota(mm)t12hgExo (m2Live.Rad cimleone Weigh2t m (g)_se. Partial Whole (circleone) BEnodooppurrssiteess: YYL1 SSievveedd DDiissccaradredd ((ccvlleeoonoe) -- a-te_-- Female Testicle Weg): L_R__ OvaryWeight (@rL___R__ L Testicle (mm): L_X4 w_3 RTesticle (mm): LZ W_> SEpevmdiintaylmiVse.siclCe:om.SmaNlolx CLoamrgecclirecleoonne)) LeftOvary (mm): L__ W____ RightOvary (many L__ W___ EnPabcyeomsS(naon) L___RLK___ ReMVpaagrmi.mnreS:iacgsIen:actNiSovmleallCloSemLmiairtgMee lTLuasa(gscienFgeuog(naceeirdcle(onuel)e on) --------------------U--tw--eiOvra-- rieus 4-- s) --w--oO-- var-- (0)i_e-- _s -------- ORGAN LSipvieern dKaennys Tiomsads wHGHT@ oos pLS--TRrE--T p-- coMMENTS mms = --_-- == --A _-- d 7 Fe Color 857 VenPeeCol_153_ Se FgClr 20553 AAreBsaseduon Ssex OrSns:olJoeve SSubmadaulnGdGgTTM ((cicGleuaneo) _Abe--Bucaon Pease Jwvenile Subaduh Gk (ciel one Comments 000071 USFW 0647 <S SMALLMAMMAL SAMPLINGANDPROCESSING Sroal MamDmemaShls suename_Lroe LocTs=sC=oInTt--oDae CoSlemdp_le.N/o03le3r3-107%01 coroesceosr_M_Lzieve Dierocesed27 T= CCe omispeies_DlPerceisisnsunTdapFoTotmpm al WL e (ciEswio(n) rvef-- Dud (dciecnd) TostonTHOM Ecoraopmunnsiiesr YY NN e TT SSwweedd DDiissaarnieedd ((ccimekenon)e) ate OI Feamsle ovary Weight(gR L -- RTTeesteilclee m(myy L LZ W WZ__ Seminal Vesicle: SmLaargle cilrcle .on) LReotgOvOavrayry(maamm)y: L LW V PaceiSeanSL mtR ---- . . Fords Com.JtCony(eile on) fishotos MVuemmriecs:ovSemaClomLiafgeed TLuargciidnPgl(ggSedl.eo(cnier)cle one) Rene Sage, Nl Semi Muli (isle 0) Ut wiOvae ries(s 5) whoOvarie8s). oRGAN WEIGHT COMMENTS LiSvpeisn `ngrest ipgn ri reer ------ TKihdynmeye f= rao= m= t van -- -- ------------ ee ----__---- -- == ----__---- Dorel Plage Color ____ Vena Pelge Clef Side Penge Color aNgaEeeBBecadooonnsnSBpexnaeOgyregSadens vJJuoveevnilele(wSSubbaodulAmdaRll ((cierclce oone)) (cele one) Comments: . 000072 USFW 0648 SMALL MAMMAL SAMPLING AND PROCESSING `SollMamDmeaaShle siemameDiyQo LoasonNe ToC.1G SuapleNo________ Coe lecworr _fCe%---- DDaeuCsoPlrloecCce=us207 we7_sd&5__=7C_ Genussp+ +eaceiSreeERclToiSizlTrp Type Nluistimspc Live Gady (eicteone) WTeoilgihm)a os= 7 Tol (2--% Hind FootP(amrmia)_(LW3EG (cEicaro(ne)mm)_e EEncdooppuarraassiteesss: Y YN (NL___ SStwveedd DDiissccaarrdteedd ((cciurclleeoonnee)) : ate. Testicle Wig) L___R. LRTTeesstiiccllee (ammm)y LLE10 WW__3te ESepmiiinatlymVsesiCcloem,.SmaNlolt(CLoan.ge((cciircrlceleooen)e) Female Ovary Weight gL____R. LRiegthtOOvvaarryy o(nm:m) LL______ WW_e__ EPmlabcreyntoasl oSeoar)sL L___R.R VMaagmimnaar:ielsa:civSmealClomLifaigeed TLuagciidnPgiog(cgiercdle Rep.Sage. Null Semi Muli (circleone) (ocnier)cle one) UtwelOvrarieas (s5) ___wioOvari(e5s). `ORGAN SLpilveeern KAiddrneneayl Tomas WEIGHT(0) a; 2 RIeR COMMENTS m eeee--s ----t -- p_ e---------- e---- == Trae Dorsal elsageeColor 2720.: VentaPelaaeColor_CoCl/oCr_s,LC_,_SiSiddee PaPgengeeCCoolloro_r_1E2056,2, `AAptee BBus aoonnsSBoedxeOyrgSazdne.s. JJuovveeniillee SSuUbbaRdAuGtIAASGISt ((ciirccleeoonnce)) Dae ompcage Denil SmdahRE (ek one) Comments 000073 -- 3 USFW 0649 SMALLMAMMAL SAMPLINGANDPROCESSING SolMaDa m Ses sueDeynBoa omionrio [L2C22 sero Cotiector_Horwe DaeCol ylas am ocessed__blu[67 L0 Prcoocnesspsoeri_s_sbaBtlnazin_hree cusade s Towve DaePr losis Spcial Ly) (intone) Tome T 1 OC PT praQh Toualmm)_{CT Tail (mm)_2.C___ HindFoot(mm)__{_ (eon(m)am) = [EcopuRstenAY&J -- Swed Disarded (cisleone) "ae Tesi We LR Female Ovary Weigh rR Freesimnm LU WW_3E HLeiteOvOeorayy(cmma L LWW SSeminaol VesiclCe:on(CmoLamrageccl iercloel on)e) PlEarcemntyaleSseoarasyLR LR Miami Soul Luge Lacing (eile ne) + . otieceN.alCoSmeimteMTlagi(cirPclgesaend). (cle 00) iwr rOvars ies(1) Wo OS 0), ORGAN SRhaieeesn Tvs WEIGHT(2) IeTERRze COMMENTS -- = Dor pts Color fury Aglee BdoaonnBSOdexSOErages: Commens VenaPlageColor ug id Penge Color JoTovevenenenQC(oSvAleyRAAddealh (((aicrrleeenoaen))) oo 000074 USFW 0650 SMALL MAMMAL SAMPLING AND PROCESSING `Sal MamDemnSeact. She mame Diy Ru Locasono LL =C 24 SempleNo. Cotiesor_Dec le Weweonh Processor 1 DateCollected. pl 55 DateProcessed_(c ~ 11 G7 VTGeneuos sSmpecLiUn2T ESEas Ta 25 tnlBrSna Ep sy ch caHeinTdrFpogpS emiste atmeSE oeacruemDad (circleone) i ---- Ectoparasites: YN. Saved rr Discarded (circleone) Mate Tesiele We) LR RLTTeesttiecle(tmmm | L___WW [TMD) Ovary Weigh LR RLiegthtOvOavrayr(ym(mmrm LL W,W : SeEmpiindaylmVse.siclCeo:nv.SmaNloltLCaorng.e((caiircrlceoonn)e) EPmlaicyenotaslSoeoar)s LL_ LRR. Z Mamma: Sma GR. Lacieon) ReVasgienaS:agIena:ctNiu avlel SC emi MilTuirg(idG(rPliuagngee)d (circleone) tew Orvarises). whoOvariegs), ORGAN WEIGHT(2) COMMENTS SLirpveeirnna [Ca --2 -- eee _------ KTihdynmeurs ECR -- DorsalPesge Color 5-2 Veni Page Colo: SidePlage Color Uh {cm a`AgpeeBBaasesoonneBSoeddxyOuSgaan.e: JJuovevneilne SSuobbaadtoohlCAAaGbRll (tcircclleoannee)) AbeBucdon page Juvenile Subdali AG (cilon) Commens * 00007s USFW 0651 <; SMALLMAMMALSAMPLING ANDPROCESSING `SaltMaDme Sahot. SheNamenugce! LocTsLi==o2a5No SempteNea2223-2001 Coletor__soguE DDaateePCrooceslseld sJJiIEC1e222d2_e Processor__&--i--itfe mane HAinndgFoont(imsmi)_ti--TeEsatre(mm) Lie ed FT oamE E D= B Tail mE m)2_HT 2_ Paria hokl,y (eeone) rR Ectoparasites: ---- Ne Saved Discarded CL] (circleone) foe) Tesicle Wig) LR 1TeTsotimclee ((mmmm) L LmL WW_E= SeSmeinmaliV.esiclCea:n.SmaolltCLoangve (eicleonne)) Feamsle OvaryWeight @ LR LHefittOvOarvye(mtm):mLE o W W or PaceomtisoanS LR t w-- NMSaaemgie::iNSeuolulCloSemLmiairtgeMe lTLaac(gealnPela(06gc)elecoi)c one) ers wiOvaries 5) vioOvaries ), ORGAN WEIGHT(2) COMMENTS SLpiveeeernnn _Si Z -- ---- TKPihdnesey -- LR _ --_-- -- --_-- --Dor_sal--Page Color=Vent Ptage C-- olor Sid-- e Penge Colo nAe aBednon SpSeoxrsOergOasns: JJuvenleovevntesn SSSuSubebtdsiitaKAdGGRE,ua))(((cci(irceclreoeoonnne)on) Comments 000076 USFW 0652 + 22 z4 SMALL MAMMAL SAMPLING AND PROCESSING SelMaDaenSlhot sieNmdiaRun LoasmonndloCo2S SapleNo___ Ee YO-------- mEdmEm ColleMc(tuorlrs Bus fn DazeCol bln] aF PrGoecensssoprcidsYoemeCeBc asain Date: TrpType asym Sorc Liv ed aeToWteiaglh(tmm)2Bsea11s0 Tail (mm)_25 HindFootP(auaml)_WLhoo'l__(circlEeacnre)(mm)_1O Ccopursies Y____ Seed Discarded (cclecne) ,,--,--,----S$FY [ED Feast cmoen) Testicle Wig) LIS _R_& OvaryWeight(9): LR RLTeesntieclee ((mmm)m: LLagWW_iL ESpeimdiindaylmiVse:sic(le.COSmRNaolYtC:oGnpv.tc(ciirrccleeonaen)e) RLiegfhttOOvvaarryy(mam)k: LL __ WW __ Phen Seas L___R Embryos (ra) LR Mummies: Soul Large Lact (eileoo ReVasgienSa:agIenactNiovellCoSmeimfiieMdlTsurgiGdiPllugogne)d (circle one) UtwiOveariess 6)__ loOvries . ORGAN i Lia Svheern KiTdonmeys WEIGHT(9) < Po z 5 Ll R22 COMMENTS -- _ -- -- -------- ----- F-- E Drs Penge Colo 22 ue, Ven) Penge ColorW:ht Sige Pelae Coord aa 0 + AbAAgeeBBBaaasooonenenSBpadeoidxdngyOdSsrguan.s oJvuvveenlilne SShumbasanl Adg0as,d {((cecirlceleeooooen))) -- ile 000077 USFW 0653 SMALLMAMMAL SAMPLINGANDPROCESSING `Sl MamaSahe. sure De 2 voice _JL=D- sapere Co[etsect--or___SCFITSSSEEE-- Comat tosis 2 DDuaeePCroolceecsested__&L/21122//--7S%T TogTe Mot appa LiveED (areone Tow tal(me m). gh 43Tt ai3 l ye mm)-- __&-- .S -- HindFootP(ammm)a "Ear (mm) LQ (circleone) fcooepimes YYRS sSiest. DDiasda G(drekams)--- Tfebs i W mem r Testicle Wt(g): L------Rec vary Weight(8): L_--R=_ LeHtiOwvaoryn(atmmy L =W v SEemrinialsVe.siclCeon:v.SmNaollt_CLoanr.ge((icicrceloeonnee)) EPmlabceonsaloSoea)rsLL_Z--RR= MNEaommmaanreiesS: VSLomalllSSa& mEiDMLlFaec(acnClaponee oonem)e ne . Ur iOvarises(5) woOvar(9)ies ORGAN SShieeenm KiTdonmeys WEIGHT(2) [Zoc Lee Loy REY COMMENTS --_-- _ ---- Dons Petae Colo Venn Pets Color___ Side Png Clr AA ge B BB onSSoed xdOOrEgs oJSovvveeen SSbauolih AAAddedaln (((Geairlcleleaennee))) Conmens - - -- 000078 USFW 0654 SMALLMAMMALSAMPLINGANDPROCESSING + 12% SoultMaDmeaSahot. . SieNume Dd 00) LocasionNo_TL-E-b SempleNo_____ Processor AISTOR Dae. ls: TVCouloe(rmsm)p.mepmS--IGL0T7apT0il0nmapp)J2--uLe.niiE: 1--WHiIBodForot T(mm)ypgeuc_seSeeeteencemSyi LLivr e )(circleone) SEnodaoppises()NNUo suaeT sSored iDnotr(iiemeoeone)) Moe mee ) Tesucle Wi(g): L. R. RLTTeeslicete(mmm)LLWW__ Ovary Weight (2):L___R__ LRiegnhOOvwayry((mammrsL EW.W \\ : Seriml Vesicle: Small Lage(circle one) Pace Seas LR Lo Epididymis: Conv. NotConv. (circleone) Embryoso) LR _ Zed 7 . RVMaaagmrimoasSr.aicgIsen;:acNiSvumeahlClSoeLmiairfgMeuTLlaagiccoacnPkiosn(sceeir)dcleo(nce)eane) BR Ste Utes wiOve (4) whoOvaries 0) ORGAN LiSvpeirn KAienns Thm `WEIGHT(2) obZ Efo TRE COMMENTS r --_-- -- __ _ Dorsal Petag Color AgieBBaasced oonn BSoedxyOSrgka.ns Bacton Pants Commens yn : Vea Pete Cor, JJuovevniele SSuubsbdudlk AAdall Jove Subd AG Side Penge Colo ((cicrecleeoonne)) (ceoney 000079 oo So USFW 0655 SMALLMAMMALSAMPLINGANDPROCESSING `SmallMacaDemnSahlot StevumeRDuoy Lomionro E12 Semple S73"07 CFrootctesoonr $H2e zaRctuss IMiduvee DDuoeeCProolvleedd_=6-5=2607___ Genusspecies_Blanes beevsieude tr Type Luzon Special Live cQaircloene) & [Cr a-Si------ =] Toulmm)__Z__ Tail (mm)_22 HindFoot (mm)_Ld___Ear(mm) Srcoipums YR Stwd ---- DC isord d (eons) [ Tice Weg) LR LRTTeseiles(mim) LL3W _5_ WEE ESemda!yVesiclCe:on.SmaNlolt CLoamrg.e(ccirrceleaonen)) Female Overy Weight 8 LR LRieghtOvOavrayr(y(mmnm LLW W EmPberoynos S0e)n LLRR RMVaeememgaSreaigeIsen.:ciNSvuoelulCloSreiLmfaiiregMdeuTlLuiarsgi(tdicniPglcu0g(g2ceid.le(ocnec)c ane) UteswiOvaries (8) woOvasies ). <5 - . ORGAN Liver [i WEIGHT(2) = COMMENTS rer ;* SeKpirldenseenty Thymus TiLREowEL et Er ee a Ten --_-- === ------ ors Penge ColorG74 Ven Penge Color SidePengeColr_22Cf AageBEB aesoooeanne pSedeoxntygOerag|rs.: JvJuuevvneenniiillleee SSSuuobbbaaaddduullltiiAdaABGlaL (cciireclleonne)) (iceane) EE --- = Comments: apy 000080 USFW 0856 4 SMALLMAMMALSAMPLING AND PROCESSING `SmallMamDmeaaStelct SieNameLz Lust LoasonNo T=fF=12 SampleNooBI23-001/0 Collector_Logact DueCollesed_s2//pA/rs? Processor__lacat DateProc __Gelucsls a?ed ToGm uenlsmimspey cies_Blam ziainl _oteb scaedeHinTdrFpooTryPpwaemrMi)auses(Wosle SAcprEeoeiaonlea) mL_ive63 (cen EEenodpoupraasnisesi:s Y@NL" SSawveedd DDiissccaarideedd (c(icrcilceolnoe)) "Make Tesile Weg): LR Femnie Ovary Weight @1L___R LTesticle (mm:L.d___ W.2__ R Testicle (mm): L2__ W_d__ Left Ovary (mm): Ww. RightOvary (mm): L. Ww. ESpeimdiindaylmiVse:siclCe:on(.pNaolltCLoarng.e(cciiccaonnee)) EmPlbarceynoaslS(coaer)L s L__R.R . VMaagimnam:aI:naciSvmealClomLiaigde TLearcgiidngP.lugcgiedl(ocinrec)leone) Ree.Sage, Nuh Sen Mls (cilone) UtwiOeves(5) who Ovir6)ies Ny QRGAN WEIGHT(2) SLpieveern Z172 KKiaernen R ff rst E r wry COMMENTS ---------------- ---------- ------ Ph; t Th Dorsal Peage ol__or Veni Peage Color_____ ide Penge Color. AAAgbee BBBacaatooonnsnsSBeoxndeegOyerSdgdes.. JJJuuovvveeennniilleeC(ISSTTODRIIEAAdRuS ((c(ciicrrclclleeeaoonnne))) Comments: 000081 oo USFW 0657 SMALLMAMMALSAMPANLDPRIOCENSSIGNG SmallMamDmanaShlest SienumeDi Sur. LocTuLiAo=nto SempleNo__---------- Cotecor Tp nforBewels Date Colleced__ DateProcessed C1057 2197 ProcessorAris ZL cCoepSep2e20s Dagisoling nT d ora tFamlli,up _sZelLus_p (SciEeAlpa ouAxns)eSll eaLhme bifuoyu (cleans) Tis SSoeooppear YYR R SSweevdd DDiiesaattedd ((caierloononss)) "mate Tesiele Wi LR Feanle Ovary Weight @rL--R---- FTTeesimdee ttomm I L$ W RLiegthtOtvOvaayry(mtaym L LW W . SeHmoinmaileVsesicClaen,sSmaNlolt CLoanr.gecicricrlceleoonne)) EPmaicyeoasioSoarn L LR F MVRaemrgmea:rSiaegIse:.nciNSvumelallCloSmeiLmafirigeMedulTLuiarcgtia(cdtiirncPglleuog(ngceeid)r.cle(ocnrec)l ne) os tewiOvsariess (g) whoOvari)--e--s omGAN WEIGHT COMMENTS LSipveirn := -- iret pr TKi- hdnieys L= _iRL-- _ --_-- _ -------- _-- = --_--= Dorsal Pelage Colorl_i =i _ VenvalPelage Color. rt SidePelage Color Lil wed! pEEe DBBasedooonmSnpebeoxntmyOerSgaacn.s: nfeievnennihile SSSuuubbbaaddduallli AAAddduuulllttt (((criiercclleee ooonnnee))) Commens Le ' 000082 USFW 0658 SMALL MAMMALSAMPLINGANDPROCESSING SellMaDena She sieNameDy Pun LocIsVi.Coon(n2 e SempleNo_____ Colleetor_SP1ine if DueCollced_G 11 G7 ProcessorDeshen DaeProces1s1ed_7C ST--oo--tmsmfsit Tal (ponmyiltpirinnoFtonka e _ LiveQt (clean) EBonodporpamsiietss YQL Ne SSewveedd DDiisesrdcedre(ctreeaomnsg)) re -- * Mate Female Testicle Wi (g): L, R. Lresicermm1__w RTesticle (mm):L_7__ W_3 ESnemdiindaulmiVessiclCe:on.(SQTtaClonls_e(Lcriracelgeoognne)e) _-- Ovary Weight @)L___R___ LetiOwy(om) L___ W___ RightOvary (mm): L___ W___ EPlacne b(Sreora)sLLy_e_K Rs, MVRaeugpi.nn:nSuagner:aciNSvameallCloSemLmiigcesMatTLasarcgu(isdcirnPcglgoan(ceei)rdcle(acnoel)e on) UtwiOvaeriess(6) whoOva(r5)i_e_s_ = ORGAN LiSvpieeernnn ToKimanes WEIGHT(2) [om orTe TTR COMMENTS -- __-- _---- cc Dorsal Peage Color Be onli yenua PengeColor_Ctos Side PengeColor Luvzaz ay). 7v AApeeBBuassedcoon BSeoxdyOrSagca.: RcBucionpee wJJoeevnnesin SES3TRR5NaAAAdGdulUut ((ccirrcelee aonnee)) (cic one) Commons 000083 _ oo USFW naza SMALLMAMMAL SAMPLINGANDPROCESSING `SellMaDmesSahit w amy agmegEA -- Sievame DE 08 Locsionto_LL=E=10 `SempleNo Duce lilt CoF lles r SZ420 m Lanco00 on DePosedLeLL ypeA3E0ocA_sectieLive E2D) (cic one) Genus'Speci ozo 7. Trp T Weights) Ze `Partial (Whole) (circle one) P gop Y iS e STwoeid DHioscearsd i (cmenon) etee c=) TestiWctl(8e): Loo Ree LR TTestoiclentmiymc l WLW. _---- Weight (8) LR LeRethOvOavrayry(m(amyn LW LW SeSmoinraleV.esicCloen,s.SmaNlolt CLoarng.e(cciirrcclleeonne)) ErplrapceomsatSeioa)sL LR R MRNaeomaSasgc:eivNSaelallCSoeLmmaigeeMolTLyuagcicidinrcPglleuog(ncgieer)dcle(nie)le one) teiOrvariess (8) loOvar6)i--e--s ORGAN WEIGHT(2) COMMENTS pSLpioveeern " fm 9= -- ---- -------------- -- KiT--donw_eeyr-- | mLe ----I--RE == _ _ -- --_-- ------ ---- = Dorel Pts = Color____ Ven Page oo Color Side Pela Colo AaA preeBBauetsobenSBdeyOxOOrSSgaaHcn.s: JJJuuvvieennviilleee bSSuvabsedanl AAAdduadllt (((ccilrrccelleooonnee))) [-- 000084 USFW 0660 SMALLMAMMALSAMPLING ANDPROCESSING Seal MamDmaaSclt sueraneDd20) LocTsLiEo2n2o semiero__ Collecn_S00n_Laster DueCon 2/97 Processor BUSTIN Dae GenusDiELSLpAYeDcEiNes_ Trap TypesUSE0HSPECI Live Goacirdc o)ne) Touknm)_/32 Talmml) a Hind actin) 0Ex: (man)_L2 EEncdooppriassseess.: SSeevveedd DDiissccaarrddeedd ((cceeleeaannee)) Tesicle Weg) L___R____ ary Weight @L____R____ RLTeTsetsiicllee ((mrmu)m:) LL____ WW_ __ _ SEenmiidnvamliVse.siclCeonv. SmaNlolt CLoamr.ge(ceirrclleeonone) RiLgefhttOOvavrayry(m(mm)a:y L L __ WW ____ pm Fo medeme. EPmlbcreynoas S(0e)s L___RL___R rre-- i MRVaeamogm.ianrsSiucgIsea:ciNSvameallClSoemLaimrcgMseolTLduarc(gutacienPgeluogn(cgeie)rdcle(oncel)e one) ers wiOvarie(8s) wo Ovaries) ORGAN LSaidpvreierns) KTihdnmeeys WEIGHT(2) T r ioR = = ZIR=E COMMENTS -- eee -- _ = Dorsat Plage Clr Vena Pelge Coo, `AApe BBasaeoodnnsSBeoxdeOyrSgaadnrs: = (ingasKBubEadol AAdaenl `AbeBased on Pie Rp Sub Adu Commens Site Peage Color, ((ccirecleeaonnee)) Glen) 000085 USFW 0661 SMALLMAMMAL SAMPLING ANDPROCESSING `Soall MamDmaaaShlst suenumeDig Bust tomsoone RELA L SumpleNo---------- Cotecror Aivjbt DDaoeeCPorlocloaed_b 1A0L.T9T7 Peo Genspecis PleT in 0m00 vLcLduisHTeoTpdrTFyepoennli(3 sGmSTmt,uiSEsINswC,eLivne fa (amcor a Craps YE SSeiwwed DDiustantd ((ecclkeeaonnse)) Frome VET "(ate > Teste Wig) LR LTTeestmiclie mtmmr L IW_-- -- SHeommiinaelumVessicCloen:s.SmaNlolt LCaorng.e (cciirrcclleeoonnee)) Female Ovary Weight (LR LeRitghOtvOavrayry(mmynL LW W PEhmabcreynoas nSaor)s LL_R.R VMRaeemermniScagsIe:,ociNSvamelaClSoeLmiuigfeMoTlLudargci(icdinrFgclleoag(ngceeidr).cle(ocnirec)le ane) tewiOvraiss(1). whoOvarie8s) ongax Ler WEIGHT() Lc COMMENTS preeese-- rererees sAdpreenal Kidney i \=TZ=r RIT -- _ _ Thymes = m== | -- == T= E----E--Z-- T---------- -------- AogerBmPaeaosnCSoeoxeOnrgodarns' VoJVaelnnSoPbealdletCoAldourlt us ide Penge Color (yiceone) 2 L4/ 7 AE BardoonnB bpoatsyeSee. I(ToEenSlc SSuubabdslitAAduwllt (c(ircclae nonee) Comments: os 000086 USFW 0662 SMALL MAMMAL SAMPLINGANDPROCESSING `Soa MaDeat Shot Sie NameDL COW LocaREiFo-An-1N] o SumpleNo_____ " Colecor__plUsTes DueCotlecnt_/12. Processor__ WTA Dae Z, GTeVonueluisgm/mS)pLecCiFes_BjLTAsLM(E AmBm)L_EV..Oa--c>Hinrd FpoToytpe (emMmuaS xiad _se2eo2cneispnigvve EDcircle one) Sef Ecioparasites: Y' BDSaved Discarded (circleone) Mae Tesi Wig: LR LR Teernuele(mmmtL ___WW ___ SEemniadtsVesicCloen:s.SeNlol CLoamgercilcoonee)) (ems) Overy Weigh @/ LR LRiegthtOOvvearyrym(ymm 1LwW Jen) s E Pacn iSoaasyL L_o_ R n { MReapn.niSe,aaCGt)SLemaissMuLLlaacm(icnegeecvmiercleeane) n Vwi rOvs i) io vai4)_s oRGAy wow comments pLiSeveertn = cqpans --_---- ------------ KiTdhnuemys L wan) -------- . Dost eae Clr Ven Petge Colo, SidePlgeColor, `tAgeeBBB aascedooond nnBpSoeexgyOsrgSaanrs: Juvenile, frSubraedeultmmAvdiurltniid(cnircetleoended) -------------------------------------- Commer 000087 USFW 0663 SMALLMAMMAL SAMPLING ANDPROCESSING `SoulMaDea Shh SChoe Ntalmee oDire_,_L_BNPEELMGoEEcLaEsEDoon1t0 obecoieSsam_pluefNoizler Processor compere EHUBRTiLCoEo e e i 1p Tye iDnattelSeat Lie 658) ein) VeToulmm)_JL 2 BE Tail (mm)__Fle Hind FootN(ammm)o = pehirEearo(vm)m)_L2 = EEcntoapearpasiiitees:s Y/Ay SSaivveedd DDissctarededd(c(ircclleeonnee)) I> Teme Wee) LR Female Ovary eign(gL R---- Leniceaumrt_A_w_ 2 R Testicle (mm): L_4__ WZ Letovy ur LV RightOvary (mm) LW SeSmivnalsVesicl( e (Si lLrgciy rcle ane) PEhnmeyonstSoenaysL LR F MNameiaee:.NSueilCoSemLmiuitgeeMatTLsaoci(icniFgcl(oogingce)dk (oncdr)eeone) . tes Ovaries(8) WoOvaries. ORGAN. LSoheaieetn KTioemss WEIGHT(8) 9os f[r TIRE COMMENTS -- ------ -Dore--eae Color==VenaPtgeCo-- lo. _S-- epa C= oo. aAe Bbaasneddoonn SBeoxyOrSagr.s uvvee nGam AAoln Greilreoanne)) Age Based on Pelage: Juvenile SABaduljAduls (circle one) Commer. oo 000088 USFW 0664 SMALL MAMMAL SAMPLING AND PROCESSING 133 <5 `StallMaDme Saheet . suefveyuRmore LosLsEiE Do21n5 N7:o60 PMSemple Collector__Speszer Processor, Hep lee DueColleced__/10/52 17 DueProcessed_7/_5367 /4 GenussspeciesLrToc _potinipLisi Trp TWoegunlg(n mm)o _3 Tail (mm)_J4 Hind Foot (mm) iol Live 6D (circleone) ceean(e)mm2 ) `EEnciiooppaarrassiteess:: M Nee SSaavveedd DDiissccaarrddeedd (c(ciirrcclleeo0n6e)) Co Feanle TeeleWeg) LR Overy Weign@: LR - LR TTeesstiiccllee((ummm)LLugOWW3S__ RLiegthOtvOvaarryy(u(mm:y LL ___W W_ SEepmiiindaylmiVse:si(clCeo.ns SmNaols(CLoanvg.ot(eiisrielenaene)) EmPlbarceynotasl(Soeaar)s L L__K _R____ Mammaries Soll Large Lacasing (circleone) RVaegpi.naS:agIen,actNiovellCoSrneiifieMd iTurg(icdircPlleuognge)d (circleone) Utena wrOvarie(1s) woOvariess). . ORGAN + LSipvleeren dren TKhiydmnuesy WEIGHT(8) = oq [LEeTRrES COMMENTS _ -- ---- _ ---- -- -- -- -------------- Dorsal PeageColorbesa AAgbee BBasedaoonn BSaeoxcyOSdruges.: Abe BaoncPenage, Comments: Venwal Pelage ColorG7tst__ Side Pelage ColorOaNl= (tte me. 3) JJuuvveenniillee SSuubbaualdiRodlu Janene Subadul GAC (c(ccirirctcllee ooannneee))) * 000089 USFW 0665 < SMALLMAMMAL SAMPLINGANDPROCESSING SmallMamDma aShelst sueameDeyBuse Locaiontio REE22---- Semple No@293-Q0I1 3 CPortoceeasstoorr__H_e_cHaorcswt DDueeCPorolcleessseide_d_L_L1u/1c0l.46234----1 S Geo nGuTn BslessaTpsa:leLrraicmd)ii_s_acn4d1ss HinTdTFooItp(emnaa)l EmDead (circleone) Tiree 0c) Tepe Eepursies: YOGI S`Swweedt DDiisscaarrideedd ((ccicelecaunee)) YN Male Testicle Weg) LR. LRTTeesaiicelel ((rmmm)) L LW W SeEmrviniadylmiVse.siclCe:onv.SmaNlol CLoanvr.geeciirlcleeonoen)e) Feanle OvaryWeigh (#1R---- RLieghOtOvvaerryy((mmym LL_Z4_ WW_Z2 EmPblarcyeos (Sneoa)s L LR R VVRaeenpg.en:Saage: GNaueEiullDCSLoemmeiifvieM,duTLlaucgt(adtciinPegllu(ogcngieerd)c.le(ocnirec)leoe) Utwe/Ovrarieus (s5) wloOvar(8)i--e--s ORGAN WEIGHT(1 Lisvpleeren Adee! cf "[-- oi KTiidnmeys IIR -_ --/ = -- COMMENTS -- e _----a ----t ---- Bhk -Terk - -- . -------------- Dorsal Plage Color Venu Plage Color. Side Penge Color, AAgeBbpasceddoeonn SBeeoxdyOrSguarn.s: JJooovnvenelSnUBSSRuMboDsAGAAuUltD (((ccilrlecleoenoanneee))) Comments: 000090 USFW 0666 <4 `SMALLMAMMALSAMPLINGANDPROCESSING `SellMaDaemShles. Site NameDt UK LocasionNo KEE-E-2 `Semple No. -0012 C-- ollec-- tor__t 42 CT Z. DDaoteeCPolrloeccetsedo__g1c 1[120(77 oGakon3 e S0T 0 m iTongFoTm ye Ast SE 752 2L2v eens wenpF == P pe eeone EEcnodpourpasstieesrs: YYRN SSuwveedd DDiiscceartdeedd((ccircoonne)) pr Fewer LR L Teste (many Lc W_4__ R Testicle (mm): LL W_ Feasie OvWeis: 1L___R. LenOvary(mim LW RightOvary (man): L____ W___ SeEnmdiindaylmiVse.siclCeo:nv.SmaNlolt CLaormge((ccierclleoonen)e) EnPblracyeonsm(loSaor)s LR L___R___ : ReMVapugmi.nmSsi:aegIsen:acNiSovaelmlaClSoemLmiuiigadelTLsaaca(gscieoPgelueg(ngceeidc o(cnierc)leone) UtweiOrvaruiess)--__ woOvari_e_s) ORGAN . LiSdpvrleernena ThKyitmneeys `WEIGHT(2) == T= i COMMENTS e-- m eeee-- ee--r---- -------- -- Dorel Pets Color ___ Veni Page Color__ SidPelage Color_____ A`gAseeB Basedooc nnBSoedxyd OrSgaarn.s JJuovevniele SSuubbaadduulltAABRN ((ciellee oonnee)) e--e--------------------------eeeee `Age Based onPelage: JuvenileSubadulyAga (circle one) Commons 000091 - USFW 0867 SMALLMAMMAL SAMPLINGANDPROCESSING `SemallMaDaenSlhit stormedeo)Louomto REE E22 sempleNo_------ ueCotlecss_0J12/29 CSoolsleeorm_T_PUSTER__---- Genspecies Build_BrsicaudAngType DoeProcLaeZsTsEed MIs SDE Gaileon) TWoeumm LOS 75_Tap mm)_Z& HindFoot F(amrma)!,_igLn=s), cEcarc()nm)_3 FCooorpms Y-- B Saved Dad (eons) "ae Tesice Weg) LR eL enstiimy L wW m-- iSemminail .VesiclCeons.SmaNloltLCoang.e(ciilcekaannee)) = >veh@r LR HLitt OOwvesa ommym) L LW W Vor . mame Pp lacemam t Seas LNR T fond4 MeVaambgmoarsiGesE; SNmuailCoSLmeaimrcgseMoTLkaocug(sciniPglcu(lcgisore)cdleo(nicl)e one) ters Ovaris() woOvaries 6) -- ORGAN WEIGHT(2) `COMMENTS LSipdveeeernns Kanes ILTfR =a --_-- _ --_--= TBhymeRs --_-- = = = _--== = -- ----__ ---------- --_-- Dorsal Plage Color Vena Plage Color. Sie etge Clo, AAe gbeBBasr ead oosnnPebSeeoxltdOayrgSaen.s: mar r-- fivenpillye15 SSSuvobbvaddauadlhut AAAdddualukt ((c(icericlcleeeononneee))) oS " 000092 USFW 0668 SMALL MAMMAL SAMPLING AND PROCESSING SollMamDemSaot suenume Dey Rw Locuionto Rofo Sample No, Pcroocceosrso_rH_folpgeenE DDauteePCortot c__64e0Jus1f/si8de9 d GentBlsazpisubrceviicaeddse topte_MosSepevcr tinGR (item) ToVula(mmn)_ Tail m (mm)___L8S Hind FootF(mom)P_h_Lo3crEaero(emm)_/0 ECnotoppuimesises N( T SwedSwed DDiisscaarrdeetd ((cciirecloenonee)) Er r---- "Male Teste Weg) LR Female Ovary Weigh (gL___R___ RL TTeestsictlei(cmmln)ey: LL_&b_ WW_Z 3 LReighOtvOavrayr(ym(mm)m:):L L___ W W___ ESemionarmVesiclCe:on(Gol Raioantge cilreeoc)n) PEhnennsSoeaaysLL_F __R___ RVMeeaarromaaS:asgb:eucilSvmehalCloSemLmiuitgeeMlTLsaagc(aiinrPgluog(nsceie)cdle(oce)le on e UtwiOe veariess(6) wo Ova(r0)ies---- ORGAN WEIGHT(2) COMMENTS pSLKipovieeneernrt L[ZLraEEwR Tos hate _ _ _ -- _-- -- cn-- m-- ort peorCg Ven Coloroa Spgscolo Gry E Age a Bap sedoot nnpa SoeexyOragarns: T JJTuovvieneinel,ee G(GESbEaLdhIlyDAAGduMlt (((accirlrceeleoooonne))) --_-- Commons 000093 USFW 0669 SMALL MAMMAL SAMPLING AND PROCESSING Soll erDae Slhek Nr SR Stename 2dr) Locsiono_22120 E= SumpleNo_-------- PCrCoocelsolsoercror_A_y2LTiLeiErSnAELAsean ToT ADDlaaafeeiCPaolrlaepcoesdec_GaeJ1is22i/1s59e21 8d) een ms 2 Hind Foot rm_JS Ee (om)Ze Panial ole Jereone) Weightg) LZ= Ectoparasites: YR Saved Discarded (circleone) "neTesticle Weg) LR met LTesticle (mm): LW Seminal Vesicle, Small Large Girlon) Epididymis: Conv. NotConv.(circle one) som i San = we LR LeftOvary (mm): LW h PlacematScars LR reads Embryos (10) LR - MVRaeerremnaeSraigsIe,aciMvSaeelllClSoeLmmaiergsMe oTLlarcgciinrcPglleugo(gneecd)l.eo(nceee ane) Unis wl Ova(8r) is wloOvaries ORGAN Saprieenr foTomas WEIGHT(2) i (TZTIRT COMMENTS Dorn pg Coton E27 enn pete olor EH leene con Age Based on Sex Organs: `Age Based on Body Size: A Comments ae ee Jeni SAAR (leon) Juvenile SubadultAIT (circle one) Juvenile Subadul jAduii (circle one). = ALLY < 000094 USFW 0670 SMALL MAMMALSAMPLINGAND PROCESSING SmallMaDae Sthst. sietame_Dzallion Loconto LO & SempleNo, CFollrecetorw2E2l0aypC h0" DE Date Collected_(-__/:. C GenasspeciDssE CI 6Lugo Amp Type DILSP Lm SPUC LiveCH.(cic oe) Toukmm)_L EC Tail mm) 2 `HindFoot (mm)_25-- Ear(man)__[7 WeigLh e tg)_20 E copires YVAiT Panial Qihole(circleone) SSwteedt DDiiscsaardeedd c(reeeme)) -- mate =) Teste Wi: LR vyWein @ LR FLTTeesicete m tomy LW W RiLgehttOOvyary(mmbLL___ WW. e ESemionalmVesiclCeon. SmNaolx CLoanr.gecileeoo)e) EPpeisSooca)s LL e__aR R RmMemasSmagmeeaoalCS(eGmoir MalLiaccoicm(lieleenes) , - Uterus w/Ovar(gi)-- es. = wioOva(r8)ies ORGAN WEIGHT(2) COMMENTS Liver Speleetn co aei -------- -- KTioemrs re =e =r= s . Dorsl Plage Color LiL. Vent Peage Co(l3Ioa&r_ ide Plage Color_tn Ht. Age Based on Sex Organs. f`AteBraseod ontBohdy Size. Juvenile Subaduk Adult w Juvenile Sd ubadull iAdult (circle one) (coirbcleson)e) --_-- 000095 USFW 0671 <4, SMALLMAMMALSAMPLING ANDPROCESSING `Soul MmDae S)hot smvame ly col onto_T-E- 2 Semple NTS = O07 F Cor l ERe T er DDuecCeoteCned_E&J1I21T57 oConmtp_eS5efia ss saCdes2STTe parMalCBs SeEplsAeclSSeAoneO e) cAF(Gd (eon) CEooooppasaineessr YYA RTTT SSaavveedd DDiissccaarrddeedd ((cicrlmeoene)) Mae Female) Testicle Wt(g): Le Ree LRTeTsteimcalse mmmy L LW.W SeEmiari!aVsesiclCeson.SmaNlolt CLoanr.ge(ccieloonnee)) OvaryWeight(gL Re RLiegthtOtvOavarryy((mmym:L=p WW_E_ PT acemalSeae n L__Rz ___ J Mummies: Seal Luge Lacasiog (cic one RVaegwinaS:agIen,actNivelCoSmeimfiieMd uTurgi(dciPcluogngee)d {circleone) UtwelOrvaruiess(5) loOvarie(8s) ---- -- ORGAN WEIGHT(2) COMMENTS SpLieveern Adrenal _--ol i= c --_-- ror -- es B ThKyidmoiers =, T-- T -------- ors Plage Color _____ Veal Peage Coler_____ Side Pesge Color aeBe on SexOtrgs Joven Subs ATS, cclean) `AAgeBBaseetdoonn BPoednygSeize: JJuovevnielne SSuubbaadduulltt "AAAdGugliaU__ ) (c(ciirrccllee oonne)) Comments o ina 000096 USFW 0672 4<, SMALLMAMMAL SAMPLINGAND PROCESSING SoulMamDemSao ' sumeLopbose taeLsAo=1n3 ro Semple SHESDEAI EE) CP olleor__Hoe rye DDou Collneciagd_a/2107/242.0_ Genusispecies_Lsccocuc fponistuliesiteToe Tyre LI HindFoot(mm) Live GF (circleone) (um) ZL Toul(mm)_L2L_ Tail(mm)__2T Weight(s). 278 ----e Partial le(circleone) me Eewopirasies: Y@-- Swed Discarded (cicloone) wae Sean Testicle Wt (g): LR L Testicle (mm): LW SeRETenstnimclVees(imcml)Ce:oLn. Smaolt WV LCaogme(e onoe)) OvaryWeight (@) LR LeiOvary (mm: LLS WZ RightOvary (mm): Lge W_4. Prceiitse LR RN VEipociGnmeECSaasomm,iWTltago(sgc,Piogocavsi)dt(e)eo) is Ova (5) woOA ) a ORGAN Liver | To Spleen WEIGHT (2) LY L TZa IoRIiZ COMMENTS -- _ --_-- ---- Vent PengeCor____ Sie Peng Col ApgRerBBoasttimoSenx0nOrmgains: vioelgns Subst GG, Sag (k(cairsemnonee) in Commens. . 000097 USFW 0673 SMALLMAMMAL SAMPANLD PRIOCENSSIGNG Smal MamDmaaSholck sieranDiny Bun LocsionneTA19 sempleNo [ four rare -- DDueCollst_L.ra2n2 9 Gonspecn Zo SeteTe ro bcliun Tap Type WI SCs nce Tamm) 2 Hind Pot(mm)2C Earom Livefod ainleone) Le VenE 2E T paral Whole,(ileone) EEevodpaprmassiaess:: Y R(LS______ SSaavveedd DDiissccaarrddeedd ((cciirslceoonnee)) - "mate [= Tesicle Weg LR Ovary Weign(grL___R___ LKTeesstteem(mmrm 1| W_W____ LRieghft Otvayr(ym(mmm)):L LW W SEepmviindaylmiVse.sicCloen:v.SmaNloltLCaorng.e(cciricleloonn)e) EnpblarcyeonasS(eaa)rsL__RL_K. __ - MVaagmimnaas:ieTso:ciSvmealClomLiafrigde TLeargciidnPglgg(ceidr.cleo(ncei)ceane) . Rep. Sage: Null Semi Mult (circle one) Uterus iOvaries). wio Ovaries 8), - + ORGAN WEIGHT(1 COMMENTS L SLipvleeren eSsr - - Kidenenrs Thvmas iEwIR == -- _-- Dorsa Peage Color (Br Venu Pelge ColoAor&_LSisde PelageColor 11 cre .f AAAbgbeecB BBausdeoda noobnnBeSeioxadd OryreSguaz|nes.: UTJuuiwvneenneiilael SSSuuubbbaaadddeuullltiAAAddduaalhli Comments (((ccciiirrrcecllleeeoononneee))) 000098 USFW 0674 <4 `SMALLMAMMALSAMPANDLPRIOCENSSIGNG Smal MamDmeaaShlr sunamdruBun Looe BETZA=20 sempieno 273: ONO) Collector Auaton Proceso ocNE DueColle/c/ed7_& DueProce79s/s97ed ToGV uemluSpLee ceSs us rs oTsasl (2nn muew_3o5 i.a 5nHitndFroToyrappe(mim [N&a_i (eEaeroGnmem) LLiove Geileone) EEvctooppaannssiieess:: (RRNo SSawveedd DDiisscaarrdeddd.((ciceeloonnee)) -- a--_e eT -- En---- Testicle Wig): L____R__ LRTTeessitclee m(myy LL W.W SeEmpiindaylmVse.siclCeo:n.SmNaolltLCaonrvg.e(c(rcicell o0n0e)) OvaryWeight(g) Lt=> R____ LRiegthtOOvvaaryr(ym(mm)o[LLL3 ZWW__2Z PhEnobmryaoistSoao)nLL ___RF ___ MVRaemnmaSresae(RSmau) LCagCoemels TLaarc"airnPgeu(socgeeldeeoinle)e one) UteruswiOva(r6)ies woOvaries 5). QRGAN LiScpvrleeereant KiTdhnueys Time, WEIGHT(2) =z ir LEA RED Tey 0 COMMENTS TIT [FAIS NE To cdl d ge7 veny suf4 Dor PetaColorKeel1Venen Penge Co2l22 oKri pete Cotn_t.2Yer te] | AAfgte BBaaoonnsSBdoedxeOyrgSadan.s: JJavveenniilee SSuubbaadduutt AG&80G (c(iericlleeoonnee)) Vor med Comments: 000099 USFW 0675 4 SMALLMAMMAL SAMPLINGANDPROCESSING SlMmDemSh : SetLieymBoew tomseoro TAI Seu ob 773SEHD) mi -- Collector Hazart -- Processor garat DaeCollested DueProcessed Comper Msoasis ighas Top oeLise prc Lys 6) (eieent Ear (men)__L3 Toumm)_0_ Tail (mim)_25 HindFoo! (mn) Partial (circleone) weighg)_258 Ectoparasites: GG Saved Discarded (circleone) "Mae Female Testicle Wt(g): LR OvaryWeight(gL R---- RLTTeessttiiclcele((mmmm):: L_LS Lip W_4C W_9-- sEpeindintaymVs:es(Ctony,SmNaolt(CConG. (rirek oonne)) L`eRfigthOtvOavrayry(m(mm)m:) L LW W EPmbarycosi(as0) L L___RR _-- MVRaememmamrSiaecgs:ettSvmhalCloSmeLiamrtgeMeoTLlaaca(gtcinePgsao(soci)hrcl(eocnle)e ne) ------ Uterus w/ Ovasies (8)-- wio Ovaries (8) ORGAN Liver KSTTpiloemeevnee WEIGHT(2) 25 Tf TRR e E COMMENTS -- = [-- Ven PesCol Side Pl Clr. nEeoBeoaortSBbeeoxatoOysrgaannes: vhveeeene SSSeoobvuaaGGaaGL (((aceilceekoooono))) ey ee Comments 000100 USFW 0676 < SMALLMAMMALSAMPLING ANDPROCESSING `Soul MaDmanSaot SieName FDrA y BoLw Locasonto LAS: Sapeno DFE 0'2 eo CProocieosscoorr__MHeogcwear Soren Zoepelicss-- Genu/Speci " Weightgf)os dgemros DueCollecsed_6/0/7 DueProcessed_cUefen iyofen fue tnGD TrpType Lose Live ead) (circleone) Panial (Wholg (circleone) EEnodooppuuamsiineess:: YYN @__ SSwuveedd DDiissccaarrddeedd((ccirlcleecoonee)) "Make Testicle Wt (g): LR. LRTTeessiiccle(mmmm): 13L_3_ WW__22. SEpeimdiindaylmiVse:siclCe:onv. (GNaoltCLoangveT(ecrekeoannee)) Fes Ovary Weight @)L____R____ RLiegnhtOOvvayry(m(amya:LW LW, EnPbarysoisoaon) L L___RR ___ VMaagmomsaI:oaciSvmealCloniLfairegde TLuacgudioPglug(gceidc coinrec)le one) Rege Sages Noll Sei Mul (ceeone) UteswiOva(r8i_e_s_ woOver4s) - ORGAN `WEIGHT(2) `COMMENTS LiSdvprieeerenn KTihdynmeuys zLL ra LL2 RIC --- -- ee B-- l "---- `DorsatPeiageColor Yall. i, Ventral Petage Color wih. Lic,SidePetageColor_Liizecmecl.i `A`AAdggeeeBBBauasseeedddooonnn PBSeeoxadOgyreg:Sa|nss.: JJJouuvvveeennniiillleee SSSuuubbbaaaddduuollltAdyKduli ((ccciiirrrcccllleeeaoonnneee))) Commens: 000101 USFW 0677 +128 4 SMALL MAMMAL SAMPLING AND PROCESSING SoulMaDaraSlhst- sevenDoler mmoT = -- CPorlolecaers_sSoprsrSeess DDaueCollesd_(:/10/97.= | Gemusspesies Aliuozin Renna cmp Type Ese it S2r0i:m 8 |) CED (econ) Toul(mm)_122 g Ts mEm_33 `HindFootv(amim])_WZh1_o_ one) Eopunsien (N PN apee Ts sSweead Ge(epolientaenes)] Male TestiWcrl(ge): LR LTesticle mmy LW RTesticle (mm): L_ w__ SSeemlmiVesictCeo:n.SmaNlolt CLoma.g(cciircclleonoen)) co eight(8): L------ R---- LenOvery (my: LB W_2 Right Ovary (mm): L_B2_ W_2-- EvPruycecsiStaesL L___Ri . e a Vesmmaos TLuaggPugredc.(cinleo0) - Re Sage: Nah Semi Muli(cectoe) tewiOrves(4) who Overi@es) ---- : ORGAN WEIGHT(2) pLiSovpeirn Korey 0 oT hirer w=xin Tova HR COMMENTS J, -- Dorel PlageColor _____ Veal Pelage Coler___ Side Pelage Color. aege BoasednoonnSpBeaoxuOoiresgase.: JJJuuovveevnneiillnee SSSuubswbt AaG) lceeioloonne)) Be Se ~~ _ Comments: 000102 USFW 0678 SMALL MAMMAL SAMPLING AND PROCESSING Soul MaDaa) Sst surat fun oTm oCoe l Sew PCroolcleecstsoorr&EsweSaAliOd DDueePCorlolceecetd_t-119A7 TLC e nntspete Bm A ai ltsHTinpd FoTope(aamlW)l.iOWCghaan(ScEiceeoan(et) vLiv2e Dead (circleone) Te P Ecopaae siess YPER vseods DDilsceairdeedd (ctiraclemoene)) - wale Testicle Weg) LR emnte Ovary Weight GLR---- RLTeTsetisctlee m(mym L LW W RLiegthOtvOavrayry(u(ma:myLL424559 vWi SIZ ESermiiinyVmessiclCoen,v.SmaNloltCLoangv.e c(liceeoonnee)) EmPblarcyenosSncoan)s L LR R -- . RNMeapua.maSiiageesvs/SNemualllCloSmeLimaitrgeMeulTLioagsis(dciinrFcglleoog(ngGeei)drl(ocnei)ce one) terswlOvar(8)iesVioOViFies ). QRGAN. WEIGHT (2 COMMENTS Lseprn =, Adrenal rR -- KiTdhnyemyes - ER = _ --_-- Toa -Dor_sal--Plage Color= Liv= i Neal PlageCo_loresSide Pelage Color(2 Lo sae. Bae aBanonsSBeoxseOyrSudne.s AE Bucdonpenre | owveernes Jwenile SSeubbaaddolht Aslst Subadu Gaul ((ccleeeaannee) (eircle on) Comments: 000103 ! USFW 0679 SMALLMAMMAL SAMPLINGANDPROCESSING SoulMaDmnSahs snaOrynRoew vocsionT=-Co8 spenaR72-:30/02 - CSoepctr ore __Hiaen we DuBueColleced__6/1002 7_ 4m. Vgenesupmescegs. rM[iecdicites_pproosyinselgyvlauysaiztrnFeyfMoulsieepn ScpreSocpinea)ll iLeive(G62D) (cine) BEcorpanosiesss YYNQ SSaovevd DDiisceartdead ((ciroclenonge) te Femi KTTersetoiscmlteeWit(mgmry LLL _W__._W R__ ROLvoeathrvyOWveeiighuyctmonL@kLfLa __WWRD_Z_ SEermaa.VesC.omSmallx CLogmeeGcoreonn)e E Pacem s L_a . . VRMeaeretma:Sragiees:: eNE othCaSe TaamtWsLtlaenirid Hue(gcgi0er)cdle`nve)eoe) p Vins Ovi) woOv@e) n Ray wmGHI SVpoeewn ToRT3 NTomws ITT 2 comms -- --_ -- ---- Doral PengeColor ce _ Vern Penge Color Lo: Sid Pelge Color bgee BBaaad ontSDeoxosOrSnanrs. vveele SSaatdaAABGHS e(icclleoanne)) AgeBascdonPelage: Juvenile Subadult RGulL/ (circleone) Com 000104 USFW 0680 < SMALL MAMMAL SAMPLING AND PROCESSING SoallMamDmaaaShelet sie Name Dry Roy LocaionNo, Z--2 Semple No 2020300T. CoPrlolceescstoror_aHrogewse DDuueeCProocleseld_egJcJois/a6eo2?d_4 TGVeoenuugssliSp)ecieEs 1E. pTeonlt(ylivammtifc)us HiTndoFpooTry( pvaen_amMlnua2 eimn(Scpeleecocineca)ll Ltivee G2(circleone) EcEtnodpoapraarssiitaess:: E Y N-- T SSeavveedd DDiisscaarrddedd ((cicrlcleeoonnee)) HE ------ "Male Feasie Testicle Weg) LR. OvaryWeight (1 L___R. LRTTeessttiiccllee ((mmm)m:yL L_2J __W_4W_t RLiegnhOtvOavrayrym(esa)my:_LW_.W, SEepmiiindalymViessc(lCe:O_RS.maNl_o CGoEnS.(c(icriclleooen)e) EmPbrayocsi(v0s) L L__R_R __ MVaagmimaa:resI:naciSvmealClomiLfaigeed TLuarcgaisdinPgl(ugigecdeo(cnierc)leone) Ree. Sages Noli Semi Muli (circle one) UtwiOe varises) wloOva(r1)ies ORGAN LiSvpleeren KAiddrneenyl Thymus WEIGHT(0 ZT5 \[ZwIrRES == COMMENTS _ --_-------- _ _-- -- ors Pesge Color vuelena Plage Coloriui Page Color `AAgdeeBBaasedsoonneBSoeddxyOrSgzaen:s: JJuuvveenniillee SSuubbaadduullii RLA)GL ((cciirrcclleeoonnce)) AdeBaosnPeengde. Juvenile Subaduli AGL (ice one) Comments: 000105 USFW 0681 SMALLMAMMALSAMPLINGAND PROCESSING #1260 4 SlMaDamSt SteNameDes_ur) LoaTs=o(nC-t22ie Sample No. ee Collector__ SPEEtRonGER. orn tn fuse fDasoe Ctolo rwlrol92%:. dope oie Le 0) ew TTo-- outl(emmm)TToe, Tn ail(m-- m)__=SP E HindFootWSiEoSv(m). ) Ear (mm)_F DDol ias ((lceeacno)) Eropntes YQ IZ TLFesetsisWcitll(ge):eL y R W-- pf Seminal Vesicle Smaellx CLomgee.(eriloeoan)) Female LKOevoanrtyoWoeighmttm(8y):aL L mi R V W-- Pi ucmaisan L__R___ N Viim : iSmlailSraLanregMe ThLaocadctilnPgetoeeie)le(oec)lon iwlOs vi) woOve, `ORGAN Liver KSiTHpleeeeasmn z WEIGHT(2) 02 R za8h e i COMMENTS _ ---__-_--_----=- Dorr Pn Color Ven Penge Color ie Ph Color AgAe RBareeEddoonnRsBeoxRtsOips oioan aAddnul(tcreo)n (ERAS Cones: 000106 USFW 0682 SMALL MAMMAL SAMPLING AND PROCESSING +20 SollMamDmaaaStelet SieNumeD@d 20K Locsionto B-D=lo SampleNo. Poses Puss Du m SoGeunuts/Speci2 es AICOTYTSo _fr2 Penlij5 nuty NARHICiTnHdEDFoToykperm pepeaesr LeiveG(Bas) (cree one) Weight) 22s) Panial (WhoSlpirceone) EEcuoparastes:e(3) N@_UuhkooTsten aSovfed rs(circleane) "we Tesicle Wig) L___R RL eesniser(aymy LLWW.. S Seminal Vesicle: Sms al Lrirc gone) Cro Gory Weigh LR RLiegtOOvvaaryrym(ma)my:L_[--=w-- PlacenalScr ip oe MammaT Sl)ELrg F Lacine g (eileeoneen Rese. Sag: Mull Semi Mats circle one) Uterus wfOvaries(5) `wioOva(r8)ies ORGAN. Shweeern Rare Kidney WEIGHT(2) 7i.0x LLZRD.T COMMENTS -- JN -- Thymus -- - Dosa Plage Color B26) ve plageCn olor(a 224_ Side PengeColor PATIL NNAgeeeBBBuaaddsooonnenSrBedeoxdnyOerSgaen.s: dJJuoovevvneielse SSSouubbabadlndgudhlelte`Ady AgBa) (((cccirrrcccllleooornneee))) eee ei eeete-- e-- e ------------------ Comme 000107 USFW 0683 SMALLMAMMAL SAMPLINGANDPROCESSING Samal MaDmasSahot rnd Ben LossinoTEDBY sempre -------- CPor llestEor_C_-------------- DDauteeCPallrocedo_Lzc: ibe:04e8%d GenasMpiepconise(OsE masg\semi TapTypePastSuaisd. ive Ga (ciean) TTooalumlmT iiLmgGmoO ); TailM (mm)A __2%R THinTdFootp(amilmW)5h_olJ(clEeaansr) (4mm) EEcooppmuseise.r YY NN _vaT cqgTE uTlT y SSwaevde DDsicsutetd ((cacckeeoonne)) ae Terie Wig) LR LKTTeecnkt mmyy LW W-- SEenmiinyalmiVse.siclCoen.v. SmNaolltCoLnavr.ge(ciircrlelonoen)e) C= Ove Weigh GFLR LeRihghOtvOavrayrym(mmm L LW W EmPlbarceymoast (Scnaor)sLLZR.R_3e MVRaemermna:rSiacgsne:acNeSoml.allCloSermoiedMurliTar(}delecRigarre)e(cele oo) ters Ovar(i) es io vases(5) ORGAN fLiSevaperirenn WEIGHT(2) a2 \i EZREZ COMMENTS _ -- ------ ---- ------ Neo SSuas sample - Smashed Dor Pelage Color s AAEEaue c eooonnnBpsdd oeodaxu OyserSasr.. ee Commens: Vern pase Colo: ide Penge Color JJuovevniele Joven SSubuadunliSBQTF Subs GER ((ccirecleoonn)) cieleone) me 000108 USFW 0684 SMALL MAMMAL SAMPLING ANDPROCESSING Fiz% 1z `ScallMamDumaSact SteNumeDel QU LocsionNo TEE SmpleNo------ Cotear__SpLEGEC DaeCollcnd_211019: DateProcessed_[1[27 Processor__gioeTonl Comping Te Le(BD) (ent Tin 2A Ni Toulmm)_j2% Tail (mm) "HindFoot P(amrmia) ce"Eearon(em)m)_LL_-- sperposmiiss((IY_NMBAlaZoErsTT Sveevedd DDisicarrdted (Gceicoamne)) Me TestiWcrl(ge): LR LR TTesteiclemt(mmem): L LW W ESoevimdaurVuessiclCe.ons.SmaNlolt CLoanrvg.e (icircclee oonne)) C= `Weight(): LR RLieghhtOOvvaarryy((mamny:nLLEBD WW_oS Enpprcyoosoas) LLT3 eBe MVReearenmea,Sasgm:e,a(nNSeaailC)SoeLrmaiirgeMeuTlLiarc(giinlPgleuog(ngiee)cd(eianlee) ane) terswiOv(5) e wo Ovaries @) QRGAN LSieveern | KTAidshneesr WEIGHT(2) 2.o4S 23RAD COMMENTS -- _---- -- ---- _ ors peage Color (300.51 Veni PeageColor (a2 SiePegs Color LET L- AAAgbEeeBBBcaadsseeoddnoopnnoSBeonxdsyOerSgaen.s: Ae Commens JJJuuuvvveeennniiillleee SSSuuubbabadauddlufully5 etl ee (a(Gciiicrclllee ononene))) : 000109 USFW 0685 SMALLMAMMAL SAMPLING AND PROCESSING `SalMaDaenSlh Site Name_ZuRun) Locas"oEn=NFoll SempleNo______ Collestor__S47+ A"m Gerie DDaeeCPorlolceeted_(- +/[1- LFCF. TGeonpuaclSte cx TZaitmmD)ense HiTndrpoTtypre mHIEE rm LiLeBd (ciocne) Wegh(glZ _ T Pamal Whole (cirleone) EEoparnsieos: YYW. O SSiwvveedd DDiisccarededd ((ccirocldeoonne)) pe Tesi Wig) LR RTTeestce (mmmL|L12u Wwe 7E ESemivnaliVesaicle.: SrNlo)xCGono. (iircleoaen)) wo vay Weigh @FL___R___ RiLgeht OOvvaarryy(atmmy: LL W.W EpnlaecemratoSe)ars L L___R.R VMReaapmi.mnaS.raigcne.ssciNSvomelallCloSemLmiigeedMuTLlaucraGdtrinePgklou(gngcee)cdco(ncee)e ane) Utw/Oveariess(8) wloOvarie@s) .. QRGAN WEIGHT(2) COMMENTS Lsipveeern = . _-- Keirarn iTxR -- - Toms = _-- Dor Petge Clr Age BasoneSdexOrgans. prt rea Age BaonsBodeySd ize: Commens. Vent! Pela Coo Jverle SobadAGul ve Juvenile SubadultiAduh Side Penge Coo circle one) ee (circleone) 000110 USFW 0686 <4 SMALLMAMMALSAMPLING ANDPROCESSING SmallMarDnnShaes suum Log Bur Locscato L=Lotd sepena2273-00108 CProocleesscortor_p_Lahetue DueCollects 20/22AM DueProcessed 4/0097 GTa eonuulstSpecies[ciatnE iBmrociincl,totrtamcSieplaar=ee) lLive(6D)(cicone) c Boeopeursircs: YYNN SMwedPDisarHted (NceIo) AiR re-HMo AAoime we foi To Testicle Wi (g): LR LRTTemei c(mammy LW,LW SEenmiidnymsVe:sicCloen,n.SmNaollxCLoamrg.ecclirecle0a2n)e) Ovary Weight (@):L___R__ RigOvary a:a -- LW. EPnaicsmoanny L LR C VMRaeemagarosnrS:iaeguse::ciNeSuemlalClSoeLnmuiigaeMlTLsuegais(iGnFglu(gocmeeee)seocnee)e cae UtwlOveariess (1) wloOvaries BOE ORGAN Spweeern Vrms Tor en WEIGHT(2) i Ws `COMMENTS --/-- ]/-- ]/--= ------------ -- Ar7e' Sprcma Dorsal Plage Clo Venta Pelge Color__ Sie Pea Color_____ nAeb BBiasssoonneSBedoxdyOrSgaarns.. Nee Busct on Penge. uJuvveennillee vee SbSuobabatdah AAAdddualaht (((cccireseeeeooonnn))) -- 000111 USFW 0687 #12) SMALLMAMMALSAMPLINGAND PROCESSING `Soul MamDamnShact Sram Bo,Rin Lom TLB enH Ne SmpleNo___-- CoFllea cor_n WMege s BW DDaote CPorloeczma_ [10/97 emsZepnseWnsi adsoengss s Top pelausesmspecial Live 6d) (eirle one) o Ear (mm)_pow=" TWeoiguhk(pm)m)L_a 5 55 Tail (mm)_JQ Hind] Parial FD (circleone) poreatly cAC) FEorpuormnsmieesr NN_TnEeSsgEToETtEs iSvweesd DDisicasrdted ((ciilleeoonnee)) te Tesiee We: TR TLFTTeemsetlee mtmm L LW W SBemoirnisVe.siclCoen,s.SmNaollx LCoanrv.ge(irelleeooen)) Ceoni* varyweg 6ROE LHeittovOavraymtma)eLL S W W E EmPtlrcyeomsaioSoe)sL LR F Ree SSEesRcGoSeCSoermiieMd lTun(icdirclPeugaedane) (circle one) UtweiOrvaruiess) wioOvries ORGAN SLpRieavreeernr ThKiedmneirs WEIGHT(2) oPrasw piconet wd COMMENTS -- ----- orsPelCogloreeybrPe eageCoa lrry. KL. Side pelage Colorpoabes ned AMgiebBdnascemddomnrSbeeoxtnyOerSgaen.s. JJJuoveevnneiline (Sobaguo(SANBdIeouAulG ((c(aicridccleleeooannneee))) Comments i 000112 USFW 0688 SMALLMAMMAL SAMPLINGANDPROCESSING SolMam Da Set SiteNameDry (AA LocsinNollL B - F SampleNo . FCol-- lecwor ThoewCE -- DDuteCrL olelescted L [1 L 1E67T eTgoanlmem elm TACpLf iebsedg ae ca Top rpC BLur ALLcrio0ncg Live God civleone Efrocogpmsss YY AW S$ee4d DDisawtad (emolmeaenn) --ee-- r ---------------- ~ wae Fema pric bly F Testicle Weg: L___R____ Ovary Weight 9k L___R___ LReestme mtmomr LL ___wW ___ LRhevvyaymerm: L LW W SeEmniinbalrmVseeCom.SmaNlolxCLomaerctleonese EPmacesm oLo)_L __%_H __ t ReVMapugomSsmagnaeaiNvSeetaCloSmeLimatgaMes TlLauilgngeP.iga(eceicsle(acnerean) -_ iwriOvars ies(1) wiOvris - ORGAN WEIGHT(5) COMMENTS LSiiieecs F= o c -_ _ KTionmes TR __ Du Pe Cole 22.5, Vu Pele Color24-4 Pee Cato 12144,110 AAArree BnBaccttomoonbnBedSouexryOeSrakg.s (JQiIselTe: SSSuiboaedtuhlal AAAdhdu l((oclrenoon)n)y ere ------ rr-------------------------- Comms 000113 USFW 0689 Z4 SMALLMAMMALSAMPLING ANDPROCESSING `SltMarDesaSsat. suu ryBmur vocsontio TLoBotT----DuctSseaplfeiNofGaZ320100111 - cCootmecpteor__Lboa caartssilosEgeDzones,TbinodFeou (5LuDzeiProcS eSedoueTeE)Dead (cic one) ee a => r Sooo per VYQ E ssuwet pDicraied ((semleeorn) Mate Tesice Wig): L----R---- Feamnie vayWeigh (9 L-- LTTeemsegttuem L EdWW_TE-- Sema VesicAle: CJ (Slag Girl oe) LReigthtOvOavryi (rmmm:L LWW Pehcenea SeasfLmRt 4 VNiomaarge:eiciNSvamelalCloSmeLiamtgeeMTlLoargci(idcnlPgleiag(ngceei)rdcle(ocniec)leone) yd, UtwiOvaeries s8) WoOvies) _ ShLieveern arena 1c4z rw Kidney rrstw) --__---- ---- Troms | ------= -- --= _ e_ --e----e--e--e F-- E -- -Drs--peage Clr==Vena elge Coo. Side Penge Color age Base on A SpoxeOeorges: JoJuvovenvielee SSSuuobbbsuatlAdAdu) (c((rccellteeeoannnee))) AComp ments: 000114 USFW 0690 APPENDIX B Analytical Reports `Washington,DrWyoRoudnCCoruenteyk,siWteest Virginia November 1997 000115 USFW 0691 - i} TGGOLTFENAAN> N|ERiE oyFtm. Wes rsetaoInncn,n. , =, DESOESTNSUINS 707214 +Fax2 TR40 04-40 021 oom smn To A ---- Fro: V.Kamal, Ansyica ecin tester Vin! cao) SUBIECT: DOCUMENT TRANSWITTAL UNDER WORK. ASSIGNMENT # 2473 ten pose st tt. low va pe Sade i wk pa Dry Bun Cok Se-Ast Rm cdoirLmeo,rien1 2 Yg Bok Aagogarncre,nevMopnssty essen Bi Vion oro 000116 USFW 0692 ANALYTICAL REPORT RoyPFr.epWaersetdonb,y Ic. WashiaDgriyo,RunWoCordeeCkouSnitey, WV. Auguss, 1957 WESTONEPWAorWkorOkrdAesrsiNgo.ame0n3t347N-o.1622.207031.2273-01 EPA Conract No. 65.C4-0022 Submited to . ME.PASpErRenTgCer PT.laHarombaedsTeno L Kania [Section Lesder (EProogrnam Ma{naagerut alDaieen de 2/zB4ale RAnEalAyCsis by: pM.repBareecd kby RMe.viBeuwrekdeyby: mses. 000117 USFW 0693 : Topic Table of Comenss ICnatsroeduNcatriroantive `Summary of Abbreviations Section 1 Analytical `Analytical Procedure for Procedurefor VOC in Water VOCinSoil ``AAnsaallyytiiccaall PPrroocceedduurree for for BNA BNA in in Water Soil `Analytical `Analytical Procedure Procedure for for Pesticide/PCB Pesticide/PCB in ia Water Soil `RAensaullyttsicoaflthPreocAendaulryesifsofroTrAVLOCMetianlsWaitnerWater Resultsofthe Tentatively Identified Compounds for VOC in Water Resultsofthe Resultsofthe Analysis for VOC in Tenuatively Identified Soil Compounds. for VOC in Soil Resulsofthe Resultsofthe ATneamlaytsiivselfyorIBdeNntAiifined WCaotemrpounds for BNA in Waser Resultsofthe Results ofthe ATennatlaytsiivselfyorIBdeNntAifiiend SCoiolmpounds for BNA in Soil Resuls Results of of the the Analysis Analysis for for PPeessttiicciiddee//PPCCBB in in Water Soil Results of the Analysis for TAL Meals in Water Section 11 QReAs/ulQsCfoofrthVeOICntemal Sundard Areas and Surrogate for VOC in Water Results of the Iniemal Sundard Areas and Surrogate fRoersuVltOsCofinthSeoiMl S/MSD Analysis for VOC in Water Results Resuls of of the the MS/MSD Asalysis Initial Calibrations for VOC for VOC in Sail Results of the Continuing Calibrations for VOC QAIQC Resuls offorthBe NIAntemal Sundar Areas and Surrogate fRoersuBltNsAofinthWeatIenremal Standard Areas and Surrogate fRoersuBltNsAofinthSeoilMS/MSD Analysis for BNA in Water Resuls Results of the ofthe MSTMSD Analysis Initial Calibrations for BNA ia for BNA Soil Results of the Continuing Calibrations for BNA Recoveries Recoveries Recoveries Recoveries `PageNumber Page | PPaaggee 25 Table 11 Table 12 Table 1.3 Table 14 Table 1S Table 1.6 Table 17 Table 18 TTaabbllee 11..910 Table 111 Page 6 PPaaggee 180 Page 12 Page 14 Page 16 PPaaggee 1189 Page 23 Page 37 Page 45 Page 77 Page 80 Page 90 Page 9 PPaaggeel12202 Page12] Table 21 Table 22 Table 23 Table 24 TTaabbllee 2256 Table 27 Table 2.8 Table 29 Table 2.10 Table 211 Table 2.12 Pagel30 Pagel3l Pagel2 Pagel3 Pagel36 PPaaggeelld3] Page1d7 Pagelds Pageld9 Pagelsl Pagels2 Pagels3 Pagelse 000118 USFW 0694 Tableof Coments (Cont) Topic RQeAsu/lQtsCoffotrhPeesStuirrcoigdaet/ePCRBecoveries Resulsof the Surrogate Recoveries ffoorr PPeessttiicciiddee//PPCCBBiinn WSoaitler RReessuulltss ooff tthhee MMSS//MMSSDD AAnxaallyyssiis ffoorr PPeessttiicciiddee//PPCCBB iinn WSoaitler RQeAsu/lQtsCoffotrhTeAQLCMeSttaalnsdard Analysis for TAL Mealsin Water RReessuullttssoofftthhee BMlSa/nkMSSDpikAenaAlayasliyssifsorfTorATLAMLeuMletsailns WiantWearter Section II Chains of Custody Appendix A Appendix B Appendix C Appendix D Appendix E Appendix F Appendix G Data for VOCAnalysis Water Data Data for for VOC BNA Analysis-Soil Analysis-Water Data Daa for for BNAAnalysis:Water & Soil Pesticide/PCB Analysis-Water Data Daia for for Pesticide/PCB Asalysis-Soil TAL Metals Analysis-Water Appendices will be furnished on request TTaabbllee 22.0143 TTaabbllee 22.1156 Table 2.17 TTaabbllee 22.1198 `PageNumber Page 159 PPaaggee 116610 PPaaggee 116623 Page Page 164 165 PPaaggee 116667 Page 169 Page G252001 Page G253001 Page G2T2001 Page G300001 Page G280001 Page G299001 Page G275001 sotan eon 000119 USFW 0695 ASIEECAe meWto apWWAA N27e3rd7CproidWdmmmiiriocnsarrm.ittfeonrmcligssw,teiTpetsss sleds1fd .m0DruyGaCGn. oe i oe eat iri st. is et 08 0K [owte | sZu[romle l Tomine Tzoe =] [ = e] |=! FoSe| oTom[ramo]r| rrr | wae ConnTo onom[ar| I EE Lom75] [ome |r_s|eoom | am on a Tres I oy a I =~]-- [oma| 2 | EErN. F |" = t 1 VOA, BNA, PesUPCB I|J | = oem onus rasmus 000120 a5001 USFW 0696 me recmt Corien | Num[bmeer | Sam[polmieng|| Date [o Ceumstoody| 2SamplT eTs aooms Tomoerr ET or | 1e| ent| een Acalysis Laboraory | m= ere f TAL For7,00, |oaeo trsssps|| EFoEn.+e Tor[sir [ao ree|mn] || FPoowe mee Troewe]] FFoorss =] IE Fone on |Coosss |5+]| 1 TAL, TOC,Grain Size exe nase 000121 B 000!02 USFW 0697 CASE NARRATIVE. (Com) Daa Pacage 30-B0NA Analy-sWiasr &Sal war The war oexlacon the a2,rodeadb:i, Al ind sie CSTR 4 FS 8 foeers168 i ba ed gs vrs Sample 216A MS bad one acid and/or one base-peutral SurTOgale dng recovery exceeding the QC. limits; OC ls 0 camps the data are not cone po so 1 the continuing caibraton from 6/2419, tbe percent diffrenceforbenbzh Doperlylegne (27%) and ietlyphisalae data are not aff d (26%), Ieon oC m caio n fm G25, exceeded acceptable QC limits. "This niceommppooeunnndewtiasmlppoetid;etoercto edGintrrhe a0sy socaiacteddO.s2a9m)pl,ess; tehe d xaple QC SoaelFS1118eS112 2 SsTrE ves Fone ad aienslecso,mitdr1edwoiclsmipdedl ss0 Sreled5 ps Da Pakage G280 - Pesie/PCB Andy - Water I IPinptOhmeDEendpoGfErsRe)q.uGend4ce7l)ncalSib4raC%ti)ocnCC cih8enck e 0afrs8oTm)6/w2C2D4a0B/o9D7a,,tovheeha.pree,rcceernt32osd00i3fhf,%ee)red1nccaeG01f9eoa2r)r0s,BogHOtwCTrsaa(e03a1s5c%)%,6QgeC-%iB)bHssCse2e.9%rS)o.seb-0B3 HC)var e Tta m sts hSshorgMSnD.+hcayweinonac6d GC ls BLOG, DFG68 0. 05 DIasecPsakaogofe Ge2e 99-sPecslieiadnenCBch-icSkilfSomT6Da2a ,oen,pamrrginofns1c1 C0Of1o)%r..HfDCOlTrG0I5s)%,)0$c0%Hi)C,scsQoOen,nB0A|2CG57,5 PBnronDtliEneSGrEE,G0d48e)0.nGE4C)2C2e1C1s5)vDe2e iat,e20GBoe xarmpo seamebsl.e QC ls Sei vi EIecaamosat esnseScvaneisn.L hacnd tfeot mdGa aTe o.tsfpeareeed GGiGfrtes.frSpoe"BhDsDwiG3170)0. 0O1oTf2s029%s, br 0000 3 USFW 0698 CASE NARRATIVE. (Con cs1taeptnhayebdleened(oQ3f3C%s)e,fcsmeentnd.coneiSlcifanalcniebtruhatilisonewacs(ha4e3nc%k)e,fnrdmoomefo7srey0gc1uleo7srh,ec(l7pei%rr)ci,eintocndocidhffeaecrkek,necmeeenefoSra(mB5p7lH%e)s,Cwaer(d3e3D%q)C,uBDiD(dT5,4(%1)81%e)dx,ceeneddrdiaa ae on ated S088, S098. $10B. S11B. SOGB. SO7B. SO4B. 055. S00E. 301E. 302E. a8 30I 3EMS: the dtp s ar sot s-- eed. Daa Package G279 - TAL Meals - War S"Tihneemtetehomdibnlaunmk? ccoonmteaianaecdioanlumiinousm h(1a3n0 fpge/L)i.neTshehealbumaiknumcomreeesunlrtasiofno.r sample 216B should be considered estimate 00004 000123 USFW 0699 Summary of Abreizions a" Avomic Abrpion BB2BSB 5 TBEBBhrllueoaokmkwanaaSStulphhoyieteskeeePbwerDauauspmclfaitoceuantQdeuaimnitmheiobnlanLkimit c5 a CCCE eonoimparmy aeLeaorystiosrtyiesPsvraolwuassiafvroimn.dlfeomd asdamipeled0sdamwplse ot called - cECoOcNeF SOF CCCCohoomaneinaoenomfaiCRRoeoanqnrudieyesd QDuoattsioanionLimiLtit . DB2EFLpTcPP ; `oDEBDeieecamtasafeeloerunod,roLtLmriiinopnhsIewmnyolpwbthpoasopnmhlietzheneeohciogdsheceesestnimloaiinnoenrlinsiansnddris 1cdiimeasted ius Coupled Acton Pasa cB5a1LrD MMDrL oMNrisecethinmomoesdn,DuSauaneDdetaeiriocdnoonrLimLLiimtit . IMMsSD Mw MNVNaaomareliSISnppreetWreeiDagucpheicne Soe Nou Appice or Not Avaiibi - NNNeae Ns NNooortt cRSpaeiukgesseedd . o5FRyDec PRs pFBFooearcrraemmnpaerDRiQeifculeoahrvmoeeinnnsceibyonvolLuimmeit aPRrreooa XD GFRRaueeralisnumdvpsaeeiopSbniacllnimLaoniaitDniDfafe1erveancne Sive T BScorineocsameTneoonn dMoedeed fer x: & Eifrogagneaamn amxn aTcioelererr mP5he lTFieagrnnraaonn 5 Pog . PR pens pie -- pric we gs fos co Revision 102196 000124 00003 USFW 0700 Section 1 000125 USFW 0701 ' - : : Asalytial ProcedureforVOC in Water weArmeopduirfigeedd.52t4r.a2ppmeedt,haonddwdaessoursbeedd1f0or 3thGeCa/nMalSyssiyssoifemV.olPairiiloer1Or0gpanuic rCogmtphieousnnadmgspl,einswwaetrere.spSamiplkweisethda tdhircehelocrooemipboanneendt, saunrdfoagattheremeixctoumrpeonceonnstistiinntgernoafltosulnudeanred, m,4i-xbrroemocfoinusoisrtoibnegnzoefnberomnodchl1o,r2-omethane, 1.4-difluorobenzene, and chlorobenzene-d, . The following conditions and parameters were utilized: `(TDhyenaptuercghe)anadndtraaptruanpitcocnosnissitsitngedofof3: VAOTCeAkRmBar4c0on0c0e(nSturpaetlocro()3,0w0h0iscehriietsse)lefcqounitpapiendedwoitfhfaounrauatdossoarmbpenlter bCeadrsb:orCeanr-b1o0p0a0ck(6B0/(8g0rampehsibt)i,zedandcaCrabrobno6x0e/a8-01m0e0]sh)(,60/C8a0rbmoepsha)c.k C (graphitized carbon 60/80 mesh), Toepape ad ap inrumens contitons wee: PuDrrygePurge DeDsesoorrbb Prebeat BaPukrege Flow Rate 210mimnina at 2255CC "2m0inCw 230C 480mminUiami2n50C A Hewlen Packard 5970 GC/MSD equipped with an RTE-A data system was used to analyze the data. The nsrumens conditions were: [re Temperature. GFlCo/wMRSateInterface 3(R0emsteetkerCoxr0p..)53cmolmumInD',wRiTtxh-3V.o0luamiletshickness. 56miCnimaitn1010C140C 01.21mCirnniant 114001C60C HSe'lmiinumatat16100mCl/min bGelalsisunjetmaskeep-aruaptgoraswiath23500mCl./min GOMS Interface: Glass jet separator with 30 mL make-up gas a1 250C. Mass Spectrometer eElleeccttrroonn vIomltpsa,ctscaInonniinzagtifornoma325-n3o0m0ianmalu elatecotnroensceanne/rsgeyc.of 70 Cploomtptuitnegr:abunPdraencpersogrvsamtmiemde otfo spclaont nEuxmtbraecrt.ed AlonlibCruarrryesnetarPcrhof(ilNeBS(-EWIiClPe)y:)cfaoprabtleemaotfivienltyegirdaetnitnigfiioednsand compounds was performed on samples. TaannhaaellyysGziiCsn/geMa2cSh5d0sayyusg.t/etLmhewsuasnsydscataerlmdibwrmaaitsxetdtuuruneseidinngwwi6hthiVc5Oh0CtnhgestrBaeFnsdBap.rodnassnedsap5wa,es2rsee0d,ev5aa0cl,uoan1tt0ei0d,nu1ib5ny0g,ccoaamnldpiab2rrai0ts0ioongn/tLcoh.etchkeBewafhvoeerrneage fesponse of the calibration curve, tabs 006006 000126 USFW 0702 TTeoe res aroifnthTeblaenal1yi.s1wersemaciavlceullyateddeiusfiioegdthceofmoploluownidnsge(qTuIaCi)onr:e isedin Table 12. The Axl Cm ARE GREYS where CR,i fr C== aACssoensacoeonffattspieeocniufrigocefriuverargnmeaatllsysauynicear(dg2/pL)) Awaoftespecificinermal sundard RXE= R$FF.. == 2 RVaevoeslrpuaomgneesoeRfeFssapacomtnposrlee Fpaucrtgoerd (mL), taking into account diluons , hTe Eaverage ReosrposnseedFawcthoernisussaemdplweheisnsaocsiaatmepdiwsituhs3 ccodniwauiihg 1calliibdaiaoncaClubrrvae:ion curv. The Response Faccaleion Choentirneusipnognscealifbarcattioon(RcFh)efcok2rexcfohlloswpse:cific aye s quasi busedon he ar response fo oe . R= RAxAlT where, RF. = : RAF fe 2=2 RAMemasapsonoosffetthhfeeaacsnopaerlcyiftfoierciamnsetpheaecilsfincsdaaannradldayrtde T X= Z AMraesasoofftthhee sapnecailfiyc iinntetrhnealsusnadnadradrd RE...+RE ane n= number of Samples Revision of 1/27/97 . . [E-- 00007 000127 USFW 0703 Amyica Proce for VOC in Soil BLpAiemon?oepsdC,eiofsmaippB5oo2o,n4es12m5net8tehemonrdiwnoHaaasniwcasrodsussGafiErnNrEtoeSfsoopmrvmasea.ofPVoforbrioemopOemrbpgbesenoCso.moponunsd4sBB Jni tseoole ,,rSaSmamipn plileedss 3wwbt eerree ovens To tong coins ot ppb roooromel Cby`TmhdoescpCcuaraegr)e1b0oa02nn0deG3zOupSsSupniaetonpcsoeinssiiesn4tg0eddtoCfoofon3:,mVAo0OeCT8eAk0RtmomDmoarr4yc0G,onr0cC eenstpraetloa ro(.30w0p 0sehriese i el)fnescqcouaink ptph o,esdwdiootfhhffaoiounroasutroosarmpaler Tepes ws uy eee se we puss Bon Frese ErJoSmatw s257 eR BodomF Rae PDPohute noc A Henle Picard $970 GCIMSD. quipped wih 1a RTE-A di sy was wed to sme he das I Column Tempers f3R0oamktnrC2o0m.59e0ma1D, wRiTtx-3Veolmilks es, CToiCiemC eure 607 CFoEuMRaefuerte SiFheroamat e0dwin Syms Rao wit ond Gams ners Gls ot separator wih 0m. keup ga 1 250. ss Spenser cElacncoronnvoImtp.acct Inoinzaioonmat335Snomoinaml claeo2co)sy of 70 DColmopiuntgearbunPdarnpcra egsravmemsmsa otroSplns mEumxperc AloHnoCvuernenet eProf(ile (NECPB) cae pable o of neggrraangfeons snd imTheinGsEMeS x3Sh50sSy oa mevnaDsicEsalwlmiedenwinnhg 6hV3O0.C1besaBanDpdaron35S.200.e500v,e,1n0t,s115,00,,b42nr0d2a2000n0pree.rk.Befwfoohrreeen scam 00008 000128 USFW 0704 TThhee mmedieumnevesoil eoxsitnsesweareseaisaaelnydaiebdnybTyaoleeepxua1rc.g4i.eogToh5de.m0c8opnseocmiomewainitdohn.s$.TmohlfemSottomanulyTileFsdiilnwuetrTineagbclaae0lea1ul.li3aiqiteuhdoet a using the foellowting eqpuation: c= DF xAx1 FARE REA W.xD where , = Concenmuion of urge smalyc (uglke) on a dry weight buss DAeE 0 === DAmiralesuastooioffntshpFeeaccittfoairrcgeet ramnaallysundard (ap) = Areaoftespecificinternal standard RRFE,. W,TM == aRveesrpaogneseReFsapcotnosre Factor = Weightofsample he p' average = Decimal percent solids ResspossuesdFawcthoerai3 ussaemdplweihesnsasoscaimapileed wiistshsc3incioendiuwiiatgh caanliibrdatlioncarlbvion curve Te TE or Response Facer caer oe response fctor (RF)fo cach specific aml is Guaniied. based onhe are response fo we continuing calibration check as follows: RF = AAAxTl - where, RAF. == RAersepaonosfethfeacatnoralfyorina sipeecisfiucndaanraldyte : 1X 5 =Z2 MAarseasoofftthhee Mass of the ssppeecciiffiicc analye iinoteerrmnaall ssitaannddaarrdd in the sundard RF.= RE. +RE nt n= number of Samples Revision of 1127197 motusnmronan 00009 000129 USFW 0705 Analytical Procedure for BNA in Water Exvasion Procedure sPircoirooorrbii0npgbeexooryalcM,teittohne,opdeba6ec3ha5,4ysaSepmcpkbloenew1aa0so.slp5ik2oeu.dlolwrnioetphdih3ensstiohx,omFapenoddne2re.l4s6s-RmesiubgrrrioosgmaotVpeohlemni4xot9lu.re2O0cn9o,ensFiirsetairyngo,foOfScEntmi.prIo2Eb6e,wn1a9zs8e6n.eex-rdAaeier2d {bC0oensiesFtoilnxlgoowfiwtneg1rh&eric-sodamprbieipaccacrhdsilo0no.drc(oonbScseepenrbtzsaeednnwee1e-0r41dS.a0yEmen.eTtdhPeHyOwEerRe4EsppePdOewBiEhBr2Eacm.iderpooaC!orsfusncbaaeradds 2mnisdtaperyene- Asalyical Procedure CAonnirHoPlle$d99b5yCaGnaHsP-Ch1r0o0m0atRoTpEr-aGph//VMMasscom_pSupteecriowmaescerae(dGC10/MaSm)a,lyaeequhieppseduwmitph a 7673A stosamplr 30d The insrumest conditions were . Cotumn R3f0ie'msmedttiecrRiaix esxs (co0 ss1bDo.nd0e2 .d50SpE-m56) SnTorjiaearcseiieeornTeTTmepemimpreparenaurnrauetree 02EEcC T`AenmalpyezreratTeempperroangurraem prCsfor 3min Spiess Injection &holCdifmo a1310m2i9n5 C Spi time = 1.00min jeton Volume ul dCTahh.eeckhGeCw/hsaMynSstaensmlyyswstaeismngrwu3anse3d0cawlgii/tbhmraLt5.e0dasgutsaiGnnedgcaaduBoDrNioAsuptsbrteanniydnaiWrpdhhsiocsahph32i0n,ee50s(.p8Do0Fn,Ts1Ps2F0)w,eaarnneddCp1h6a0asplega/3mLSb.yonSBnheifnoargepacneaailuysmitsoensch Serge response of ie calbranon Curve ' c"TohneceBntNrAatiroensulotfstahreedeltseecdtedincToambpleou1n.d5s twhaesTcelnuuliaveedl sIdienngtiftiheed fCoohmopuoinugndesquaatrieonlisted io Table 1.6. The Eronanorame 00010 000130 USFW 0706 c +" o FRDFEsAED ILY,Y, where CD,E == R= DCAirolcmawoieofmnuiFraogcnteoorafmuarlgveer asalyc (g/L) ofspeciferimcal santard e8) fVr, A. 2= = AMVmoilasuomfeospfeecxifmisceitne(rumla)l sundard RR1mEF. == 2 RaVveoeslrpuaomgneeseRoefFsaepcxottnorsarect(uFimancijeiecostrse)d (w1) V. Toe REis ,ed when = Volume of sumple (ml) sampleis soci withan nilcalbration curve, The KEisused when asample is recited wiaconttinuhing calibration curve Response Factor ae RF foach calculation spi ans is quand basedonth ares sponse from ie coping catbraten check 12 follows: Axl, = pee dyeale where RNEe fhe =2 2 RVAeirsseepssooonffsetthefeacastponercfaiofliric3ynsipntteheecerinafsliucnsdtaaannrdadalryd X fir =2 MAraeasoofftthhee sapelcifyiciinmtehrenalsnsduandradrd rr, HREoER,h Rev. 719% and = number of Samples smotanmestmat 00011 000131 USFW 0707 Anaya Procetur or BNA ia Soi Exvacion Procedure SF Prsonoa.ysoaposeaoydaploeT o,l1095 3Sooreepbeeraacs:ed2fo3r.1466booursowmoiplhe3o0o0l.a.T-- hoi1fny1gsratmos nofm-- epilyleecweas sired oE rimgE eowfn1thsopierptaroeaiobnw.ithesa"mnsespaaNarsBeEedwDeE-1e0dS13OJhkEssTibPyRGweeGre ohfPehscAoMsBhTEaR3EBreg lCHYpSaEmRbuEte1B0t8rpnryineAaiyss Procedure CAonntHoPne5d99v5yC2G0aHsP-C1hr0o0m0aRtoIgEraGpNhV/MMasscoSmppecetrowmaeste5r6(dGCto/MaS)o, eequoieppseadmpwlieth. a 7673A autosampler and Th instrament condivions wee . Column TSRehmseitetkrRs2u05(cros5sTboDn.dm0e.d5.0mSwE:a56) TSInojiaemcnetsitonTTTeeemamppeeprraaeuurree 2oSo0crc fAnoyamTemipedrs p80rCrtmfor13 mi2n05C Rod or 13 a - Splitless Injection Split time = 1.00min Injection Volume pL Ta rhevGsEeMSxasyystwehhmeewnayspecasnlfwgrised1n3ew0idnggie$rsmB5N0SAessatdpoedcauBduonmrviosemtpuwnresyalnp2h0e,Bi5ep0h,Po8e0e,|(1p2O0aF,TnEwdPe)r1kp6e0aspeeg/eL.conBBtyeocftoiornmegpton he erage sponse of he eairaion cave Thhse BNA ress. based on try weigh, are lied in Table 1.7; natively deified compounds are lsd in Table 00012 000132 USFW 0708 Tne concenuaionofthe deaced compounds was clcuedusinglefollowingequation: " DFzALY, * ZoaRF( orXR VWFD where Cc, BF == CDoinlcuednownaiFiacotnorof urges analyte (g/ke) fAr. V, =2 = VMAaorslasuomofefuosrpfgeeceisxfaiaccntiamel(rnyaLa)l sundard (og) RA,E RF,. == = RAersepaoonfssepecFiacftiocrim(uenitlesss)tandard average Response Factor V.TM WD = = VWeoilguhmte ooffseaxmpalcet injected (uL) = Decimal per cent solids oEee RFa Saimsplueseids awshseocnia3tseadmpwilteh aiscaosntoisnauiendg wcailihbraationi.nl calibration curve. The REisused Response Factor The RF calculation: for each specific analyte is quaniated based 00 the area response from the coninuiog. - calibration check as follows: RFAaSxll,, =: - where RAF == Tr 2 RAMeraseepasonoosffetthhefeacastnpoaerlcfyiotfierc iaisnmpteehcmeiaflsiucnsdtaaannardldayrtde 1X. == MAraesssoofftthhee sapneacliyftiec iinmetrhmealsusntdaanrddard rr, H-.t .+RF, and n= number of Samples Revision of 7/08/9 00013 000133 USFW 0709 Analytical Procedure for Pesticide/PCB. in Water Extraction Procedure Oannde wlaitseerxotfrascatmepdlethwreaestismpieksewdiwtiht6h02msuLrrpoograttieonssolouftimoenthcoynlseinsetincghloorfidtee.wraTchhleorcoo-mm-bxiynleedneeanxd tdewcraecrahelofcirlotbteirpeshde,ayl, concentraied 1010mL,solventexchangedwith60mlhexane, and the hexaneconcentrated 10 1.0mL. Gas Chromatographic Analysis The extract was 58% GC/ECD saynsatleymz,edeqfuoirpppeesdtiwciitdehs 2unsiHnPg s7i6m7u3ltAaanuetooumsatdiucal scamoplluemrn, iannjdectcioonnst.rollTehde waintahlyasnisHwP-aCshedmoSnteatoinona.n HP The following conditions were employed: First Column IDnejteeccttoorr TTeemmppeerraanniirree c'aDpBi-l6l0a8ry,,300.5m0eptemr,0f.i3m2tmhimcfkunsesesd silica 2a0s0cC . Second Column IDnejteeccttoorr TTeemmppeerraraunruere Rcaupxi-lClLaPrye,st0i.c5i0depsn, 3f0ilmmettheirc,k0n.es5s3mmfused silica s200cC Temperanre Program-(both columns) 3700 C*/Cmifonr 11 mi1n5u0teC,0.5min at 150C 8 Timin 10 275C, 10 min at 275 fTrhoemgeaascchhrmioxmtautroegrwaeprhe uwseerde1c0alciablrcautleadteutshiengre$sppeosntsiecidfaectsotrasnd(aRrFd)soaftc2a0c,h50a,na1ly0t0e.,2T0h0e0,dav5er0a0geugR/LF. waTsheusreedsptoonses c1a),lcaulnadteidtehnetitcyooncfetnhtreatainoanlsyteofwtahse cpoenstfiicrimdeedsiunstihneg tshaempRluexs.-CLPQeusatnitcifiidceasticoonluwmans (bsaisgendalo2n).thAe DfBin-g6e0rp8ricnotlguamsn (signal cphanriocmualtaorgrAraomclowra,s orruntouxsaipnhgeneeachwaosf ftoheunsdievnetnhAeroscalmoplre.mixtures and toxaphene; calibration curves were run only ifa 00013 000134 USFW 0710 nepedePCB res, lsdfn Tile1.9,ve clad fom he olovig mL c,- DTDeFsLsaAaY,t,e where SBiFC== CRDoiinecomonrrapFieaoacnkerboefigmtabe (WEL) $ Vi.=T VVoi 2I RVVsuooaellmruumammgeeee voorffoaseupaxo:mampcle(teati()namjlerc)ted (WL) Response Fator for wt calelaion pct sy squid bid on a regefom be coming cabin Tek s foows: Raol t pe eeed where A. wd = Awa or peak height RE oR, Rs = where 1 = number of samples Revision 712397 [E-- 00015 000135 USFW 0711 Assyieat Procedure fo Pesicide/PCB. in Soil Exracion Procedure . TcChoehnassosniielosgafoomfp1lve6rshawouecrrsehweilxittorha3rpci0tsee0dn.mebLystah1de1Sdboeexcshaalpceeh,tomrseoetbchpoobned.c.yTlAhtmeiexhvedaigwrrairmaa3stli0Cqoyusnotbewcyandsars eodstp soodw3ii iuBtmLh.k Sausfuae rero1gd 0a8teSsooluttion Gs Chromatographic Analysis ToTolneoawneixVaagacatconnwdai2st6i0ao0sn.asluyvpaeerpdeefedoarppl`eowsiytheics3idesai1o2dmaPeCBSuumsipng,sac8acpoensoidduawlicto3m2 pVajreictiSoun.CThheesa-nSalaysnis waTsoedove First Column 8Co-p6l0a8y,,300.5m0ewem, f0i 37Bmanfussed silica nDjeecctoorr TTemepmepreartaunrree oree . Second Conn njctor Temperarure CSRiaxp.elCaLPne.st0.5i0 cpidtess, f3i0 medec,a0.53:fused silica Dieetor Tetperanre Te Temperature Program-Goth column) 7300 CCimfoa 10mi1n5u0t%e.0.5min a 130C iin 10 215,10. min m1 275% {rTehoiemugeeaasdcchhtmorioxCmtuaucoruegartaweeprhhesetwCeedroetopccaleafbi.rinedeoftuhseeissrgetspeopmesisneifctaihcdtoSstraaa(pdlRaeF,r)dsQofaueaa2mc0fh,i5a0as,iac1nne0a0wne,sd2tbh0i5e0dda5vb0ea0raopggee/LRD,eRsLpTGohOneRsecreoFsaouvsnor PCSihagInrOaMliOaG1)HEiAIrnoDctl`hoWereseoTFnuoniRUyaspihonfegnhEeehwasonffyiouhnWd36hviEnRc,hoeAuTSmoacempodlre.URsAioNgIb:e 2R0idy-1C0LxPaepshintei:tsaibCroaltuiomn(Cgoemaels2w.ereATSoopeyrri2n mot wemesviL 00016 000136 USFW 0712 The pesicide/PCB. resus, listed in Table1.10,are calenied by wing the following formula: CL _DEsAaY, "RE iVawD where cD,E A. == = CADiowlnuactoeioornmpiFeiaaocktnorhoefiganlalyte (/ke) $RV7E,.2== VAovelruamgee Volume orfesspaomnpslee f(acmtlo)r of exwact injected (51) WD == WDeeicgimhatol fpesracmepnlteso(l)ids Response Factor Ine RF for cach calculation: specific analyte i quantitated based on the ara espouse from the continuing calibraion check as follows: RE 4 ol pg injected . where A. we = Area or peak height RBEE. oF, where n= number of samples Revision 7.23197 mothmESRTIAR 00017 000137 USFW 0713 Analytical Procedure for TAL Meals in Water Sample Preparaion oTveefnl,onwhcioAcnrhaezpwreaerss,epncrtaaoptgpirevadem4wm5eidmthLtoTaeblfriliqonungotlhioenfedesaaccmapph,lesnsadm1p0dlie1g6we0satse+dm/-iaxc4ceoidrwdniintg1h0tm5o.Si0Wn1-me8Ls4c6on,(cfMreesnttthrsaoatdgee3d)0ni31t05rdis1cla3ocCwidlE,yMrpilsaMec.De0Sdi-21n61a50n.01am7ii0cdCrironiwnasveed oTnJySdecyl1e0eomeeidesbo0rs.G10ouducSampsilesagwee)r.eCoAupresgArigoroannl,Fmesraalmep,le(esxCcAwePeprt).mpserlroocwvsuebrdytoyUc.SnEPtoAoSoW-h84e6,mMeethord 70o01eAwLeGrTeiceABStOrTMPIon 7470. TeA s1a0m0pmleLs waleirqeuohteoatfeed.acfhor s2aBmopulreswoansarbaontsfpelraetde 2to9a5 300c-omoLleBdOtoDrbooormeteamnpedrapnruepraer,eda.ndacroerdduicnedg twoitShWH-y8d4r6o,rMyelatmhionde hSypdercoicrholpohroitdoemet(eNrHqOuHiHpCpTe)d.withM3erVacruirayn wVaGsA-t7h6envaapnoarlygzaesdansaelpyazrearteblyySW0-8426,VMaertihaond S7p4e70c.rAA300. Atomic. Abserpion ofsampleAs prreoacgeesnstedb.lanOknaenmd aa bulanskpiskpeik(eMSsa)mapoldewoenreemcaarrriiaedspitkheroduugplhitchaeiesa(mMpSlDe)prseapmapralteiownerperaocleodpurroecefsosreedacfeho aancalhytiacnaallybtaitccahl bac or every 10 samples. Analysis 04 Calcularions manufactTurheer'AsAopearnadtinIgCAiPnstriuncsttirounsm.entsAftweerrecalciablriabtriaotne,d inatnidalocpaelriabtreadtioanccvoerridfiincgatitoon S(WI-CV8)4,6,inMietatlhocadlibTr0a0t0i/on74bTl0a/n6k01(0ICEa)n.d ahneg bQlCanckhe(cCkCBs)andstaarnddsarwdserewerrue trouvneraiffeyrpreovepreyr 1ca0lisbarmaptlieons. toThVeecroyntpirnoupienrg coapleirbartaiotni.ondvuerriinfigcastaimopnl(eCCanVa)lysaisn.d continuing calibration instrumentTsh.e mIetCaAlPcaonncdenMueariciuornys rienssuollsutwioenr.eiaabmeiocrodgirreacmtlsy pferromlitienrs(tgru/mLe)ntwereraed-rouesasd. direTchtely IfrCoAmPthreesruelasd-woeurtessyostreemssiodf tfhoe exdtiegemsatliolnycvoorlruemceted(45formLdigseasmipolne vo+lu5memL(1.i1t1e1%cAidA) rperaido-rou)to. instrument read-out; AA read-out (excluding Mercury) wer For samples tat required diluion to fallwithinthe instrument calibration rage: WEL meal in sample = A [(C+B) / C) Lo whee AA == dciormeectctreedad-roeuatd-o(utICA(PAA)and Mercury) B == ascamdplbelanalkiqmuaots,a.ml.used for diluion, mL Results of the analyses are listed in Table 1.11 00018 000138 USFW 0714 oes woteaen1111 g pa pcf 8hE 5eHh aRtTe 1 0 Bom Bom Bus SOF BSl E Hae aSdE INJECTE D LW193eEe Bm3AW TL osen not 2E1A3RY eewalet S2euev mooh m z2Os2F7 iem wit P sBim Dieiareitressian b8 oRou bLOw bBoy Er e 3 Bw b Y aO em uBob B1O.B0 neler bom EE111 Dichloroethane GE Reetnene. Pt Biromceethane YIIES RhikoroEetnmane. Pombo uv 10 ou gore 10 ou Mow oul 1 uv mov ouy 1 ou yoy on10 if bvoooy b Bob oy oHoy iow ony oreo on if ovb ooBr oY oy MiOowL BweoYwo oreHy} o1Hg wHo R, Pol ow Bion i 00019 USFW 0715 it 1 my Jett ah mt, ev tn BgmHBeEEieUEErMwowaweeeCond SBEmBSoEhTWYwIoERnoh RHBoOBE meBDumINeEE ESBBom5haFoee HBSBomSioem -- Bibel 0ee tem em Ame,TmeWme, m HEEnT Eh aroethene SEEDER ene EE fHDlrranarcnietlhane TIER roetmane PEE Blog og oB odeouooeob ie oy mou dR yore uoodmov 18 ov amu 18 P yP oreR BwooB B d:eou Bdo3 otouoy rdosmyou o1o:B9B vores ow ido 180 dmv 18 ig ee PR BE ou PRE HE ou oproB og oB = ., i 2iuig id i ---- USFW 0716 smee twee1n1nco,com JSetsotfgRa gATtSfr Eu2rse 6 0 BEWBHBErEedbEedlOsEoawEhg"m EE:IRR eae ow mL SE ScaneEE ei HEmree TFPPoHERwlOEoBHu dserm r,d a ane PPFooHRloLoboB vooiowlv 810 S 1hPC1DHiicihTloroe eethne PPPooRnlEoolonoB jFJSPeeiimEmnREeER. PsPFLIRoRH:IElEL oooBBR oH E riEesR JEenen bB$ob 8 PoorloloBoB Ten Polo E HfSHiaEmimee e eHfmihnmer m PEE ECee H wC oe an PP P oR0o R o E8 E B noR o PPooll ool oB Pb atE on cPoliodns wwm er twe 1n.1 oy ggApetSeSof EmrEvia sfo vBiBn ner gSBeEiaer. Goamm BSg UI H2OWm P S w Tp oeFEomTTgeomRYme BT wmotoRm8 mem US ECiEsE. ICarbon . Tetrachloride. TRiheanme PPPaoR ; ld Pu EeLv LPoBE OF oo: nulttooB2n0otonnou owbu owu BoB10 OoRyO BmotioB a Cima Zentororotiene fbo oat03 BOBlO MopOP OoBn Pov 1m ov oreow oe 00022 USFW C718 Table 1.2 Results of TIC for VOC in Water `WA# 2-273 Dry Run Creek Site Sample # tahFile# Lab Blank 6/12/97 A2545 Unit Con. Factor ugll 1 cass Compound ores ro To =e | cone| CT 1 Tr1 J or TT 1 T1711 C or 1 TT T [ 1 4 o Lo T TT rT 1 4 oT GGof71 1d 1 1 Co 1 TT Lo rT Lf L T rTrd LL 1 TT Col TT 1 4 CCooTT TT T 1 R CTT "Laman omen Raps Fer 10 asosiunensoRwOCHT 000223 000143 USFW 0719 Table 1.2 (Cont) Results of TIC for VOC in Water `WA# 2-273 Dry Run Creek Site _ Sample# 208 LabFile# A2546 Unit Con. Factor nell 1 Lf lomwrowe TT 1 (L[ L TT 1 Lo[111 [4 11TJ LfTT LfTTT Tj (4 1 TT of 11T Le11 EE A SE TT1 lofTT TT | =[1[Td [ofTTT [of TT11 [[oofl[TT 11 T 1 : [olT7777. Lf TT 71 i} AsmComomproFnr 161 : arsoeLansTosoRwoOHT 00024 000144 USFW 0720 Table 1.2 (Cont) ResultsofTIC for VOC in`. Water 'WA# 2-273 Dry Run Creek Site Sample #207 LabFile# A2547 Unit Con. Factor uel 1 Fr ee Creer Pr er Ld rrCd rT 1 rT eer Cr1d rT1 4 fr or CT J rT1d H r r r rrL Ud d Per PT Td rrr or Pr rrr rr PT Pr er rT rT rT TT TT tntCorin (pos ir 19 Co armossaaTCRroT 00025 000145 A ~ . : . Table 1.2 (Cont) Results of TIC for VOC in Water `WA# 2-273 Dry Run Creek Site Sample # LabFile# 200 A2548 Unit pg Con. Factor [ lomwrow1 |Td 1 TTTd 1 TT 4 C11 TT 4 CT 1 T C1 11 1 1 TT 11 1 T or 11 T 1 TT LT TT Co 1TT oT TT LTT 1 LT TT CT 1 1 4d Ll T1 1 4 Lf 1Td Co TT 1 Gl TT1 4 mae Coren (Repos Fe +10 amozrsTsoRIoGT 00026 000146 USFW 0722 Table 1.2 (Cont) ResultsofTIC for VOC in Water 'WA# 2-273 Dry Run Creek Site Sample# LabFile# 201 A2549 Unit nel Con. Factor 1 [Tom] comms TT Jomserme lolw[om] || o o r r r d T } ar rTrT1 Td rr rd or rrr TT ord Ca 111 TTT . r ca r r r r 1d d rrr : c DT r r T T MC arT T TT T ol 1771 madConsnmon Repo Fer= 10) ZmosLuRGTOSORVOCHT 00027 000147 USFW 0723 _ _ i Table 1.2 (Cont) Results ofTIC for VOC in Water 'WA# 2-273 Dry Run Creek Site Sample# LabFile# 202 A2550 Unit Con. Factor nell 1 [homme TT LT 11 [Lo | TT1 LTT 1 TT 1 LT TTT eT [TTT TTT LolTTT [ofTTT [ofTTT [ofTTT Le[TT 1 [of[TTT LoT l TT [of[TTT (o[ l 11 [ol[TTT olTT 1 1 nese Fa arson erTmERTT woooss 000148 USFW 0724 Table 1.2W(AC#ont2)-R2e7s3uDltrsyoRfuTnICCrfeoerkVSOitCe in Water Sample # LabFile# 205 A2553 Unit well Con. Factor 1 - (Toe mess Tole[om] - TT1 TSe eeee TTL Crd er Er 11 11 er or rT TT e E r r rrTd Pr PTT Pr Pr Pr Pe Pr 1 1 Td rr 1 1d Eom Coenen (Repos Fa +10) ZTIDELARSTOSORIOSWT 00031 000149 USFW 0725 Table 1. 2 (Cont) Results ofTIC for VOC in Water `WA# 2-273 Dry Run Creek Site. Sample # LabFile# 206 A2554 Unit Con. Factor ugll 1 [ pomssree | [1 Lr 1 4 Lr TT 4d Cr TT LTT [ CTT T LTT 1 oT TT TTT Co TT 1 TT T Co 1 1 14 Co 1 14 - CT 1[1 4 Ce [TT 4 : Ce 7 1T Col TT Ce TT TT CT ol T TT Gl1[TT met Comten (epee Fsr +10 arsoswreTosoR oT 00032 " 000150 USFW 0726 Table 1.2 (Cont) ResultsofTIC for VOC in Water `WA# 2-273 Dry Run Creek Site Sample # LabFile# Lab Blank 6/13/97 A2561 Unit Con. Factor pel 1 [Tom comms Er Tome [l1 owL lcd m] err r TT rd d o cr r rT[ 14 d o r r rr r rr o er r Cr TTd d o o r r rT rT r r er T CTL r rd r rd rT eerT rr Td orTd Sram Cosmon (RepeFr +1) sosReTsORWOGHT a3 Gi 000151 USFW 0727 Table 1.2 (Cont) ResultsofTIC for VOC in Water 'WA# 2-273 Dry Run Creek Site Sample# 250 - LabFile# A2562 Unit Con. Factor ng 1 Cl homme | TT 1 TT 1 oT 1 CT 1 or TT C1 TT Lo rT or " 1 T4 or 1 1 oT 1 . LT 1 Co TT Co 1 17 T Lf TT4 Ll 1 TTTT 4d LT TT Ll1 TT 1 Lf 1 or 11 1 G1 TTT "Eames Corson (Raper Fr 10) ZmoRRETORVOCWT 00023 000152 USFW 0728 Semple# LabFile# Table 1.2 (Cont) Results ofTIC for VOC in Water `WA# 2-273 Dry Run Creek Site. 216D A2563 Unit Con. Factor nell 1 CF fommmwe TTTf o or r r r 1 T C 11 1 TT J rrr 1 o T Tr J rrr 1 4 - L 1 r"rrT r 4 J p Col1 1T 4 LL o 1 r 1 T TTT : C Lo T 1 T TTT . ' o o T T T T T 1 o ol1 T T1T T1T T "EsetConcrinien (Rporse Far = 10) . ZmosuRSTEBORNOCWT 00025 000153 USFW 0729 Table 1.2 (Cont) Results ofTIC for VOC in Water `WA# 2-273 Dry Run Creek Site Sample# LabFile# 253 A2564 Unit Con. Factor pL 1 [Tease[ compows To [mr omen LLola 1 11 LT TT rr TT Lo TTT of TT1 LT 1 or TTT LT TTT I [of 1TT ofTTT LT TT ol 1 TT LT TT (olTT LT 1[7 LT TT 1 1 TT17 amis ' ZTIOELARSTOBDRYVOCWT -- 00026 000154 USFW 0730 Late 13 S esssesE ffhshee onE ayss ,ar VE In S050 SoSMGHLeuEEe#,D:| Sao BLK ww 53BB0r0EoEm gB5E1irb,Ser g5G?ante wim 3EB1R0n: d sme cova HPPaadElE Rm weR ewM10G0 re eee EwRShR em ww7kw sWnnE mm SHSiechiioredifiueramethane min P CT TREeTLYTTYTHTBeTYYTe Bog ood T BRMooY Vbronw Boomy ot poOyHH oH rr ete Ln s oHooob Roy Bop OHR bboaOW ooyu i ooaud Wor Kee tbyieT ne ehioride gvo oorou Maoovd omoy Rob FHSHEeiIrRRreorromoeteenene. gbv PoooodEboorobo mooemorywoe modoopoywnmoHoboobw oionn JARRE Fie. u Tey PRL woe 3 oro oe 1 HECa gfooogmoyobo deo omdoyy nmooub ne FTE sri go oy pow mow Hob bE u ie fiie A `olbromochioramethane u 10 u bsooddyod 10 u onooy 13 u oMnoov mRoobb RBinylbRenienEe. ee 0Eo3s Poy BYoy BoEy Etooy [BEBhiEe A 513 EPoEde 5od B3oar Eob B 3omboo w EHuooby 0a REEAS ene BE AL n gSo od bdb onoerowwoo moo r eidy at gPoodE ob woeye oomnooe HoomEy aou Run. warez Moy own i 1 Ewwereyys;; te oo 1w3ewsnew oBgBpaSmpeA,tET E2BootSmepemrnfor.iBebcet BEE BIE SBIBRyWa Wtg mhiieEbW . oBW5hhd WWhAOEWS5h emLhk Pcm aov E bBt oRY,HREloBRoYmeBH Aratumethare pov as oy dou ze woo2 {HE tram 115 ch raethent 173Dichloroethane 0 EteRor ethene PoE Po ob v ev Pom ob nov sv nov BE 3 ov 3 mov Bo 3 o toB113g a3 Em bomb oy Bb ou oR Ewsaa---- 1.2.3 Trichioropenzens Egy omy Bb oH ou u 20 eu 13 vu 13 b ER 000156 2 ooozs USFW 0732 Table 1.3 (en(CanM ey A1a%sE oSsfBAttnhesTtT eslsAhraiety forV0CSoit mpegs wens mu, BL BH BS MweeLshsieTlolmgad, o" EN#4EiA8RE I B8B+3ART in sts sats sBW>yNEE rhisr 2 EAfnes s0he BE cCohivaraa mLirene afakc. T ou caE . ol cY ae. hLGE C dWi LowCHs C oOeL HrBiberraaati,ree .cnn gv ggbo oo ooxeo err dyoo8 yoEoWi leooboybob goods oy Bob EERfBooOobubPb Bap ommmwooobbbooobb booossa0Ia8t JAESAoRaTltEITeTtTocrhoTisetethyeenee efgggooooo1grhoyd0obv t1oWE3oryoobb WHRRToobEyb mFmooobbr 1ow aaReEg oan AFiSnei:1l:a5r1e0c1thnlionreaethen ie cerca gyoommowob v FIoREoroJyT moovw % SoTb HowoobuwooiE S mHoTs am2o ou oSyT a +i a HFTEE SEerR eTEeREoCroprop.ene gGsooorrde3ey8oodyo 0lmoobb dHHi ooodyb mmo: ooobbroo okw SCiarrebnon, Tetrachloride SSJibeerre pur rane Gu op1 ooru g g go o oo r s 13 ob Wooombyy Hwooyu HoHonoyob m5 obu os1.0 ommoyvob i3 - p1Sih.a1in2as:iTBrebicdeehhilrrocartonCeothranee e ovpvgoyoooew oomou rry gory oo1mmw3oboooorbyy HE w HHooob u ybb Rb o1Mom5mmooopuvoub mob oa1as0 I . p sFFflheeEtrCeener - fre ggggooooogreerrbyyooov yeooommboooobbdbowhomfooobbbooby d33obuoobw ou a8 8 ey olor Hoy mov f fhalIlsmenoroestane TE g gGGoooorreerry Poo ooooldooyyry HHHHooooybyb oopmpoovooyy ieosw iLfe mET Sne oT raetnane LFhoeis b oSGoryo ooeeo rrb ooooer gory oo ooodbyryob dob HnoHoooyvyyoy oy mwoooorouworoouy oai a pE C F F ri A EE RE TE enS sernee S SSg Goooro orerer ooyor oMoodyyov ody MHHHoooobydy oY dmoooybuoy or aoeR ry dob oy oor S HfP ERyhh eRmeeE , Cne GgLoSoroore%egoov orr 3odo oyoby Sore doy mHHHEooooydbb oY uomobbuoy Eo a1oowm8 a LEa et ene Pyoelu o43 boy muooboY 48 v8 wore smstamemoraon 00 te 1.5 cnRsRpoAfpAdrTi fr1 0 50 wwBemss; wena igBoan geBBaare oEBm.aec B2 umae gmHElSeeEE0 ewTe [WIACEE BESERESTE A EBEETEROBBSLiY m WLA W>h BEAymR wih cone on wu oem toe EE aon PBL Ha HJ HSB 1S.h1iDni:c1h1l2o7r0oehtlhaonrecethene SE ETAT eatnene Fide Tia-ichisrcernane vvgoomebuov Ego REov toi ov omw dou b EEooyw obaotov BMoYU mow oud i3owuv a1n2 oBmoov Bid i3ou oad bri $n11.3101 cEorapene rAd hE Bronoforn. bPvooopmmoolovroo odw yi 1 poR b y doHogyotodn PoRob El El ody u 10 ou 1 uv 2 13 vu 12 FE, Ee. sR BE Ey BY on Poy RY HEB i BEsfoetlUieoisrD;| PHSWiaEElhSEeLl| SL SiTccrohbeirvtoeaarnaidoLruiocreemeihane plLAOfaeserte inttioerteoertonmeentehane HSSa ehalneeSlaoeR rriBeryer TT tEroctnane i SaniAE teerRsporrcpanheere $LF i1T3slBEiiE ch,toBrrC aoaptrmoapneenaee Shrine Er ane $ST bhiinn]meBthIon SnNesrISnrunesnee spJriilaelauatreisreeta fEEEaLiEeEi)trenaeepiennecannane fdiPtrsElsTtinEietne en iororinane BSraten EHRiaE tare niE pesnkseneeorosetnane ESErgenipETrcEaenmierernas:enone LT EE ET REene iFE FitUnehsEnteRaa.s T78E0ToCrame:n 3-chtn orosropane rR E ucsge iene wares Table 1.3 (CongE) Ro pesraneofpBtahne istnhadteyanissefor Vc in ll soma ue B3GmBhRaBenes sBSMimAomMwSe sMnWoamihwea i sSWMmAeBTrE Hs hh ak saSliti?ts s s8ati?%s saEti?ys sfalii}toe fouc. ou coc. $ Su1eeeyov WL ewe. OL Mobei CoC ToYy bob ov WL CH IO my oa3oyuouiaooddn gSy vGoooorroskee ysr8yommo3mEooyabbb ifoIpyytay iyor o0iH3ohyayloy aoo1nn3 ad Ggggoooonrnneeee oooodrwv gore dmmmoooobbvb yoiiEobopoy god3i3oobwoovb a0 oa yg oo o2 bobb noidoow m12oboowy foHnmoyoyy a o gbyooorrkemobooyy yor mommon oooorbvb oy roooddooooLyrrr Mov o1idi3o ooobw ogo aaaoobHdEu goPbo rooemoobov oor mmopoorbboy mob oioodvwoob oy 1dgo3oobvoy doy 3i2 Pgogooonrrreeeosooyv goo oommmooodbby ib 1iooooysb Moovy oigdooorbob movob aid oH oPgggooooknrsreeeeeyrdov Gorey Bfkmooobbyb oMobb ofioroooyby oy ooomdobyboboi mob ad oogrorenoes moboodd ymboooywy momoooybooa Pgo Ggoooornrreoeoyror dooolooobdrr ob MonBooooddyu ou ow WWmmooooryuv ob ooiinH id vgggoooornoreeeyor gore or Efldoooddbb dob Mhdoooyyyoy iowou ammmoobuooyv imm obob iiaadx iad $gg goo1rroee8o8ooyw o Go rb b diloobbbod iom boy bhooyyoobb oy iomoHiombouu ob o0aiuE i vgoorie ov Good1e8 lnoobv 1oor oruowov o13i ob om1o3ouw Hooyyo a ou gpmisis awto1w3sCRimgSHBgMpEaaeeteesoEmRhAeBRBeA uowtr OoBvHmten siwHBoews BfSHHeEEEiEPEERLgwB uEwRNSAPB"EEYF gBa0uFm BR aSg BUR Fw k EBghW Ei cEe g iPoELopr emBEemBEemt, emt, BUY OH Eade... 1.r1-Dnichsloroetohanre em fE JlaE tarPeene. i, Sibrommetiane: IEEE. PBL vvolo e uob HE HY mLeouboTo e vow 3H 3dobow IIe vP PoorH od owoHHowoF R B1 EooH i3dovEoaH Pgomoe lvooH b domoy i oydond FP BL HL oH HoH Pelee. Einjibenzene En bot =fen. FHP HL BY HLH v ou ou nov Hou 1% PRE oH oat oud PRE By ogy BOY HOY BYOB} OH Ehrc wos DBaBpSaayEBEPBBeaasarow TT BBB EoRe G2 BBEE B Hf{M BaERsiRee ILl wwm .we LWBEASiTEO BBAUFR mwTe WN b kAR WwH5hEe em me evosnn Ev SBBySE BoSFEmHE BoB pEerane, PPoomyp oodyy HHlE BBYoBoH A11i1neic1h1l8or5ocehthoarnoeethens. PSadRer oroetnene. gore v1 oy ov PPoayaopy gooey Moy 3 dou omj oddeor Bw] Low e oooam3ogeu oynb o4o1133w3 A EEE Pat R bE dou 13 v eu Fe. carbon Tetrachioride Pu weou gore 3 oBb Moy w Hoou ysoou 13 His) `pibramoch oromethane u nov 13 vu ou ou 13 mn Poor ody Hoey HER wna JR---- Poor ody Hl omy on 0001 Table 1.3 (GonE g bier sSaSofosRhnenuteeatl y for VS in sot BfBeeEelaDete cso nc || wneer Sagie)mrrnzrier SMBEaiSlheerLOBREe, Ajwi3oit ETL ak we cova I SSfichiiiorboed ilsua amsihane EBrranichieng v Cv bIo o o ETy y yY aaon boob ou SASPeSArAiERoTSEroortoSsotrrcemnetehane v bvv o oo os y yooyy aoiieeee EH$riabBniEethntSoTrtoohrltonrioaranreeiateer bvbvooooaosmsmyoooyyy aiaaees FFEoRiRET bvoorobbiea SLBiicenihsroeiaerotnprhaepaenne e Carbon Tetachiiocre vv voosioteou tbaae bvoioy ae fei$Trb7Eir8ae8mnTiSenreeoterhtinuneeenreoune vvvvo oooiineouoooyy yeanaeee EEfI rrTienTngcarBehiSotl toaTrnoepCtrhonseen vvPvo oooilieouoooyyy ahidees $TE1t3sEtincrcheioChnrnooerptarmnoaesneaemnnee sister v v voo om y yob voy aaast ae TEottiEennaSnesencanone SEoetnene v vvboooomsobbooyy oaaaaRm - pCiiinyilEessiTenitEeineeesntaroetmane v v go o oy yusaae sSxlrenst PEo od ooyy ais jL E s a E i ar oetnane v b oa o oy yoy aaate srsgrieaoeennttineene P FAoR oAaR| pHehi aaEvsiebietseonetnzene P v bo o oy y w aaaRe EE Cina voy as s a SLhT, aSrn, P v goo od o yovaaa iNL TaEgheSnaE oieeonereE oprRamne o vg U oor1o 0 b4 aa1a868 HE eainip erosi tagie. ne o Ei or aie vores moranemmotran 000162 00043 USFW 0738 Table 1.4 Results of TIC for VOC in Soil `WA# 2-273 Dry Run Cieek Site Sample # LabFile# Sand Blank 6/13/97 B3484 Unit Con. Factor ng/kg 1 [Tow] mem Cr femmes Tol[cm ml TL1d e a r rT Td o rrr r T Td c crr r T Td rT rT rd C 1 d TT a Tarrd r dl Lr 1ITT L er r r r T dl Td CteeT TT TT T Am Con Ras Fc +11 J 045 vo 000163 USFW 0739 Sample# LabFile# Table 1.4 (Cont) Resultsof TIC for VOC in Soil `W.i# 2-273 Dry Run Creek Site 550D B348s Unit Con. Factor nekg 1 C o Tr DT oms T rTTd o cT r 1T T rT r 4 or 1 T TJ or " 1T T or rr1 or rT 1 or TTT C Gol T TT 1 11 Co 111 Mo TT1 or TTT CC olT 1 T 1 T 1 C11 1 L Mol11 r 1 vr TJ Gl TTT mcm mci 1 E---- 000164 USEW 0740 Sample# LabFile# Table 1. 4 (Cont) Results of TIC for VOC in Soil `WA# 2-273 Dry Run CreekSite 512D B3486 Unit Con. Factor eke 1.2658 Er Tomo Creer or eer er Fr eT Fr or br Pr er br TTLd rr Td rr rr rd rd Crd 1rd rT Td rd rd Crd rrTd br TT ecmm-------- arsorvmesoRrioEst woo? 000165 USFW 0741 Sample# LabFile# Table 1. 4 (Cont) ResultsofTIC for VOC in Soil `WA# 2-273 Dy Run Creek Site 513D B3487 Unit Con. Factor ng/kg 1.4085 TL Jom or TL 1 Td : o r r T C1 T1 T . r or T rd er TT co Tr 1 1TT Tr Tr Cr Ca rr TT T cr T CTT CL l T 1T 1 1T 4 CCooTT TT Co Cl1 T 1 TT[4 tm Come en ar 191 arsoELARSTOSORYOST 00048 000166 USFW 0742 Sample# LabFile# Table 1. 4 (Cont) Results ofTIC for VOC in Soil `WA# 2-273 Dry Run Creek Site 515D B3488 Unit Con. Factor ngke 1.3699 Cf DT omwrowe T orrrr or rrrd o or r 1 rr r 1d rr 1 or Tr TT or rT Tr or Tr rT 4 oT" 1 4 Lr rT 4 Co TT - Lo1 l 11 4 L Lo"T r rU T1 4 oT [ CCoo TT 1T 1 Col 1[4 GL 1 TT 1 CeumaetCoenen(Reger Fc= 10) ZmDELMRETOBORNOCST 00049 000167 USFW 0743 Table 1.4 (Cont) ResultsofTIC for VOC in Soil WA# 2-273 Dry Run Creek Site Sample# 500D LabFile# ~~ B3489 Unit nghg Con Factor 1.4286 [Tose IT comms Tolar[ co] [Lo Domwroas TT TT ES NN tr rr TTT Lr TTT 4 TrTT (4rT or TT LL1[T7177 : bofTTT Lf1 TT lof TT TT fofITT LfTT (of[177 ee L rr rT fT o T TT folTT TT LeTTT 71T "EnmaedConcenin (Repose Facr= 10) 2m0ELwRETORDRYVOCST 00050 000168 USFW 0744 Sample# LabFile# Table 1. 4 (Cont) ResultsofTIC for VOC in Soil t `WA# 2-273 Dry Run Creek Site 501D B3450 Unit Con. Factor neg 125 [ol lo[ msrows TT (rT 4 er rT4 Lr TT T- sr TT fr TT Lr TT ofTT Lo 1TT folTT TT ofTTT fof[TT (ofTTT LfTT lofTT fo ed 1TTT fo T1 [oT f T TT lelTT 1771 "Enumaed Cocenenion (Reps Fr = 10) Zr0euRsTEsDRYOCST 00051 000169 USFW 0745 Table 1. W4 A(#Con2t-)27R3esDurltysoRfuTnICCrefeokr VOC Site inSoil Sample# ~~ S02E LabFile# ~~ B3491 Unit Con. Factor nghkg 1.2987 Hr me Cees TT1 Tr 1 r Per rr 1 . Er er 1 1 er er 1 1 1 1 C1 er Pr 1 1 Pr 1 Td Pr er 1 Td 11 Pr er 1 1 rr P Pe rTd Pr Pr 1 td 1 Td amdCons (Raper Facer = 10) to ZTI0EARGTOBDRIVOSST 00052 000170 USFW 0746 Table 1.4 (Cont) ResultsofTIC for VOC in Soil VIA# 2-273 Dry RunCreekSite Sample # 503D LabFile# ~~ B3492 Unit neks Con Factor 125 [ bT omwsrowe T er TT7 er TT1 4 Lr TT Lr TT TT r T Lr TT or TT Lo 1 TT 1 fel TTTT [ofTT TF 1 ofTTT 1 fof1 TT1 i -- [1 1 Lf1 TT fofTTT foTT) fo 1TTT Le TT TT1 "EsumaedCoenen(Repns Fr = 10) ZrsoELRRGTOBDRIOCST BN Jo 006053 000171 USFW 0747 Sample# LabFile# Table 1. 4 (Cont) ResultsofTIC for VOC in Soil 'WA# 2-273 Dry Run Creek Site 304F B3493 Unit Con. Factor pkg 1.2821 Cl femme |1 rd or or rr dl Td e o r r r TT dJ rT er or Td TT rr o terr T Td or oe rT 11 11 - bcer r d rr : tc err d Td UT1d [-------- 4 ZrspeLaRsTOSORNOCST So 000172 USFW 0748 Saumple# LabFile# Table 1. 4 (Cont) Results ofTIC for VOC in Soil `WA# 2-273 Dry Run Creek Site 30SF B3494 Unit Con. Factor ugg 1.4493 [ol h[ omo TT er TTT erT r TTd (Tr T71 fT 1TT J TTT (4rT 1 et rT r T [olTT oT 11 ---mm---- rr TT LfTT of[TTT LfTT TT oT TTT fofTTT lolTTT LL T1771 "amc Concrmon (Raper Fr +10 To. 22730ELARGTOBORYVOCST 00055 000173 USFW 0749 Sample# LabFile# Table 1. 4 (Cont) ResultsofTIC for VOC in Soil 'WA# 2-273 Dry Run Creek Site 306F Unit B3495 Con. Factor ngke 1.4925 m OF femwrwe 1 r | T T [T4d d or r TTTr d orTT L S r t rrr o ol r r 1T 111 4 4 L111 Me Mol rT1 TT 4 L L 1 T 1 T 1 1 M1 T TT TT T d MC 1 a 1 1 1 1 11 GlT71714d "LmtdConcensaien (Report Far= 10) TIOELRRSTOSORYVOCST 00056 000174 USFW 0750 Sample# LabFile# Table 1. 4 (Cont) ResultsofTIC for VOC in Soil `WA# 2-273 Dry Run Creek Site 3077 B3496 Unit Con. Factor eke 1 Co h[ oswsrome TT =1TT sr 11 rr 11 Co 711 J 1 11 Lr [i Lo TT1 [oT 1 lo[TT 1 fT TT [of | TT [of TT fT TT [ofTTT fT TT [ofTTT [wo 11 [ofTTT 71 - LeTTT 1 srtE--n---- ssotoaneronsst 000175 - 00057 USFW 0751 Table 1. 4 (Cont) Results ofTIC for VOC in Soil 'WA# 2-273 Dry Run Creek Site Sample # LabFile# `Sand Blank 6/14/97 B3500 Unit Con. Factor reke 1 [TomTom Cr Tommie [om[om] r |Talbd Eee or 1 11 Pr cr C Cr rd d er rr Crd e o r T rd 1 or Pr Crd 1T 1 J Pr rT rT TT P Err r r d d : er Bb rd Td ee Td Se BH Td "EnuedCoco Ree Fr 19) 2730ELMRGTOSDRYVOCST 00058 000176 USFW 0752 Table 1.4 (Cont) Results of TIC for VOC in Soil WA 2-273 Dry Run Creek Site Sample# 50D LabFile ~~ B3S03 Unit Con. Factor nghe 1.2987 ( o[ mmsomo TT Hr rT 4 LT TT[= rr r rrJ Lr [1 or 1 rT T [ rf[TT rr TT[4 Lo 1 Td fo FT of TT oT rrTd Ll-- 1 1 TT oT rT Lf1 rT 4 (of 1 TT 1 4 : LoTTT 1 - ofTT TT Ll TT T TT "EmmaidConce(nRsenaeuFaern= 10) 2moELwRETOORWOCST oo . 00061 000177 USFW 0753 Sample # LabFile# Table 1. 4 (Cont) Results of TIC for VOC in Soil `WA# 2-273 Dry Run Creek Site 506D B3504 Unit Con. Factor ughke 1.1765 Ft r omeeT r TL Ld d PcrT rr T d T . E or rr TT TT ccrr r d rT e oT r r rT r oT oT rrr rT . r mrrd d r Cr d d TTr T r Tr -- 1 Ur 11 TTT ---- [---- 00062 000178 USFW 0754 Sample# LabFile# Table 1. 4 (Cont) Results of TIC for VOC in Soil `WA# 2-273 Dry Run Creek Site 550A B3501 Unit Con. Factor nglkg 1 Jomoms To Tw wale 1 1[17 rT 1 T Lr TT1 1 TT7 JT TT1 1 [TT (1 TT (of 1 TT 1 [olTTT 1 [ofTTT 1 lofTT TT (olTT fo 1 T/T lolTT to 1Tr [olTT [ofTT 1 lofTTT Ll T1 T 11 mat Concent ar = 10) ' ZmosLuRenDRIOCST LL 00059 000179 USFW 0755 Table 1. 4 (Cont) Results ofTIC for VOC in Soil WA# 2-273 Dry Run Creek Site Sample # ~~ 504D LabFile# B32 Unit Con. Factor ug/ks 1.2195 p Cr ee ee er T rT TL C d dJ P or r------ 1 1d Er Hr rT1d rT Or Td Td e r r d r 1TT 1d n Per eer rd Tr 1 er Pr Beer 1d rT Pr er r CT rd or r rT T1 1d d "Eset Cancion (pense icin= 10) ZTIDELARSTOSORVOCST 00060 000180 USFW 0756 Table 1.4 (Cont) ResultsofTIC for VOC in Soil 'WA# 2-273 Dry Run Creek Site Sample# SOD LabFile# ~~ B3505 Unit ngkg Con. Factor 1.2346 [Toa [| comoms Tol rr [ com] [of Jowowsmowse TTwel 4 [of loweawe TTwal ul [offowomm To Tw wals af rf rr TTI rr TTT (J rr TTTf rf rT r T rr TT er TT felT= TTTi fofTTT : LoT l TT lofTTT Lf[TTT ofTTT : fo[TTT fof 1TTT fof[TTT [ofTT TT Lal17771 "EsmcdConcenion (Repose Fair = 1.0) 2T30ELRRSTOSDRYVOCST 00063 000181 USFW 0757 Sample# LabFile# Table 1. 4 (Cont) ResultsofTIC for VOC in Soil `WA# 2-273 Dry Run Creek Site S08D B3506 Unit Con. Factor nek 1.2346 EP r e Tee met Er Er TT TT|L C ro 1d Er Hr rT1 TT 1 Er Er 1 Td 1 To or er T CT d d PT er rT | C1 e e r T C T 11d P PT Td T 1d P Pr U11d ST mouanrsonicesT 00064 000182 USFW 0758 Table 1. 4 (Cont) Results of TIC for VOC in Soil 'WA# 2-273 Dry Run Creek Site Sample# ~~ 509D LabFile# B3507 Unit Con. Factor ngkg 1.2987 [Lo] omwrowe T TT (LT TT ol[TTT (1 TTT 1 TTT 11 Lo TTT Ll1TTT LoTTT lol[TTT ol[TT 1 loTTT [of 1TTT Mt [Td rr TT Lo[TTT . ofTTT Lo TT1 LoTTT lelTT 11 Trt Sapte [r---- -- 00065 000183 USEW 0759 Table 1.4 (Cont) ResultsofTIC for VOC in Soil WA 2.273 Diy Run Creek Site Sample# ~~ 510D Unit ngke Con Factor 1.2346 LabFile# ~~ B3SOS [ETroo m] me mmm Tole[on] |Ted p Errpeet------ r rd d ST Cr C1 Er Hr r TT T1 1d rTTd Sr or CTFd TT1 er 1 [4 I I Pr Crd Cr rr Pr U11 "EsmeConcrinion (Reps Facer +10) Z27IDELRRETOORVOCST AEE 00066 000184 USFW 0760 : `Table 1. 4 (Cont) ResultsofTIC for VOC in Soil WA# 2-273 Dry Run Creek Site Sample# ~~ 511D LabFile# B50 Unit nghkg Con. Factor 1.3514 [Tow IT compos To[ mr [com] [Lo] omens TT7 Lr TTT of T1 T 771 J1TTT 1 TTT . fr TTT LL 1TTT Le TTT (of rT r T fof[TT [ofTTT lofTTT lof[TT -- [7 a -- Ll [of TT11 TT1 [of | TT1 [of[TTT Ll TT1 "Hamed Cosme(em Faar 10) } ZmoEwReTRDRYOCST 00067 000185 USFW 0761 Table 1.4 (Cont) Results ofTIC for VOC in Soil WA# 2-273 Dry Run Crees Site Sample# 550C LabFile# ~~ B3510 Unit Con. Factor neke 1 Er Teme Tomo Eee Sr |[wl Tel 4 rrbd CT1 Sr CT rT Er C TT TT rT 1d o P r er Tr T r T Per or rT rT P PP er rr err rT T1d d e r r rr C1 r1d d rr rT1d "EmreConcensaton (Reps Facer= 10) 27IDELARSTOSORIVOCST J 000186 USFW 0762 Table 1.4 (Cont) ResultsofTIC for VOC in Soil WA 2-273 Dry Run Creek Site Sample # 300F LabFile# ~~ B3s11 Unit ngkg Con. Factor 1.3333 1 --[ TT T T 71 EE AA BY ' J r rT T [ Hr TT T 7 = rT fE of[ E -- r ---- T -- folTT PTT [=ofaE---- [1 lelT7111 "Esumaed Concern (Repose acr + 10) ZmoEwRGTOBOROCST . 00069 000187 USFW 0763 Table 1. 4 (Cont) Results of TIC for VOC in Soil . WAS# 2-273 Dry Run Creek Site Sample# 301F LabFile# ~~ B3512 Unit Con. Factor ngke 13514 I oon II I I or er 1d rT1 cr Ber rT1d 1 r Er r rT or Or C rT11d - Per Per Td rd er er rT rr . e or r r Cr T o b C r r r r d T o orT TT Cd "EmitConsensaien (Repos Facer +10) ZTIOELARSTOSDRIVOCST 00070 000188 USFW 0764 ; Table 1. 4 (Cont) Results ofTIC for VOC in Soil `WA# 2-273 Dry Run Creek Site Sample# Sand Blank 6/16/97 Unit nekg LabFile# B3517 Con. Factor 1 Tool eww ToleTe] o Apeine T I1 TT T TT TT T T TT T T o TT T T TT n oT T 1 L LT T T TT n LT T T T T T T T T L T T T TT 1 TT sat tomem bomtinet 00071 000189 USFW 0765 Table 1. 4 (Cont) ResultsofTIC for VOC in Soil WAS# 2273 Dry Run Creek Site Sample# 302F LabFile# ~~ B3SIS Unit Con. Factor ugke 1.2987 E Pre ee eer or Sr Hr Er Er or err Per eer TT1d r rr r1d C11d CT C rT Trd r r Td od rT r 1 d or rTtd Ee rr r r rT T 11T d er "Ena Cancneaion (Rese Fa = 10) Z2TIDELARSTOSORIVOCST 00072 000190 USFW 0766 Sample # LabFile# Table 1. 4 (Cont) Results of TIC for VOC in Soil `WA# 2-273 Dry Run Creek Site 303F B3519 Unit Con. Factor ughkg 13514 [ol borrows 1 11 [of111 T Lf[1T 11 LfTTT|] EF Lo11] : [LL TT T TT [of[TT : [ol T71 777 71 [ofTTT YE I TTT WT [of[TTT [of 7TTT IE I LlT7171 mst ---------- [-- 0000773 000191 USFW 0767 Sample# LabFile# Table 1. 4 (Cont) Results ofTIC for VOC in Soil `WA# 2-273 Dry Run Creek Site 550B B3520 Unit Con. Factor ng/kg 1 E P ree eet [Td 1d or PT T Tt T1L d ; Er Er T TT TT Hr er CT1 rT1 or rT1d rr P Pr r r r 1 Tr TL 1d e e tr rr 1 11d ee errr rT 11d d oT T T rd or rT hmmCon(hmrceicn+1) i amsosuaremmoRoSS pense 0007=4 000192 USFW 0768 "Table 1. 4 (Cont) ResultsofTIC for VOC in Soil 'WA# 2-273 Dry Run Creek Site . Sample# 808 LabFile# B3521 Unit Con. Factor ugk 1.2658 [Lo] lT omo T (of[TT 1 | TT1 (4 1 TT1 TTT dd TT 1 TT1 Co TT1 rr TT [LoTTT [of TT 1 [of[TT 1 [of[TT 1 [TT 1 LT T 1 1 - LT 71 1 [oT 11 1 [ol[TTT [of111 lof 1 1 TJ ersten tem 10) J-- 075 0007S 193 USFW 0769 Table 1. 4 (Cont) Results ofTIC for VOC in Soil : WA# 2-273 Dry Run Creek Site Sample# 899 LabFile# B32 Unit ngke Con. Factor 1 EP r e ee eet E er r-------- TTL 1 d C1 r 1d d co or or r CT r1d CT r rd T1d Pr er rTTd CT1d P P r r Cr Td r Pr Pr rd rT er or 1 C 11 1d "Emmed Coenen (Reon Far =10) ZTOELARSTOROROCST 00076 000194 USFW 0770 isAEsestwhes: wBuOaMenG'E || AmEieiSherl1 [Se cova Sr2BFaIhSRniCaDEci-rcpnntreoonrosoetentsheynLeEther s1Ti1n2DaByiilchsiioscrraonbaoretnteene RCB#hkaieetEtGhniyaIlopsnneerfnniosoltpprop--y t--ether HeMLxEsactcorhmcioboreronnoteeentehans B$Ziis5e2-nmEeehttnhoyotiotpehtehnoosty methane N2Fig1htTheahttenoerTmeneneanlaene bEEeBxEaiNcshtioomrSomtauttniandeiteonneenot SHSehUxeaEtcthyloirnoaaNcmymenoalmlopeannnetsadiene SSSiiLcekErloomroncrnistominmnteneitnenast jDirreetshiytlpinsthiaytate EFA3eiEttnraogcphannneetnonLansitenneat B2Si.ob6e3onismnottottrroaainvaottvueenne: FiLBlsEeatrheyniCeooninnnaatreenytetner LCbs ronscomnr eitni!nR epmreemnpA iteotnneneart PhPFeeennsataanctnhtcrorreoonsnntinnianls AnH[nmreabcoeitnysipntnatate BBFrliiarmaeennieeynisonthatate EBBSirEnAvEsiSoLetEnaiIeShaynitnonemrraeycntepsnoenatihmaet.ate BeBBreltnnaieactvyoiErnStarnnantthahetenene frSITiregeennoelc1hFRSaneaarrpaycreennse Betas. peryine Table 1.5 WRePsul2ss ofotrhyeAAnanlyFsrtesseYoSirteBUA In water mswfmireymee Smwiemlin Brora moieonmnstsk Berton 20So2i0oGomsleaens Serbs SRdesEeSr wie fiwetaosme wie oGaaivsaaamrr wee o8B3r5as0rsrr ize aaheeerr1d03r/9s7r wie E s5n nTno w1n xTon cok. KL cove wou oc. ou coke. Look. wou vvvOooooT mm@oT ouvooBBR obovvT owBB obbob owBB oyooyu 0RBr vvvoooooowmo oouoooy uovyoooooooo8oouw bod@okmoovu ovvooo o1B Y yooubb B000 gvvvooooowww@ouvvooooow ooovvb ov ooooooommoooobbvbooooowBoyo oyy 0B vvvoooommo vow ovuowoyo vooloo ow0vwo omw owwobuoovoouowooo8b F oy E E vvvvoooomow@mooouooywuoooooowBoooubooovw omooooooouvoobobooooBowov 8 BRoR vvvvoooomwmmoouooovvo uvooBoo owooovvb oowowomooubboooowwoooboobb oomobo oy 0B vvvooomomooowuovo oooXd voovu vo@oov Bou o Boowombobou oo Ro8o08880B Bob Rob voomoRouvooy B% obuovu owF ououF O%E Vuoy OB vvuvooomx@o0 ovoovo volo mo0o0koo%wuovvuo % ov B o o b uoy Bou 0%B oR 58oouy 8850 0% E vvvvoooommomeooooooouvvuooooodoBobwobw oomkoouovb8 B BBoobb b w0 Bb B Ev vvo ooo exow owooy owoooBBoowEwow ow%oR uoooub OV von B Bobb0b 8 OR OLR vvvoooommooooovuooou ouwW@kowuocwu u %ow obvobnB Bubgo 8R oomoovoomoobo vvvooommovoovooovwoa@@ vom ovo uuwwoo ooooddd dolouob vvooow. o w yu oobb k vgvooooloxo@oooouwwoosomdlooooouwww volvo uo k s kv o utoB mbY ov R dou 1m bo vvvooommm vo oovv vooomwo@@ oo@ vvbooommm vom oobbbooow boow b 8850n 008 8 0B vvvoooowm@ vv vooo1 o@@ volvo eo 5 wwo omwod% uo bbbooowwo 4o8 b 08%1 bb -- te 1.5 GeomDISTousSohf 0 mals for BUA In ACE wwHSeohEeeer::| BSMeaSlD 2EgBRawGrYe Smmm J TSBRLahhaaeiammm uSfwSghiaheeea oe rBwMieaa wa pfiiiet1h EoAih coven fFlie, wooo. SPoeE tT oosu mobT E 08 [I FA Ladleee LrheE. bgEoooorrE oy ooyr oR BR oo bOb ROERR HE iCHanrEeaElEe ES opvonine ppbgoooooorfEo ooobrr por oBBB B obyovB B BYR f Lm ie. fF BB fBHL rEataeen pgBpoooonwrooroory BBBB obybbw Eok Bb 8 i Flheee meald ean. bf:p okFfo4r Bb oR E fsRimmade ieet sgb pbooooooBksosroooooyrrr nB R BBBooYL Y yyob E E0OOBBB Em bog SGEiegnmee oen eeer ] arm, mai HE ree FLoIb BBOL3A ssooosB ooyr BRSObTL B ROB B poor oy B Pgoopro or R oB obBo8 00078 USFW 0772 Sr wBhpeeameesi:r imBm1m5eenemrUotmnSeaue g-RRs tors C fo mre rc Bel BOE| wo om G geEnoCee fii Retaeieoreo, ethane f rSEMatfEt seE..T R EET L, sen d Hia Eii HHE HEheine Olemoe E.T Pa: fEd E vPPP F oEmEiEyuddod PPFPF oREBfEfLb; Eg gor own: PEt PPPPEE2EEE1LEo3oxk P8{ 0 EE EfLLB FEE PEb ok 00079 ee Sample # LabFile# Table 1.6 Resultsof TIC for BiN nWaA ter `WA 2-273 Dry Run Creek Site WBLKO061397 DRO02 Unit Con. Factor pel 1.0 esi"T 1 TT al Hee Hie 1 Teal eee 1 1 or 1 TT 1 TT er er TT 1 eT 1 1d CT er Pe T TT ro er er 1 rT II I ul 1 Hr 11 TT Pr Er TT eT C-- d J JE-- os hi 000198 USFW 0774 Table 1. 6 (Cont) ResultsofTIC for BNAin Water 'WA# 2-273 Dry Run Creek Sample # 203E 769 Unit wg LabFile# DR003 Con. Factor 1.0 e (Tool t cms Te oTwTo -- = -- >-- [ol JT owee ea Ll fowee TT Lol fT oe a - Ll owe TT al Lol ewe TTa) [LT TTTi [LoT 1 TT [oT TTT [T of TT 1 [[ of TT 1 [[ ol TT 1 (olTT 1 fT TTT LT ol TT 1 ee] [of[TTT [ol |TTT lof[7777 17 11 7J - ismntt------ stom: i 4o0s1 000199 USFW 0775 Sample # LabFile# Table 1. 6 (Cont) ResultsofTIC for "BNA in Water `WA# 2-273 Dry RunCreek 202D 770 'DRO04 Unit Con. Factor well 10 EE Hes = = = TT[al Has T af wk 4 CoB e H P H r e er e e rr 1 T1ed ld e T pT r T r Tr T rT " 1 I ---- n C.l e + 1 TT toecentoptine 16 ZIIDELARGTOSBNAWTIC 00082 000200 USFW 0776 Table 1. 6 (Cont) ResultsofTIC for BNA in Water `WA# 2-273 Dry Run Creek ~ Sample# 00201D 804 LabFile# DRO0S Unit Con. Factor nL 1.0 == a = Ce O el foaweefe 1T r .[ | SCT TTT TT T --I TT TT L TT TT T 1 o1 T TT TT 71 . r --I r I T1 ; r T [o T TT 1 1 TT 1 1 1 *Esumated Concentration (Response Facto=r 1.0) -- 00083 * 000201 USFW 0777 Table 1. 6 (Cont) Results.ofTIC for BNA in Water `WA# 2:273Dry Run Creek. Sample # LabFile# 00200D 805 DRO08 Unit Con. Factor rel 10 He Hee Prem Cree Eeeeee Hr Br or er Tel Tel Tel dl Taal Teel rb T rT T1 bd d C r1 rod TT 1 P or r o TT 7 = Td T 1 T 00084 000202 USFW 0778 ~ _ . - : Sample# LabFile# Table 1. 6 (Cont) ResultsofTIC for BNAin Water WA# 2-273 Dry Run Creek 206D 806 DRO0S Unit Con. Factor nolL 10 [ol Tome TT al Lal fT o T [of Town ToT so am [ol fowomas Tau Ll loT we a [olT lowe a 1 TTTj [Lo [TT 1 [[ of TT 1 [ofTTT [olTTT [ofTTT WT TTT [ofTT TT [TT 1 [[ el TTT lT o TT Hof T 1 TT } C--O . SRE a ~ 00085 000203 USFW 0779 Late7 (coDng Tissof he rps for wnSal SfHBAMiPaeLrEm oe#:ies `SmGg30e6Ehum$5yLm1,07 `5BgSE08mbM8RScwRTo 5GSSS0R%huaI$am1T10 sa 5BWBs10E8dhE$RF1,11 id 0SSwo68uaR$emv126 g8r o emasne 1BRy pihaek O8g sZalt 38S a22 5 Zr &8@ 2iiS moms JPeoEmE,L--cnarsrmrtenr cC onionBBnROeY nLBS cOL e8oc& T e3by o8o oe y4m hBoR ' ePEiEe eosrelee itter ypppppoooooBBmBBoLObooobbo oLBBoR B12 oyLooo oomm 1Lo oB vbyLbooooBommRooo:yooi RoooooRBRRR L sG Fa B izble E e o: A s [a f40pbbo ooomBRBOLooOoobbbob ooBoooRRBB LPooLyrooooR@mmB m oLoobbbo Om oBofoobObioLooRmOooBBmR - E [EFSEianArrReoe EIente e pbb3booooBmmBoObsLoobo OE obo 8 oLooyy oorBmmmom oLoE b bbLooBoff obo boB bOoobyy LooRmmoomB - haE e ne C fHeel m mme bppoob oooBo@ obboobyo oRo8R bom ovo OLooLb voomoom& L LooLbbo oomao ofomf ot bbbooRmwGRRB ) . i E Epihleibrisae atal frien bPEPpaooonmmEgbEooEboo oo omR ovoEorrb oooaaoummaBoEboLLb ooaaoommumR o GR oyAbbb ooowowR ob ER EEi Fpitnen- bo Gboooaanobbfbo oogodmoyrbobooooemm@ boLobb oaooEmmmoobybbo omooBR FE Geamraenm foie e ee Po0b omEBoOLOL o aBB ob oORB v4oBm E oa GoOyL oEBmRe oobb ooHR yom bOoLb oOaoHuE 3bLo Mh d(M E L EiEenge e i eE mai mme PPo LbPoEooEBRmEnsO yooLbfb oosaoBmReEoRobyob or o aoo@mmm bbooopbbb ooawMmoou@Roobbbbovb oBmw3oBamn EHemiahielspine Pfe e amatae 3o,0m8 J, to o moB ybA o8modseo EioybVaaomm dbbeoomammybbyoouom o Se bo LEohl PoomE Lob oioosomom oboRm ooyy oR JR-- 00092 000204 USFW 0780 (gwrEeeaees J 7 1g BmguEnmeCa BpEBEiREBrERt.2Eo3ehEg ASSgwLEfl o Emw5eIirSrT IemeDg doShBEauheEsset EEgHfEAThRwhe BEgBSEETaaTwme OBSBdEETuTRwmE OEmBBBEEiYThem EdHSuSduElm R HHBiiEepo l m3|% Si4g. 8%i ;E33 48%3 , j F LFBhCOEMrhPOlUeNa oD.ame EEE coP PPT nt REIF oR rELLe EcooncB " E goB r coB B FnTAe" EBRMEOY L LTECOENLBLC. B8M8 ROTLT CONL8 C. o8MoO8L PB LE PB LOB YE H Hfg FEaiEnnEneEeROsOO.Y FEA P PPbFP o oBEEoR LpLoPrB EBooo22 oF LYFFr RBBBoB 8 :tELooR8 gsooR8 8 b1oYLb oEBmoo@8 PRLog rE LB LoS jfP HEHiESaEsE Ea,E.PP PPPRREEEo@ LLOLLoFOsgBoooER2 flr Pogo PE FFPOoBBBEBELCLOLLL 8BBBooB& yo bo8 YYoLLD BRBBoB LoSoR SR H i(BEllETeL.. EFnEdE a PP PPP FgBRBEE LOLoPEgR BoOEB E ProDr 8oO8sBooER L LLLooBBB8 oE oYY1y ES8oo&& oR fo bom boa Loa aE S FEoairnnn fEs3rkRi tirhomnet Liene P PaELlEB LrEE= E los B o! w PP vPoooo2E 0g0loLuoo oE2m0 robru eoaE-s2m00 bboLu ooB2ma00 lYbboua oB2000 Lo HpfFEEaEiertEREneREs,eLy . Jizz PPPPPf oRRBREo@ YLEOOLLBEEB oEE LYoFLYy oEBEE2oE LoLL LOv OLER8 BRo8 8LoLoLO8SmERR Pore regs LHGiEITTmmEe sEene. PPPEfmoERHoorrOP gooBEpEEeOLoyroy E#ooO8ERofooLLoooRmgaoE oooob booRwomEm8S Elma E E E PfnEEm E SE PELE BE roo dPfooaoBRBoIOfFrELEoo0E Bg yE oYyogBmomEL4 LEoBBo&b EoOoyYbEoooo&&& PREY ELE LB jonaos 000205 USFW 0781 ors: Justew1.a7 s(CanWeyoREmBEH8sE4oEftohneArSa5 brleafmorBUA nSoil wa lgmeeoarunwem.0 eGGwEdEnmEC enn WsWRhEaiuAenR #7 SsEwmeeemmre fed BWfWBEEaRheSRie:tLE Si83 B2=i2t ii8%] 2 coo WCE S]She EN eco, eu meSar ec mC DSLeeindhsgnee taeratne enyigsnner sil neat o ybsoooom Bmmmy obb3ooobv Loo@oomo@@@@obouvobvy oumaaaeee ow pPRSrthaeaiem a ee eeele seo L sb om WmRuo3obb somoL o@o@@@m @ y b u vue e ue oy a AAF HEtianerrErs aenirae nnesnt obgggooomBmmBooOyLL8 oy BBBo&@ y oboyy oumaae uumum LP S E HiRghtid e mane inee ne engin: gyyoooom BmR yooobby Somoob BB @o@ yb bovy muam e B @ uvua CL E proeSsaSitE rnegst!esraet e go o ooRm m B oy y Sou AB o@B@ yv ovy auma 2ES S'Chrlimoortoesnaisnhe ethalene ug gyggooooo 3wwm90aobtLuovb ou4aRo2B8Ru08oybvbyau4am1m0 SL A S EoIan nrinetruets SySssooooomwBmmobbooobvL aEu@RRg o@ uooubym mEmie yw LSSHeeonanntsnammie. TCEime es gs0Sb ooommamob yuoby gH&BB AgEuLoy vyy uumBemom SS ST ee nn Rneeem einer Go o Som mEmoLoL soeoy A@@AR guu L yn a a pfEnReenSrmcnatace Baten s Fss RooEmo omTooo oL BB BB y u4ywo1omm SheinrTsmeen tonenAataEcneLe e SS S5 YooBo o mm b oooLso AB uR u yu 8 AaIdmp Ry on EESS vrianeee rnaiee acee i pe , o o PCooR mEooov B 8B oB u yLos8o8Bmi y om Eh arieae Como v 390 v B "20 v 0 Benzo(g,h, i)perylene " |1 : 000206 00091 Teble 1.7 (ConW td RE esultsboofrntyhewaiAralybuiin for BUA In Soll nmseseotiws iFesosca ' BBSaMu'E ||io8 daA re smWiuecmeser11 sBaLieEl MFC lEeE A| R] ]5% wi Se coven coc. wou BSIrAeEChn2iaol-rConpthaernoastthy cher byVoooRmm S$Ee3nDbaIyia"aoircaoonbeaelnnzteennee Vvbooooommm BhiersncyahllproBeranoboebrleontszoepnroepy ether [[[ A A3] RApexaEcrhiSoreoSetnhanpsr,opyamine vvvooommm FMTisitcrotmaroboremonmnieeennoel om vom B2$l.E4:333.iiCcmhhelitoohrryoeinootmnheennasos!ly methane vvVoooommm SE ree vo HeELEaerhieoormsonmiuatianteditopnnsenat v vVooo omm . FSekxEeaecthloirroaonytoehroaaptpeeennnteaatgiene vvvooommm Fusing io JAsSeiaemnnmeiinrrhhyainihygilnennanel'ace v ugyoo o SiFbnEeBniriootunrceannat vvvooomim SS2.lE8eDShIivnitmittrrnoaatvtooatttuueeennse vvVoooommm EFCE iisTorroeomnmemneitnimnte pnenytetner L8Sitero Bomecnytonenat vvvvoooommmm HLeiaxcerreonesoostaoinpenneenynesanaptiocoener I vvoo]mm PEnreeennstriianecinehtenoesrnoenens: vvvo oomm BiFciboiriientieimtnatate bVvooooommm B BByierTesEensnviontenataothene vVvoooommm EEnsvRoienEeantRnreacyenaenenatate v vvooomm SBenItolESyiEpenaernaanttahtaene vvo ooom BeDIbnrenonnisseods DSapnCeirnryrpiayecrneesnnse vvVoo oom 000207 00093 USFW 0783 Table 1.8 Resultsof TIC for BNA in Soil `WA# 2-273 Dry Run Creek Site Sample # ~~ SBLKO061697 LabFile# DRO17 Unit Con. Factor ngkg 333 ee eee Td 1rd Or or CT 1 rr E Pr r rT rd Ld E rr T r1r rd d rr rTTd rrr or TTT EE oT rT rT He rr Le 1 1 1d 000208 ! Table 1.8 (Cont) ResultsofTIC for BNAin Soil 'WA# 2-273 Dry Run Creek Site Sample# LabFile# 512B0S8 DRO18 Unit Con. Factor nghkg 40.3 [Tease[com [0m [mr |s come| [ol oolosemees To| al ol IS yo NH [ol Tomes aa) Ll Towa TTa i [ol faT e T a Ld lomo 1 Tal uf Ll ToT w al wf Lal ToT me T Lol lowe al al Lol TT oe l [ol TT eme aw [al ow TE [ol Jowee TTa Pelee [Led LolTowel) Lal Tow LT LolT le ow LT al Tew T Lol TT ew T Col TT ome T wl Hamad Cosme(hepa Far 10 morwneTsNAsTC 00087 000209 USFW 0785 Table 1.8 (Cont) ResultsofTICfor BNA in Soil 'WA# 2-273 Liry Run Creek Site Sample # LabFile# 513 B 059 DRO19 Unit nghks Con. Factor 444 - = [Tow ee comem [ow[cml] CT Teal a Flohm Eee To wel Teal oo ul Cr fee . CT lame owl wl TT wel wal CT FT fT aamee ea TTl sul woel Fo ame ET Taw Tol eel 1 Taw] ee Col fee Co lee 1 Towel wel TTwel ow : Pal Po flT aomwee e Tan al uwell Po ae Po Tome UTal el al val Pol fee TTeal wl PC al Jeo e ln TT e osl wd 000210 Sample# LabFile# Table 1.8 (Cont) Results ofTIC for BNAin Soil 'WA# 2-273 Dry Run Creek Site. 514B 060 DR020 Unit Con. Factor poke 455 Ll Town TT a] of [ofsomon a| see m mo [of smleemese [00| aos] oo] Ll JT oe aw Lol owen TT al Toowmses TTun] El ToT me T] Lol ee TT Lol ewe TT al [ool Towee TT Lol Teese TTeae Lol Tow TTnan Col Tawa TT a] el Col Teme TT i] Col owe TT al al Ll Je I Leal Lol owe Tol] Lol TT emes a] ae [ol oolmmsmes Ta| on] ue Cool ToT wne l ernneimmnn pT nmro 00099 000211 USFW 0787 Table 1.8 (Cont) ResultsofTICfor BNAin Soil WA# 2-273DryRun Creek Site Sample# 5008 100 LabFile# ~~ DRO2I Unit Con. Factor nghe 45.0 dee ET fee UT Tal wl Tal ET fee FT lame TTenl dl Teal E F ETT lle[ eee T T o 1 TToewl aell uull FCTr T Tfaamee al Toul ueeal El lame Co Jam TT wel ud TT wal Co fem Co fee TT wel wal ow om Co lame . Col lm | wal od 1 | eel Teal ml al Co lew Col lem Ca me Taal 1 [eel = wl DCoolo Teme pT1m oT|easll wmll EmmaedConcensaion (Repos Far= 10) ZIOCELRRGTOBENASTIC 00100 000212 USFW 0788 Table 1.8 (Cont) Results ofTIC for BNA in Soil 'WA# 2-273DryRun Creek Site Sample# SOB 101 LabFile# DRO22 Unit nghkg Con Factor 423 [Toa I comows To[ar | com| Lo]ole Ta|s sen ae] Lol Jowwe aa wl [ol JT omo aal Ll fT oe l LolTween LdT Tome T] Lol TT oe T LlT lowe T Lol Tome TT Lol ToT ewe T Lol ToT w l Lal TeT e T a [olT ewe T Lod TT oe T] we] LolT Tow w } Ll T Tome a Lol Tovems TT aa wl : Fal Dovemes TTaa ul . LovoluTm u oue ] ul Lal lee 7 Tal "Eames Conenrten (ers Fer + 10) Zoot wReTReNASTIC 00101 000213 USFW 0789 Table 1.8 (Cont) ResultsofTICfor BNA in Soil 'WA# 2-273 Dry Run Creek Site Sample# ~~ 502B 102 LabFile# DRO23 Unit Con. Factor nek 413 Cr ee Erde Ere Eee Ere Er am Er ee Ele Er Teme Pree Pre Pl Cr fame Ele Efe Er ee Co oes Ere [wel a Toad al 1 Taal al Tul uel ul Teal Teel wl TTwal el 1 Tuell Twa wl - Teal ml TTaad om) 1 Towel wm 1 Tel om 1 Tas ml 1 Tan we Toad ml Ta|owl ml 1 Tew wl nm Coenen (pore Facer 10) ' Drove ARGTORENASTIC 00102 000214 USFW 0790 Table 1.8 (Cont) ResultsofTIC for BNAin Soil WA# 2-273 Dry Run Creek Site Sample# LabFile# S03B103 DRO027 Unit Con. Factor nghke 445 [Teasw | comoms [oo [rr|com| [a Towne [| wa] ou [a fowe-- T [ aa] ww] [Oo] ofsessemenss [os| sere] sul Cl foseme TTas] an [Co omele |ut |am]s ww] Cl fone TTas] mi] Col fase TTan] wd] Col awe TT wa] ow] Col we TT wim] i] Col omen TTel od] Col awww Tom] ue Col fame TT ee] a] [ol fowen TTwe] oo Col ewe TTwl wi Col fawn TTaol Col owen TTam] Col fe TTaml ml Lee Le |oa sol Col Jewem TTun] wl nim) ST 00103 000215 USFW 0791 Table 1.8 (Cont) Results ofTIC for BNA in Soil `WA# 2-273 Dry Run CreekSite Sample# ~~ 304E 105 LabFile# 'DRO30 Unit Con. Factor nk 427 F E lom rTe oTlaoanll om E Er am e1 e TTeeall wdml) ) Er Tae CT fae Tl we Towel CS T lem N ToulNN= Fr Td TTT x e or r r T TT o T r T rT rd o Eb Tr T 1 J rTTd t c T r TT TT T pm I I hms Conon Greir 10 JE---- 00103 000216 USFW 0792 Table 1.8 (Cont) ResultsofTIC for BNA in Soil `WA 2-273 Dry Run Creek Site Sample # LabFile# 305E 106 DRO31 Unit Con. Factor ughksg 452 [Tease| comms [oar |con | Co Tome TT cal wf Ca Toe TT wo] wf [of sofsusens [| nal ol rr rT rr er TT TT7 or T Lr rT TrTT fwTT TT [fwTT TT : felTT TT [olTT TT LT TT oT TTT - Lf TTT [oT TT [ofTT TT fofTT TT GT TTT "EnaCorn prs rr 10) smosunsTosessTc 00165 000217 USFW 0793 Table 1.8 (Cont) Results ofTIC for BNA in Soil 'WA# 2-273 Dry RunCreekSite Sample # 306E 107 LabFile# ~~ DRO32 Unit ng/kg Con. Factor 527 TT me [To] oles 1 Toul on| wal we olelses Ca lee Tu|wal ol 1 Taw od [Cil oli oweb s estT1e o[|ne uaelle uowd) lowem 1 Toul wed Cl lowe Co lowe 1[onl ed Toa] el . Cl lowe Col low Taal ol 1 Towel ww] . Col lame TT wl ed Col lowe 1Tal ad Co loon Col lowe TT unl vm) TTaul ow] Cl lew Taal wl Col doe TTaul el Col oof To| oul owl | Col lowe Tua el Col lowe TT wal wl "Cormac Coenen (Reprs Face = 10) ZI0OELRRSTOSBNASTIC 001e0m 6 000218 USFW 0784 Table 1.8 (Cont) ResultsofTIC for BNA in Soil 'WA# 2-273 Dry Run Creek Site Sample# 508B 109 LabFile# ~~ DRO33 Unit Con. Factor nehkg 409 Tr mm Cl Joe 1 Tas] wel 1 Toad wel Co dome Cl few TT wal al TTol ml PTTame Tl lew 1 [wal UT Teel ad wd Cl Po feT ewee a TT l owl wwdl Co Jw Col dee TT al wd TT wl Oe fd Cal doe Pol le Co eee Pl wee asl wd 1 Teal 1Ten wl wel Teal al Ca Jee Col lee Col dome 1 Teal wl Teal wl 1 1 oul wl "numa Conceion (Repere Ficir = 10) 270DELARGTOSENASTIC 001C7 000219 USFW 0795 Sample # LabFile# "Table 1.8 (Cont) Results of TIC for BNA in Soil 'WA# 2-273 Dry Run Creek Site 509B 110 DRO34 Unit Con. Factor reks 418 CL Col fee fon 7 1 Twn] 1 wel wl wl Oo mbites CC Jowew Too| nl ed 1 onl wl wee Co lomo 1 1 ol ul 1 1 awl ul ol lowe lowe TT seul el TTwal ol ol wee Col lowe TT wal umd TT wal ol Cul lows Cal lawns TT unl ood | Tow ol Col low Cl lomew TTsnl el 1 Tal an) : CCT oll oweea ne l TTo aml wf ; Col lowe Col owe TT onl uf TTaul Col odpm Gl Tame Tw|ool wl TT wel Enact Coon Gene Fe 1) oseLumermensT 00168 000220 USFW 0796 Sample# LabFile# Table 1.8 (Cont) ResultsofTIC for BNA in Soil 'WA# 2-273 Dry Run Creek Site S10B111 DRO35 Unit Con. Factor ugg 40.7 C0 Jom [ol mlm Co Joe Cf Toe Co fowom Co ewe Ca owe Col Tews Col law Cal Jom Cal lowe Col lowe Cl owe Cal Jowom Cul Town Col oolommsmes Cal lee Col lee Gol len TT ual wl [on| sen] el TTsel uw 1Tal ual TTsen] uo 1 1 wel ol TTsal wd TTwal mi TTai ed 1 | unl wl TTaul wd TTwal mol Taal wl TTan aw] TTwal ul a|on] wl 1 Tus] ml 1 al oul | wl= [-- A, 001.9 000221 USFW 0797 Table 1.8 (Cont) ResultsofTIC for BNA in Soil `WA# 2-273 Dry Run Creek Site Sample# ~~ 511B112 LabFile# DRO36 Unit Con. Factor reks 43.6 C To]F o deele 1[orT|s aaseln wwwf] Co foew 1 1 snl mal Tl Jue Cf fame 1 | sl ol 1 wal oe Cl Cl foo[ mwweee To 1Tan al ovall C[ l dwswal wl Cl fw Cal fies TT wal oa 1 wal wl Cal fome TT aul Col few 1 unl wl Cal fee Cl lee 1 1 wal wm 1 1 aul ul CCoullo fowmew wl TIT n|s oonnll wwll Col lm Cul lowe 1 [unl wl 1 Toul Col wae = lame 1 1 wel wf 1 | wel wl hmsConscncnon Report Fr = 10) ) ZoosARETBEMASTE 00110 000222 USFW 0798 Sample# LabFile Table 1.8 (Cont) Results of TIC for BNA in Soil 'WA#2-273 Dry Run Creek Site 506B 124 DRO37 Unit Con. Factor ngkg 373 [P ofso = lem Tun l Fl owe -- Ll Toe = 2 Ll own Fl ows Ll we 2 Lol Lol e= w = To7 wn fol owe Fo owe = Lol Lol ooT e we T Fol lowe Lod owe Lol we Fol ww IEF I EP . Lol fowe -- "EnumCoenRepe osFn ar+ 10) oe RRSTBBNASTIC ~ 00111 000223 Sample# LabFile# Table 1.8 (Cont) `ResultsofTIC for BNA in Soil `WA# 2-273 Dry Run Creek Site SO7B 125 DRO41 Unit Con. Factor pkg 402 Fr 1 Teel I EThe i) ep 1 Tol [owl P H = T TTeodlad Hee Hm Tel Tl E Pe m 1 Toul wl ev Pe pe Taal 1 Teal el Lee CE e ETaT[oeudl Pet Cal lo Ted C1 onl wl ------------ J-- = 001% 000224 USFW 0800 `Table 1.8 (Cont) ResultsofTIC for BNA in Soil `WAW 2-273 Dry Run Creek Site Sample# SO4B 126 Unit kg LabFile# DR042 Con. Factor 395 CTCeeJlam comm ToTlomalna]l CClw T famhe TToT|m useaall a CO Tee 1 1 Ta al ml Co fT am eall OTl Tam S aa] - CCoo Taeee eawe al E leT e e e --a -- ) C[ o amada ar : C a, eeam i[en a CCT ool llaT ammea e u al l tr pote 00113 000225 USFW 0801 Sample # LabFile# "Table 1.8 (Cont) Results ofTIC for BNA in Soil `WAH 2-273 Dry Run Creek Site 505B 127 DRO43 Unit Con. Factor pe/kg 425 TCT rmm e m T {woT[awaall wwll CC ooolume im T1em T|asm aoull s vwelr . Cl mee Co mee 1 Tuell TT sel al ET mee CT ewe TT wl wal | Teal wd Cl Tl woT wwe e TU l el wuedl Cal wwe Cal fw [Tom uel TT wal al Pol ome Cal uae TT uel TTaml ue Cal dome Cl lowe TT wal ed 1 [uml wl CCalooloowmesmm 1Teal wm o| oul ml CYolO E lame B PeSsl ol auntCone (Repose Far 10) 2T0DELARSTORBNASTIC 00114 000226 USFW 0802 Table 1.8 (Cont) ResultsofTIC for BNA in Soil `WA# 2-273 Dry Run Creek Site Sample# LabFile# 300E 135 DRO44 Unit Con. Factor neg 409 [Tose compowt [0[ Br|come| Lo]sofesam Twe [wn n eal [a ossofsumrns Tn|on] ol [of Jos TT as] a Cl foe TT mu] LoToews] wo Cl Toe TTaw] Co TT ae T wd Co aT we n a Coldowel a [ol Towa TTwel a Lol Tow TT uw] a [ol Town TTsa ml [ol Towa TTwn a Ll owe TT wel wl Lol Tomo TTan] a Lol Tome TTas ul Lol fowme TTs lw1 TTT [of1 TTT T el T 11 SA wom Ce 00115 000227 USFW 0803 Table 1.8 (Cont) Results ofTIC for BNA in Soil `WA# 2-273 Dry Run Creek Site Sample# ~~ 301E 136 LabFile# ~~ DRO4S Unit Con. Factor eke 393 dee Co lowe TTwl wl TT wal el TPoio mls lTle ow|[onnll ewdl e CCrr r T d o rT r Td r c r r r rT LT oard 1rd o1 r e 1 T d Gl 1I Emed Concensaon (Repro Fao = 10) 2T0DELARSTOBBNASTIC 00136 000228 USFW 0804 Table 1.8 (Cont) Results ofTIC for BNA in Soil `WA 2-273 Dry Run Creek Site Sampled 302E137 LabFile# DRO46 Unit Con. Factor eke 422 [Tow comms Tolar[ co] [nf0m [ oul wl a fowew TTsen] wl or 1 1 1 1 4 rT rT 1 oT 1 T TTT 1 rT No 1 TT LTT 1 LT 1UT Co 17 1T T LTT[4 . LT TT Lf 1 1 oT TTT Lo TT Lo [TT Gl [1Td Eames Coen (Repos Fa = 10) 2008wRETORBNASTIC an147 000229 USFW 0805 Table 1.8 (Cont) Results.ofTIC for BNA in Soil `WA# 2-273 Dry Run Creek Site Sample# ~~ 303E138 LabFile# DRO47 Unit pgkg Con Factor 40.5 [Tow] comm TTebm [ow[ cml In| wal ow Flvem reer Tn| mal ed Trrd or r d rr . r rT r rT rT r or r rrTd oo r T r r T T CT oT rr rT ctr ae d Td oor er d rrTd oL r T Td T rT "EmadCancenen (Repose Fr = 10) Z0EARETISBNASTIC 00118 000230 USFW 0806 Table 1.8 (Cont) Results of TIC for BNA in Soil WA# 2-273 Dry Run Creek Site Sample# ~~ SBLK062697 LabFile# `CRO03 Unit Con. Factor ng/kg 333 Lol Toe TT [al fT on a Lr TTT TT ) er TTT 1TTT Tr TT1 [TT 1 [oT TTT lo[TTT [ol TT T TT lel[TTT (of[TT [oT TTT [T of T TT 1111 lT o TT lol[TT lol TT 1 TT mers SE . 00113 000231 USFW 0807 Table1.9Resul"tWsiokf2t.he2A73lDryyRufimxCrPoecskiSdietn/PCBin War . CLoicattioDn Analyte sBaHmCc SHeapiacchor ABeHrC MsCheonttaneie En+dCorisodnftainne 0) pDeplaDriDnE EvpipnDDD Erpc#on-iDfDeTn @ EEnrddoenmdiAalntSeulcfse EMnedovnaKcetoorne ToaAvpohsierne1006 evcotorr 11222312 | `Accleor 1i220428 cvlooonr 11225680 perv weLK--osu1T MOL Geb) Geb) A0r0ItF OL Gel) Geb) YWom uU YoU oomm om UU o U0 US VU oomm oe UUoo;: US: UVU oomm U oe YU %% VU o@ Uuo oo Ut Uu U m oomm U Uo t uvu oowm U US t UU oom Uvo te UuU ooo2 yUS9% UuVv ooxx UU SeS% UU ooxn VUyV 9e%% uvu ooxn VVU o9%% uuvv oonx VU 6% uv ox oLoeaC0r0oFk MDL Gel) Gel) Uou oow@ oouu oomm uu oo@@ Uu oo;m uu oo@@ U u o o@ uU oo@2 uu oomm uuv oomm uu oo2m oouu ooox ouu oowm vuu oonm uUu oomm Uopp0e0rTsFAB MOL Geb) Gel) Uou oomm oouu oomm Uou oom2 u ou eom oouu oo@m ouu oom@ uU oo@@ uou oo2m oUu oomm uu oomm ovuu oofm oyuu ooxx uU oowx Uu 00%0 oAmF? ML wel) wel) U ou ooa UUU oo@x UU oowo BU 00ox U U oo@ u U m o@ UU oo@@ vUu oo@m UU oo@x UU oox@ oUu o0x% u U oow UU o0X UU o0wX . acannon 0012=0 000232 USFW 0808 Tal 1 Con) RferospofehberAenrtiiafeoPiroindesPCB iWa : LCiie o Analyte. UmwaorTsiEoA vo. gl) (gl) wReoemrs vou (gl) (gl) -- oy ou (uel) (ug) Jreo. Eopneaedi rlnpabegoie ErCdoomnttioinen fErrBioennend fFaiosoDnn rEFiaaommnremasntieme faTnosnisrosl rvaooi 330522 omttroeer 12b25o64t0 -.- VVvooooowmm oUuuo ooem UVvooooo:me ouuuvv oooomam VvUood0me uuUvo ooooem UCUooooo;ne Uooouu ooooomm; VVVooodioeem uuuooo oaoeee UCVooooonm Uubooo0nm CVCoooooemn ouuuvv oooomem DDUoooooon% kuUuoo 0ooo%nk UUDoooooown kuoUu oo0oo%m% nUv eno b= oom ubouu oboam UuUbooem UUboonn Ubueooe UUUmmm Vbbuu ooemmm oUUu moonm bbUv ooommm bU ooommm couro:n outst 000233 USFW 0809 abl 110 ResounltssoB2f2h7ea3ADnarasylyoRsyeiwmsiCgxdhoPtkeSisSdPnCSB CLioemeaenSli sexNeAs? 1% Rsaitmh 06 Rsms PHMDL rseurse CameTsMDL sAuTpA Coe TaMDL P co apr Coe MDL Came wks ugk weks poke Heke Analye pee woke poke bake ygks wvaotie tance S vvom nn uooyy a n 8 u uou 4ss s3 oo opUu u4 s ssuu u us w e HaepaHsher rn V[vv A oBu3UoA oobp omn hou uuE ooEesouvogsaosuuosu HCCrooerrdte aane Erni vvoBn von oory ob nnouu onn uou ss oessoooo uuuoou wesss oouuoouws BPrraDnDE fore v uvooo nn yooyv uBR ov h oH uou hu awassooouuuo6ososopuuous osu ErDioDniDin DT vvoBn ooPy ohh uou swosuouoeonous as NEniBEdrhriaioonnmnAKlwedteiohnyesdee 0 uvvoo3nn303 0uoy hannl oouupu ow4oss 5om ovuuouo omseausu s u8u us w e THeoowrtmonan11202116 vvooxs v vo2s 8pSok y pe S uu uo swo us oouu uo ooww ow u uo w u uo x oaloorr 11326322 eoaier 11336584 vvoes vos yp y S8 y8 uuvo uuvv oosxx os ouuo oowx ouoowo u ux x ox ou ow ovo ox Sonor 1360 vos 3 8 menses 00152 000234 USFW 0810 Table1.10 (Com)WRAesYult2s-1o7f3tDhreyAlRuym CrokxPSeitse icidei/nPSCaBi Basedondry weigh LoCclaiteioDn PernSolid Ansiyie BBHHCC bHeapacchor prioomns " He+opCCuhhaiicohrcdlaaonrneeEpoxide pEnpdoDsuDlfEin (0 EDnedirionn Enpc#oDnlDiDn 0 EnPPoDnDATldee MeErhdoormylefhnoSardiwe TEonaopnheKneetone Arroeccltorr 11202116 `eAcrleloerr 11226322 "Aselo 1268 "Ahrrocciloorr 11225640 Amso1BB Coe TeMDL woke whe UUw2 UU o 442 UUo 422 U U u 2 242 U U4 2 U Us 2 U U2 2 U Uo 44x UoU 4422 vU u 4ww u Uv sow vUo2m Us uU v 252 Asmoimc Cox w MDL wpke weks Asm2nA Co ptMDL wgke wake u UauU44s U U4UU 44ss U Ua a oUu 44ss U U u 4 441 UUu 444s5s U ou 441 U Us4 es U ua a Uou 44ss U UaUU 44ss UU 4)s1 UUU sesas UU s4l1 UU a4s5 u uw suumas ou u w2 UUm% U usmm UUs% Um Us U u 22 Uu %56 Up0aTibB Co EyMDL wgks bake AsRoEAZ Cam nsMDL wehke pee U UU 443 U U4 4 UU 4433 oU u sas u ou sas oouu aass UuU 444333 UUu a4as5s UUaa3 UU aass U U4 4 U U4 s UU443 U U4 s U U3UU 44ss U Ue 3 UU 44ss u uo wa3 oouu maos U Us w u Uos mo U us s Uus% us Us u u s53 U u s"51 00123 000235 USFW 0811 Til110 Con)iRes3.s37f3DeyRyo sCrfikeSeiciP5 CB `Based on dry weight :: LFCoisoeinn s 3 Analye pSarseiiscc Haiepesatic |i "* CFHeopotaiichnrloser Epoxide JEBeriiarorniein EFr3i 00 i Endosulfan (IN ! NepBEpbo-oaDnDsaT s TEoviueteKsee Di oe | tNnAsoocmleorr1mi016 : NNNirrr 1133546480 MsEWoGsA MsEo"AmD AsRwoEoAmID A0RTEmeAZC Rcewloeermer Coe "MOL cme "MDL Came "MDL Cm | MDL Coe MDL wpks weks peke weke bgke wphks hehe eke Mohs heke vUvooodwsooovwuoooff4oowuvoonmoBuoouou o88a uoou uw o@oa vCGooooNdn ooovo uuvoo4o4fououuwo mhhommououuoo@oa@ouoou ounaoa GvuvoooWdN38 ouUoouvo uovooofffoooouuuuo%o3390 ouuoU ouaoa3@uooUuu oaoaa vvCooowNwouooouuoovof4oooouw+w oooouhommooouuuoooaa@ouoouu oooaaa UN ouo4 uo houowouoa u 38 u "u 39 u 43 u 41 VU U u o3 3d38ouU U u 4 444ouuuuoo 3323%9 ooououuuoooo@43mouououuooa4ooo1aa vUoRd ouuo wfouuowmsooouu dee uvwoa vCvu ooosw@a ooouuuv EoloMw% ovvvu oomss49 ouoU u uomusw4%oybuuw58a1 vvvoooesw ouovuo o%8 v vvo s 8 v oouvok oo%xouoouu a oa L l. 000236 - oo01:5 USFW 0812 Sa 120 |CompoundName. m1 rn.en [refevoeeere Table2.4 (Con)RWAeSl2o2f7MSDMySRDAankaya VOC Si ate Vee) -- a.e h we w es a om GRD eke Gek0 Gk vVoams Com eose oe ooen wr vUamoaa s nme oWpm Gk) Rec. wm Re [ RID T=] omaoow mom oomm om a|m|e om awed mZ ow L ow eea|lEm= 273DELARST0BVOCSMS BN 09178 000237 USFW 0813 Lane 2.5 mA eme r of the Infe aElrckalSe1a0s0ions for GE cCnottoaropanueeissa1n087$1,17, pIuIsSs118 COR COSUeATmEO r fy -- Bo He Vi wae dan dhooonbsmh whoo Ta Tameray eEmRLhEE URE WTF RMA xme cue UR H movaww 12Thgi 7 egLeermtorhasn,e UE ee ee sTvsdiiiihmem oNTisaEprdI H nmenaetnnls E e evVsaanol aCcLBnnEgRgSRGHVSREEEEESE Tas a R liehmelene 3 cen ToLdaRma. BILE an fL ESHErISTreEee rSconnCiae e,e R h v(LDiRPinSHol CVLaElMaRs IBvsLaIiasREsnt vrR cIaoonRmymEe UaLcSARhnEE LUVVLREEEERELR GRTnIuiTNadiEss G5 ne 1a8s Ldna rP FLr iaUtkaee s cn ome eTcprepene pTSFnaiEhnhgSfehLmaieOmanhH iaeToShaeenelsencVlplSoeoemesinnsCgCLpHumuiURmnlLEoAoROoTIenS SR omRaaiTEsEmnR LRINnG oLTGnoea oihw P Unr EiAtReROd ESTI fh TThioRlt TI8mS0eN Pderwin HdE mEieeRs IahtEger mSen UaoSaoRnmIEC nEGnR TTcE othleeiihGSen8ll0] LbSTeaee HVF EEeERmeEe menosnmareee n me, aNdSMennsIB RdmEmNs e mHdUeeDEm uouSmEnh NE eMBSnLRERBGESNmE HEE AWEE NLLDoohoamadansyw WE Be OoDLnayRer ew H : a TNRr ia sdee, jSapm SBaSaiEmthaHimnEe da HmeH ag ungdeuubalee edmagodmken GhGwEeeERnE I oOdMRdE TE1G i0SG TSRREpa LSaHr HNURES ETr e EE pare JiL is --- GpE d wenrE l tomEC GmEaen mE ae iE E h R BN hR SF e SEEER Gn fo IR ha yHrsinlga]mnmeLno 2h C1viG3ItEe0REB88iEGmiaeSssesvnGneiahenea1Li43iasoBse NoLOTRIeCnEEHHOI IESERRE voTToooRwnTdTRlAeEe mSWLaoianed DEES die [eDeEmeEerReE,, ETEypR Efi iEor Hn a Vlit de dUUeSRe ne eAGRmSR gn BWGHlR gE en! mn H UgfRle R NLnReeHHGmRmEE om LDED a pTTPhhomEeEEnLLEE yi sE0e%dwR CuewAls Le eCwenEer LD wwsm va] GLoHsaEeVCL REBERE gL1TmGRIEadEsRRSh HE TR IE Gb LTiaied f E E UTiaiT a pe mRy i,E epe E hawalhieenh lravaemin hwna veeeeem wnHvwaasnEans aLELanEaRLmgRLCITVSIIRRIRERS LThLInERea aHseE ihe cGfTam1Ee To EH TELES TeOoeNr I LEA Jig CTEa en maaan we eeme meA mwme) Be hIl el R BE L1Had OeRlE Teii E TETC mE eme REieET REA tl LES T RaEe : CeE es s Cro0e0r0238 09129 USFW 0814 `QA/QCforVOC * Pfbrroemrocfkoooproummteithnaa,ste,e"u1a4nad-pdliLfedlsodrwioecbireomeennsctpt,iukneaededdw,cito1m4'psreerheceo,mpso opsourpte emisussaencdomesisbingyof tiocsandss, 4 eToreefnvt recovsearnst,radlssrlseadrinlTeadblef2y.T1a,blee n2.g1. ArolmS45210er1a04l.s`Aada5 rareessewerreowniOiQCC eceirias, Thesurge ReSbrsroourmmloottlcshlooioofrruteohbmseeeItsanis,atiseeerw,naelS"1auu4ad-nzddpia1lf.rieoiwrAloerbreoeaeursscasaepnn,idkeSeuddrw,riotgastned3RteceaovselrcieoesmpfoocnremVnOtoCisspurSoopmiuleamrisseetcoansisningbof sSeedes, 4. aed chomsbemry pTehreceentrmre)covewriaess, tasowalsiedaeinlTiaeldei2.T2a.laen2.g2. AfLrLYomm83e1r1a05. sAta13d maeesnwseewweiinO,C aireTa Te susp Results oftheMS/MSDAnalvsisforVOCinWater i0Sasmpdllineste2Td0l1ineanTda2.b32l.e16r2D.a3.nwedrreafgocehmdos5ef3nrf1oo0mr 10t01h75e. A5m.laltAr2li0lx es1p0iRckeF/wDmatvrwiixeerstspiww keidiuplOicCd atie .(MST/TMheSeDe) lanaalysies. mTheepercemnt recSoverSies, Results ofthe MS/MSD Analvsisfor VOCinSoil dmiipffeeennsc,esS04(lR0iP.nDdS0)2.inFaT1a5blel$e17.d340.inwreTargeleecdhe2f.so4n,mrf7oar5nghe0de f1m0oa6,mis3A1LsL0k3e104.mraAsoDtvs1e5srpRiPkweDedwupawieiaenmeMGcSCIMhSoD,)Sgazo,eamThe pPeTrE Resuls of he Inia Caibrasions ar listed in Table 2.5. Resuls of the Connuing Calibrations sz lsd in Table 2.6 00130 000229 USEW 0OR{E Lente 2.1 Resu of the interWat HStuIardbrryefsusnwCdreSeuktsrietgeae Recoveries for VIE In UiteT re Swples oFiwle wr1en Internalt2eStandards d3 oEope T sur"rToagateswT o edSas pw a a WM HIE ie mm Ben ee eT mm Bene Sa Te mm Bee m0 yo me Bee mmm Bee ew sw mm Benn TTT em ee aeSame a "ad cee ee i ea ssa arSoy era wwwWT HES ew TTETa ee ss s 389. e I Tr RTE e sumsoate UNITS water $ (E50a5) R Sramotie uarenene zene Ease) [ET ---- 00131 000240 USFW 0816 ie 3 eod f hog ot tesGres to 1 Rrra sown, supe8 Hie ares EN on FER TT a BT Tem wr dawn asm mma es a0 8 a i CC) ETSnwin aern r SnSh S, i WtWC) rrrn B aO e e id B B e l i i rr ne a ri Bnd Whi p vgn r SO A jim grrr BaTRLtienJ iJe oiles eaasn ses RRR F#6E51hHeanps gr5y o0011CZ28 000241 USFW 0817 22 my eto a TASTrE pre prin swe gers serge r tes PE ar T fe ou oe BEMewTH 5 1234 rr en eC WW TH e SeR is e He eIna i e w Tee H - RM Em TA TE SA agg BE He i] 0013 000242 USFW 0818 Sie (CompoundName rI o on fooee Table 2.3 Resul`tWsAof M2S.2/7M3SDDryAnRaulmysCirsofcko.rVOCin Wate. r aa e g.a o wwew wu GOL) Gel) (sl) el) (el) wwe w Ree Rec. RFD[> =] vvvvooooonnnwonoonmn oowoWww omaosh me owomo w omom wm sm s | uwe eanemoomm ow Rw ae me ee 22r30ELARSTOBVOCWAS 9012 000243 USFW 0819 Samp 216D |CompoundName r1eDoronrinies fee [Tolruenee ne abi 23(Con)wRhe#uso2f MDSRI2MYSRDU7 ANnaClRy3sEiEsfKxVOC i Wit ww ee Sample. wel) Spike. ah a Spike. Gel) uu u eoonn on uu 5L0 oonso omMeS CMSeD Geb) Geb) wwsm oaw a we a 47 M413 | Wo Ms MSD QC Limits Re Rec. RD TM Re w oww omwo m aajnwa ienowm 9ww9 3 mew n [7% 12s] 207 3DELARS708VOCWMS 00155 000244 UsFW 0820 --_-- cf fooTam--r -- eweeine Tele24 RemAit of M17ADSyeAmnyi VOC i Si (ae vag we aww e eae ow ws ae os emwmp ewe elw -- ET ::v : aa Paa Emoaowonoa aa ae m oomm o on n|n Ele ne om : a a omomer w one 22130ELARST0BVOCSMS 0017e6s 000245 USFw 0821 -- pant f-- earme omeee ae (oyRr emlein MeoSh AyEmDemoyiaVOC 2560 -- a- wMo wA eewe w ewww wien [PE | T soawoomow wm owmownoommooLaxonxon nosa alzlaleemeom o voww wwoowm Sm Rs see ---- 00157 000246 USFW 0822 Section 2 000247 USFW 0823 Table 25 (ContWREeEnuEof che Inirtioat CSatebracians for voc WCoilniibamtnioBnFfoorn$t9262/11/3907.,40, I`nsRtarxumiemnXmt 1103:cfoorpGo2t301031302.90882) rary 1: comouns 5fTeoo HaIlSoo AsbaieSoo AST who ASS whoo gn mb WT W xam comer SfHrircaiekkoikicnaieenarama fro 3a TT.R55EE56E7 THT7ES9E55L08 41I I 9U300 4LRIOdRG LCLhoEoAe0RT LALLoiANons Tas Lei ven vant La Lin f aBR03aSms nionen sTRaaaomm 3 Ll So ASA rttoEibtoerorortrnoesneetane Rerhvien lorice 8L$18 3H005R708 I70a330ed000 FTI TOERaCRoE LTpo"ERheELn 2LTTtaoEemnD iEThaiayem SEN Ta od DR LER I IR38 pTLoeoeEadn o3 vTneEge Sian i SJaenniTenEtSelroetaenynsRe apron IT2T0RhU12SaE08 021h ae CsOANnaEG La CVIEENRREE CIfLRIaRAEeE Ia oOMoIEtG LEIS LEN LG LR LB Le wipniosmiaeleey oS3a3eae% SB LIS fam A aSTtEitISnaIirOoIeprOapNeNneee TENRITsaIn LLgFiiioanelSsdriRihoeAhonsSLdSailRIaiGLss LDSIEhITeHE BTCSOEEhRREsD TSEcEAnmER LS 7l acoRemdess ST ST Saerst danas Learn Taam Ly LR CI sGooowr Sad SLSeErhen ere eene ters VTSTEEaEER dCmEaeNnlls a hEoaaetss dl en hn amwmeenedr sGCwhimees ouBanRnna wm dn BE coT0hp8eRREfBEEem NGS wee (IeSo3amod Sfam irermotatI vaale, ee Re EdfwDBariBCCEgEEE SE i URSRwE c BBNINE e GImRanEn gn She me mdR Imuien 1LlI m%e mmpmoa ds lan ime io obseemR sSfieilteratiriley, pit -- aSSdenEEn hm EGEn HE GHGEnhRR hGUhnoedSGlGEEnnS Gn Gn BI SdDnIeeREEneDT ILaoeRnny n2aa8sm% m(rriE0ee USD 8 ae JHTSoiaErtaeenatshesns ere ES iERcR lGi aRmECR EUdRhh r CNoOmEgL aEe m mRoS roemdsee i Toa 1 IEE ER RESOH Pen 8 hd gan fae. + Si Ff h yreaemientoroesane itt TVTiIRtRReEEr Toth a I nSEanEEg hLC (HynOR iLVmR EIEsSL I1HERE1RRE RALLRGeEIE IRL RE LG VRE LvJJoEEenR IlveoEenm LR a s4rra 3amn iad CsSL Tp eE eoT e nne sien VEiaghsoEr RDGEEaa ISaLTmEseS GHIolRnE!Ee BaIEwkNRne 1L8aD8 iss se se Gnd HN hn l6L05navvaneanyyse LR Am dLtLjnaauoe LFT TarEiHEiearSeaenee ne Hae BfE mERreSQO veieonie 1e G1d0eh8 c 1 0GksN00 EGGSEn MeEr Teo TEE LEED he LAR LOE La LDR1AIRBRR vmanei (ven Bw e0o sT ifii Eadiee sp ihei miie, tia 5TToGEa EVialElee DIaOAN ITSia00 Bn ATT DLGLOaGkNEs haensn CLLEOEHS hHeDn LLSaIOl vRaRl L1a2Im8B 38 mILTgraEamst (IB IB LcRDaeoan Lom hLE EeynvEdTel Eenorme freind TT1T05REh01 CeIGaEiRnLe EnTiEsatTe 1oTinaSwths raTHioyLHt TaEGeanRn CIE CSG CR TEE I A (l0La%Hmlivemeeees LLvs8eue7se 1 Te Lose Bfa TeTetEB RAeTrsciRE ehneetmenettimereeThdT5iH)TeL87ESApELnrEtL eelaaRtorI ie aenchGieten s DHWgiaime Et,nRhrL1ST0 IOe1Re2s5ScaeeTseowron motnmeora 000248 00130 USFW 0824 Late 2.6 tesesy 1SthECoRnRg EEfiracios fo VC initn Secrat rBgs EioStts,S$1E10,7, am UlraStol n Bates8IeTt,wTmm: 120 oo mg mes ~ t iBpoieirssrrs evpTTiammmemnrliciheeiemsmmTSei3i1gh88. . EB a LCe tiIae--mNSre gmt, S pavpimmmiepT iaitenssee 28ng. IERIEE 1 Tm E Vaa neaer s. lie, PRE ySDIi hReRamEmEIy miGEyEsL 8o1Utf3E e. Padiam i. _ iTEHJiliaAEeiARmrNReEeE, an LfLmmoiimeemiia agneBe ]IT238g8i [fia mraaEe R HeT oBaaahyeammakmy t2. n 1g - meA HD IR ERS UTLTThieembnlhoiainrhnm,ee SpE pdE wTaneodE aWmemyn oipn E3He. - hi ETerr ewew8 mee v1%e. . S DS pLEatn angrR e JEHdnoneeosEr maBoEawnFn 81oons. LT in SStE CI oLnyT -- tEe, mSie vie liehaem a d me n1oSihgB" Sl 8 08 Epp Un LronRrr.i EOSee oiPiidEnEoeS uEwsm d8i2le I ERE wenlnyll JsRpEe,, V(RIES B daann m avele 1388 Gi fh A [eirp tiR ai,Eee JEigeHm mR 4813 EoetErerpenrete. manyseSFictrheesi efiinen3,]G2108008 meen, BBUULIESTIE TEELREE leeTe fa 00141 USFW 0825 000249 Table 2.6 (Cont) WResEultsEof otrhye tCuonnciCrruienegsSheCaelibrations for vi NIIinnisnctiiraaunlmeCnRatFlifIboDr:rat`SiGHOoEUEnEDDi:as1t(e0S:.0G36L6/A1T1Z/S9075,3,CaNLlaiabbzorriaamttioo0rny D11a0t:e:SfoA6rS/HE1CS3E,/E57f,a Time: 25.08 1:17 DEVhEilnoTtraTmeeEntlhoa arnieae TTHiZbEerr wUami az Rm ias me |e 138% UE 7. ChBJirrcertfoenseatthhaann-- ee sTliieggaosede cVmaar0inn 937s0 AeCTeiSrtiooTnneenDtiosruarettindeene prlraetitme pv"Gueimets7L]a2s KNA eetthyiteN tneerSEtniliT aeororyirbdsoeetS vtineetnmeer R18110E07328 4fL.a39e303r18y3 e63170y86 2i2a2Du5rllaeennnntteoorroopertompaannee SISiTghEs vsSaheyo 7T1m25o ow SETnLt1EoDrlseStRoronernotporrospeetnneene Jo3oi0md7 SD2voiilseiaso S2335s8 o 1TL1E2DEDiichnTltoorroareetotnehaitnnheea-noek (suRR) S2.mE85e1E1 T2.S38ha43s8 as3.h90 CBTaeirncbzhoetnnoerToeetthreancehitoere la idseta lmaemegrs Esoaamr D1Bir7bo2rn%oeindecshemtneattrohorapansreeatphaannee. lSlaaesns idmamanew LVeaas e ETIrEeaTiFl hD3iio0crhohosrtaaprmroaornpoeepneene 3Sd0a7sm4s7o LSmireea) 13.0083 ((Ccoonnccersst0:.0000)) B$$i13b2rDaiTmceohciahonororoeaptnrheoaipnhaeinnee laFaopniks mmew mes o5h 277 SEToileoneetnoarssdsz p(eSnORtAa) ne fS Jeriod FR oe TTheoettcreianeneRotnoeraetnene l1 Saars gHsiaionn i2n8e . 3% SEihTnljoirEboepneTtneettneaencentoronthane vl4i7od6g3es3 vdaaamssosr i5.2i000. we BSSxyEyrieenneptions ITJaenEs Viiseen 1ot (Conce100.00y pTTsWdepmerioaiyiteobtrernoazmnetenosnreoneeth(aSnoek) TL38s7Ee8r0y S[es3iS1003f ago3ei we SnBioorSraeonyeTinrbitecennnsteeonreapropane giienEse Bndeers os1ll3s CS$ichshiioerraPorriaatnrvueeeynnt:ebenene vSGaEgsE vBmeomms 68T8a sitTierbRaayiiteTmnoteeinninebenesntene TTeoEanEs kvSeao nn 2Thk 2 oTSi lLEseBoEroomortratasoeernnorseeenmene rlaaaiik soo aoH tsas R2T4Rs FVTaEEutDbyioinnreonortaennmsnctnetnoeroprosane TE Tren orapenrene vW34i3U9e1 31E2m2m01 ie lan 1w36.iN3dS8 ReNSisgchthnlaotreoensReutoraegnieennseene vLocrloeegss SoS8ema0y 108014h0s 8BS1Epec+ RLeesTpnSonneseeetmfnaaBcnetrosrteorfmrTaaoncmceeecraiCthtyercoksmtaCIonnmdipatoiruadnldfs.Ciolte(f0oa)trati5o0n.,00 gob, eDieff - XCIDBirfAfeErTeonncechfercakm oCroimgpionuanldsaverage or curve mosunmeotaus 000250 0014a22 USFWFW 0826 ote 2.6 eo L Bats ofosyhe a antiga raons or GE oemmtintneescaaTpraossirn iSeoc ae1srts0.3$0, 1ET,, aSCbarHmaesIriaoEDnoBlBereafoErdCoTb ta Ye 2.0% mp sm 121 S o SFloanreemT riirneere, EoVETpliaamEsvTT nhamEsm R I3dNREe. E i nir d e EEEimaerBelo|l,e TSiIShEEEmIS aLTREmNAeLCHt8%h MTFSSeAiaphelseelcrnopaa,, ivrHfleamEadnmEiioaiEammeGnne 1To8nH. 0B eres oh. BdfTlraiEatrReT oun Jie PcSTsaarmampiernimlse wa 11LihgnE iE HfEe eimE,nee nee SEa e ae ffwdmolemeumEmen UR iiE OEE ML eee VTU LrReAeTiEnsS Rn adEBEEneE l eouMamRmn 18OBE SSR HaFrehEeET penne he ad mmameom n olm yo43iRG. fETaT rnrEinea ohN ne paid JvJd1omne:mieeeuenemJ 1E2 L 8 mento.) e8 , aIinceH-- LEN, i cmhae8gn GoSaE Gemm i118BB 8 FHcPaiooT Fo oi meee feffrcnea vhs meneh l IR Pp E B H E rm r n ,o Vymca EeRapaLEemEs nt0 vamerem 1K . i P1h3 maRmay mmTaTnenreron re cEaksI mBrmomn 3 Gn U SH omeSayr noatecreertrfemramtntyysmg saemreenfnl 315o0o.f00n0 wp,e RB40U + 3EiRfCfErTeEceRUfErm arERR Spec System Performance Check Compounds (**) " iors Lk te. 00153 USFW 0827 000251 Tbe 2.6 Cont) Besgtsn ofosyhe scoemiinnCabrio for vc AnriistTiaSCaatt1brebt0ersasien aBIGarts:A4/1L/97A, cm Caotlbirraatie ioonnlaeccees0g/139, Tims 2th S TCEmnhEeyrRerE ,Re TrE Tajiaoisnrmm ieesem m RhbbeynXe. 82K a A m 1eeoreryronree fLVmocIemE0 asRn uy memipapnee,sime, L$Bpoaa2matiEn0nD0aa C0Le32 yFwfrEaheReSmmo.p.e, Lppppnhmeeialaoonsmms rLbonEen BRE Ar V JeErEey pmrN oineeTny LITm mpammiLeeaan ti1GugEe . sB Sheenn re T eneane stale ednmaaemaammmommeeEen ooannx oo E TgTEror SatT, ioI., fEEfrEreSi OEEOR OW B e cose . 3 pSJH irbaaraenolorie eth re f f fao o l o]ob gen ee G8 pBEfreeta rere ne T dan m meawem Euveee Eee Eo. . S FPFDahrraEeEmieroune TCmS2REa0IH ReE HF8EagT. han a censor E aBe S E nu E eaae rr nA s eMc0 mhR egoae IeEnkS eH 8En L | pPCreieI mcisT Tat imgaeeR eaemeBooLnne er . Ri Le N, ye rE L aerR Eee 8 ue PTTTiEahTrma mui,ne LEE a cha gmaamTnsReE Te mm xoL8Bd on BLr EoBlEi --. B8a ence iE BBC-Afetm oe fctor fmrmaarntrytcaera i(le a413S0.0008 oene, BA1f1 33aiittteheee trtroen irgiinst,aavar es or cures - SPCC System Performance Check Compounds (+) Sneek tn sess 000252 00144 USFW 0828 Lae 2.6 Coney wSazEof oshh EcantenuieCaleasias for YC Itniresaiintceeaater1rsa OoEpEeG: E/a1AT,, CTaamberraIeirosnTD1ateTToGr EeItT1a Th: Bmx 1100 fm flaiametnir : t i TTVfoEoRlRBTEoeeiElmmD PiiInE, - iFIsEmtCeeoTnnoSreonmmmeneeen AR TSrL7soU0fa0E8naTatahesm 3 dv on hE astleene srABeol rrdee n, ers Saree pret FLPCieHEtaeRlRLiELfIEER LEG ciB3iE FDEAaErSEsEiTeraOreprNopr.e iTni ENT on fDSIiarmRrebEwEa Zs aasye 11a. 8TH F STinMieEa racnemaree nse naSdnamohmsne Eos ooiifRnm. de UR fSr agITbriEaTetrhel remnl.e, 0 mdGannn SAdoghEemesed 4aiB8%mB dh de cEoncrsno.on STsfEisEhsieiirtrepreeeeanernonne ahGfreeimdooues UuBhgH fa jnir edne semen SCUiTnIEe ene aq 3B0na7 om aSs5m0 a. Ti3nm8 TE JSSSahtoeieemnnaisns CTTSaaRmekLEVeEeme 0gien CE ES conenra0.00 fR rI HEaRnEIpe, nne pissecan i a S5m SdadeEede oLEn TH Rie aR TfT a F ieen nsO nrf e i.csCT AeMne g pfGiEarSs i ivae 8 33 wt1g+ E G8 pSHrrhaeStieTty Eh ICa ShERvlnn SE v8Tsn CRE oR HTLE LE ihEteEn s rneen ER, CLh IEEvEe Ehs dE38Rm Sn a 0002553 poner fra any stanfidleast 30.00pon, IF Eoiffferorn anricgeht grass oree bration Check Compounds (*) > S7pc Av+eraSgyestReemsppoenrsfeormFaanccteorChfercokm CIonmiptioaulndsCal(i*b*r)ation, " Tec - Calihe cre k Lis 0015 USFW 0829 Table 2.6 ant BeEisEof Ise I concua rcat eatin for Voc RiaicIriNmneTcnaefeorRfatSH oEn oPtS eI:Ae1E57 CWattieanesiontoSeesReE757, Times 11:12 r bSo mire me ro reeTRjfHcTrEciEtE:y Roiptyfke - iEr3taoe roisrtonmeeneane eFaad5aT0Lial8smaR1d8 m TSrEEiEiRreAneetsee, LfSLpiEERShREloIEgeRRRsR SN8 i1HRn2 . FElR aamrIrH y aR ne pL5 pgiahgniaseeJ Itnn. f[TsREi eitnRe--T cnn SsEm rmimit0 eier 8IT1EE8 fT S HirE nee trg e mff graalem IbEn SSPriTrmIaeRiEsnsSe , fEBaEmhEHEeEnEe 84iu2Eg cuonmlo - pHT EirEoaT Eete)R il sae aEfadgoEsaRmo StEd anee Ba pttpeecans mmfmErEE ous dE. Elerleacencrineons Ev5a00eRh0 SoRs5h0 GiH$l3Rh. . ShSHhappeioesene mi IeREiecIakEaR iIR 18 cowmon Hs [D eiy n ciaSnI , e dSiBcEooI EmaE 2J TiLeRotEie nie l E i a i a EneE iIrEEeB EF FE rinahe , m[LRERIaEEInrTD i01e8 Fm Fnhs ee i,n TECSEREEEISELEEe O83IRS JRiaaBata he BE uf NaHR pEhthalenee ren 10p 1t3i18n8 1r 0h36a10n3 ]U20R58 000254 1B smuE ctr frm lly soar 1s 0430.0, DUNE 3L 0iffeeE ne fron dorigiana wane or curve SPCC + System Performance Check Compounds (**) ay 0016 USFW 0830 QwaC for BNA Besulsofth Iiema) Sundard AressndSurorseRecoveries for BNAinWaiet consistingofnitrobenzene-dy, 2: oe TferRmoie,e nesdoeranrndtaimsatsteeB lrtayine Tenoleddo2.s 71. oApmLi3mmciror7.csoEmaiantng aofo1eweorfle ioipnrptQCercenrsd ,s TveE eSien Pfrliuoorrotboipehxetnryalc,titoenr,pheeancyhl-ds,a,m,plpebenwoals-sdps,ike2-dfwliutorhopabsenioxlc,omapnodne2,n4t,6-sturrTiobgraoimeopbmeinxomlu.re After the extracts were combined an. Rprfeosuurrlos10aornfeirto,xhneo.lCne,hae)ea8S,tSasEndRparidBeAreseassapneoddSwunimhorg3aoseicsRoecmowvpmiereii4ensr6foocTrogBioeNniAemnfgenmSoofsil1lx.4Adsiocnliioebaeoesfxaeszc4aest,bwepepeHonLemadla,edey Td,ey rnshn. ahyseedr, o To mmemd smart esa t led in Tle 2.5 3d Pendy 1 ATlbl e742.f3.ermaalgesnodmd2w0a)s w1e0 e10i2 lOseQCbancdireda3 To Fevers wie wih QC li. Res Camper of he MSS Anas for BNA in Wer 00201 an 2211664AviweereBc1hs3for,ie rPeAE sFrpyks okueofd4oloev(rMSMwSeDr) wsiayns,QCThlemwsE,iisThQeC . ~ Sa --ample OUI0LD1T08 e Toe 25. rasp fom 210 26. All 2 RFD values wer BSesolms eSosf0039h8eD3aM5S8A33S0D0.33Awneweriesecho0 sfeorn BfNoAhein EmSoairlshsplkosmuarnt .spioetcofli4csvOUeSInMSDw)ereswsivsialQsTChwceipetrsieiTnhQC . SouenpneeLe Te ed Tak 2.10, raged fom 11036. Al 2 RD. Ress of the Initial Caltrans se ised fn Table 2.11. - Ress ofthe Contoing Calibrations 3 hed in Table 2.1 . 00A1L4T7 000255 USFW 0831 Te27 euie ogrfI th rsWtgSPungLgsT3Lprepats Scorn frB-t1ate CALCHECK 50 PW BNA SOROD1 61848 EC a En Ha i262 326978 wa TTT Mw HA T ECT E Ra ER E R EILa irT E i E iE E Re E ReT gsTyaeT TTT 002010 ws soR06 47780 AEEwRe w EEe E y TER or 002010NSD S0R007 49178. 2622 ae Jesiay' 16327 9% 03 FE i HT E EE E aEEER TE TRET 2040 807 SDROI0 _4g407 225744 160537 8 5m - aE ER TEY TY CAL CHECK SO PPM BWA >0R012 74730 HEE TEE RRR WBLKOSTE97 HDROTS SST3T HesEa GRR TaE aEENi ea TT ER TREY 206A W121 SDROE 84146 381673 255085 mr 222905 mem 1rsa3s 8 ke) k) 8 ow or bed on TT 0018 000256 USFW 0832 Table 2.28 teResuts ooffetohretInm cSmpgaolr,tSSsERp; AtU Supl eSTEspores WEi" wiml for A 11 Eel eerdeeaielwHiEtiT lw-3h"Te E'l J FdwTT dam3ees"JE .wW r. a E Shom E y ee we wReOT ed] Juem Gam WR 168008 881 BO 9% B Wa he B6 RTT 7 eres Sis eon ge ee sidesose oR sBiaOF ESEES Ta hm B wR n E seg Gas BB 8 ee iy TIS 20) Teen CEE eEi ae a sEee a e wWemee E4BE8BR8B T eg ERE BL Rr TI anh ww es mB BB a pahR e En RB RBEB Ey EER C: EEaCR g EE Eum T n Re E e WwwmwRR B6RR8B2RRE%REF . . TTT S038 s103 oDRO27 Sse slo 0R028 5038 S103MSDX0R0Z9 304t $105 SDRO30 Jose S106 oR Jose S107 b0R032 Soa $09 OROIS S983 62476 61730 64238 S782 3622 TSE 208325 292075 23625 303636 77617 315269 BRT 63 202798 196903 200091 189929 203905 22219 ee REE - CEe E aa h eRBBEBE $308 $111 0RO3S T9943 382636 244698 i CI 4 $i S112 soR036 6265 307738 192589 pre RE EB Soe $126 S0R03T 60298 Ta930 20903 nn2 7 bed 8 er nn TM 5 on SRE TTT E:) TM 87 WER TTT we Te oo Te TTT FE Te TTT g aaS m 51 (NE; 0m seatSiena Ra Ga; m (23-120) GI $pBal0ol n si e o e G 5, , --1it BE SR ] 0019 000257 Fw 0833 us! P18 steotosL are PAeEnE en swpie eH ake ate on EY RE ER E J RESEET HEBIEIES BID SERIES. EB rms Lo 00150 000258 USFW 0834 Taste 2.9 ei5n% of598 BR r hen R patsforBUinvAat } E oei FE R THEconch E Trmes| i,ake Hin 5rEi {o-- me = |rFmes 2 it a Et {at 110} 0 1p J||E pHAeFEiaposreLeee TStmeeet= i s --ee]|| 3 58 5+:3 8 g w82 8oBw) h rE Ehx:i4lr| ii8E Eaf;neeasae}| ; ree! FC fr LBTi m f E {feE= Em RE -- R-- Ba1h8 ih S E EH BRoal aN gphii iiEh n E3:a9n E|E HairEdoE Er =--= | 8 | E lj ll8 dl-- e5eig EE dh we HEE A :rl Wn Sol Er i it Sample No. Ri | Jeoucrniiion Gar SH : LiE Ei [F E m e WTOSRE {E { Ttii arnee iaE8 iiHHnoEi H nEH kEdi lnTE= h8e I --iil i -- [-- nnnTHI Lora w ak T TaB| E ga 0 it h H |E| hiIee oeErne RFEm Ee R tl jiiiee: LEE 5 iE-- aE gL HBgieaEE eaLllLi&Eiti iji ie-d ris) 52. ILNRREE oo 0915. 000259 USFW 0836 Tbe 2.10 ReWgEs E1 oSeh 180nstiteto Bi In st ;iSemple o.: 503 8 ny TE echon oconieaarsion Jogirs| fe ke a)DT |[ Pe paEET SeEa ae REE eHEnE eBRiEs ~ | eTnEiTprHesoeratonbeprreonss| 35 S55) oSootd meedsss 88 [[Esiie epmbel {pm | Shore Faethyiment] Ew HaEHl oGEioREof B mmeaallg5gfeeu iist || pByirnetnea.chioromenst.----|| sfeka-ecal Rael HWoOllEy m ABe LE i|2 cowsnn||dGoiavree,y(lcGoCuacekttBmearioRn]ak%Ee L||aaxh |||B oBc uEmE irsE||| - | | BwDwiEsO reeasreeNtabTpros) H# SEER0EE BBZCl uR p | EB 1 E8a E[63a-3an2e! { [ ieE R eeE E ----E S --1 BEHEElEE BHHERaREdS E BB1138Bg jeRaNeeR ||| PBa rernieancei h.ioro omnene al ]--|! EZmaEazCaa LjEiaAdslLe &oBs |L|Kea8 ||N4iA7 Gf(aB)sEt) see ~ i1 EcoEmounonme {| 3Ea5oE3r%ks|)JeGaoyruEkLecionEc1 oNAucGTeamrEEaeyTR)ioTn]ak3c [[HLiEEsiCrs]) [|E PaErrT erme a] TE1 3s 81 RSsoRn TEETER Sas sf HdeeEeedl! BmbB oofngEdeG EE 8 aie [ || e E Ene s n--n--e --o1 || BSiimadchiSromenar----| 8 Sb3e3 8l5 fEoRgoEst! SEaeEBd BLO7E30R0 EB8 BeBIeL EeSR BEoRwEl n REnE ier arenes {WHEooRsE SeowSctiEimarLionEEXL x B | scu(mC | || o8ThEeRnaO oi rRemTS)|T Se ECH erate] SE E X BRTABB|123118B vgEyuLe Beng | dg |g fi P | phRe aEsSSeeT ttOer), BaBttiEratGc BBHiEeendnIE8Y 1 B 13BEB NEEO | Esoinaorner||od2o0e3f3i8a2l1l adecserrtesSse! 133 |1s47 hfailats! || Fbarnetancehioropnenal. || 0w83s 10 BRioes) 8 a3 | )oo ! | oa lBiErNeE! TESTERATE tf e ll 09152 000260 USFW 0836 ore at spi gh re tr SES, ETE EEWa # ne 2-273DryRunCreekSite. srt i iBFuoEresEh ee EE BET RL 2GLL aaEE) E EL11.36E6m00 1eL T.e26El4R42TE E1T.E27h67RR2 L1RU.E4aGEe BTBBBii1EmsU.2ms07 45o4a1 Pn SPiifEoreeuuLsmeoe frahe gs 353 chlorobenzeneener U[E 1i8R0EE8 t N1Ee3O0nWdRe 1 UESSa EIVibRmTIaorERelEe Yms0a Se:nsRa 1E00R 60 aEi D n DoD LRER Ba LAeE RELWIiTRel TE 7568 FBHFi Hi RreaIEEAatCREuEo sme High. .. 4S H f T408Eh T H RHaEEs BB OR aSSE Elkn EaameeEaEvGBlgeRRms TBHlBBFRoOuaalOnngioiennee fBsGBiEciRbniEonEeEe gdw aasmoml aousmsemHdeHR R edEkRE EaE HasEek BEBamaEld dannmi g2T0e0 HHEeEIREc.o SSSehxeahcenrleortoecnyealmoompreneneahtnleaadtiene EEREBR BBEE BHoag a ERE RK EOE Ee gsaieoaenr UaOSliE SdGR5EE0 SdEiGeEe lddoiernns 1m.m1e5elseahewdns 1W1nE00iQ) c 7 12100 IE 118 ae ihe mee wes RToal - Epi Hasriamrti)tiane rHEig vSJ SiEshRE vavSeBmn vEaieaaD8Rln AvHmeEmEd o1 ERnE GRS EE TE ERRaee SGFiRnrEtaAneENtEEnee.ESHU E EheTiR hEe CbmEi iETmisRmVRoge vniaGhise aa ZaB - dpHa ireEomsEedaMoeneno:y aemiener EJ f dSEEoe mEsE oCn Hat w I WmR E oeHWrEm R BmBooR ER mhE ImW fe 1 FB HlR CHbF orEEt iVsEheaEiRn eaee batl e ace HTBREH Tie EE Gimmes PEEL Lan a He ETRCSR TERE BR Bi a EE EE EERE #2 NnTR, E a TR Sheen BH RII Ee 000261 090153 iRssapirinees 3T0et,e 2af ounW gA aetngocS , oom:p9cyio Bi j2Elgcmov m Winimm RF for SPCC 14 0.05, 3 i E[n18RWoax7 i HwimEEm % 011e48wfiorE.ceotwiss25.00 ESHEeEsEET EiEiERvEEn GowF EH F Hj FEEyiaEEeMen CE lf d FiHsIik a EES I8iyR HiHS H hEmaEaE ET HHf HH&EEEEAaa EEiE.eRC CE H aflaei.se el.f., f BEHoEeFGadRm aukge . Fc pHHEaaeEnnessEEH ddgF iE Eoaue aGsE fHE{HEiirimeimmn h EHdHdHdaeg Essn gEi Tiidge o EEE EE. g EEEE 0 HSii iAelneTlaEealRaSe. H4aAEE8EdEHaeEE gtAHl. EF HiHaEoaiN d a EokE 5 saiaAEE m HHE iee,, HCBEREBEERGEEE EHdERE. EEGeE lE BEiiEOaeEn i EWHRRieEg 0a. SPEC System Performance Check Compounds (*+) for a Rp. sh lad Eg TerSeAcm,)ony22t2.32eInpoS iGfT SnAnTtTiANocatfioraBA BTLiRHIERcmfoor nsec 1k 0.05, Kameratiopolmi ufor owct s1s 25.08 {niEiRTsE L4. Bil)mone {P PRnEe E TL{j0a88aagCahg0n8 Eodaea. nH i E T icy e e . a e n:DEdd EEEhIa I EaEE 4hS8ey fH E SESRHiEpEie eElnte t pLdHdp8iEeeEa wahHeeEeE s ]1Le 3ion a En i Gjm HeEReeantrrsaeiE es Elli e P HaBEmEe E BRdE ]iGfghE.C d ie FPrEtaSyiRa rSE e g mdop nn Agee E hH is E aim BaE Hn o ELi rLnitr e.--- E rgilae E eEElEl EtEe. n gE a fSI Tiaszmn ant. HvB p EEi EER E44RR2 CpLIEIiNiTEEmTeormomapEmhEeneaet el hn J H1Ha s8iEE8d E HomEEheR A7gTtG3ReE. . i ooro-- jeEiiEgERsgIAR Ft $3 BER crobens dine. Rlehd iam oR lw E7y a TRE EE 0f8a. Ef e meEr e eRee E, UI E HfRf E E HviS 2BRR0YRE FF ve rm ater sar tse 113.08 AverageReEspEoTnse LFIaNcEtSorfcrheoemk CIonriptoiuanlasCa(l5ib)ration, ar, `c c BIE ce ++ - {tere fn slave ps eaCtiabrlatiibonration CheChecckkCCoe mpzounds (f*)e,in oor curve AT R 00155 000263 USFW 0839 Tile Ca) 212 A tte oT f ho cnE g collate fo ek itniiaadsl eabrraseiRonneEgeeC: 71979, GE matbircionnR pu,es 4/n7nTom: 128 F= Soirfiegn j3 BWEEREiE a Em E E m8B.e BH{iRbltmoomtmonoe {{E0gR8eIIEE 1B p72ricEhigrEobentene m I[EHE ed IeE ioiEfy BCHistrhEnloirorsmcproipylreether 3Lf.392E6i6 I3.e1S1008 88i.H33 fNif ftrioabem nrzeene et BffE errERaEaisnEs nAiElke)) JFE W pL hanaidaE mEleTTe dmaHHoesEeEogeEmmle 8ioTirEng ST a a d 8 E HH EE: seEHHSiatilTooEEernoemmtaRpyRinliondaptEtinteu.iene CE Bd fEEiRgEa EmIsSe s ineg oe SEimi i EEEEE gE GSEfSfrEetliTiEEiRIrmElEEsiSsRs-ener H a afdheoE m a aeben HeHEEnC 4eg E58 HE 2 on - F E Hra e.r Sei s CI gd REv fEe 8LG . H[AoTErR. wEEeeekh HE aE H HLLPheREnEantah-- rene. rfT1.oa0Ee07s64iiLL1l1EE1i4d5EEl38 13.67 In, [{ FsSiirysft,m [(wpBabEegaERsSe]EYHE Sn [Eoioge I En Irae Savor ene Ea Dibenzoca, hyantnracene Vjodoe aiEe 8 gh. Bo95281 LEE 1012602 BE18.38 F3HtIenet RfemEail i canta ieega J30R.00.sam,23104 -RBitierefcefeofrm raigrnal semregen or cue ------------ 0917s 000263 epg Laoten(coyp 2.12 S peahd mT Gof OheRI caTnm tRCEa ifranciagns for Bk ATRRETRYcofmorpoSupnedc 14 0.05, wKaw rineRoltmh ifor cmok w1s 25.0% f SBhteEierleL oroeenyireiner iav 1n -3ne 2 nT116e a1s30e LER e13UCsRE . WF SL LFHIREnSTeere chi srobenzene. bi acmaane o=hle . en ITHEREE CHR 4 PE aC $93 gH aIH lNheieI peopyR beirnneer 1LT3E0f2E8 TTa EERR RaSDEh)1 f S Mfiiierr art noieen RPaEta a fE nrig oR Re ms HE HR a8iTEh. UDC FFL rEiEaN rTs ae ee HNaEghthalene ne aaeme agmss El E Twsueen u (97Ek a5i.d78 LHLpp iaEteTei erS ra sien!eh. ee fumdgEoog iaHHengE Sgn HE TE TiuEhe. fEgaihottiartrneimaainimmntdnaiteeens! vV3S a ahEgHE ELiEGREEee EtieEhn FSLA Acromimaosrsitttnereinoesednat E e R moi h s ciate liTeEE on igs inl 8 =* SBpSteeeEtentnEniaootvleeens ener ESmiEnEeeERs STEREE in wTnH CREE UE 3 - Haren D TF fEEaTtTae hbeEes e imaets er 0 aldaEmei Ea wEEEmE)1a 49oahk. pfreeiaentsitass CamcRogemEELRRaEEEm WWnRSn inEsHt Treen VvEeeLiIEaRE Sh RE Nfinnh. on SSiR SitmuiaEnnmnA io nescae R ne ne EoryieEne ontnatace LcTwiaim smgia e nEeSer TEIN dobTkhsh aul. fSSs SrIhLioy ennoard,es smn Tnv LaaEmgeeLLSeuIm dgeE om Last W2TSoh5euh. R RH 3pu0dmememe,lEeende tnmSo?nyhnaFraeaRlunidlscaelib3rac3i0o.n,00 sre,BIIFH BoBtiitftferenrGf{Eorreecy SeokSpIRooliglnoailsW4e93, Bi AYER REIS ARES check Compo 09157 000265 USFW 08al Table (Cont) 2.12 WTfus Rofthee ContiT ing Calfbracionsfor BA SIIntnNeitEalrSaCatItbessBiognTtpureo:es,3/19/97, CRMaRlRbRrEaNcItTnmOioRNnieSrhaoSw07,s"Time: Ghent compound mw mi ewe DhBFreiaihntgovhortoeyreener 1IITEHEa-RE 3EIT0E870eEE 1ENO0.Gh0R9 . FH THE Le f sJipaini s IfaHEEEREEEE EGg8. E EB HURLE ET S pcooprtoapneimneeerr 31dE31070060 308 LAE E190 1E3 iif ne A fri i E EEof SiHFLiEBE TlEsonennt nuns f (aB0hE10iR0oRdmsei E ] 63CR. sHH iERsIiE ine ene faHihEi a oa oTahg + ofRraStSaaleneIrat $8888 dhEE e3sY F gSEithholf oreoimme aotnnriotneegnnsat CaffEeseEoiIHlRehE al. BE SLimaei nTntuce T3E LHaRe 38 AFEA enTmtataahnotnistenneat ud gfirc iits tB a ersA a TBIEdEC .non SFEieBbninreoltuene irdsiieds sine AE LO 18 JCI fiEcasn rereene eny nnent eriener |iR 7EBAiaedSges E cTBiRhEi HEHR 351 L psSeihne tsatemiy ener 8 3a08s3 [nAimEg BISES C BE S AfFnrerrerm es a G[ LSEiEeRL SLLe EL EER 4 WE TfpeElnierate nLLhiiEseg aEeRnEsEe N5IeEl8e. BE R rememsgtE saE sineacSA ennare i8LE5e0RR0 LLEdEESgE IR 8nh SSE SEieEni omran ian,e LTLLiieaElnkee iL1a 3En5E5 28AN8R. S HPEECRHEE TovrR ene Ew aRa hLn aE waln 8BS5eLt+ BesooMnUseHEfLacILtSorEfRInroImSScaoitr yksidao rocnaradtfeLiiEet8 Hac 00.00 sum,oBRifH - RRifIferIenceHfRroTm oBrigiOnal eori age or curve 0018 USFW 0842 QAIQC forPestidde/PCB `BTeoseslssuomofgtaes SpuerorgoyereRceocvoevrieersi,eslifstoedriPnestTiacbidlee/P2C.1B3f, oraWngaeid tfrom 42.10 167. Twouesofl20rv ecoveeries are within im. Is ih percent recoveries, listedin Table 2.14, rangedfrom27to 98. Thirty-seven outof 54 recoveries are with RaWeasstuselrssoaflthsaempele M0W0SH2OML0E1SFwDwaAasnscah0ois0se%nfo(frorPFetsheiBcmiadueiS/xPoCehBdispcpiWrkTeao/omtmafetrre iex 17.e AJica6tRe ODo(vMnSi/GMdCSsD)lriaemniatlwy,siiTsi.heTQhTCeelaipievre:cepnetrorceactover ied Tal 215. ge5t9 284 J, T sRaSeiaslluslsasammopplfleests5h0e53M08S30IMaanSddDSA300p33aFElwevwrieersefeosrshPeesnicfio0gre3h/% 3ePCBmM10ia8%oxSaohigl eepkcnFmanroitszere osp(ik0e) 10e p85.lcTeOaCSeoTuMtwoSifDt),12OARC.PNtDi,mvsa.ieTsTHhaerPeErwEeLlia,tyh Frondices (P50, 8 Ted O3 00153 0002677 USFW 0843 Table 2.13 Resultsofthe Surrogate Recoveries for Pesticide/PCBinWater `WA#2-273 Dry Run Creek Site Sample ID . WBLK 061497 00201 F 00200 F 00206 F - 00204F 0020S F 00203 F 00202 F 00201 F MS : 00201 F MSD Percent Recovery TCMX DCBP 9 a 86 160 * 80 138 9 157 88 169 + 82 146 88 166 + 81 152 80 154 + 84 156 . Tetrachioro-m-xylene (TCMX) Decachlorobiphenyl (DCBP) ADVISORY LiQmicts 60-150 60-150 Z7I0ELARGTOR pes 494116614 000268 USFW 0844 Table 2.14 fRoersPuelsttsoicfitdhee/PSCuBrriongSaotielRecoveries `WA#2-273 Dry Run Creek Site Sample ID Percent Recovery TMX. DCB SBLK 061797 512B 5138 514B 5008 5018 5028 503B 503 BMS 503 B MSD 304E 305E 306E 508B 509B 5108 5B " 506 B 507B } 5048 5058 300E 301 E 302E 303E 303EMS 303 E MSD 98 EN 9 ES 84 64 82 64 85 67 9 54% 92 84 67 EN 88 60 86 55+ 95 60 83 88 6 a9" 84 as 8 36 78 340 8 3. 9 a 84 38 88 37+ 83 27 82 3. 82 340 81 38 94 98 61 59+ 95 62 Tewachloro-m-xylene (TCMX) Decachlorobipheny! (DCBP) ADVISORY LiQmcits 60-150 60-150 ZTIOELARSTOBORYPESTS 09161 . 000269 USFW 0845 Table 2.15 Results ofthe MSIMSD AnalysisforPesticidePC8 in Water \WA#2-273Dry Run Creek Site SamplIeD: 0020F1 Compound saGmopnle ASdMpdkSeed CMoSme M%S ASMdpSdkeDed CMoSnDc M%SD aAcgvLiismoirys =- (ol) (gL) (gh) Rec (ol) (ugh) Rec RPD %Rec RPD o gBrHinCr UU ooiis 0o1t3s U Oi oi 1o0f5 se 001m28 007m ois oie 1i8w 165 4S061233 2105 17 400 2 . EDnidienn P00 UU 0O3o% 0oa3r8 0 03% oan 1126120 00225%0 Ooa4i0s 132+ 020 os itemdc: iat 55 sseia21 2118 6 wiz 27 PS eee ee ees 000270 sess 09162 USFW 0846 Table 216 Resultso`WfAt#h2e.2M7S3IMDrSyDRAunnaClyrseieskfoSritPeesticide/PC8 in Soil Based on Dry Weight Sample ID: 5038 Sample SMpiske MS MS Compound Conc Added Conc % SMpSikDe MSD MSD Added Conc % QAcdvLiismoirtys (igho) (igka) (9kg) Rec (ugk) (gkg) Rec ~~ RPD %Rec RPD a Hegp-tBaHcChlor Aldrin U U 27814 27814 7400 21000 U 27814 19000 27 76 2277881144 252800000 68 27814 22000 2791 245 4365112370 3510 79 15 34132 43 DEinedlrairnin UU 5555662239 3467000000 6B54 5555662299 3591000000 7902 88 4321113349 3458 A pp-0DT U sse28 7200 13 55629 2900 5 --85- -23-13-4 50 Sample ID: 303E Compound gHe-p8tHacChlor Aldnn Dielarin Endrin p.p-DOT A ms sample Spike Conc Added MS Conc (ugko) (igs) (gk) UU 2255338833 2213000000 U U 25363 50786 20000 41.000 U 50786 51000 U 50786 5900 MS % Rec 83 91 79 81 100 12 MSD Spike MSD Added Conc (ugh) (ugkg) 2255333933 2213000000 25393 50786 20000 42000 50785 53000 50785 13000 MSD % Rec ~~ RPD Advisory QcLimits %Rec RPD 83 91 0 0 48127 35130 50 31 78 83 0 2 34132 3113 43 38 104 4 42138 45 26 75 2313 50 -- * amosursrosonests 00116633 000271 USFW 0847 QA/QCfor TALMetals `ResulsoftheOCStandard AnavsisforTALMealsinWater TTheea QC suenrdai rpdseeSERtSAor-%4f31icd,sm,hQedCe-To7htxeser1ee0cm0oai,vreeerQnvC0ca-0sl291fLox5ri1%0ts0hc,oancvTfoaiMimdlpWeaonbSlcu,eesdfmTsoirMe2rfM3voAaulonXfdt1lhiinmeiattn4bsde2avcQTaoCMlpleMsesnAbuienRTdaf2atrioodnshrweerlrreeeecomudvaseiernndiienT1s0g.abcSlAhCeelVcE23kR.5N1t7Eh.ECreDoanacnFcegecnceutOdrrVaaetrcfiiyreoosnom.f RS Seasmupllte esso0f02th0e1MB,S0/0M2TS0aD1blAAe.za3ai-lac1vdd5s.i2isr1fa6Ton8agrbewlTdeeAroeL3.Mm1ce9h,oa0 slernatsnoigfeon1dr0W4maf:atroeArmrhx01st1po8ik2re2/e.mcaorFviiesf.trys-swspieixkroeeudwuopilfiic5aot7et.RhPe(DMQsSC/wMelSirmeDi)twsi.atnhaTilhnyseitshr.eelQTiCvheelppimeeirtrcsc.een ee eo ia ResulsoftheBlankSpikeAnsvssfor TALMealsinWater Tne percen recoveries fo the blank spike compounds, listed in Table 2.19, ranged from 8110 109. All46 recoveries wer Win he QC hts. 0911 000272 USFW 0848 Tul2.17 Retonhs S7S3ardmACrraeTAL he Wo we oOmeO why So SCmT Catt wi Cat--e Remy ee = amen op w A ocTom]om 10"m mor Corin Ta wi: nse ariis"e = - ue SScoermnwy hhTauaansne mBoek [UE 10 2% Em ae w NEaEviESse eam on = - Bun cumam EoCowTm Sim SGSCweneaxmm oer 100 wwose = -pae b@ia oly coum om Genwi on -@ ramon com SoGowmm?m rm GSGCea2aanmm ae r5lewm oo=m1 oad"W a4 ser. % comm wf GCeommm r Gexeormaa ton wa oS4owo EA mear"swd bibai) ssa.7h 3 we sprain eGSywo ThGaaeenm ea9fs o%n Pprreed=] *5 oy EorwaEEGTSa am Tons Ei5me 1iSoe 3% ass-aoe"n bwid mie 5 - [I comin m R Go S T era wan ooovoe mi-"n i@=o - SR vea SsntwewH m heTaaramne d9s 0i SnaEsaa -w =% cn Gime wh wo -* Tn sum ao0w6iw7e3w TwSaeamanem os0a yo 10" = n$o5sfegiy bit ma bE me nSomm GEomLme2@wm own 20.5"9 b=t ImcamesTosoRTIAW 00165 000273 USFW 0849 E RE u--" aE = =n RT=aEo meSA y WD SEe=ew -- n I B m EBdF Ru AEwu EmZeY 3a E E2 B2 1E t EE BEZE . w-- goBFmm wooouumn iom mg2Em% K#f 4E8E I i BIEEERE:E --"mBrm o3Ag8Bn%MH UHBEEE 2 2Z% %F :i 1EEn3E%EE ow m Bom y GHM Emz EH E2MZ7E Eo4Em5 {1 1 Em IEEsER own Bmgwg I$U3EM8EW2 8BM8EM $ f# 3!$2 2ED8EER8 } coer goBFmt L$I1BE3E0 H5Em 8E% 242 7%Z !3mEEE3 ER own oSmNOBLBNEEWOE LOWByDR zOZ zOB 32o2EoIIEEnRAgZ wn mBwFmm 4nTm2E5REm 2BM5EL I2Z Z%2 31 ! 8 E8N2%E% ww wWCmwOSMLELBOMPE BO2E%WE # OOB 23O4 B : 1 m BOEEz RR: Ww GSgENnE dWBfuosnumuodm osSEHngAseR Bp% oogs6 o1c mTEEREOR:oD EEREEER om oEmoEmoE o3owoEE 1omEEoD wEw omLEoB ROB wor moFFmm LnYEgMBEMEEg woo sEsmfme otese mEm oOmEOB wer goEprASBSNEEoL oLE we wmwwmr t8 1m9g%OM we Woowumn mg HuEtLREm won mwsnmfoNnumgHE ;gBE mw mwmm mBEEE OZEBEE 0B2Z0% I3 EmEREoB B1IEE% z2m33 4+Ls+ BEoEmEEmRZn woMmmBoommoorooow9 woo%n o10 mEommEEoRBx sS MnUS537BT L 1GT3 T a ME2EBZ H33 3B: L11EmBE:E z M8En%E # 37 %72 % m 1 HEz leno% mE2dE%2OE 28ZO!1 iEIEZoOsLZooozwa XBmE BIBZ t 'Iemag : es 00168 USFW 0850 F210 Rtn eBar pnn ra TAL w et wtem"s Shaw -- p58 wr - -- =- = nm 2 - con -- a - -- JR om - " - Cem -= - - - we yan no a " % we 32 --7 ! " -- om --= wo ho " " --8 -- om # - - on a -- a " vm = ne - ws a - Wa Se=men = we _-- Jud --- jy rs ne oe #5 jy us rs jo as i us os i os oo Fssm--_ 00167 000275 USFW 0851 Tai2.19(Con)RoutWAoS 2he2B73aDkySpiimnACorvaSi2f0orTALMaca bsWe: Met CSoonh.a CRoeecord * Recor RecoTmmoansad ot or J wn Ts amar 88. 2s os os Anne ss 3 tor oi Bam = Fo Tous Bum m2 mn es Caamum 0 os 5128 coon aaa ax es norm 22 ze o ous conar = Eg sus compa = EY . sus on ann as * es TM sss 23 - ous [I a0 2 5s " Magness 22 2 *% 5s Marry 200 200 ow sus . Nest = 26 o ous Possum asst 0 " 758 Sonn 556 3 or 5128 Sour = = 0 88 Seam ans a8 - [2 EE 0 or 51s Vimo 556 FY os 51 nc = 2 51s monRsTRORTAW 0018 000276 USFW 0852 Section 3 000277 USFW 0853 ea BA 5 23 3CcoiteE eo 5--a2I % EEi,m Halligan 18 f|| aLg ll Hal] i88r]i! = il 2 3 i i lz 5] i ETT iif iP lee idl Pha EE SE we a i ol [ide 52 g RLEBNENNEESES > TE a| s1ii JSi am .e.. aSlEi; - ONE | 2G EneRiEes * wn 2160 ot a % te ATER OF) A 8ST ITER | Crt Pdi :BeRHITTITrAe L 1B5E er U al asE: : oR SH 3 ae i EE TTT ie He T T RT H th ia H uh aEnRiEa8 l0s 2/#.4 F|T TTEI TLTI6ET0T TTR:HoelAl h(eI 8 B: oY Ha TATE TTT TFBe LRIAMTTHTITTITTHTRTIIITATRIM FI[[3531802]) (388 ote 116%30] 18 ee {ed[THT lal! ln HL | I | FYE i rn 88 HEE 4.9 RRR 3532 3 hb FILL Hi Hh [EE nil e BaE l hk bes [ATR7 |[ER] $5:2TAPy T | i| JT{ml = A i [El RE i ema. I [Rl Bled de art i me 1 3 TTR | 9 ] HHH LLICO 3 : ARTEom 2p=SS SHIT 3 ATT 2 {>4 4 TAN yr BE(EL: 855z.) . HELg Emmi 8 CP TE il | pi ly| [] [T1 a(i HHT odS1 E iHleIaTI HTT, Sil|l p rr egi, RiAt E of| [pH 2.8 | fades | ,& 5s888: S EEFI Reeee T 1111] E These 3 IE|S1LE. Em TT ja SEE GEE Ei RIE linii ii Wn ve [8 Jen i er lh Re H HE - 5 LICO os ARNT Ee 7S/1e0rf TAJT t 8 || [=] {tii t3a LL g I 33Els eeH 5 LL IE L3 gS A INU pe iiiht J] hN i a BEAN Mg] SHTITTY = J id TERT 114 g o9o B STRTT EMTTART[3I| + StAIHTTTLATT | oT lee to SETI r ETli lT] ff i JRA NY EB 3 [GE bit gure ill SE EEATH TI esc Py 5 SEET R inHt Et Ri E iiii JS i ERpHHA 2 DL ~>on SI TATE TRICIO SE TI, 3H]e. |f[eERlLE THT 5 g 4 1] gl I] & os AH NTITHIH ITITTIT elel TTT e|e aer LR LIE, |e | a SN) x dail =3 i Bawa et It 5 Eee BRI 1 EE i {I HLATE TT ee FEL soe g 3TH 1 : iti MH Ear fai RH[TT fe SLB 2zoy[HFFLF H Z]ICO - HII 9 Po IN (D|0B [3 [eR] OITLG, | 3] i 2z3 3l T e rrH r TERLTET JB81 2s & 1 vi JHE [TH 28112288)) [cGerE] ill HRl == | lh yIlHl i (A (YE Sl 3 i it E HF e 2i2i% J 3haz 3 SNHHHHFHPHP se. 3 il 3 BET RI hy wis[RIa 858 FEHEH Siy sa SFT AN [Ell L t T =eu Badd > 4+3 ETT E- TTRCT]TTGORTTRTITH (7315) IFRE + el(HIIIITHITH] fe i EAH CHtEat [HTH 2is8 [p1e0lti|] {1| [I {|pt ; ley : NNN RY NN 0 RIE n s 1] iiG l H HTHH I H,| iFT 5 TABTLA ATT i 33 FE 2. hl 31] wp we 2p 3 FE dBi3e5 SJTE RS CT[.HE Ji IRAEi SEIT = / pT TH +8ICO 3 : ls MJ N niiiinimng i J (THA P iE | Eh 3 Pat [i hl iJ ALO EEE fLilEEHDnEsssEnsnii INES E ill SRT = ih | $ ELL i JH ARTI rc 8Li EE [A]Ti3 i} JELLIES rT tH SH. 02  + ATTTESTRIICHOTIEIING [Bl [FET] ; [[HIHTTHT ITHITTTT Es i[P|E 3 g h J ER 3 ETAT As 2 eT3| |, & i8 rTumHniIne)y4 143 SEB| [3 i Rema Cl I SH HIE i NE Hh EN 1 3 n uf nin lar i Ried [1 iN fli 3 me , 3g sa ST Nn gL TI1]) FE Tiol J[S72 i eT TH 29% i jSif S ShomeL r Mh. g 1; NET => S Pe 2d Tu 2 =D . ey Wena, | Sm ap 200R Arve, st 1 wir sisi: Se Neen es DATE. 29 Spemer 1997 To R. Sioghi, EPAERTC Proj Officer, ) FROM: V. Kensal, Anaiyica Sesion Leader #7777) {Asee! SUBJECT: DOCUMENT TRANSMITTAL UNDER WORK ASSIGNMENT # 2273 Antal phi nd te Ailowing dommes prpend water i werk un Dry Run Creek Sie -Ansys Repon CSEeenaTnFsile WA # 2273 hay ; Mom -- TDairs LVyaeidauieoen nrt Raeon Wrking S Croup T Lister WcoalsistSoanmsewisnachmenn 000291 ] USFW 0867 Section 1 000292 USFW 0869 Table of Comms (Com) Topic `PageNumber -~ QRAJlA/sQCofoforirTAMVLSMeeAtsAaalipshsfoorrTTAALLMweaassiafnSosoi TTeEeIr hmPaegee a58 RResoulstsoofftthhee.DupliDcRaAIeuElSysUiPsSAfoTr TMALeMeulsbionvSioilFol Mar TTaablee 22.09.0 Paaggee 6658 RE oiBla ao TA ars Filene Ti 3 Resultsofthe MSAnalysisfor TALMealsinBovine Fecal Maner "Table2.11 BE Page69 RRRRReislEeullsSstlsoooo0fffft1bh2ee LWBiDCSSpSRlAAAamnyCaymliyyMsattisfhttPooorrrdTTTSAAAALLLTMMTMMeeaetswHassslsEiiFnsinoMTFrFoasaruruanaae ETMTahbilEEel2.e13 mE PRRRagEeEe DwS71 RES mSKRaIAlrGeCEEoofrLCraH Tm ABsaA y orSCiymneen0osno f= TWeEzIR EFEe 39] 3 SRIeGeE foorfFoBoteeat Masye for Cymi: de i Sol We Emi e1m01 LRKKo ee osEullRtes oooff thFD hee LWBACSeSynAntaliyAsMiasttfrohrsFFolaouoerrsi.FdeoionninnWeoWaShattoe5oerlrweossFFeeacdWMaunreer TTTTaabHhlleeEe22Ii.32Rl52 Tale 225 FPmpaaEgaeei110s038 page 107 RKReonnEtes RE ooSoffrf bhee WB DDiSEpMRlcSEnD,e SAdD aRayaabusHfooornFmFeooirormteeFatbbnnnsFFalmia n betWTeheieii2dl3 RhBeERliGDBoE SRRKEeeIBnlsGeS oof5fFr2fhAentRDMoonENaRSnER, lAnaisHTioo"rrnhFeoooratteFoirn FFolross eTWhieEiWdhEBEEEEminLmn - RRRSEeiAiGlEse CotoFfrhFBeeodE1BiESpSlfAoaasyyaeRya1so0prsAAvfniooonnAisiinWsWsoaatnrerWar TTmheeelriE FBmRiEkeel1w . B RSRAG CoFr2Or rgBuapntcFnoeroAas.asy for TOC in Soil Opn Fes ]pol The 23 Tpe2ns oBFaggg10 R RResIultGs S oofrtCheetMiE Sn/SiMzSeD AAnaalayyssiss ftoorr Gran size Organo FluoridesinSoil TTaablee 22.4309 EPFaakgkee 113253 Secon I CoSmmie csioy ns PRageE126 AAAApppemRndiitxSA& BDBBaiiui fIffoooorr BTTBNAAAALLL,wMMPelsetVksPCCSFRiohinSoianies(leCfCoConerraa)nnbteaeSrolClo(lCuomrdb) AA AARPBIEEEREBBBBii IIIIo o CPBBAiKAEv BMFovAioanveuoFmecSaloLTlOsiCWstAeRB rn)CaolsuWL matner & SEal} AColSumbia) AAAAPmrPSddAHkBBBBaau IIIIooBETTlAAaALLrarMMeeaaSohotl.orr8amBovCDSinuoeeuF(DreCeo)aMmathtiaere Combi) une comin JpjFaiogfege: gGGateaearont FFFhiiaikkkkeeee GCCSlaaointateald!nl jFFaakeke dGGaaatenaonronit Fike SEED Appendices will be fused on request. 000293 USFW 0868 fsarr enAT pmo me REBEL Introduction Siatiiar QUGE di ew8 pepsin lyin repon comsiaiog 3 Summaryof malyeal . EEPETe Eee| =Te = oi m er | [Fe e[eoeenasrm]|| || or mTTeeenre] [erat {em | Fo Treefoe]ome Toee ToTa EEE | | er [eeriee]| wm piper, | TAL Meus. F.CN' pl || mre om| PrSoonegA |Fos = Tew a re Co|e| ] ER woe 000294 USFW 0870 Insroducsion (Cont) Cuoafin | Numaber|| SSaBmp | Dauleta Manis Laboratory 1 I wr wren | om |1| enum[on | I [ 15 | omam [oms [5s| enn Ed Toc GranSize Columbia l | [oma ao enon|onuor| { om |2[en|eensr| ams anus =] | [oTena | | 612097 Bovine Fecal Maner | Cos|s1o8n| osseon | 3 | ew | 71797| Eanbwom Tise | Fia%oriLdiep,idsT,A%LsoMleiadlss, | Columbia |I] CASE NARRATIVE ACoulbuembiraequLeasbtsof REAC, TAL meuls, lipids and solids was added to the tissue fluoride analysis in the award leer 10 Data Package G247 . bnAtidothne27usddayerseqduefstoraoPfnetishietcWdeoW/hriPklCeBA.3spsoiogunnotmefen)htolMSdaostaifmgeie.ro,fA[llHAeTssCamplHess1WAriseanecdsoan2usoAiohe.wreerdeBehoeSlidmsaiamtepdRleEsACwerfeore2a9rdanyssTporisorHshiapmenIt nfor BNA Asalysis - Soil CIhnctehceoecdontsicncueinpgiblcealiQbrCatiloni.t.cheTchkissucnodmaprdouonfd63v/a9t7n,otthGeeepceirceedntinditfhfeeraesncceiofonrdbias (p2i-cshlomroeiBsopyropey) eShEBr4R%),, * Pesticide/PCB Analysis - Sail The data was reviewed 20d found to be secepible. Data Package G402 - BNA Analysis - Bovine Fecal Matter dInitehelipnihtialliccali(b3r3a)tieonxceferdoemd6/s1e3c/e9p7bl(ienstQrCumemnits.MSOT)i.s cthaeibpaericoenntwadisfnfeorvenecedfor1,04-Qcuhlaoryophaennyyc!opmhpeonundsethhere (G31a)s, a+nsd Iopmnehatthothyeliincaeo(pn3ht7i)iQb.naCulbieinsnhge(m2ce-a(cl25ih.4bl),roTZart-ooimiosinobtptercomohaopeslycilekl)iasnaecetnd.hdearr(r6ad5()7l.6o)f,-7fn/mrii1lt/str9ooaabn(etinmhnznsepetnre,(um4e3(n0)2t,5.42Ms-)iS,lrOboe)?pn,shoelbntcehoael0.dpeS(r2c5o(e.47n7r)t):,aodn4idfco.fhenmreaerrn)obcaeesneifsloirni3d.r2an)"il3ien0xee.3e2s.o(d5e5d)s, blenzo! dreestuelcitsedforinstahmeplaesssoc8i0a1t,ed802s.am8p0le3s,:8t0h4e, 8d0a5t,a 8r0e6,nnotda8f0f7ec.iaedr:e considered Esumaied. The Rave of Sooner on cIQhnheCltohdlreaitomcaibsoe.nantrzeineTunnhioienrsgca(fh1cf0eae)lcc,iktbberidsa.ttaiConndcahrcldhoewrcakasssoutspaendrdoarp1dy0 doeaftte7h/re3m/i9(n7e3)i.inhsheterx2uammceehtnithoyriMopScha1en0ne)o.,l t(c3ho9en)c:epneatrnrcadetnitbone.dniafnifnierse3ennceplef(so0r8)Ba0Ea1ih.la8is0e9d.o(5d83)0e,5b1e.o2p.uiblBeok GSaTmpmlei8s07cChormyspeonue.ndd1s2 aBndosmamaplnes s8o0n7.s80B1e. 8p02o. p804e,aned i803Fmperylene.1d122 ientmernaal ssntatndaarddaarreas exceeded acocPept moto 00002 000295 USFW 0871 CASE NARRATIVE. (Con Data Package G306 TAL Metals -Si Theda wasreviewed12dfoundtobescepabe Data Package G24 TAL Metas, Fluoride, Cyanide- Soll A be request ofthe Work Assgnmeut Misager, samples 1Aand 2AWeeheldak REACfor29dayspriorshipment for sounbcdonetraoctuedofannallsysemse.whilAella opotsenteial recosnufslicat ofcionntesreaset rwaSsATsRoAlevedd.AndalBolexs wGeercecacnhaleyzsead sfosrooe,rcyanide and WCSe/olLe)nn.iaumSnhwiairbsiaduemiecoTienseudlsb2ifonrthseSaomTpfAleLs4.m1e91u7A3)4135p8it4a35A.6catwaercosinsoi3nd2edreBd2a.1nke0ss.ot8fi36m4aw1e9l1l(s8.a1dpgS/LTan2t56/05C19A7S0:3apyieid 1n5% 1.5 Data Package G400 TAL Metals - Bovine Fecal Matter The daa vas reviewed ad found to be aceepabe Data Package G452 TAL Metals, Fluoride, Solid,%Lipids - Fauna Fnluodridae sanalhysisawwaarsdpeernfeorrmedby a modified EPA Meshod 340.1 wih the permission of REAC and notby 340.22: CCMoeontmehemonoidra2Bi5lc.annCsko.inthrceoonltda2aina.eda9n0C0aA1.(197t00mi8p:el)SdsnO2d0MdgC30(11A0.. amko,dsMamgplaesmsCcoonmumolons1A,weCornetr3ol p18,sCocntr)ol AICC:, CCoonnttrol 2A, 50Me%tb,ogS04BBl.an5k5dcSonAaCi,seCda Caand(N11iSonmpcg)iamrdionMgs(1w5eremgsD) Eprensaemplaesy9n01B,S01nC,9r0n29oA0l2,8,,802SOCIC,. 9S0033,A,S030388.,SS00AC3,C. Data Package G415 TAL Metal, Fluoride, Solids, % Lipids - Fauna a Figoride aT missnws e performed bys modified EPA Metod 340.1 wih he permission of REAC and not by 340.25 The dus vas reviewed nd found to be aceepable. Dats Package G427 TAL Metals, Fluoride, Lipi&d %Solds - Fora Fluoride analysis used EPA Method 340.1 for igesion and 340.2 for analysis with the permissionofREAC. nTheeblhaenkccoonntteamirnaeidon.barifouumnd(0i.n36heme/oke0)k. the resus ae nos affected becase al associated smples had more wan five Data Package G302 Fluoride, TOC, Anions (NOS, POS, S04, CI & Br) - Water& Soil RChliorimdeeandMbirmosmgidee ion analysis were nox equesed on the COC and were added ler 3 the requestofthe Work iVpinieeshaxtdesofw30Ea5PAfsooMrletmlheoasdnd,3b01y00..E2053wn8 imGe)tihoedu3rs215e5S4vrefdiarvrterwIrmeeprEenroocmeedh,omwomeirieepeersmiesso!f(REAACCS.b?yEEPPAA. Samples 701. 702. 703, 32d 705 sre bovine fecal maver and are repo. in the soi results table SampTleesen20u9e210o,ni2i11cd212S,213i. 214, 215 were recived pas he recommended. hd ime fo Or phosphite and pit, sommes: 00003 000296 USFW 0872 (CASE NARRATIVE (Cont) DutPackage 401 Fade- Sol . Fluoridesapnalyyssiiss wwnsprotmed by a modified =o,AMethod 340..]1 with the permissiionof REAC xdmotby 340.238. Samptleass70w8s1r2di7n06dae12boveisedfc1ablemmranldearreporadinthsolels bl. DSaitmPcetsoe2ns0002,03410100,Or2n0e,F0a5r,i3s04-,Sa5G, 206 vee le diy ousideof i 30 i: 8 els DactPanawcserGi34ndGra1i8n Sfizoed to be pte ) A 0000 4 000297 - USFW 0873 Summary of Abbrevisions I2" Br oBhrmeoimmoclieAribosboernpaieofanosund in the blak B5BRoL BBBlllaaonkkw SStppheiikkeePrDauvpilincuQeuasiaion Limit 5 CRCeoomnmageranTaeblestiessvaluweasiofbruoimneaddfurodm asdaompmleed3s0dpwaes ox calcula ar Conia: Laboratory Proc! . ooRncoer iCCoonnmcoef rCReunqsuniordeyd Deeion Limit Gor oni Required Quaniion Limi DBFLTPP DDeeccacfiluoonrotLiiphseaylphosphine EE;iucrape T"ETToaihdemuviasarilnocuedeliys1mCgolrumeopaltwmeedrttAtphoramsgnestoiinhbbleoePhdlicdgoahnseeeseteaalniinoenairmstian1daridsacnsdtiismaeesdtimated om5) MDL MelairseauomldesD)SeaeDcrettiaeocntioLnimLiak MMMiRaLr MMVieaebno:oddnQeRureapenoriresuaancigeonLizLiitmit . NMMiSsWD MNMiiisncxioSSsppikkWeeeiDugphlicate NNNeAE NNSioonrtesCReaNqeouuteasAeepsdpiable or Nox Avalable N=so ZREC NPPoeetrroSmnpRDeiefcfoevreernyce FFFoEarAv FPFraaanrcssicepaelrr Gbbuiillallniiooinnai3byonavolLuimmeit Ny RRSQeLMpo RRSQueeiallndautieivvtseeatipSToeounrnncdeMaLnoirtmddieDtiDfefveiraenicoen Tv DSeineemserneot decid fier I"t ifroogm waww Taaclicineeesr pi4= e Llignmean n% PCarnoogprieas - denotes 2 value tht exceeds the acepuble QC limit ARevbiiesrioan m91s9/5t7h sic 10 pric ble re shined nfs on . - 000298 00005 B USFW 0874 Aly Procedure for BNA in Si sion wer sly crn to SV-846, Mihod S218, The es lisin Table 1. saya Procedure for BNA in Bios Fecal Maser siewersyedscofoSV-84,Mihod 5210,The ere is sdiaTbe 1.2 . Aaya ProcedurefoPesicidPCBinSil supe were nly scoring to SW-84, Mbod 080, Toe rlsa lsdfnTable 13 A sppieeseeer dipes 150 sydAnaloytircaoilrgP1rotcooedeSurWr-e8fa4om6r,iTsMA.eLMdTeotea7le4s7il0nfsSooim1le(riCroryde.) TMeablode 716410 for possi. . tal Procedure for TAL Meals in Sol Coun) YAslalamslpamlplelesswweerree Gdiggeesnteeddmandd doanalyzed eg Vicnod C010fo according to SW-846. Method 7471A for mcehrecrurly,iMset.hodThTe06e0lA sfor aaerselnisc,d in sA te ewerr diges Aalytcl Procedure. aa n syd scoring to for TAL MealsinBovine Fecal Mares ShW-u84., Me3t3h6odMet7h8od1(f0o1r0mK eorma.l oMdeetrhoyd TeO.DA fToroarcaeil, 7421 ores Tae 15 satel Procedure for TAL Meals fnFa Aslpaimpeless wweerrreedeidsgiesgwtesedo150s0dtBmyTlsotve scoring 14. to S46p,oMeet,hodandT4sTIoA dfor mwedrcUy.. MEePtAhomdet7b1od02o0r0.l3 feoria.l odes Avail Procedure. for TAL MlsinFlora Aa 0 ssamapmleps wweerree iggesdaain0d eIseEweCedisnsecodor1rinTgiamineo gS1W7-.8e46,eMe.hadpTaATsIA.for4mmersroyq,wmM:h2o00dU.7S,4DEfPoArsmeleeaidvm,2008 A samp were aye scorn to Analytical Method For CyanideinSoil SW46 Mebod S012 Th rss are sd i Table 1.8. Aoalytic Procsdre for Furie in Wate A amps were alyzed secondo fo EPA Method 0.2. The resus are lsd in Table 19. Avyical Procedure. for Fluoride in Soi/Bovin Fecal Mane (Cor) A samples were alyeed ccrtiog EPA. Mebod 300by fon chomsogapy. The resus we lied in Table 1.10. }A 0oo 000299 USFW 0875 Analytical Procedure for FluorideinSoil/Bovine Fecal Matter (Columbia) Al samples were analyzed according to modified EPA Method 340.1. The resus ae lised in Tabe 1.10. Astyical Procsdure for Fioride in Fauna Al sampleswereanalyzedaccording 10 modified EPA Method 340.1, The resus ar liisnTiablde 1.11. Assyical Procsdue for Floridein Flora Al samples were analyzed according to modifi EPA Method 340.1. The resus are liedinTable 1.12. Asalyical Proceture for Anions (NO3, POW, S04, C1 & BY) in Water AN samples were analyzed according 0 EPA Method 300by ion chromaography. The results are listedin Tabe 1.13. Adaya Procedure. for TOCi Sail Alsamples were analyzed according to Method LOI AASHTO T 267-86. The results are listedin Table 1.14. Analytical Procedure for Organo FluoridesinSoi AMTvlshsaee mbprloesuh 3twie2craeesri,aanafluhya ozererdou.eeharn acacnpoerr.doipny3glebeiolno,SrWo--2281d.416c1.lM2eo3tr.ho3oddhueo2xr6ao0omrmeooipdirnfoeipeadsveat,os aa5cndhaileyevsreefdia2olroorwseeOrbtdUeYtsIemceatnliveoins.wleirmPieetcaofbfl2auyoprzbpeed.yc5lobuiane Lael' denied compounds de 10.8 ack of sundarts. The reuts re ised in Table 1.15, - `Analytical Procedure for Percent Lipids in Fauna. pApailnasssaameplhepsiwceweiesgrhetiynan2wa0alsyozvceeadnebu2yideTOdyiC3nsfgo2frolm1llowhssu:tof.scaomoplleed eixt3radcstiossdroyrnes0sdawaepirgehsewdei0gh0e.d000p)angroaum3bceourpilya.teT@he <p7e0rceCn.t Th %L, i(vpetwieigdhy = (Ca LE ipid -L -ggBBPaiah)Axx35 yg 8 Sample. he results ae lised in Table 16 Ansyical Procedure for Percent Lipids ia Flora pAalnsamapneleplacsed wereinsayn eovden bayfTdOeCvng2for1mkshooutf, sconolped xin s3 destioccdatoyr sand0weighedpre1w0i0.g00hg0i1d an ot pteThe <Te0rCe.nt lipids (wet weight) was calculated as follows: hed Li %L,i(pveriweidghy = (CsELLipiEd -gBBllaankb)xx5 pgp 8 Sample The resus axe listed in Table 1.7. 000300 = 00007 USFW 0876 AnalyticalProcedureforPercent SoliniFadunsa Alsamplesweresmalyzedgravimerricallybyfreezedryingthesample. The fessarelisedia Table 1.6. Agalytical ProcedureforPercentSolids inFlora Alsamples were alyzedgravimericallybyovendryigthesample a60C.Theresusarelsdfa Table 1.7. AnalyticalProcedure forGrain Size All sampleswereanalyzed according1oASTM Method D 422. The resultsarelistedin Table 1.16. monks 00008 000301 USFW 0877 et 11 IgretSs tEoEnRt a nt HEwSEEeEEieHerER EmnOmTSTewmeiwmogSbEleeHEREin aEGubBaooRnme fo B pfaeddeR ed oBdT8g o odLiiiiee oddiiiee, Fftsoggeoee Fbo8RLF # LE (g fdHhAwEee EEeiosl.e FPPPPPoOBEEEEE LP8oDOb LOEBOBooR#B oOOoii BB3oBoBB { Ef EeEaEEry P F PPPooaEgmgooE LdopEooomanibbbo ooamoa biHEHFiHs(H2-dCsaEhilolroRet.heaxEy ,methane. P PPPP oub oooE EEEogB oL LwOoovFbp E EoSooB1EER0OPvPLFPBBBBoO5BB0 FmPHHaEmEhrRemEsE, bb PPPoooEaEEg bPbbob ooosEmaoE Fbbooop BoaoB E{j EHErRliEEE P P PPPaeE E EL L Lobb oE E EomsE LeTbLLoBa2Bm HmHFoEiriarEreal. EFnoEe E Efi r LPLFPBeBEBLLEoDb BEWoowB LbOLooLoaaEs b PbeBaLbboawow obbb ooaao8 PPogEo L oom boboo@# CE o sIr SRPom bo ggwwauEgsmste 18o0swes,etnS 1 HEEgEOtEEIpEEsa ATEBBuRmdorm PcmEzmmeomzNBES eSWPSHEEeL FwB ayg SoS i ET aE S4he oY athme ewloeTR HBBoEle FAg: oPbo FI O ed Tb O od EERE bog bE bobo Hh Poel oud doa pmesmEee dma. Himes Ls Hin. Pbooenld BLdY R PoPep od boa bog bE bobbi bp BOP LOL bd Sonor Lot bob AE A TT I I GHEiRmee.e ffLob4 LBLPOFBOLLOFBOVE BE EaamE on, bPbaodosobbEooda b b bdbb b bd b ob 00010 000303 USF 0879 ve Vt at uWge 3Eh-i275o.rEyRumSnCs,reEeLkSite4Bin Gw wgSelUdeiSiko2MBEu,Rm oE SEEmRf=SS.aEwE ig i [i EBEi Ca SSLe o odea. et o_fE em re PLL LE th er HEaabit Bleckchioroisapropylyether bP PoosoRsooror dooes obw d3 EERsED pope RLoens HHmm, ee LHES iTmee EE a Es EEEATC, ee io hob oTI hotd yop 8b 3 P PoEEEyd Po on H oho b ob AfbI by bd oH oy Hoy Ps EI LI E | PPHHO oos aodd 000304 USFW 0880 Table 13 Res`uWltAs#of2t-h2e7A3DnarlyysRiusfmoCrrePekeSsiiecidei/nPSCoiBl BaonsDryeWeidght LoCcliaetnitoDn BNLAK DryRunAUpsweam Lee2C4reek Percent Solid Come 100MDL Come 6 MDL Com n MDL Anse weke ueke wgks peke hehe wake - BHC BHC BHC uo uo uo ou s2 sz U4 U4 uo 17 usa U 4s HeBpaHcChlor uuo 1177 U us2a UU 44ss ~ HAelpdusanchlor Epoxide uo u U 17 ou s2 sz UU 4s U4 CChhlloorrddaannee u uu u ou ou 50 90 Epnpdo-sDulDfEun () v vuoo i? uou so z uUs90 EDinedlsdrin v vo ou u o oo uUo 9% 50 - - ppDDD EpnpdoDsuDlfTan (I) v uo o 33 uou vou oo o uusoso ou 80 - EEnnddonsnlAfladneShusldfete u uoou 3U ou ou 90 so MeEtndhsoinnycKehtioonre u uo 3n3 ouou 2wouou a 90 . TAoroxcalpohren1e016 U u mBUuo a0 0 UUso% AArsocolocr 1221 1232 u u 3 3 0U U wwuU % % Asoclor 122 Avoclor 1248 u u 3 3 uw uw ou ou 0 %0 Asoclor Asoclor 1254 1260 u u 3 3 U UwUU %0 % Chlordane uv ou 90 acewssrescRresTs = 00012 000305 USFW 0881 fH GooepE. Memes Coc MD Parameter mgs mpky 14R SE n bt yI isttTAeLe Mei Mowo5e Wavxe MsaR2 Manfmi Ca MDL Cm MDL Cm DL Co MOL mks mpks mks mpks malsmes mpi mgs sm cox a mph mpks Pi-- mnonee Ea EEe. faCroeet i= =Se MHaEegoormesnioom pfbErelsn bVean SuSokowoolnowwoe rooRn1 umdoeetahonnow mwmmovmennuw1 oowwomYe RnE1 mofgennow gVSoonoolnmoonroommee ndummeom nou meum hnmn e vSoohlooormw dos owmRdYr onow mdy mnRodoREmSy Uole mmRoe5 owRmoaoeRoa3 mwPS o23 omUeD oa uPDo oaew2Doooamsh0Toao3nODOauReomMR aom3OD Muo04eTR asue3womwwo2eM:%aas2 wuow3emNaa3 G Ccormo oioouso3 osmTorwvodm eoou ovnaa mmb ve oysbml eooRaa C Coorrsa ow n w Er misom -- 00013 000306 USFW 0882 Table 1.4(Cat)"WRAe22s7o3ufDtrhheyARsaamlCrfoorScTikAeL MeatsinSil BasecoDry Weight LoCchaetnio>n 4 Salids ASm0a6l.ia " Asataon1ve = sRieah * A5r09aAva n ASm05nc % AsroainB u Parameter: mCeoke MDL mets Cmoehms MmDeLk Com MDL meemeks CocMDL mes mpks Cem MDL mee mele Con MDL meks mek Pe = `AAnmumoonyn. axevom1 sevo on12 10von13 dow[e FH13 lowu 1o3n 160[0I 12 51 ABnaesnue Beli woFR J wos 1 ma 1 1 w71 [ Boa1 1 wm2 1 uo CCaaldemoimum Chromium wouo 0 u2 meuo 12 no2 mouo 13 33 mouo 13 wo 30uo 3 v3 M0no 22 2 CCoobpapletr ron 02 3000 22 5 66 22 zoos no H 3 e005 nwo oos 200 5 noo 0 3 3a 2 2:00 5 uo 8 2% 32 MLaegaedsium Manganese 32 % B2 awuwo 22 wo 1m 1 W2o 236 m0 1 zwuo 23 so) 32c 3 mou 031 4amw 21 u oz NiMcekrceulry Possum 3uo 0o2n 190 40 Buo n02 S80 40 0uo B03 2u o13B BO S010 S10 2 mo 1 so 3 12 7 zwuo 40 SSeilveenrum Sodom [uI oo2 a uuo oo2 na u uo a "2 uuo a x2 uuo s 2 "uo 3soz uo ThVaanlahdoimum Za u vo z e2 a[I 2 nz auo 3 23 avor3 53 2[I 3 %3 Bss oz2 o. ZTIOELARSTOSORYZTALS - 00014 000307 USFW 0883 Tate 14Com) hRsA 237h3DrAmieakoSrtTALMet 50 eg Gnemp,uf sBane4 MoaiWe soM n ES wsp % Ssomna Coe MDL Cox MDL Com MDL Cow MDL Com MDL Conc MDL Pe armramemyter mnpmgeompkn 1sm ymmykesmksonRm mkesoOT ms ekO3R mngwgoOMT mpkousNw mMymsMTmpkoBsnn `wmpe"g UmaRke opfrroeeseeems Emm "veboeThr Solow movdr weoM v 1 ros 8w 1 owvs srs od FbiSren os a2e203ionn meT0% YBmo RE3wmRwnSow PoR 0 wi ox 3 amoEoeR Yn3eh ORS x3 %3 poLTyo e oem oom up oa53 eo ammeTeR o3a3 mameRs oa35 wameUS o3s Ed We 0m 1 wamTmR oa33 Wm 1 somshem oa3 ae NN ror uh2To%a Yom TRO umeMe nask R we5Mom %aen w2mT%eom w5eM%aSe Mon x.mW9ese nA ffSnoed Tor Y>SoLm0% Sb HFvoyym Sd x obvrrs3uomTs ovb wonanownoaw sh Ss ea Lo e - Poy oRe : oni wi wa rss. 00015 000308 USFW 0884 Ti14(eCom")WARse3.2s7 DtohruAm Crn ocfeoSrTiaAeLMyela5 `Boan DsryWeeigdht CLoiwenr Solas 3Up0eDrTmB A20m5a0l pA n soAm TM 3A060v." sToemer 5 Ce MDL Cee MDL Com MDL Cam MDL Cox MDL PParae meter eweAs meks mghg make mph mp mks mE mks mks Animminim pres oouuow woh weoeUm wWwvsoonBonoeuwyzloee Tovon12 a B"uBernmen Cimum aw2 1 mvo w om3 1a swuo 4 mw2 11 Byo 3 122 a0v26 a uo Wvo B CCarienma CCoonmer 2 % 33&mo 33 o0m 3 3 3 3 m=m 33 3 12 Wuooz: noo2 Loyoand Mages go%o 5 woo 3 swae se o6m 3 swwe o5 mmw awe 3 ow oa63 mwU2$ moc 2 MaMsagreersese Nal Swuo1 e$ox s4o zwU01 ewm o0w eovos1 meou 032 0om SBO omBO o 60 a0Ue x60 a1w - SPceonromm SSiovehrn vvo os w mo ovuoomom uvo os ow ox ovu 2o3 a 3% uuv o2 now TVrilmhaobmum 2m gvo s wos svo oa wos avo 3 ow 3 ovw 23 om 3 nvo 2 2 >: arotLURGTOSORYITALS 00016 000309 USFW 0885 Ta1b.6 l(Comee)`WRAY2e27o3fmDhreyRAmCsrefeoka rSiTtAe:LyMewssisSil BaonsDryeWeidght LColciaenitoInD 42Solds MebodBlak 100 D1rAyRumUprream Le2%eCrock 6 wu Coe MDL Coe MDL Com MDL Parmeter mgs mek mwa mes mek make -_--- AnAuummiosnoyr, 8U 4 oom wwee3833 eeu a72 ABnunrime Benim uuo ooonl 002 000s 1nmous3 1 on suone u 07 CuCtumciiaomm o2o4 osso B3o4 ToOt 101040670 CChorboanmum oout o00o1s 32 71s 9n9 oe1s4 Corpoper o6n1 00003 00x 319s 18n0 ae14 NLaegsretsiom 021U 00s0e3 w3o2 0Tso 16n0 o6s80 . MMearnegaurryese 0107s 00o00m2 0u o2m3 S1u0 o2o0 PoNeukseslin uu osme mxw T6o2 nuoowse SSicirenum. 00752 00co0l5 uuo1s2 uu s23 SThoadluam Uvooorso mu0 smm 5uo1eew Vansdom Zoe 009056 0000s2 s 0 o3 23 62s asoEwRETOSORYZTALS 00017 000310 USFW 0886 ile 1.5 Ren of `eAWDa royrRTmAtLCMrek.lSnBove Mar C[pereaDc Meowmmk wo BaWr=w `Boan Ds ryWeeigdht 0=s w5uos oonl wa%w Coe MIL Cox MEL Cee MRL Came MRL Cm MRL Cem MR BR Parameter mghg NR mpks TM mpg mes A mpks mpks mh mes mg/kg myks mks mp/ks frooiemnmn Sa UVSYwoommowe rtv@T: oe Plow md moTou rlb wm i wevvo ordo3ooau0 0o8w om 1 ow CBaeckiienn Chromium vYvoonrroon%me owo0n meve 1 mmvaomoa ron om os ms meTVoao umwoo 10oa Me MG Cfioenet pa vCColll amoo%8 ol ir sweow do4 iomuexo:o4z wmevoo::4 ooas we 4 oreo or mor mo he VVVaepeeeeinvnn New VVvlalomowMae3ol vhs % woesTm e3ob uv % awmmNoa3 uh sRwVe e2 uh atmmbow2 ou SSFoieaorsmin Soin VP Voodreooe wovoa:n Con Mom weToUw eoo:omovmMY40oa ow om am om uovToe0:oomvw 40 os; me om aw pfoTonaln Vv voor r%aslh o h%er2or sw Ne ai 2 vwo:iE owuz Aeee eee etr-- [-- 00018 000311 USFW 0887 Tube1.5 (Cot)Remit"oWfAtXhe22A7n3sDyrsyfRormTACrLocMketSailesinBoveFecalMater BasedcnDry Weight LColcaisneDn Doee wDw3 32Solds n 10 Pn ursmeser ECoEe T MRL E Come MRL e ---- `AAmsiusmoorn,y wvoww am [a 0 ABnaerurn o uoow 2 euo 21 C_ aBetnrtiounm u[oA uuoo CCharoemnium wwvoz0 BuBz CCoopvpaer xvoz2 wvoo o2 : Larnd wouzseo32@ . MMaanggnaesseosme swo 21 aswo 2 3 MeNrkeeulry vuo onoz uuo ez PoSeulessin wo[a00 omvoaz0 Siver Sodom wouo 2 weuo 202 VThaadliam vvo oz uuo z - Zine 5 2 n2 ETIOELARSTORORYITALS 00019 000312 USFW 0888 LCoiceateDn +s2aSLopddises Meb-odBlsk| .00 Panne mCoones mMeRkL Te es A`Aussrmony u u sox BAnuenreic uU ooos CBaedmniiumm UU oooem CCharcoommium wUv oeC:N CoCpoptaer Uuo ooolm Loens v U 2oz MMiangges ouo o MNaircakenls uUoooe:z SPcoisasumm Uuo omo SSoidveirum UUO' oz VTiharlalodmum u o`nez Lm U os -Dpbod we Table16 R"eWASof2t2h7e ADrcyaRmCforreTeASLiMeals Fac BacnsDryeWeidght LCbamonllA LeCosmuells LeComm2iic LbCemol22A ois 03s [3 os meCxosxapMRiLs oCoamke mMkRsL mCeosm mMeRhL mCeasmeMkRsL CPoymmi28 0180 Cox mis MRL mois wwvomos mwu om5s 3367 o0ms 43oosm o1o3 oomm 001s8 oowm a4w1 02os a33es02 so o0m1 1is ooml oeme om2 oesw om2 em 011snoo1 3u3 o0z2 2us o0z2 moo> ae m02 201 somm oloom40 omdo omm ooam o1m2 o0m2 mo os mo 0s wmu onsameu oe5 az os ss 0s swu 0oSo 43 03 04%3 oomm 19 ox oigs oomm 18 002 03%3 o0mm 6 oa w3s s02 53 om 039 s02 i om a2 S02 ss 02 a1s 012 aom ol2 1W6w0 012 #102 0;1 Boo w12o oc hoor 0m6e om1 sa or 7u o0z2 M0 20 24u0 0022 80 20 ava oz02 TI 20 om1om 0m2 om 0m2 om1 a000 om0 14 02 00; 0:l 2 d0m 0100 1 02 0s 02 1 os mo os wo os aEmOELURSTIORTITALS 00020 000313 USFW 0889 LCoDn freenea Parameter LCoomozc onn Coc MRL mks mais Table 16(Go)RWaae2.f27tDeryAasamCyrocfkorSToAnLMeals ema BasDryeWeidght ASmaAl ostun Co MRL mks mes A0lp pseoc ozn 0x1 Com MRL Com MRL mks mpg mgsmes Asoma oxn Com MRL mgs mek AAnuimmeny Bumenne BCeinmiomn CChaamma CCoopbpearn Loysont VaMagrrgeeseisen NiMakreans SPcoieamm SSohian VTehnutma = wvoos "4 omos ow oomm s2w5 035 5Wo m`ei s1o 0:2 wWoo 1 vuo o02 wo2 x S0e;o omlo 9B0i o`xx Mo os rrr mevonssoUzsweuoos 22 os 35 05 44 0s mUooso 26 03 onmoomm 0%woomm oz1m oomm 00u% o0:% am3o4 om5 w3w4 om0s a3m3 om5 w21osao e3s4 o0m2 20Sm02 a333 o0m2 a1s7 o0m memoor2 aw0e e2 11m3w oo2 ouw ol2 w1o3 om1 0m%0 o@1 s1w5 021 0s%o on1 wum ooa ove ozol Mvu o02 Uo0 lo37 M0W2 WeOs M0m2 m43w;02 030 02 00s2 om1 om> om 0s2 om 0:22 0m sooo om1 4000s om10 a0w om10 ao0m ox10 a3m5o o0s2 m1os o0s2 a40a 0o2 sm2 0`032 amotLursromoRTAS 00021 000314 USFW 0890 oie 6 Com iRoAt Avisfr man TAL MesFos 2o2sp Mes:"odmaiz w01s3: 3 wRee% oo Wwiyn2 = Mwsa% 4 Aween5 os vem oe me ae Cm MRL Ce Mu Cm dL Cm ML Parameter mekg wgks mg/kgmpks mgmp/ks mgsmEks mgsmpks mgs mpks = i J = vYTedym vos mvTesdm moe mpmMoemd5 BModSe mgTeesdm BNEnE moGemNeGomeasweamuooeemm op tn om oom tSfomoh = er pvR L oommCoIglm eeAmm vo ee mee moa DD0aI 00S mDSohmd wBhe oomw a UT co== Ga pvveoomwdA mom epcomeeammgmEm fmeetrLBwetetaenmI ama w om ow Bm ooaoh m ISNo esn PToeet Bvvo oeu vvoomm aoosvmeaa e om Apmwe ouax hNBmEa wSwYanwe eoeo omagoom om maeTawwe omTE om fouvseo na, UUvo odm vem mowodeom eammoem umooonom CRCA R aooeomm UooNm oooCdmR AA LoOmf hoem Mamoo0mwe mhE ee E vwwemeRY arose 002 000315 USFW 0891 Cjarnooqspae sodess os5s Parameter Co RL imgkg mpg AmAmuorny BAanneem .CBeanmumm CCrooemn, CCoopprenr Lbayt MaMagnngeanseisae MNeircel Spoassni SSiavderun VTimhaatmum om auo5 a%t o9ws o2s oomm wVo2 015 Wo 0o2i 0w%o om2 GSo oa1 2v5 o02 woER 20 G0o7 odmo "bs o`moa Mo 0s TEERR-- Table 16. (Cot")WRAeSm 2.2o7f3tDheryARmmyCsrfokSTtALMeals Fama BasDryeWeidght pseuend Amrcar n 2 R0e0faeree sRuepfer in n on 02 081 03 Cm MRL Co MRL Co MRL Co MRL mpksempeheeemks mpks mrks--me--s-- mks mes ewVom5 as bs meuomssou 22 bs 35 omsumuso os 43 0s omi oowm omb oowm om1B oowm 0bso0m; sma4o om5 32 02 a202 omsum2 ow5 34 02 21 02 e2 som 3 02 aNs emownomoo 7m9 ooom 57 o0m1 me om3 w1e2 om2 moso om2 mom0 022 memoa1 vo woem oo1 uo02 a60 ol1 vu 02 sset o1 u 02 m34w;02 E4O0 A02 M6W0 202 0woo2:0 oo3 om 4m 10 00s5 om 4m 10 op2 0m 40 10 oota om a0 0 6307 o0ma oam3 o0m2 o2m2 o0m o2m6 o0m2 mo os Wo os 1 0s Wo 0s sRemfecrence oa0 Cee MRL -- mksmake mwu ooS$ 3x6 o0ms o2i5 o0m0 e6m 03 wmoo: w1w6 om2 mme o1 ovm 0o2o WWEl 20 4o0m o1m0 0603s o0m2 am 03 amosiwrarmorTALs 00023 000316 USFW 0892 ae 6 (Com)RWas3n7heryARycfraTALMis an frGHrieeD. Me:a0e)dmt3 olmm 2 `Bca o Ds ryWeeigdht i% nl=s3 on oh meo-sa noam%t on oe ML Cm MRL Ce MAL Cm MIL Cox MU Cm ME BPr slariaEmne=oter mpgYVmsdpka st =pmkMs msres mgmkg mse ekms misgSmmeemssomgm/? kVs omkmssmm g/kVgmopokmss pffroeyr Tr vVvoelzm lpbeeSem USE ot XTVmRE mYuaommm om on on om bvvoosmm om om mbvoowmm ox om Ccroaoe oo YYUo osm poop aMe 0an emer moeThH ooedmCG oxox moeRwodm3 9 Wm amToeoH oomasmeohn ooam LG Tw i=Seen J T vCoemruggommsan Vr Bm maBomtotm Bom eomn Tsam Hem maw thom doomea ea hom oem eToren prs vLDoESm Uomo ugmnemsme eo ma owdTe Smwb ap neeYw ommme mem wwwevwg oemme woovwg wo3nm Lhfreon for YYUoelonn Yom ao2mme0e%n am0MaemCkh wwVeWoemmCh 8 Sh am mmbUommow eommUmomow br ew be on RE vor sv eP8e H FNF ge OC ad woo amonwenmors 00024 000317 USFW 0893 Tate 15 (Com) R7hryAfCrrfTnALMoe Fe a Gfreoasnt us 3 Le. on roal% wedw%n sehbie ne i n oi on o> on neokSxoo ok Co MRL Cox MRL Cm MEL Cme MIL Cox MU Cm MU Parameter som AA mg/kg mg/kg wCon5 mg/kg mks mwMes5 mks mpks mg/kg mks mks mks mg/kg mgs omCossamVomsamDamsoaom3 pa -- oi Eo E2v S Mdees GGemm WE SE mem aMvmoewsa oh im wvYoommm on om bvvoommm om om wuVoommm om oa Cr--a e Te ASWIBGU0E aoe aaEeE OT om a0mT%heo OF om aomneMwcm3 om am Sm aommTY oama ma woeCnU aao ew . otLt eeaheiT Noten % wr hoaem oon Rem wwMeS sedTmomw samoT Hoa Roem mooswe om Boa doanm oa Nom NjVeewLm To mA eTosaem pom nomadoswme weenTs amme maeUImmEe me mg aq mpm moowHmgwoeWmm wawebmg aoWomm fSoooill ---- suSYoonm2 SC ambTeesmhwbToodmhxUToommCh dm Se dG aebVoemmwwemVoomm am wa o -TEE wouOoO% sd wRc cwcac Sd nd aronwrosomS 0002s 000318 USFW 0894 Tore1.6(Cot)`RWeAYs2s7o3ftDhre yARnamtCrsefeokrSTtAeLMeals 2 Fao Base onPry Weight CLloiceanttio>n i2LSiodlss Paenmeeer A`mnstzimuony ABunsnusm ~CBaerivmlumm CCahcrioommum CCoobpapletr Lerownd MMaagnngeasnieosne NiMcekrceulry PoSucslseinuomn, SiSvoedirum TVhaamloumm pr RoesfE2 0V%ER 12 1x5 mCgore mMeRkL = mCeesc mMeRkL au om5 wu son 1u oons Bu omos 02u oomo 0u1 0on2 30n0o o0S2 ame53 025 0726 o0m1 03x2 o0m1 oouo on2 a02 om2 Ge7os omCG we15 02oa 0a0s6 0002s o3o5n 000s2 sw2 201 M0120 wou om0 awue oelo oUs o0m2 ooms o0x2 5 os 6 0s ReofnB-10 30s0 Roesll 13 mCeok MRL mek Come mpks MRL mghs su son mu som 2u o0osm 7u2 0o2s oul o0n; 03u oonm M202 02S0014 025 0B5 0021 o7rs 001 0m%0 o@2%om 0x2 as2e% on1 me1 0m1 2U3 o0s2 o2il2 0002s 10K3 20 MO2 20 a0u on10 0uolo uu o0n2 0u2 oonz 9 os 0 os 3NE 22 Co mek MRL mike owu om5s 2u3 ooms 00us o002 mo2o oz5 o6z1 o0m1 ossws om2 am1e5t om1 noU 000s2 WOuo 20 30u on10 0us o0o2 @ os wed owewe oRoef? 136 Cox mes MRL mks wu soo sua ooms o1m1 o0o 2302@7 02$ o1m2 o0@1 01 om2 910o)o o3o2r 000s2 803 M0 3U01o0n 1u 0o2o am os amosuReTsORTTAS 00026 000319 USFW 0895 Table1.6(Com)`RWAeY2s2s73tDheryARsuamCyrfkorSTcALMeasin Fuss `BcanDrsyWeeigdht - LCociaeseInD prose ovnen 3 oaAls 3 onnox ~ Lips 33 057 01 Parmer oCookmse mMkRsL Co MRL mek mks Come MRL me ops Auimmoanny wmUosmusom muoosn ABnaerurn ovoons nu oeos u oooms +CBaednmiums 0u o00n2 00u6 oonm 00u6 0o0n2 ChCruomcimum a209 025 wnooso m2o9 ws02 CCoopbapletr 05%9 0021 0321 o0m1 063s ooml Leoamd 403 om2 0msw om2 0a1m on2 MMaanggraenseosem wonon1 menoon1 mw1 om1 k 2 MNeerkceulry aUs o0s2s 7U0 0002s 2U6 o0o2s SPoeunssoiom BOuo 20 m0uv Ww HWuo 20 SiSvoedrum 0u om10 30u oz0 a0u om10 VTraarlalduumom ous o0o2 vu oozm uu o0n2 oc wos nos 0s iid we asd wer weg aTsoRLwRSTOSORYITALS 00027 000320 USFW 0896 Tale 16(Com)RWkma 3.7Dhom enyArRymiWyd CesogfkxSTtAeLMeals Font pTCreoheomm Me?s0d0Baxe nes Remz= [ewwnw measiSmn 1 ois meus5s i Nisa is ok Co MRL Cow MRL Co MIL Cox MRL Ce MRL Cox MRL Parameter mgs mek mpkgmefks mgs mks mgsmes mg/kgmgks my/kg mks pArouimeeadn VYCe3ss mbuossm avvooms3 Tom omuwu omoos s mVUosmsmuUsms som mom es om "pSBiueomnnns pore UUvYeo 0SY0ae% Uool aR 0% momwveommsemoSxvoeomm3 aommoToommssw0%voomm5 Te oa eo CoCChoirmnoemra or UyUo oSm 4moxmogdoap vou 2 mSMeoGoamoows oam ms wm 2 o1ms sm oomo 2 om om olMooon oaa0 om2 iNoaoniposns Uyodm VYU im oonea MUasm fi"emRooommTaw2m2 oomm1 ues oe oo mm0woam05 aowssoeasms1 TVoNmoeswnon Semon v yUooSoS8ngN m w nmem;nao vow uw wedeMe a2o0e Um MmiwoVooxme%OsNmlU oo2wm0 pSioow VToesaimm YUVeo0ao VO eaVh emm awvepoemlo wh amvaoome0 sn wov Vomdo uwme CU om eh wa wInv TEv E vw v aroesumersoraTAS 00028 000321 USFW 0897 i fCiee iyo = Parameter AEwaoN 5 Coe MRL why mpg Tule16 Com)WRekm22o7ftreyAsCioekSTtAeLMel Fen ar ry ABooiMs ABw5zN AEo5sD meTon5n fH 3 fH on Cox MIL Cae MUL Cm MIL Cox ML mig mpg mks mpg mg/kg mg/kg my/ks mg/ky aron5ms he Com MU my ms pAAirmimienny mbVoosloom mUVesmm aeDs ems5s wweDewassamea0p osmsaozwCU soems [Brmeeanm 0sWUoa0mem 0aMVe ooammm 0o04m4aoommm oo3sm% ooommw ooi3ms ooowm myoxi oaooom CoCoronomner sae oom01C3 mo`exos o0w1C3 moems03 a0w1C3 am43o1% a0w13 zoe4wep o0z33 soeonmm oam piaxg oSSbo oohm3 omwne wom3 oaww3 moam3 w0mkSwom2 woamm aom1 w7me6 aom3 VVVerpsrewn d%mvioamC1 oovwWeommoC0 umwve omma wWeNoSma waMoreeoasom wlebw noma ToSooramin Mo2MTF0m2OumoD ee 03 wem0Y 2601 meaem1y 2001 maammg x00 swweem0a. TpSrioo aoooVooommlo aoemVoommCh woem"0 oomh m mombooommop woooU oomma woemCU ooomow - poVen w os `o Gewe owvm omm m NHYG wana TE------ asoeswreonoRvas 000229 000322 USFW 0898 Tube1.6 (Co `RWeAYs2.s2o7f3tDheryARnusmyCsrfokrTSAeLMetalsioFa. BacusDryeWeidght CLolciaetnitoDn +2Solids ARE1A0T0H8 20 ARE1A0T0!7 2 ARE10A0L8 zn ARE10A0L9 2 DryR10m10 2 0m53on 230 a LipsTM on 2 - [3 16 Paneer mCotos mMiRkLe wCookme mMpRkLs meChosmeMlRLe maCkeem mMeRhLs mACosx oMaRkLs mCeosx mMREL ~- AAsmsmionny wsu omsmu sox 0u on5 40Uo3mo;w oxsowus o u os pBrassriuenn "Beryl u oons oo 002 1 0osm om om 159 0o0s 01s o@2 52 0oxs o01m9 0o0m2 027% oons 0KU o00c2 onm oomx 095 002 CCaadmiinum Chromizm. s0o%n 9%3 8s 02 aoom om5 no oomz aMoeewo om5 116 o0o2 20#025 15 om 0023 025 on om M062 028 oe om CCoobpapletr rem osn o0l2 0a20s om2 0as 01 oe0a om2 W5e4 012 14 om 3202 012 \t oz m3o5 012 0: om w9m3 012 03% ox LMeagaedesiom MMearnegiarnyese ve ox u 03 d3w eo;CG u 02 eme0 om1 u ol w1e0 0m1 U 02 ewco oo1 ox oos w5e)om 0072 00082 PNoiucskseliom Scien 104%s2 2022 101M 0220 32 M0309 20020 22 140u0o 2o0z0 u3 on2 6107 2002 oou oo2 802 2002 u on SSiovderum Tham S0o2 on"To om aoU oaC1 o1m6 o0m2 woU onlo 0506s o0m2 a0008 00120 22 02 260u o1o0 04 02 40u o1o0 uo 02 zVmanadiom w1oo202 Bo 1 am 1 we 1 w mw -.iid we bed on wet wh alia Sample Vane ZTICELARTOIORYITALS 00030 000323 USFW 0899 Table 16 (Com`)WRAeYm2.2o7f3tDhreyARnumaCyraeferkSTitAeL:Meals iFao BacnsDryeWeidght CLhoiceanioDn Meth-odBask neoyu EoYs Refoines meor m0ois SLioplasse -100 os31 2n3 -= 0z2n 1n9 P-- arameter --m-- Cookcs mMyelR-- eLes moC-- osxmMeRsL-- oeCko-- sc mMpRkLs -- mpCham-- mMkRsL -- mgChos-- moMkRsL -- mpCe kasm-- C eMAkLcee Am`Ainsnmaany - Ani uuo omos u os 0U son u os mU som vos mU oose U os wU oose u os omu omos u os BBaeumno [vy uU oomm U oz 03no0m2 007 002 o2m 0o2m 03 om 6Us oomn 04 002 6u o0nm 005 002 8u6 oomo 01s 003 CCharioomimem. Cobalt U u s02 U om m0s160 025s 04 0m 20s0i 025 04 0 200102 025 ou on S02020 025 0x oz M303 028 om om Coopnper U uv zor s7e5 012 so5 012 a9w3 012 m 36 201 s6o1 012 LMaagndesium Misganese uUo oa u om me2 om1 %0 m1e3 0m1 7 om a00m om1 2 om m0e31c 021 17 on m0es om1 74 0m : NiMcekreclury Poussin Uu o0s2 Uo am asU 0002s dow0 20 2U8 000s2 90 20 o1o5 0002s 10000 20 00177 000s2 10 20 oi1l4 000s2 S00 200 SSievleerna Sodum vuu oe2 Udo uu o2 30 do omuv om2 am 10 u+ on2 40 10 uu ona 40 10 u2 on2 30 10 TVahnaaidoimum Zoe u u ooz uo os 0us o02 os 1u2 o0e2 % 0s Uu o0n2 wo os uu o0n2 mo os 0us o0n2 5 os LTE bse egn bailoe SempeVobme amoeReTIORITALS 00031 000324 USFW 0900 Tule 16(Cot)RiAek2.2a73tDheyARsmaCyrfkoxSTeALMeal i Fast - BacosDryeWigdht - CLoiSceaslnitDsn ne8s 7 n1a0z9 we1i0 } 0% ost Lip ou Framer oCakms oMpRiLs mCaokma mMkRsL mCeoex SMREL ANsuemmi Aric wuo5 u os wmu u oomsseuvoos8 wom nom ~ fBrentyion CCuucbommom 2voomw sowm ou5 ooUoow wow 5 o0x: oomm a0 3 CCohboarra Copper oWm oo:m G7 `ei2 osxs 202 osws 012 008m o0m2 Wfwo ol2 : Loans VaMgarnegsuirosne 0wx Bo om1 % oom aowme om1 ou om om oa1 nm om : NiMoer!es Posen 2Uo oos2s Doo 0 aCsoopesx do :0 om15 o0s2 no 200 SSaileen Sodium uu voo2m ao lo vvo2n we do uv oa2 sw 10 TVitsiian oe mvv eosm`2 0V7 oo0m2 a0 os o0ns o0m2 mo 08 >Lpe oa ov wd -- amoswReTmORaTAS - 00033 000325 USFW 0901 LColceasenD SuiLSoildps s Parameter aMentohosdnBlak .100 mCeoke mMeRkL Table 17Re`sWAsXo2f2t7he3ADnraylRysimsCorrocTkASLiMee:alsisFora `BoanDrsyWeeigdht Arala0 ox AaBwo 0821 Amc 026 Aram@a o2s5t mCeok mMpRhL mkCsomeMRkL meCkaesopMRiLs Cox MRL mesmek AramoBo 0329 Coo MRL mks mek `AAmsmiennoy, pBarnue ~CBaendymliiuomm CCahrcomium CCoopapelr Leroand MaMgarnegasnieesne NMiecrkeealry SPoeulsesnumm, SoSdeurm VThaarlsluomm Zoe uuoo 03v% oozn [uFoE Uvoomoo2 v U2 2 U uo2& vUoo Uuo 02 Uvoza0 vvooz vvo oz voz mUso nu onos uU oomm a1mos02 o2m aom oomm om2 a6e os1 021s 00205 m0vo 20 su oowm 02von02 Hos 0u omsowu soe 1u5 ooms 1u5 0os 0mu oonm omu oomm 3160s02 a2m9 os02 0a0s6 0o2l o3o6 00@1 ol o022 0a2n om2 e9e5 os1 b6w 0s1 02113 00625 o2n0 00025 200uv 20 160u0v 20oy Eu No)n nvoowm vuu o0n2 03vom02 6 0s os m[a s uu ooms vU ooem a$09 025 ooi o0@ owro o@2 Ba01os o2nl8 00025 2000u0 200 0Uo:10 02u o0o2 nos au oa nu ooos omu oonn as21m 02 03046 00012 52 w0o0 0021 006 0o0sS 101000 20020 Uv om 3u oo10 Bu oo0s2 Teme amoewReTORoRTALS = 00035 000326 USFW 0902 Te 17 Com W ReiAn2 DofDTyA7 merfnt3ToAeLMesFr igCmeep Thee Ew5 dawp on 5 amwe% on Am"e= a aiwnH oh oe ML Gee MEL Com MU Cm Cam MR Parameter mig make wpa make wks mes mg/kg mgks mgsmes i-- srmn Soren w2 vosm 2% owveema5s Ls msoNPeeomwEsmmVUoeGmmsmmUous oommoes Uae von CBoaoomm. en woV2 oomomOF wg MgwEEmT aeUNnEMT MN a memYR soo@a ge on oom omoom aowwme oowm om om pofooeey =le 2alo oSnom mBhE M2ozoom ET 0NR% SRem wh omMw hWem om th omMvw aom mh NrHeeon Ned 29% %0% AE mWMedns am a waeM8Saoemm`e GbeaTwDe aWwmeow amsavwoo;smoo fSoromm fel ppUohmme 5 megbSeemmsmmSVVeo%mmmow8VVoo%mm em HE auwm vvoowm W . = =E B L ScooEnw Unmu aRE Be A NE aw asoerarmonraTis 00026 000327 USFW 0903 LColciaenstoInD w+w2LSiopliddsse Am610 036 Pumas - A`Amoumseny ABvuernme. CBademnioimm. CChureosmaimum CCoopapler Leamd Magresiom MMearncguarnyese PNoiuksesin SSicvlerenm TShoadloimom Vparsadom -id re mCooies mMeRrLs wu som 1u5 oons ooU t o0; a10 025 oai 002 022 om2 d2e0o 0s1 1U4 o0o2s 0vo 20 n voww 04u o0n2 nos sed owerwe Tale 17 (Cont)`RWAeYs2s27o3fDhreyARsusmyCsirsfkorSTteALMetals iFors: BacnsDryeWeigdht amotn RetoAu ReatB 30 3 ReofuC 3 ous oss 08 oo mCeones sMeRkLs SCoHm SMPRRL Co make MRL mek Cox MRL mes mes aU om3 2u ooms onv oomm 0so s02 o4m0 o0m1 o0m 022 a0me os1 2u2 o0s2s 180va20 0U 1002 omu oomz 6 0s nu sox 0u oons 01u 0o0n2 m25es02 0400 002 016 202 mBe051 2U9 0002s 1900u0o 20 u om10 uu oonz moos "u oosn nu oeos 00u6 oomm m30os02 03056 00012 012 022 11&500 051 1U3 o0s2 100uo 20 2u on0 uu 0022 Boos mu son Bu omos 00u5 000@ 025 S02 O3M0 0o@l oxn om2 12600 0s 031s7 00025 150u0 200 au onwn 0us 0002 "os 2IcELARSTORORTALE 00027 000328 USFW 0904 te 1. sgoStfErRAetrs rio ns fBole operrots sank p10 wn 2few v ~RTee e Ts =~= .mre - 00028. 000329 USFW 0905 Table 1.9Resultsofthe Anafo lFluyoridseiniWatser 'WA# 2-273 Dry Run Creek Site. Sample ID Locason fcomre oiMDnL 2M1e6th0od Blank 201 204C 220056C "a002 Ews Tennant W-ell Ama1v Areal UUppppeerrTTrriibbAB Ama Reference ALeaelCrveek uuoo o0z2 uo oz u 02 u u o02 uuo02 vuo oor02 amor ARerRORYIANON 00029 000330 USFW 0906 Tale 110 RefWhae.sA3.273a DfroycFios mrCdroe inSii.l Bovine Fecal Mater: Buse on Dry Weight co MDL - `Semple ID = Location. mgkg mph Mnainso Blak Dry amU-pream LesCrk osuso ooxm vos 0Met8hod Baska [--- wvow am2300a30Am UUsppppmeerrnTTribBA 2008 hmv 4w w 50 w w130 wm 0o5am LAmeaclk 0s Ds wvowm ue TMTM 0bs2 sue nm1vB u vomm ww soose hoamlilna sir Rap wwomm ww sosur py pReeric Bam Ar wwo w mm TMsue oan ne sos netic wuw w mow MMeethnodd BBllsakks -: sor nmi wvI oww ssoore haetact sor a wwoww mw sosiorr hho am1A sur Rath w ww w ww --TM0e--r ------Dxe ------------vuo--ww------ smosmemmoRyON 00030 . ; 000331 USFW 0907 Tale 11Ruofthe As forFoa reii Fasa 'WA#BabVey 2-273 Dry Run Creek Site: me MOL ee Sample ID o- Location mghg mk CMoetnhosdtBa Cie La . 1 PvE ow I mCmmizca Com LLao Lb vvoowm vo cmmz Ls vow "7 sssoo00sca soi hhAoaraeatatl uvvoomm350 vom ssooc hhaann son ham u vowm ww . ssoic wn hhaamm ary vvoow vow ssoic hhaearrv sin Reece vvoomw vom ssoosic RReeeecse vvoomw I. yt ER ---- 00041 000332 USFW 0908 Table 1.11 (Cont) Resuolftthse AnaforlFluyoridseiniFausna `WAW 2-273 Dry Run Creek Site: Based on Dry Weight Sample ID Location Conc MDL mgkg meg - --e Method Blank? - u 50 Method Blankd m m-B-19 u0 ue m RefE2 200 130 nm RefE-1 1200 1100 ne m-c25 uso ous m-C15 uno 1000 AREAIV 1001 AREATV uo 20 uo 2 - 1002 AREATV 160 150 1003 AREA 1004 AREATI uo m2 T 1005 AREATI 50 200 . 1006 AREA TI 1007 AREA TI si 230 ua z 1008 AREAT an 20 3 1009 AREAT! um 1010 Dry Run 2% am 053 mc17 150 ITIDELARSTO9DRYIANON 00042 000333 USFW 0909 `Table 1.11 (Cont) Resuolftthse AzafolFluyoridsoiniFausna `WA 2-273 Dry Run Creek Site `Based on Dry Weight Sample ID Location Conc MDL mgkg mpg Method Blanks. - u 50 Method Blanks - u 50 0a ET u7 I 1D 5 160 046 Ref-A6 uno 087 mc2e U0 048 ms-10 U0 049 men Ue 050 ms7 Ue os1 I-A19 Ue 052 mDs u9 100 mc-10 Us 101 mE-12 us 3 102 n-A20 um 103 nes LT 104 nc 2 1m 105 I-A us 106 TALS um 107 LES um 108 E-10 20 1% : 109 n-a2s 10 150 no mE 60 160 LTIDELURSHADRYIANON 0" 0043 000334 USFW 0910 Table 1.11 (Con)WRAeNsu2-l2s7o)ftDhrey AnaforlFluyoridse aiFausoa Run Crk Sie: `BasedonDry Weight Sample D Location mCgonkce. mMeDkL - MMeetthhoodd BBllaannkks? - vo uo 10 2 ns m4 vom vuoum 1m 123 mas RebD-1S J np um us 12s 126 mas nc vuowm - Ie 128 mE nc uo ve 129 os BES RefF10 uw aw wo . 035 0% RefE2 VER 00ue180 or 0 RefB-10 Ref-A-ll s0u0 ve130 0 030 E10 RefE7 wvo om10 Lon 02 ve vA W"w on1% os nc vow J ATIDELARSTRDRYIANON 00043 000335 USFW 0911 Tile 112 RWAeS2sohe9Apa7nCn fro3FShotreisFrm `BoanDrsyWeeigdht a MOL Sm oampole ID o Locatim on e ogi mghs VJ emma }: vvo os iao --J5 vo pi= foare mvowm - nerd vw =- Tel ReaafCmm wuvw150 -- -- ame y vo=m -- amme wTm e . -0 prinmt s vvoomm - ane vow SN 000336 00045 USFW 0912 a5 afpT r rOSXGAT J as matR e OSTreTemm "nm rwm m Smem E Tw ww att Se = E voormE ooxomSLbnow vow o@LmmooEmwm oon Gemrtan a ya vvRosE CPhoonopesn ov on Ynown vHoEmI B W -- oe SwsameDv vow mmmoooewno mow 00036 000337 USFW 0913 Table1.14 Resuolftthse AnaflorTyOsCiinSosil `WAH 2.273DryRunCreekSite BaonsDryeWeidght Conc Sample ID Location Percent 3020 Areal 3s 3000 Reference 36 303C UpperTrib A 33 301C LeeCreek 19 304C Upper TribB 3s 306 Area Tv as 30sec Aman 31 s0sC Aral 78 soa Area TB 51 503C Area IIA 61 s00C Areal 21 s01C AralB 7 502 AmaiC 85 506C Arealll A 52 s07C AramB 58 s08C AraC 57 509C AralvA 6 sic AralVB 63 snc AraIve 92 sic RefA 65 5138 RefB 16 + - TIDELARSTIDRY2ANON 00047 000338 USFW 0914 -- =E ET uim bE E o E EeTrbA } srsgSiTe-- re ren _ TEna ee er oe W--cmoEcWo: Elm E=mm=m bPvE o or:o oE bv fvo ioryou yoEE3= ENeEEwEent 00048 000339 USFW 0915 Tale P 16 RA eoeAtnE sin ftryrian5. a Seed f[OFo a SE A sox mm enB sun rsEe ery Tomy TseE ISUEE TwpE, TSEE see STo odoor orio76 SMe mE Grlr ees gro eme ro ie5 mcmores cpmlmess SS Bn mB corlDewap mcoorlens le lwp cores op corICesoL ime me oaSinoll mWm1somwosmey momssmarmws wm as wsaeomwwoni oowmea aomoaRwmoown PunecCoiwla GEmoanmLooammse momwaas mEosse Bwbrrs mwomwe am mommws owmsw omMMoowome SooSSmol N masas ooEerRa o0ms aoomsO e an3e uWs oWma omme orl mh he de 6 fh OW OW 4m02s omass oennSes Tseieen [Juamm Msizn sMisB sMuMeC Roomme LomC AseA aseve dswic sohm, RsoBm SocSuroTno|| Si Coomosrn tew3o1o sl Me prdieaosoo me GreTmooer ms omear#e1 mo cparmeb ome cpolreno `mb corloeseoer `me _cprlheaeenys des cores mmes crer`eman ou ocSimul Gl mmmoeommmssa owmesm Ar miss woBaeyn ms wsarny wo a8NI 83 wmommye my mwaee owwmhomawoommsom me mr ay om S paseLoGoinl mMe1 live dwes town mmie ee Se momee Bm e ames ge Te Toe Boes Soe N ws o a3 o98 gov Sow Sov mnoGnoli 0laeset&wte wWays OEm2s6 5dO0sW0 hS0n%howOha%n oeOwnW oom&@e hwwn oomwhs +Dents Cum Been Thea 2270sARGTORDR GRAN 00039 000340 USFW 0916 Section 2 000341 USFW 0917 QA/QCforBNA RePB sourlttsoo fctahteiSe ounr,rogaathe RsecuoavelrwiaessfsopirkBredNAwieinhSiomil co0mpoo nn suropt ue me couisg of ihe 2 The sumogae pee recovers, Hn Tale 2.1, apd fo54m0 136, Toeayight ut of 30pre rovers `were within QC limits. RSesaulmiseof1tAhweiMsSc/haMosSeDnaAnBfno,araltvesismfaaor0 rsnBNsAmpinmtSkso,oi.l TesipiiekesAu,ppicca(eMee(SiMAhDSn)DO)dCnlssyss..TTThtee ppelrsieonpt oeomvenriss, lesdd in RT reisrulstoofetxheoSnur,rogaactheh RseacmopvleeriwesasfsoprikBeNd AwiitnhBaosvniisnecoFuEeTpeEosn)t Mesaterra opac mmiixre consiingof icobeseaed, 2The reponed sumogate peren recovers, sso isd in Table 2.3, raged from 720 96. All 6prea recoveries were within QC limits. `ResultsoftheMS/MSDAnaisforBNAinBovine FecalMater TSunEol 807nweasschoosemn f5o3r the5a6ihe 2sciovken sTpikee dwuplnicatOeC(mSMeSD)peamraas,,TToeppeeaes.rereccoovvereiers,ileiseeddffon listed in Table 2.4, ranged from 4 to 35. No QC limits are available for the RPDs. ResulsoftheLCSAlvisforBNAinBovine Fecal Maner The LCS percens recoveries, led in Table 2.4, ened fom 42 10 80. Teo out of 1 recovers were wii QC lis 000342 mss : 000i5.0 USFW 0918 TabLlee 2:323 teolfsehA nBiogasE oSreycRoumnrCirH eesefkoSriBteu inBevie Fecal Mater -- a w--oe-- eee FE Sa zs 8 zA g 4 | 3 ET EEeo 3 eg F4ER 8s F FREEE. = 3 Sa E $8EE3 S i E4.R8 ~ E F#ra 3 on es E 52 E "8 E - RFTEEE]TR J pBoEmsTnEoirtReecaSonetee gGrNe 5R ge0nT e irro.n aEEuDEn - : 000343 mo 00053 USFW 0919 Tote2.4 ete ofgWhEm ILES OraAn5drv Sthee BvIiTmrFeeaatt acter sore wis . [---- i; EE Tr|fimoeyJeomceiaemrnttion concaoasion] L"8 ote[et}me]; Ie errr re eese r Rm EiEenn e me! || dWaiftrrmoessSo-aidiy-En-eepnrTtmTo]Ts 6t4.r00 ||| bb 8v on0 3% Be i m [esBtie i 18 | | || bAceanapnni thaeentena! -- -- --1| 1 so3 &i5 || || i | EEE I P g v Pao1 za3 51 8 |ia&0x zmhmmoeemdoem vol 23 Fe-Hvet .RE TE TTen Lo" me {5Added re TRE concentration! emmeerstanas x fenmnae ae| cme | BOE HE: i eeeras bees] piipSeem ramrem rr e|| BEESEEES G 860 PHEHIE |BLR YH E EEel |m| heEmeaetinmteeeemsR |ghpmeta--t g2$e2201|1 BE1EE3S EI[E 8BR184IEI8E| MWEEEEERe - !asRuEsI ! gp 1LEHBE B[18RG1s7WEEEpERe | E HRE ISEE ER EH H |b B | R FEE imei | HE Eh T E con eR ee Toone,0e TcoRnTcaEEntEratiT onl sxE e.e B[E eiRmical hl oToEREnGT. 5 . WNitrose-gi-n-prop Ty] 3. I 5 2 nw! Cfremanes MITT IersameummesttaEnI----l B3S8 LL| [ Fyre TT -- 53S 4Bdr L1EE 8 iREeE h i E] HS 00053 000344 USFW 0920 QA/QC for Pesticide/PCB The surrogae percent recoveries, listed in Table 2.5, ranged from50t0 102. Al 10 recoveries are within QC lms. Sa Hoeial siaes mpdlein1TAhaabnwlgaeesd.2c.hf6o.rsoermoa9n9gfoerd(5tfh1er3o6.mmatzrAeirlxo sI(p20i)kreet/coomva7et.rriiAexlslspa6riekRePwidDtuhpilvniaclaQuteCes (liMmSit/s.MSTDh)e arneallayisievse. peTrhceentperdciefnfterernececsov(eRrPsD,S)li.st are within QC limits. smonunmeore 00055 000345 USFW 0921 ' . Table 2.5 Resultsofthe Surrogate Recoveries for Pestcide/PCB in Soil `WA#2-273 Dry Run Creek Site Sample ID SBLK 1A 24 1AMS J1AAMMSDO ToMX 102 9% % % 000000 e9%s Tetrachloro-m-xylene (TCMX) Decachlorobiphenyl (DCEP) Percent Recovery DCBP 50 51 51 50 0 s5o0 ADVISORY Qc Limits 30-150 30-150 arsoscarersonvassrs 00056 000346 USFW 0822 Fase 26 Renu ofahae MaSMSODnAnnsyCsomfeorSPean sse in Sd `Boa nDrsy We eigd ht. Samed 1 Compouns GSonoe aSvvsey owvse uhes RSsehoues GcWooSnOwe MR%SeD RD ReSscammsoRD w J CoveLGpEoee RmdBCEmoRm demeewOmWMhe omNR wmBd smoau womm s 1i eomwieon Dasene Bren UuU SnBmi RmnES1o%w DEERE OW a1S0kR% eenmen ER We dWnmwe wm 013 wastmwm x&4 7 mw JpeE een BR 4 svar 00057 000347 USFW 0923 QA/QCfor TAL Metals RTQehFseuLlltCsmoSsfs"ntTahheyeLspCsSewaArsnatlsversdis1fe0ocrhecTcAkfoLtohrM1eevathcaccleusoriampcrySpooeisflnthefocaulnidbrnaiohn LcuErSveas.eAMlle69nreTcovuereed.2co7ncaenmagteioBnos we3r3e wikia ReSTosaarumnlpgctleseusoco5fu0met8hdAe1f.M9o43Sf001Ao3sD0am.l3v2isdFicos1rAfyo.1wr5oTe8wrAs1Loc2Mhueoftsooafesl4sfroiirpnpmSooanireSlsd03smpi1kee30o(M3wS0)1Dw,aneaalnyswisi,oriTEhaemrppeOracCetntJforomeaceovBelras,plBosrdd ieDn TeaTbrleI2.62,8, Be Saipl concmTEiaD ofhe SAE was peer ta or SQ fo ma for samples 01D RnVeSseaiumlpltnlsecoefSa0tQ8h8Ce.mDuT3aipn0lty1isc,Dsat4TOeCaAnc1amAliviwasseiTrsae4floseerl2T3e1.Ac5tL.sSMrfieiotgpaaledduspilffnioocSramot4eirplaonoalny0sdi)s, TTs4h5o,everFreoepvnowr-eodAnerteulmsiv,oef pmeercmennt rdiefferrerncnes s(VRPEDRTSF)D)for RaPlDiSnverien Snaomplcesu5c08uK, bJeIcDu,se1ndoot1,1cboosiorf thsepsieusfoSOKhAesmnad 01Dw.eBemorg mp ekelr2 m St dod ResulisoftheLCS Analvsisfor TALMetalsinBovine FecalManer cTohmepoLuSntsamfoaunsd wianshuesdLCtSo rcheecwkitthhien aGcCunraaeofatnhde acllhboreison cuTrvaese. 2Al0l 2 reported. concerns fohe Ress of the MS Anaufor TAL Metals inBovineFecal Miner - iSfarmmopmlu3e4,81007m1wi20an.spicAnhloilseernepnofdnoedo.mnartecbioveesarpiitekse h(weeMrSeS) wIainbEalnlC,otnheceTGnhnCeatriheoownoen.eofdhT_opeeerDpeenscvermecoswveecrioaevse,irolsssdaairpTapaoeblZeu2n.eo 1d1,forra0n8ged Bess of the Dusline Anau for TAL Meta inBovine Fecal Mair : pSSaainmoepnyliaes,8l0si7sitvewdearsin0seTdlaebcltteedh2.lf1o2er. duRrpaPlniDgcseadteefarenoamlyns2io6s1.0GA(Te0hU)eI0Rreed1p8,obneecNdaousreQelCaotinlve omperbcaaernchtoafdviafhfieelre.snecersAunm(tRifPmoDoSnh)ye..cfoSur Dtthe,ieduBplEmicToaEtreSc. Besuls of the LCS Antu for TAL Meta in Fung TpFfoehrrencceonLtmipSocruesnacdo.svne.roisfefspo.euwrnaIcdsenne1wttst1ieenctoTovCaeconlhyesecQk2w.Ch1ti3hcl,eihmiawtwcsi.ceiurrhaScweOyiCvonfahtmhtQeuCsscaLloiiTwbmroaito,ifpon1pa0ec8curecrcvoevosf,errtheLeedCcSLsCe7,GoLwmbCeaSrmt1e0oec,usscaahnldmomgaLsp.CSoSp13mabacaddia1llbe$o$44ZOEoi| LCST Re we ao hated in Table 2.1 The pice reves ges rom 8 so 138 po ed 57 REACd,o Results of theMSAnalvsis for TAL MeulsinFauna Sef2a4imcsp2londeTn0h94e5h)0peeer1d1c8ce.n1t3AmSTr0ae.4bhcClo,eeverS11i2a63em,s.p1lwe0er1ric0en,ogne2ndo0cefC0rn4out5mr.w1se4r1eoe0f ctfahhoeo1sraenEidfoovir nminalrOsiLpsrAoieskasnod(fDMS8So9)OeaoAnaulypspais.irmoTeehesrOA eIpoCm)teda. npdeErrcLeonnnte(the OoCC 000348 - 00058 USFW 0924 QAGEforTAL Metals (Cont) fS coepeiees50(1OAE,DLTh, 5o04r%,eSaOm2iA,ca12s4,s10v1i0..0S4loi0nm4e8deeinroeTeoosbreebc2.tt1h5.oofrradtnhgeepdrefcsruosmfy2o2e0h)0e) aTtoloy10S6.wpeeNenot0QCHdaeAclidFEJ: TaeC10S%sayswasavid10chick3h1e 6scruagmeydofrbome 8ab9r1a0si1o10n. Aclules18r.eTcooevepresewesenw urisi hefQfCbi ehimcomps RCeSsEoPumlpteso6f0190hewreaMvScehrAienenawueforrefwmoiarttThsiA.nLphMekeaQl0C4s9il)nimFail.oyras To pera rovers, lsd in Tale 2.17, raged frm 6 0 SSaammppllee0095wwais llecetcetd,(fio0r nduCpeliT:cateaodsyihstea. m0Th1Re0PrDeS1p3.owretNr.eortQeoClicvleienpklsewaresbaevdcaialfuisbileoec,oeusAmRofmFboDont)h.offstahoehie,eieuclsoir,he ie were no deteced. motor - 0005-9 000349 USFW 0925 ws wa JU ney oe Bunn " Beriom [I Gm roman Come p. Lot SP ope - Mercury ita ron son sve Sota Ten in oc Til 27 RenWtk 3he37LCSDyeatsCofor TaL Mens 5 CTmpia=bw fReoene Clme ms J me wun ne 93 wo nem a or esas @ a a on wo 02 92 67107 108 -- = ses 70 mo mews wo 709 ws wens on wo wns PS oe seme @ 100 so wom " = us wre --- wo wee TM 3 2 as wo 25 23 1603.41 El aa - 1 ne eas ne m2 wo asm " wo ns sens ws - sosats 503 so ons us 162 ne sa15s " w win " amsonwnemsonas 00060 000350 USFW 0926 Ti27l(Ceo RWeamn2o.f730DLryCSiAmnCyrikfxTALMeals Si Les Mea CeCmef ReCoowew QCLmm Remy o mois = o ES Eo. nam 30 25261 10B0521300 1n J pen 5450 rs mam 105 param w7 0s4a nuasuss 05 Berton Cuma "s s03 wars 0 Caco 10130 0n0o53 waeaiiseo 0w Cucmum conn 26s usm w Corner wr ne soz m on 50e ansu:s wmeenes 0n0 Las a apn 30 wo moa 0 [re 103 Tou - fo 01 20s n Nasa 17 ois osm w fowann 90 on meses 8 Sdewm 1850 ms 563 % shar wo ma ums ns Sot = 6 amo 0s Tien os as uss 5 Vesta We ss uss i P 0 as sas ---- amoswRsTSORTITALS 00061 . : 000351 USFW 0927 "Ta2.b(Clonet)R`eWsAaX 2o3f7t3hDerLyCSRAunnCryocik SorieTALMealsi Sil. es Mews Ce"rCiofnee.d mas RecCoonwe.nd = QC Limi os Recovery Neminam 6210 an 03570 101 Antimony 512 1 122901 mw Arnie 1 ass wasn 10s Baron 260 ES 150330 106 * Berylium 2 ns 7100 12 Cadmiom ne 14100 5 Calcium 2760 250 mos 2 Chromism 9 84 $9494 E cova 01 02 768.125 10 Copper 82 53 455704 % on 15300 15300 s021700 10 Lead = nz 160 2 Magen 1800 mo 102160 9% Manganese m 2 mass 103 Mercury 2 226 160341 0 Naked 16 10 12200 El] Poussium 20 a0 1102630 104 Selenium a1 590 sss To Siver 6 "3 S148 10 Sodom a as 305.645 Tratom sos EY 20768 ne, Varsdiom 2 ys 92195 106 2c na 107 Blas % _--mm amosuRsTRORTITAS 00062 000352 USFW 0928 we ome gmm 0 ery o30w0 = re W31s0 me n m "fpreurcimmi 300A rPeiO. forreen c3d0 fPrl fJ al =maw wmWm dunee 28 mow30 Mcagowesm uJ mn ,We mweeowam J no. w tunn 2W00e8 Bem awmFtp amctsermonas a ADTe ------ moemoouvemicm RMaepesmm MMaTme aMceme wwoowwnm oow.- -xoaxm va om 3= o5 owme Hoi we 5w sawmm wnoww @= mSeemk b1o no ovomme xHHwo P[aA H_--] EmeR mOeW utee ono e tooem 0Towmoe J tol uvmoen tonnee F5 -ow mPnaoomms "i na 1" @130 ia 5neam Ph3 awamn -jo 55 wamh Z w nw a mGee wXaono =- 5nwa o2m x we a wm o3 w . woa ww 5nowem ;; nweoawhn wi wwoea u3 yeaw nww nnaome uo@me --maemwm--x -- . 000353 i2b(Ceont) R Whx 327Do MySRoAnmCyonsh kfSoaT.ALMee s Sa. Bud Dry Weigh Mest Chr SuleOnfiCo ReedCoc Nimoy QRCLeimen eChas oespme eSkwe spe Amery 1A wo om or se mas PE ny sme nes ws as Bom ws ons sas noe sis Boston 1A wom 10s wos "umm a wom ne ws rss Choma 14 ET En wo mas crm we m2 s2 moe rsa Come 1a x2 we us ns ors Lat " wm ss mrss Norge 14 wo ma 2 Nema Nena vom om ws Nad ns ma ms we as Sam 1A ve sons 200 wma shea 0 se 1s sas Tae 1a on ome me a Nami 1a 26m nse. ws sas z= nw ne m2 I pe ms nroewsenmonTTAs 00063 000354 USFW 0930 Table29Results`oWfAtXhe2D:7u3pDreyARnaaslyCsirskfoSrTteALMealsin Sl Based onDryWeight Sample S08 Mew simp DuSplaimcaeteRent RFeeensne QReCleLiviemi Percent Auminam 9640 10500 5 Aaumony u u xo Arenic 3 nm Bum 16 ns 2 2 Beyliom 1 1 Cadrivm v uv ne 2 [re 290 290 Chromium % " oe coat 1 1 Commer n " iron 260 2m00 4 Lest 2 2 5 2 Magnesium 2580 20 s [r---- 1310 ' Mercury uv u Ne Niked 2 s 0 Poussin 950 noo 1s Scien uv uv 3 nA Ser uv u xe Sedum = 3s 5 0 Trai u v xe nA Varsdom o ES 5 . 2 Emde amosReTIORTTAS 00065 . ; _ . " 000355 USFW 0931 Table29 (Con)Resu`ltWsAXof2:he7D3upDrlyiaRiacaACsralkiSsif.or TALMeasin Soil Based ouDryWeight Sample 301D Mew Sunple Resul DSuapmlipclaetRees nse mare RePtearinvte Diffence QReClsLiivemi _PDairfeinetoee Auminum 7080 on 0 Anumany v uv Ne PY neni ' s x Buon. 0 o 0 0 " Bentiom u u Ne Cadmiom u u Ne 2 Cakium m0 oe 0 Chromium 1" 2 1s Cova " n 2. Copper n . 2. ron 22000 18600 " 2 Lest u u xe Magnesum 2050 1620 ER Mangano 450 as s Mereurs u u 3 nm Nake! 1 u ne F Pousium 04 sus s Selenium u u ne Na Siver uv u ne El Sodom 2 3 2 Thalia 5 5 " na Varsdiom, 2 El Zine 3s " amotwRsTIORITAS oooee . : 000356 USFW 0932 a2 Com Relhsof3be7oapensvnse eiSt TALMein 3 scape 4 Me SomcRot SDeipeisteens PRoana cPRolaeismne ph THE Dime Dime min 1295 war 0 Arimeny v u we Aric 0 n Bann - a . umn "Berylium 414 13 50 7 20 i oun um ns . J o A Cobalt 25 2 come % x 2 20 . 0 Iron. 38534 Lt Jagseom 374 rae 1601 Mery u oe n J Iu sive u sobum os Totem o tan 3 e2e or 32891 1 20 2 o sw 5 wr s u TM " W ar 2 " is Ne v we os : v xe 0 " " 0% T . F 0 smorumemeomITAS . 00067 . . - - 000357 USFW 0933 16BenetrentrrHL oes ee : - I"Lest Ce mr fore son a cum cic Crom I SE fr wt I one p- 2ores ws wm sass wwe FE. wm rR me me VN wn eo worm owe MO [A F- wm on wn san omar oe a we - a on Sodwm Geen MwE we : ass 305.645 22TIDELARSTOFORYZTALS 0006s . 000358 USFW 0934 Til2.11Ref h"eSMASSA2.n37s ryormTAoLMveSe BevisFoalMor `amd caryWith ve Git SCualee OupopieCo RSpeeemo NRSehamrey qRCoLrmsy E -- a ew Asien mene Buen Ben w vom " wo oa w n wom as woo om " PEE wow om em wo em Camm wo vom n weno oma won " em cont woo om ws ry Comer wo one " w emo on www 00 x em Lee wow wo ei Monge woe om wo PE) Merry wor es os ww Nt won ow us Ww em f-- wv 1 2 @ emo Siver wor om n ww Toten wv om us a em Vaminen wo om 1 om em P ws ow m Ww wm amosmmoRTINS ~ 000359 Table 2.12 ResultsoftheD`uWplAiYca2t:e2A7naDlryysRiasfaorCTrALkMSettea.ls inBoveFecal Mir Based onDryWelsh Sump: 807 Mew SemmpalesResul DeSpalmpelneeResti mas RPeelrnnivte Dierence Auman 13700 13600 ' Animony u v xe Asenic 0 a " Baron mw m 2 Benton 13 13 [ee uv v Ne [3 1530 1560 . Chromium 2 Cobalt 1 1s 6 Copper " 1 6 on 2570 20900 5 . Lest 1 1 5 Mapresom 3000 0 2 Manganese 1340 1220 5 Mercury uv u xe Nickel 2 Pousom 1300 1300 Setviom u u 3 Siver v v 3 Sotum 9% o 2 Thala u uv Ne Varsdom 2 3 Zoe B 2 2 -_-- amoEARETRORYITALS 00070 i 000360 USFW 0936 able 2.13 ResuAlsRoft2b-e3L7C3SDArnaRlaymsiCsfrokTSAiLeMlsinFame . Lest - Metal CenCiofineed. RecoCvoenre.ed. QC Limits. % Recovery = megksg = mksse 5m2g1k2g6 5 Amini 103 Arsenic 180 1s 165191 5 Chromium 347 ns 22402 0 Copper 230 229 21825 Fy on @ 120 mas 100 Manganese 26 368 332400 01 . Mercury ast 8 43843 0 Nickel 194 175 163-225 90 ) zoe 36 2s B32 ee 2273DELWAR\STOSORY2TALS 00071 600261 USFW 0937 , Table 213 (Cont)ReWsuAlWts2o.f27th3eDLrCySRAanamlCyrseieskfoSritTeALMetalsinFauna Les: Mea Cenibed Recoversd QCLinits as ws nats 4 Recovery Aminm 109 Avsenic 180 Chromium 347 Copper 230 ron 2 Masginese 366 Mercury ast Nickel 194 Zine 26 vmr-------- 0 92.126 6 165191 ns 22402 22 21825 1450 152182 36 332400 46 43843 no 163225 23 n3278 ert 5 EY 9 % 102 10 3 5 9 ------ 2273\DELWARIS70SI0RY2TALS T 00072 000362 USFW 0938 ab 21 (ConReausSof LyCSAnsCsooSrTALMessfnFos LCs3 `Metal min rnc Camm ca Comer Let ogee sen sive os FE Certified mmves 352 6 08 on 8 ys on 658 60 oon ws Recovered ewawte ns wr nee a wer woe on on ae wm mre QC Limits = nok meme meas owom wre seriso omen enw smear ses wsms % Recovery " " or " no 0" us " ne --. arspsamsrmoRS 00073 000363 USFW 0939 Loss Meal Nem nic "Cadmium Coat Conner on Lest Manganese Seenum Str Cm - Table 2.13 (Cont)ResultsoftheLCSAnalysisfor TALMezalsin Fauna `WAS 2-273 Dry Run Creek Site: ComCobneed ReCoowd QCLimis mg/kg mg/kg mgkg 252 2 ns 166 187 155477 208 23 203-213 0x 00 awe 28 ee anaes 10s 1080 J0s61150 on 05 amon 6.88 6.58 6327.44 cos co ss0se2 ons cs asmsos sss woe mama nnn -- 5% os 102 108 o 108 96 5 10 m 22rsosarsTosoRvITALS 00073 000364 USFW 0940 `Table 2.13(Cont) Resultsofthe LCSAnalysisfor TALMetalsin Fauna. 'WAS# 2-273 Dry Run Creek Site Less veal Nomina Anic Carifed weee 252 166 Recover = aa 20 use QC Limi nis nears ssa %eResoney 1 "Cadmium 208 195 203213 9% Cobalt 024 019 019-029 TM - on ne Copper 258 252 24.7269 1060 1056150 98 % Lad oz 03s 020024 109 Magee 688 sme amas " Selenium 606 sss ssa M : Silver zoe _ sss 80 03883 100 0.608 0558 * 0.576-0.64 92 -- 2TOEWRTOSORYZTALS 00075 000365 USFW 0941 Less Mes `Table 2.13 (Cont) ResultsoftheLCSAnalysisfor TALMetalsin Fauna. `WAX 2-273 Dry Run Creek Site. CerCtiofnieed ReCovned QCLimis mks mks meg % Recovery Aluminum 109 ns 92.126 108 Arsenic 180 ns 169191 9% +. Chromium 347 n2 22402 % Copper 234 22 21825 9 on 10 180 132152 104 Manganese 366 365 332400 100 Mercury as as 43849 106 Nickel 194 m 163225 5 Zn 256 255 53218 100 f-- e --r---------------------------- 230 RRITOSORYZTALS meeemeses -- 00076 000366 USFW 0942 Table 2.13 (Cont) RWeaks2ou.f2hl73eDtLrCysSRAunmalCyrsoicsefoSriTALMetalsin Fauna Les Meal CeniCfoiveed os wel Auminem 2000 Antimony 50 ssenic 50 Bum 200 Baylin 0 Cation 0 Crem ES Coban so Copper 0 on 1000 Leat 500 Manganese 50 Nickel 0 Scena 250 Sites 0 hatha 100 Varad so ne 500 [2 Recovered. nel 2080 = " 1950 s01 90 x = 2 1050 sor sos s10 28 50 50 sis a QC Limits. % Recovery wa 120 010 0120 80120 0120 50120 50120 80120 0120 0120 0120 020 si s0120 s0120 ES) 0120 %Recovery 10 5 se 10 100 0 104 100 105 01 10 0 E 106 103 9 ee ZTIELARGTOIORYITALS 00077 000367 USFW 0943 . Table 213(ContRWeAuNs2of.2t7heDLrCySRAunmaCioskSotxeT:ALMeainFlaisa Less : Meul Co Cenified [ Recovered QC Limits . mghg mee m/s. % Recovery Mumm 252 7 nes i Avsenic 165 woe ssi ) Cutnivm 08 wee asus 5 Cota 02 ow oso Copper 58 2 27289 0 en nos wo s1150 a - Lead 022 Ming 638 020 020024 ar emu 9 - - Selenium 606 sp. 5.506.62 8 Siver oscs seit osisos n ne sss mes mams 10 ZmoeurensoRZTALS 0007s ee 000368 USFW 0944 La Ce oe n sf TALMt ea Fu sess cpm dr moe cclm -- - mg my/ks mgs. -- 09 je 0 wor same pa wen w " vn 7 3% ne mas amas " w vo PA 36 w mam vo sam - sa 28 a oe me was " w z ne ws wr mem w" arsn------. -- 00073 000369 USFW 0945 Table 2.13 (Cont)ResultsofheLCSAnaya for TALMetals i Fema 'WA# 2-273DryRunCreekSite: Lesto Meal CenCifoineed ro RecoCvoenreed wel QC Limits. 4 Recovery % Recovery Amini 2000 199 50120 10 Astimony 500 50120 2 - Arsenic 3 PY 50120 8 Berm 2000 1990 80.120 9 Berlium s0 1 0-120 9% . Caimivm 0 0 80.120 2 Chromium 20 Ee 80.120 101 Coban 500 sie 80.120 103 Copper 250 4 80.120 3 ron 1000 598 80.120 100 Lest 500 0 80.120 0 | Manganese 500 o 80.120 9% Nickel 500 500 80120 10 Selenum 167 m 80.120 103 Siver 50. aa 50.120 Thallium 10 963 30120 El Vanadium 500 50 50.120 100 Zine EY s08 80-120 102 2273DELARISTOSIORYZTALS - 00080 000370 USFW 0946 Table2.13 (Cont)ResouftlhetLCsSAnalysisforTALMealsin Fauna `WA# 2-273 Dry Rum Creek Site: Lesh Meal Cenified [= Recovered Con. QC Limits % Recovery mg/kg. mye mk - Aluminum 282 260 28276 103 Arsenic. 166 144 15.5177 8 ~ `Cadmium 208 195 203213 9 Cobalt 024 020 019029 8 - Copper 258 20 247.269 101 _ Tron, 103 110 1056-1150 101 Lead 022 026+ 020024 18 = Manganese 6388 s8s* 632744 85 Selenium 6.06 58 5506.62 9% Silver 0.608 0.580 0576:0.64 95 Zine 838 904+ 33883 105 J ------------- 2273DELARISTOSIORYZTALS 00081 000371 USFW 0947 Les 12 Meal Table 2.13 (Cont) ResulsoftheLCSAnalysisforTALMetalsinFauna `WAH 2-273 DryRunCreek Site CeCniofnieed. make RecoCvoenrs.ed meg. QC Limis: meg 4 Recovery Aluminum 109 tae 92126 132 Arsenic 180 1s 169191 0 Chromium 37 29 292402 9 Copper 23 ae 21825 9 Iron 102 152 132152 107 - Manganese 366 362 332400 9 Mercury a6 a 43849 9s " Nickel 194 3 163.225 Zine 256 26 53219 106 2730ELARETRORYZTALS 00082 000372 USFW 0948 Taen13(ConyRWeKs2s.27h3e DLCySRAanCsefSo iT:ALMelia Fama Les Vea CCoonnees Repvoe QCLimis rr-- oe Hel wel %Recovery Aluminum 2000 2000 Animony 00 " 80-120 wim 100 n avenie m 2% 0120 Bum 00 10 0-120 5 Benim 0 as wi20 = Catmivn 5 a 0.120 ss - Cota 00 Chromium 200 19 sie 80-120 0120 copper 20 2 0120 on 1000 0 w120 9% ' 1 * TM "Lead 500 51 80-120 Magee 0 - 0120 Nike! 0 - wa Seesem wo nm 0120 Str P) s26 0.120 Tham 00 sn 0.10 Vanstum 0 I 0120 ame 00 as wi20 103 " 0 105 10 = 000373 ror wRETRORTALS __-- USFW 0949 il214Ram2o73MSbyAComTALMe Forme at Cir a ry SakOaiCm AmoesiCax Nao Rcrem = oar - Ew ew 0A Fa se nem pe 0 wom se wen 18 nom = oem Stem 014 ws a = em i 1p woe a vom 1A wow mr mem con win wow ns ww came SA new ae wo wm ma PR wo em wa ww no wo em Mons 1A woe mem [PE ow ww ww aw won ooow a wen [. Fa u nem swe sn ww = Wem 1a -- 0 oem tn 01 ow a wo em Zn sia new ry YR mosses 000374 00054 USFW 0950 al 214 CyReeASfDMyS i eeonks STeANd om vw mr Soeo ourmaieCm ERom XRSmoowy Rcemmay eS em J ---- cw 2 a wm eC wow 2s a [-- om = w em Belin 904C PO oo mw em cm mic we ws wen Groans WiC ow 01 ww em Cobalt 904C Ge eC oc ww me Mapua 500 New tC Naa ic J sve wc an iC Voi 04 0 " "s ww os wow mo wo. as mw --_-- os --a a " we = [PE or ow 00 12 130 Wem wo em weno we em "em wo en "wm oem wwe ww PY sc ww wo 5 em 00085 ` - - i 000375 USFW 0951 Tie 214 ConRaEmrpArof vNeSeAmrinsfrTALMee Fm Vai Gir Soeok OvmoieCmr R--meiCo MR=may Nccoumon TEE JUS vow - wo wm pe a us mem om wm ne a ew evi 134 vow - w em an wa Pr wo em rm wom = wo em aw ww ns mem oe oo 5 nem - om "ow ww x wm ww ow ns w wm ot ow s " em Newry 0 a ow wm aw woe ws ww Soa -- x ww Sw we sn sem 10 com wo wwe Vestn it ow ow us we Bow we ws 2 em ' . . 000376 00086 USFW 0952 1CmRy e e8Sem npCsk TAL om i er Smmeoumiom RCo Mimo aNciimm T = o hs m am= 5a ww UN wo. a -- pe 100 wn us a em [-- now = @ em FR--- [a - w em J w a a nem a Fa us ---- [-- wa " "em [-- -- ur 5 wm me w om m ------ wo oa a em [-- wa m nem ewer 100 -- on wm --- va wo oem [-- vow u "wm oe wo. " "em S---- ve o -- " pe fa wa " amonwmermomnas 5 wm --- new 00087 000377 USFW 0953 ae214 (Con)RWmAS 2o.f27h3DeMrySRAamnCirfSokraTALMl Foe Baonn rdy gh Mew Cher SCeomei OnpSmpiinCeoc ReSokenCom RSeparo QShReLsovy ae ew many 048 vow "e vem ame 04s [-- vo 01 EI m 5 ew em Benim 0 om so on new Caimi + 088 os ey 2 ew Crom 088 uo s we smo com os om wm ---- om n nem on os ew 1 x sao Lat ous ow a mem Nong 045 ws. ns 5 em ton os om u mo em Net oss uw wr new Sdn 08 vow n weno She on oo 30 s we Ten 018 toss 997 wo em Vest 045 now 1 2 sao Zw 2em ooun ww r w m i 0 om ewa w mosurssoRIAS 000378 Table 2.15Reb`sWAofXt2h:D73upDriynRuAaCsrtkaSfiortMlis Fanos. BasecdoDryWeight Sample 501 A Meal S`emmaeple Amino " Animeny u Annie 26 Bunun ns Benium 006 Cadrivm. an Calm 390 Chromium. 1" Cava sas Copper 136 on 96 Less oss Magesum 940 Manganese 872 Mercury = v Nk 30 Powmom 8500 Sele 2 Siver on Sodum a0 Traum 003 Varsdom 20 Ze ne --_---- DuSpaloipclaeteResli `ms 1100 v 28 12 008 3 30 23 918 1s nso on 955 950 u 36 00 2 on 0 003 2 ns RPeelraninte Difference = ne ' 1 5 2 0 5 ' " o 5 xe i 2 o 2 2 smoeaRsTRORITAS 00089 . . 000379 USFW 0955 Table2.15(Cont)ReWAus2o2f7h3eDrpylReatoCeArknSsieforMeusin Feiss BasedonDryWight - Sample 902A Meat Neminar Sumple Resi eww 360 DSeumpplleinRet RPeerlcoevnte ew Dem. 10 Assmony u nen Mn u xe ! Bum us 11 5 "Benton oor 00s n Cadmium 2 22 ' Caeiom, 3% an 1 Chromum is 24 5 Cota 946 508 A Comper uz 1s s ron on 1640 7 Lat os ors Mogesm 199 a0 5 Magee 851 964 n jr u u 3 Nkel 3 3 6 Poon 8500 5000 , Scienm 5 5 o Siver 00s 003 2 Sodum a0 an 5 Thatium 002 002 0 Varad 50 n Zn 0 100 s mE amorwsToRORaTAS 000380 000380 USFW 0956 ue2.15 Con)Reasn3a37e3DruyplinCArneaibsm Mealsia Feat `Boa nDrsyWe eigdht Sump 124 Me SupleRos Tees oman 20 Arnon u po u parm 197 Bein u Cimon 026 Cun 0 Cuomvm 18 Cos ox comer o on a Lat on Noein 1370 [---- Mens u DSuupmlpienResh mew m0 v u ns v a 10 1 ax 22 an io 91 v RPeeevte Df \ re x PF x 0 a s 3 . 5 u n 2 we ---- Nickel 14 14 foasan 10000 ostn 2 Semin u v e Sir on v se sotum ano a0 2 Tham v v Ne [OR oe o an i so n - J------ 00091 } . . . 000381 USFW 0957 Te218Con)ReSm3of7DDyibpscAnksfrMs Fe -- se STehton -- 00 - or a Son am om wom wm oon 3 `Based onDryWeight _opS--arh_ent ePeeere - w . o M " > vx on me s us _3 " - " - oe on i. ' pen 1380 wo . oor 10) . ew om on . out w ss - so P : seman v u xe sor a on Twutnen o `Sodium 2640 : 2590 2 mosamarmonas 000382 1leEW 0958 abl2.5 Cont ReAsas 3of2th7eDDurpylFcaamicCAskt SeforMeli Fos Based ouDryWeight Sample 045 Dpto Relive ure Result Percent Mew `Sample Result S J ns . Aainony u u x sie v u x Brom 53 1 un Bun 003 on Cutmivn 0 ox 5 Com 2000 nm s Chromium 0 2s @ cami oa ous s Comer 5 ss ' on oz ws n Lat 1s 1 \ Magen 1320 0 ' Manganese. 269 83 5 {Meer u u xe Nk 2 1 fous 80 510 o Po u v xe Sher on u we Sodom an an Thin v v x Vamsion 12 n 5 P 7 ne ' r-- osumeT-- sORTITAS ------ 00093 . 000383 USFW 0959 `Table 2.16 Ad 35 Dy Coe Resultsofthe LCS Analysis for TAL Metals (Flora) Losi Mel Cota Rewvest QClims hooey Si ot wer JU -- a wi w ronensm - s0120 " po = wi Bn am 10 wi etn 30 0 soi cman 50 as wi = Chom w so 0 cont PY a soi Cone 0 wr so120 on oo oo wie no Lae - - wi wo pee 530 " wiz Nise - a 0120 0 on 10 0 w0120 sie 0 se wit 0 [OE se soi u - Cin 0 = wi 0s ne = - wiz a - nnn amosumsrmonas 000354 00091 SPW 0960 a1Rmy S8DSAt ensTALi i be mr semeoewmm SMemowe Nim fShee E >. e wise w vw n 5 wm ani w vm wn w em Som w ww - nom "Beryl " v" a "em a nn "am a " ww a om w wom - w wom - " ww wm "oe ow _-- "vom - ww -- " vom ~ "- vow -- "vom si "- vw ZIe.e eP e weT s ow amonvesmmonas ax " 130 - mem nem " w em 2 5 ew = - " mem " " em wom - ww w ne - ww - me wr ww Gwe9 XS wi 00095 000385 USFW 0961 Table 2.18 Resul`tWsAoXft2h2e7Du3plDircyatReuAnnCrsoycksSfoer Metals Flora Based on Dry Weight Sample 609 Meal Semple Rest DuSapmlpelenReesst PRaersesnte mee mas Difference pr m 1a : Asters u uv ne Anni v u Ne Barun 21 2 2 "Benson v u xe Cadmivm 008 005 2 [ 31460 5260 6 Chromum 24 2 5 Cobar 00s 005 Copper sq 53 2 or 1 ww Lest 0 on 10 Mapesem 1710 1610 6 Manganese 1 156 s Mercury u u Ne Naked 1s 1 0 Possum 25500 25200 3 Selenum uv u xe Siver v u 3 Sodum " . ' Thalia u u Ne Varsdom v 0 Ne Zine 193 203 2 3ceMRSTRORITALS ee 00096 000386 USFW 0962 `QA/QC for Cyanide TheLLeCsSsatyw was ee d1 chick 19he.aTocmeyaoef5heQ0callbirmmiitsonvaclaeb,lefTohrepth oretcoverievseyfor cfi ond 4 Sapte 1A was chosenformaurix spike (MS) analysis. The percentrecovery,listed in Table 2.20, was97and within, Be QC limits. `SRS easmupllies_e o1fAthweaDsupslelieccatoetde AfnonraltvhaseisdufupolrciCcvaaebneiacndaaeulysiseinsS.boeihTlheoftreelatiCveypedreeen,ldsiffWereeence20(1RPdDes)efdorthe duplicate analysis, 3 Fema 00097 000387 USFW 0963 Table 219 Re`WsAuSol2f.tt27hs3e DLrySRArmabCyrocefoSriCteyanide inSoil Lest Cone Cenified RecovCeornee.d QC Limits % Recovery mg/kg mg/kg mgikg w ere r wm --r ------wm------ smortasOR ANON 00098 000388 USFW 0964 Tale2.20 R`uWAlXo2f2t7h3eDrMySARasmaChriekorSiCtyenide iSol. `BasedonDry Wight Client wou Sample Coe Orga Cont. Sp mets o9kS RecoveredConc. Spike ES El WReowry Spee a Rersaorr 75028 TORURSRORTIANON 00099 000389 USFW 0965 `Table 221 Resul`sWoAfWth2e7Du3pDlircyaRtueAnnaClyrskisfSoitre:Cyanidein Soil Based on Dry Weight Sample: 14 Duplicate Relaive QC Limits Relative SampleResut SampleResmlt Perm Percent emee g meee Differen-- ce --D-- ifferen-- ce -- em----v----------u --------N--e ------------ 2 ---- TOE ARSTOSDRYIANON 00100 000390 USFW 0966 QAIQC for Fluoride `RTeoseLulLCiCsSoSfsa mtahleyLsiCsSwiAsnouastvedsasofoTcarhbeFlclekuo2tr2ie2d.eaicTochWuearretcaeyorf2h0ecQaClllriamiitosnavcaulrivbel,eTfhorepheerree,onerriec.cofovrfeluroriydefoundin L Raemspulleso2f1t6h0eMwaSs cAhpoasleunisfforomrFaluiorisdpeikien(WMaSt)eralysis. To pert rss. lsdin Tele 333, 30 102 and withis he QC tims. SRSeEsaumlptlseo22f16hCe DHweueprleicsaeteeAdeneanflnouardsp.sfploercFcaliuseosribsdoeslfo,ofWahTiehcetNeolariene epserstWedrif2i0rnedsee(ciReDd.) fo he oplicne analysis, listed mTeLCLSaays wssd tToancgheeckftoem 5s2c.a10re1y15.of ThheeeclbarxatooonQCculei,mitsThaevapliebrlme,forcoiveercyonfoersf.uori foun 5 4 RSS easmupllseofL 1At,he3M00SAA3ns3aadlvTSsOssSfoowrvrFleovfoctrhhiodrseeienrfSeoocriom/vBanosviiwnaseprFieekecwa(ilMMiSu)rtahenearlQysCis,limTirhtese,supSsearmrcpeelererSpeoOrAstFeedMrS,rtelnodTpsrodu2c2e6d, Ted from St dicaiog matrix iierferene. Only be origina Resuls of the Duplicie Angus fo Fluoride campls 1, 3008 n1niddSa9FTowveere2s.27e.erdagefdor in Soil/Boine Fece Mater fprolm 8cto a1n8a.lysAisl.l aTmhpelerRvPsDS pweerrceentwidiiafQfCsL(iFmDS) for 20 Sr Resslis of the LCS Anais for Fluoride hTehLLCCSSaamnaalysis wasaused taonhgeeckfrtohm in Fauna a9c7cutorac1y1.of TihheerecalairberantioonQCcurvlei.mitsThaevapiebrlceentforrebcoeverreycofvoerrifelsu.oride found in Resuls of the MSIMSD Ansvss for Fluoride in Fauna SSaammpplleess CCorol 1Aa. c1k0030a52besnd2.1092,8 wrearnegedchohsoenm f64or10m5a1.t Tsphiekee! amvaexrpeescrpocivekenertiuesipflaacedacecRcPDMsSM.S(ARUPSDDS)) aalissedT1o2 Be EO rm 310 23. Thee ae no QC limits availabe for th Resulis of the Duplicate Adalsis for Ehvorde in Fauna amplees CConrol 1, 10n0i3052 Taanbdle1238.3w0r,ewerseeecoexd.caflorcuuapeldicfose uallnayQspC,ileimTihtbseecaarrueesleaivvaoelnipbleoefrcfb,orrRioPfDfrss.hoecers e(lW70o0r) [of ewes" Supe 128 was mayzsd in tpi No oanrRORTRNS 00101 000391 USFW 0967 `QA/QC for Fluoride (Cont) Results oftheLCS Analvsis forFivoride ip Flora TthaeeLLCCSS.anlailsytesdisinwTasaulseed21.031chweecrketh9e8aancdcur1a1c1.yoTfheheecaalriebr5a0tiGonC. ciurnves. Tavhieapebrecefnotthreecorveecroiveesriefsor. fluoride fousd 12 ResultsoftheMS/MSD Analvsis forFluoridein Flora STmaaibmtlpseles2.a63l02a.5blwweaesrefco6rh4oBsee3ndTfeoc7r2o.vmeanTierhsiexarsaepdaikiRev!FeDm,apetrrciexntspidkieffedruepnlciecaz(eRF(DM),S/iMsSoD)leandaly1sias.TabTlehe2.p3e0r,cewmasrc13o.veTrias,e imisdeinQC Results of theDuplicate AnalvsisforFluorideipFlora STaabmlpele2.3630,5wwaassnosreleccatlecdulaftoerd.dupbleiccaautsee abnoatlyhsisr.esulTthsewerreelibvoe Gpeerccee.diNffoerOenCcel(iRPsD)arfomrvtahbeabdiueplfiocratoeeanEalyisis, ised in F-- 00102 000392 USFW 0968 Table 2.22 Re"sWAuofl2t:hs2e7 DLrCSyRAumCrn eefkoSrFis ltueoriy deinWs ater Lest CenCifoinecd wor -- conc Recovered. WoL QC Limits %Recovery wo w= J-- 00103 000393 USFW 0969 Tal22)RWeANf22h7e MrSyAhnmsCkfoSPtueri Wate Gio SekOngmisCoer RmoSwseiCox Reve tQhcoisms Se e eee ret----gl ---- nolL ------lL -------------- ---- ee --nr-- eu------ ------ " ----ww ---- msase-- ens smorrmoRIAS 00104 000394 USFW 0970 Table 2.24RessWfah2D2u7plDircyatReAanmaClyrk oSriFtorde in Vater Sample 2160 sompleresti DSramepaleRemt RPaevrme QRceLtiems Pernt - nel nel Difference Difference u v xe 0 motLARSDRIIAON 00105 000395 USFW 0g74 Table 2:25ResultsoftheALRCS3A .273Drn y oma Cr Sl iinSeily Borins Faleisi CaCgoened mg/kg 1Le5s2t (w6a2s0n9)) waw W165e3 62i65r7) 662 Less nny pH --Con mg/kg. PYwo aco `0 QcLimis mks "w n"m n rev" 22 n"s a [-- 0010"6 000396 USFW 0972 te2.26 Re of MSA1n7isrfyoaPmCrrtkSSairi FeaMan Batryoiin Cleat oe e r mica RermdeCmn Reo Rcmeso Se yo os INSon or opr sm oem 1is0 an 5 Se wmmm em momen 00107 000397 USFW 0973 Te1.27 Rots ofbe DnitalcAtDsyyonornComiinSolfo Fo Mar - Sipe SDarpste Fioen PcReoanram se a we [il spIo"sn oposs ors u5| e--r ------------------------ TIDELURSIORYIANON 00108 000398 USFW 0974 Table 238 ReWAsSotf2.ts2h7e3LDCrSy AnaforFhluiidein Rum Creek Site Fund Certified Cone. mes Recovered Can. make QcLimits wake Lest Les? 88 88 91 86 NA n> NA Less Lest 88 62 98 62 86 Na NA Less Less 88 62 62 60 62 NA n "Les? 4 Recovery 103 8 m 100 8 9 100 TIDELURSTOTORYIANON 00109 000399 USFW 0975 Chines -_-- Cont 14 1003 052 m _-- Tube 229RemWusAoXfts2e27M3SDMrSyDRaAmnCsreyeskfSotrePirie Fama BaonsDryeWeidght Ms Msp Sone Ms MSD Recovered Racoverad Came Cox MSW MSD% RD. Cone. moe Spike mk Spke Spike Spke Recovery Recovery mee opks mei u u 00 a0 10000 soo a0 wow ime a0 9 n 2 u u M0 200 soo 400 ow aw 200 2 ow om 10 3 5 EmonwRTTEDRYION 00110 000400 USFW 0976 Sample Control 1A 1003 052 128 Tabl2e.30 Resuli`Woif#t2he:2D7u3plDircyaeRAunmalCyrseiesk for Fluoride Site: in Faint `BasedonDry Weight Semple Result mek Duplicate `Sample Result mee `Triplicate `SampleResult eke Relative Percent Difference u u u NA u NA Ne NC u u u NA 20 u Ne Ne TIDELURSTOIDRYIANON 00111 000401 USFW 0977 Tie231Rem 3o373SDrARanmCy fSo PeinPin - Liecs Con[tes ho[ws Qclinn = mks 6oome=k. 660oma=k = ." 0 5w = "" rey 0000 or wm 00112 000402 USFW 0878 ble2.32Res`WAofX2th:e7M7SD/rMySRDuAmnCsryksSfotrePirie Fler. `BonaDrysWeigaht Sample MS Ms Recovered RecMovSeDred MSD Co Co MSW MSD% RD. Cie Cone. ogks spe mpi Ske Spe Spike Recovery Reco mek mk oes 0s u Se woo mow ae m6 2 STIDELURSPORTIANOY 00113 000403 USFW 0979 Table 2.33ResuWlsAoWfth2e2D7u3pDlricyaRtueAnnCalryskisSfotreF:aridinFlora BaonsDryeWeidgh SumpleResit DupSlaimcpalteeRemt Retaive Peemt S-- armplre r---- --mekte-- esgk---- Diffs ---- amsrrr--v ----------u ----------xe ------------------ monarsTROARNOYS 00114 ere----~-- 000404 USFW 0980 `QAJQCfor Anions TTioeLLsssayaess wsedd0 chick2 0heR amy5 E of cTaroats3S0I0 mmepaernls ecoovnerBye forcAonivoenns found i oSamie w21 nwas hhsosn forma ihee UGC9limmey.n, Toe pe rmvenis, Lc TE6 2.35, aged from 900 SSap,ao2t3wt wes sTiei 1f7rSGtlEs0sT0iDTeeoIgrR,ealpf ecrmbpphRoop,inLSs IpEenPDssB)cfPoartSshe. durplaicanmteae [thei sto 00115 000405 USFW 0981 Table 2.34ResuWlAtsHof2.t2h7e3LDCrSyARsuanlyCsriesefkorSiAtnei:onsinWater Bromide Cenified Recovered %4Resavery Culoride Cenifid Recovered % Recovery Conc. Come Conc. Cons. -_-- mL mgr mp me Lest "0 9% -_-- 146 m0 -_-- Lest -_-- Nitrate 25Nizogen Cenified Recovered %Recovery Conc. Conc. mpl mpl 81 mw OrthophoassPphohspahotrues Cenified Recovered %Recovery Conc. Conc. mo mg 61 6m Sutue Cenified Recovered %Recovery Cone Conc mL mpl Les 2s 5 = ---------------------- mELwRsTERDRYIANON 00116 000406 USFW 0982 soe -- Conte NieNig natPerpehpotroghnasc sone = ns ns EY ns ns Tule235ReWAHo2f2b73eDMrSyARnmCofkoSroAesin 2We Samp OroCoe. Lm Cone. Spike. RedCae.| = Spike. vow swe nm vow n uo on ww iw m0 Remon Spike ecRuems w wm ws wo as ws as w wm motimsmoRTANS 00117 000407 USFW 0983 Table 2.36 Result`sWoAfXt2h:e2D7u3plDircyatReuAnnaClryeseiks for Anions Site in Water Sample: 215 Amy -_-- Sample Result mL Bromide u Chioride 30 Nixes Nurogen u -- Onhophosphate a5 Phosphorus uv oSuwlfuee d1e00o0 Duplicate Sample Result man u 30 u v w11e00 Relive Percem. Difference Ne Ne Ne 10le QC Limi Relive Percent Difference F 2 2 0 02 TIDE ARSTINORYIANON oo11s 000408 USFW 0984 QA/QCfor TOC Sample 302C wsseleced for duplicate analysis, The relative percent differcoce or this`analysis. (RPDs) for the duplicuc analysis, list in Table2.37,was 6. There are no QC Limits available f : rss 00149 000409 USFW 0985 `Table2.37 Resulsof theDuplicateAnalysisforTOC inSoil `WA# 2:273 Dry Run Creek Site `Based on Dry Weight Duplicate Relative QC Limits Relative Sample Result `Sample Result Percent Percent Sample Percent Percent Difference Difference _--m--,,---- 302 3s 37 6 NA -- e-- e --ce-------------------- SSTIDELARSTORDRYIANON 0010 000410 USFW 0986 peafivorobenzene and 1.2-dichloroetbme4, QA/QC for Organo Fluorides were usedasthe interoal sndard and surrogate, respectively. The sumogaie percent recoveries, listedin Table 238, ranged from 830 100. All10recoveries are within QC limits. SSooillsasmpale.me300000 wasacphoesenfrfoormth8ea4tnomgaeid$e4.ifxrAosmlpi3rkeetcfoom8va.eirxAileslpsi3kaeRreFduDwpiltivciaalntueeQsC(aMeSliTmwMiiEtt,hDi)nThQaenCalTylsEiemisAt.sS. TheerepnertcednitffeFreecnovceersics. Be an Tio jised io Table 2.39, r mpunmeoRTE: 0011 000411 USFW 0987 To 38 Res fE g reT Rr cre ts 5 -- Sa aBBm olm eep k kl D&3i Ce E 222 i -- morro ooice 000412 USFW 0988 Tate 230 Ree of07 SSUT SSoRnDw1GxerfoiokrSTore Punrids In it Sr ame bo. 300e 0 r obe } 2 TEE75 i|{|Tl eercomve eanteirsst o ie|nT! n H5EHa T | bT TIoH| TCRayE: S ||t%ec EjRECEs. || i} | |Bor W17H3 )| l PLa) iV 1 fJ u 0o0m E 0T| p SESTa0BEaEr,EEi |[T1 eGiEoornH]kRuaoE)se 0L(5EeBlSe |1 Er |s ||RS Sl U} IFoRRE|EE| ] G | loE railiV2r|iPmEeniy ororTRS 00(11233 000413 u ISFW 0989 QWQCforGrain Size Resulsof he DuplicateAcalusisGrainSize SSaaamipyleiess, SsOt7eEd aiondTaSbOl9eE2w.e3rXe. rsaenlgeecdedfrfoomr dzueprloic(a0t)e taona2l7y.sisT.herTehearreel0iveQCperLciemnittsdiafvfaeirleanbclee f(oRrPtDhSi)s afnoarlystihse. duplicate morn 000414 001 USFW 0990 Tile2.40 ReWsAs#ofthe2DDryl2iRcamC7Arnsk3yis.fo GinSze LSamnple |[s0aE_mp shUmEmDmUP RD . Sissel So cortroera cor0e o9GS.wo5il0l| 10ofm0esr0r 10wem0.3sr0 oo11d - ooGikis|s ww7is #m77s 211 . pa anicooon| mmas nms as2 - ooisl 3ds wwir ow Staimopnle [[5N09a8rva hsoeeave RD 3 sive Szemndsos oCTrdsoo_ cor0Me000 T Gi feo Tes a = ooSssos mmmesr wosiw aoa1 : oGooikmd mm#s1s wmeoss 1 Face on a 2 ms 8 - ooool iwr weee 11 +aDresnsDuamme nByPoerrice:TAhouygh ----_----mm oars 000415 USFW 0991 Section 3 000416 USFW 0992 Co g ADEN [SJ pEoaErrmmnEeeyrE CSRooimmebipARenrishsaoen,L ocd 908-321-4+2F0a0x908-494-4021 ` Am: Abbie Spielman 18 June 1997 serra | oi tr -- eas ttms veges 7] `samples I Lov asiTo T2786 Asions Fl. NOS. PO%. 504. C151/PA 3000 Te foe To] Tissue | TS omehns T pve emopeyaee,mhleo4 QbuoaTti `Samplesare expected to arrivaet your laboratoryon June 18, 1997. All applicable QA/QC (MS/MSD) analysis as per zTzA [rd coreen 88 \ ' Uuliv 000417 USFW 0993 ` :, BBB CoryFre.W2ei ao0stlwemoseer n.Beyy) ire FoesDasa f Ean, s le iake t 360 | Sher [Tx] SPoOutBhwoes2t85R1e0s,ea2r2ch0lCuuletbreaRoad SanAnionTX,. T0510 Aw JoAsnBoyd 19 Je1997 Projet # 03347-142Dr.yR0um0C1r.k2P2a 72 ns er Weston REAC Purchase Order suber 81456, plese sale sales csordin oefollowingparameter: - ) es Oreste Modified 260 5c ashes is) lw | | orgieorgs secwasresis Low [1] rere \ e Sapirpaveor nosutsyo ambplermm aasor.nJyTeec1o8,m1p9l7.eAdaUaappapclkiacagbeleiQaAe/Q10Cb(usMiSneIsMSDa)ysasnhealsyisppiesrofmheethaodl, iell To mpi ds acing mt mode a es oa deliveries ces P{e9a0s8e45s4u.b4m0i2s0.al Areaporcso3ncchhaus]oq.espolnessccoalnlcCeyrniatiDarvioanajt0(cJ0o8th)n2J1o-4n29s6o,ant 008) 321-4248 orfax to Tankyon Sips. TDoaenVaaloiidklsuyonBand RepA ort Wein Group Leader Roy 7 Weson ne. REAC Projet } MBs Archmens S RNiSmSpprwenio ger ne ICons VS.ubcKoanntsraalcting File V. Exume CM.. DHaavirseon M. Baer BO 000418 V01ls Clck toWESTON On TeWes ita is vest com USFW 0995 @ raptrm ve. nT' 2=2 uscite HINETAN 4Eoi3n 5vo0w+sFeas Pcoy04.62701 5f[ 3r0iRngat-- an emer Posy . Are: Mie Meio Prt # 3947.041.001127 Dry Rn Crs Pan 30a 1997 As er Weston REAC Pacis Oe amber BTS, plese sys les csrin flv psn: r sient I1 -- wees | lJon| ---- | TAL Meats01o0r Sees 200 [sa To | lo [7 } ruondcreea so [moms slo | Jo] ss soe se sar per ems SVsaobirseaerredpre1e0doWcEonSsaTpiOvNseRaeEmACyronbuyriirtoPS5ney1y9o9c7n MTaSha yu3cl0.1io55c7k. nvAlephgpltiaebltemQUIcsQC aohneens s!prChRoE0,: ALL ORGANIC EXTRACTIONS ON SOLIDS IE: BNALPEST/PCR MUST BE BY SOXHLET EXTRACTION | TPO0c0o)sSnsANbTiI.alArnyorcsorsmnccalhaielsq.esipoennssccoancCeornnmiissBopr1eJothneJononn at 508) 21-43o8r fueto Sirs. vRDoaixssVsaWldesasioann 2Lb0ed.oR|eEpAoCWPreiptGra Lender MB Aves RrS ip Snes Cn VbS. Kaiaac Fle 5d oo17 3oDBaaerineny 000419 SFW 0994 Click to WESTON On The Web http://www weston. com u = pred n@y | 9660 MdSN | TOC A ty [RATT H T > dal 2 5 gl [LH / i = I dd / 3 szt|| [BLTITE f(EeE: :| Ih HE z|2 fr 2128) [o[[1]] 283] [; : ] ALI : Mm olH e ERE] NEE 1 [H3 E] SLRSag TTf T ESl IiL994 ; |] 32 15 / w2o< = he il is 833 sti (amma DTTes: g =r 3 Edda 23 of 58% SEBEEEEE if sig Ii 28% welled| gaax 5 [5E[ BLi J = 3 SIE 3 COHN |r Eg 5 [ LTI R]TLT UEte [ET %Sf THLHE T HH) gglE,. (88s) rr1k STH HEH R 582 1] A ac 3 - RI \ IL] He 13 [ITTY pm Hy ETAT] 1] al] a [RII Se JSATCNREEL] eeoes 409 [TTTbe, 1[2BRT y aT g TT iis Ae _ SH ia 5 3) HTT fe ESE TAH He gg 58s j fii & EEE USFW 0997 8x = anot o, HUTTE! fa |e) = RodyE N TIEER [B 3 i: 5 + 5BETH 2 REF THA [ES | 31 I (8158) | RUTHIE | ml 1] Wf JETTY, J11 HRTm)w3 LaEE[11] ER{IT EE A TETE 5 il ; C il. tE id E . J )wid LY Land 4 a ChHiE CCEEERI THINh..n. alLL oy FIT f EL C5 5f TT T T 6 |BI 2) FgR ALLITITITTUILN E < =HH n H (gA8)ig) ELs 3 ill 2|E3 tr) ; [RIT : Hi 1] : N| 0HU UI[H RIIHTEH E, AET He DJd RITI ETT eoee |[3] Psi 3 3d 989 aiA i Quay $i8i5s, 01] g |H9Y99AauI0a044d5u 8 | Is 158% ggg TE at H49349249 Hadas ad If PEE IE I ee 18]; El] USFW 0999 nn. 0001" PE53= of Ml TT 2700 zBT [TTT 3 TTT OHwLoo he : titi -i yLHT ii f RT th JEpasasestruinnaineece: PtOhLyE ill I y lH Aa sadaa saaa d I o RGm. al name A 55 5 eCco0 gC 8 LT I IHTTLTEH> & + TTT 3g 8[ITTTAA T STEER H Re HTTTT ee 1 i |i I EJ s He 1 38 |Lr HI $9 TE TIT a[3 || [TF [gs Ea(ELssEs] ELLE !i | Em [E]]] i JTTI J fiTILE) ; RRL, Ba g IA . i eH i 4 | THA i33s ; Hil WE fsz SHH ee. 2116 aN e QTE Ble SITHARIRAY ST [TIT] 2 LTTE 85| ATI 2= A TTA FARES < 3 rrrLf s : | HSIIITTITTTEIE BE) i8. S | RILIH TH JG]R TIC o: h sm TR LTTE he HE ull 3 AAddA AAI |] 2s $s Bt 8 iMaAnzyiAnAda atid adie Hor eh Jinigig|| 8x |3 USE 1008 itl | "ey ; 00L MSN pp? ] 1] 3k TTT SHE a PITA HTT EE.| fee TIT 2 4 STIL) alg Ei (ERI Wh 3 0 ft ETT | A ETI Ely a HEE dH fe i pEtih., a He gis UU Sab [TTA soc fi PEEL BE] 383 La dadlg g ataadiss 5|1 3 HE N ese: is = te i [st] 2 2s1ase ([LIOTIIT MN ssH : I ER 4 1000 00} MSN |ET00 wEs i STlHif HFIrT| il y SHTTTI ll PLLLL SLE Jrit n *Hi4 tifE S[HHm EIA ITT m TT 3| o1rm]m gH E)EThi er enii W WT RIT ECelLL | . S00 MSN 2000 62T00 " =HSHiITn ILg TT I Br AE *Sp TTT 2 . BHT gle. <5 : TCHE HATIE TTH E82e8) rrr F 3 ATT il 2 HAit mmel ti WII | 1 1 HHLR QHAII,oeiill Ji] aes ; 1: ifMA i isaeeBn z NRNNR 0 . 4 sin [HELI hs: Ls IIE 3 ee z2:[l 0OFTO0 a a2 | [eEt TE SI HH] 3 AN E TIte H0l IB ` | h I Hl 5% WW {| RR N hi BE TNT 5Y I 1 3a] A TTT] 51 HTi NIT\ iai : 2 hd NL i334 aai E (IE N Uiys ALL ul L== ia2 Li [0ET Bed i H1l;. ty HHH 2001 M4SN i FE =H HER B J bil = 9| & HERRH i4t(Lik bi 93Hs ETH lk i= [= : iHiil ff y[EATTIT TIEEI.)i|ll Mp, [ED i2 3 [EJT ET TYEill 23 TTTdthb | `oor wasn 2} TT11 o &gPHHE HEEHi FHEn HETTe Je a THER TTHPPPPIPPET 128 rr ETT ll 3 STII (3 VEIN et< v q 2 ene k EHH 4 HHH +i -[] SF HT] Wf TEE ge SLLLL TSTLRLIT RLT Bees [ETT L 3 HL | i [eae AS Lhe EEEEn-Suuuly AY an [EEE CE ges A35Ee AE ATA a 3 8 VT rT TT Sd { 3 HTH a INDI | N 2| i1r FTAaLCL] EA 8i f3l8 ErLs | } J UA{ E2l pel LIE, ol TT ddodas| | I S /l odNyS! 1l fEinlm Re: i fTid [TTHERI/ TITi HshE TeEs Hsi :] SHR[HTT see 10 HE bb ; id : Te: : TI f | sie [I[ebT b [T Th [E1 ou1ss USFW 1009 0 [TTI oo A oF yiiR t) : TA Hdlgl JH Sm F] E EE 28 n ; | LT ii LTeTl od J H HH E:1 fe|el Hi e TITLL i) SHAH TTT] o BL old Jd ddd 5 inne CAL sEannahak aaahRIERA EEN ad EE] iif HH ik Gi dE. CTT Cemmraashgttc FL ji E81|0 ) pee] AHHH | =5 32000 4 [4]SHHTRTPII8AT (fs| Erp ] 22 iiTr Tr A MT 2 fs il ;2 LAH RERL R H--EjEI g JJ8EeWT (RHITH TLTEEANFRR4:5] HJ 1]E H GIH TIH TTTITE T IrR] ]|eiz|PdalR] IEEE ERAT] oe [20 of al [ EE Em 2h sll 3 RNEAQGU/ESSPTEICNIGESD:R|: GU3N3C47O1M42001227301, OK ATMNIMAL 10; ORY RUN CREEK 2VE8S9TOWNO/ORDEBARCIDPGREOJAEVCET 4209 EDISON, KJ 08837-3679 292 104: (067271)3070605-028 REPCREIINVTEEDD:: 11970000018977 097 ee: 1 ste: VR-97-001030 INFORMATION ses 97-100 Antes)500ReCfheirpeentcae MPaaythology Salt Lak0e00C-i4t2y6,-2U0ta0h9 84108 VESTON-REAC PRDORJYECRTUN03C3R4E7E-K142-001-2273-01 YHiSsTeLr bumimarh5y Lins DayoH fen CREEK TT # deen - ALvIeVrEyRR.mEilFdThSiIs:ymothioscsyuteicfsplaacsuataeclyyticcongiensftieldt,ratsiuopnporitnintgheapcourttealdeattrhi.ad Tarheesrse w1isth no evidence of toxicity or other specific inflamation in the Tiver. - K15IDI70EY-evidTheinscesoefctisoingnioffictainstsuetox1iscwietlyl the rem parenchymal tissues. orpreisnefrevcetidonviotrh daecguetneercaotnigoenstioofn.anyTheorfe. 5L.IVER1.ncTorsis: 15 one smell tissue denonstiorates slight autolysis collection of Tysphacytes and plesas vceiltlhsacinutteheconignetsetrisotni.tiatlhere aarroeausn.d in the vlAiavsecvrue.rlyarfeelvemceonltlse.ctioTnhesreof1slynmopheovciydteesnceandofpalneysasspecceilflsicaorteheprrescehnatnge KorIDNiEnYf-lamTahtiisont.issue is very mildly autolyzed with no evidence of toxic change cLIVEmR. cTh:is tissue. This tviesrsyueliiskelaycutieslytheconrgeesuslttedowfitthrausmoam.e frTahgemreent1a5tiaocnuteofcotnhegesltiivoenr and scattered eosinophils along the portal triad areas. bKtahIceDtNeEcrYai-pssulToerh.isevTithdiiessnscueeheoaifosrrtaohcxauigtceeiltyiynccloiusndgeeissdteenndteiuwftiirteohdphiailnsfotchaaenldreacnrlaeolst ofofrmhaetmioornr.hageNoover tivsue, 0. mic: Continued on Next Page... nunz0022730, WNC VESTON/REAC PROJECT 000436 USFW 1012 MSARaPEiEAaCTIITNEoG:SO:DkA:Y UUCIENMNTDGIHRZNE0E0K1227301, UK ph VEYEtoSsToOnARONEDAaBCR0IP6SR3EO-IV3C6ET79208 1763086 R1ETCpErIV1oE0D4::w(e01657l2070)?0700-0.928+ at: 2 tr: 9700100 eseaon LLEiRs.E e TheCsee cEtio,ns oaf Trsveerwvhafencnuot1hasakeSir1oyindekoffenncyelupda8etasecryTet)ee)sprapeessaerrovacecnducrers.eedctions }A Con. To seeconeof ronenre eEfmssauein15 e5llEprIeseArvedIwnit1hsstseeccooneson. E eEE nBTerCerwet rbboetonmaatattfyionveonrrmf.5opowrlttalnheptrrpeiseaegrpvaesrde.is..ThTrSheceat1rsteemraiecnuddteerrecsootnfrgehse{ti1oTnvaenirnd Ca E ont.rThe rena iosssoureeasiftorraecdgutheealsmyrhocneorn,gFeessTtthe.ed wpetlhvisno of this 1esvdiidleantceed.of Ttoixliceisty hyaroeposis. or rFenlsC: same Re 15Tofreagrmeenti1ngacanudtedecmoonngsetsrtaitoens osfomtehssepTavreartiotniss8ue.AF the CI io. This triessureefsscsoerpaeratendfhausmIaFti1o8nhaar bteaetnefrcozaern.s oTferteeistusbutlees en Samra 6S.ERaErTsEeeTpevtsitsoStnightloyf sthweolnyezpaetdicvitHhaavceute15coTntgesstdinotni.fieSsp.ecific CioEy. Tnerrenmoaatinsustuedt5obe.acaulttseelroyedrcobtnygeetshteedSapuwteioctiheti.acrtepasrteoefsrsm.ohdaerraetefs ot WBI EwTEeS ievecGteimnigautrainteasndfraereozuinngpoarrttei)facttriwaidthareascsu.te congestion. r LeIvoeNnEeYr.etiTe ohins ttaavsaseaedvevemneont.sstratheosesveipdaernattioonf, asnyppsopretciinfgicfrteoexziicnigtyaorrtifact. nan, We Continues on Nest Page... 00043 7 USFW 1013 2 RUENQEU/ESSPTEICNIGESD:R: UN0K3N4O7W1N42001227301, NK AKIMAL ~ 10: DRY RUN CREEK W26E9S0TOWNO/ORDEBARCIDPGREOJAEVCET #209 EDISON, NJ 08837-3678 1376508 RAERCEPIV1E0D4:: (0169702U7NG)7000-2 PRINTED: 170ULS7 0921 PAGE: 3 RESEARCH CASES: VR-97-001030 L1.IVERR-EF-TEh-i7s: tissue fs mildly autolyzed with acute congestion. There is acute YL cThoengeasuttioolnytiwcithchasncgaetteirsedmoreeosisneovpehrielsarofunndandtheargoaulnld bthleaddpoerrtatlhantriiandotahreears. sites. CKIhDaNnEgYe-ofThiinsfecttiisosuneoristosxliicgihttylyisauntootlyzieddenatnifdieadc.utely congested. Specific 3. TA20: - nLoItVERa-utolTyhziesd.tisTshueereisisacsuotmeelyhecmonogrershtaegde.oveTrhethteiscsaupesuilse.wellNoprdeesgeernveerdatiaonnd or inflamation fs otherwise identified. pKrIeDsNeErYv-ed,Thwiisthtinsosueevifdsenacceutoeflytucbounlgaerstedde.geneTrhaetiroennalortisspescuiefiics vell other inflamatory process. There is hemorrhage in the medullary tissue. K. 110-26: 2 LanIdVERs-plitTthiengliovferthteishseupeatdoecmyotnesst.rateMsildfreaeuztionlgysiasrtihafsactocwciutrrhedsoinne separation the liver parenchyma. Acute congestion is part of this reaction. ' KIDNEYSPECific tThuebulraenraldegteinsesruaetiiosnmiolrdliynflaaumtmoaltyizoend wiisthidaecntuitfeiecdo.ngesAtniyont.oxicHochange 15 not identified, but this may be due to problens with autolysis as well. Lone: TLhIeVrERe- areThescaTtitveerredtifsoscuael decnoollnescttriaotness fofreenzeiuntgropahritlisfacitn and the acute Tiver tciosnsgueestiwoint.h fibrinous exudation. ang 1s varied in size Tahned sihnafplea.matory process is very severe in focal sites KIONEYSpecific tThuebulraenra)or tgilsosumeeruilsaraudtoelgyezneedrawtiitohn eisvidnoetnceidoefntiffrieeedz.ing artifact. Wo 111B19: aLIuVtEoRl-ysisThiasndlaicvuetretciosnsgueestdieomno.nstTrhaetrees aarreeascoolflecftrieoenzsingofarItyimfpahcotidwittihssumeildand 3347142001227301, UK Continued on Next Page... 000438 USFW 1014 SARERPQIUNEEACSLTII1EN0:GSD:DRR:Y DONRKAITOIWAYZOIZZTSE, RUN CREEK UH ne VSE53S0TOVNOROEDASCRIOPRGOEOVECET 209 Eotson, ha 0aE3T-3673 13765085 RJEaCpEIV1E0D0:: TaN: (11096397u02s517700005128 ae ETT re eosinophils in focal ares of the portal trig collection. . E CC ioNEr. o The e ren s! tishseusTeohredrehmasogenepsatroravatetireosnthseaoumCpeapcrpsatuespglaeafrraetsoieruozfnibanacogeflaetrvrutibitufhealgcactero.nngeeelTTesmhtteeiinrontens11s or Sammieied. ae. eciiic ater NHo ItiRonEs: oeirdemosnesteratceosmpsaectpiaorna.tionTrofethreepfaroecnlchayrmeuss oftheherseosrurlntisoef tne iver parenchyma. CEioweIy. Toecresnalttis.sue s3naacmuatteliyoncoongresctheadngwit1h dneoftindietenifreedez.ingTubular Soniciey 1s nat denies. - 0OpI .rrl estenta.Anaeuoe uetone 4y5 accealtaeenltyinscootnnneegecspotosertdtnaolvpintithlrsi.fardeeAazcriuenstsge.acroTtnihgfeeasscetti,ofnnfT1lh5uermetaarrye COONEY. The rena)eatisssuteiss1sue.acutSeilgynifcioncgaensttetdu.bulTahreroer gislowmierdaafrreeczhianngge 5 ot Saenified. biasEE:E tiaoncnoorfat,issuTeer1es mairledlcyollsetcotliyoanesdowfithh oscudte tconugeestiionnoe re attared eosinophils are present. CIoNEr. The ren issue 15 acutely congested, There 15 mila autolysis in ne rene) tissue. 00 VmETeTEcL sue in o1fs apcigumteenlty. cionngeepsatteadi.yteTsh.ereThies pbiilgeaenrtetseenytiobne abnidlesoonre cxnarrazoonazrion, une 00439 Continues on Next Page... USFW 1015 RESQPUEESCTIINEGSO:R: GO3MTLY 012270, NINAL 107 DRY RUN GREEK w 2N8E5S0TOWNO/ORDEBARCIDPGREOJVECET 4209 EDISON, KJ 08837-3679 axe 100: (0672173)70605-02825RPERCIENITVEEDD:: 11750000577 0528 PAE: Ss caster vier oem researc KIONER- This tissue i acutely congested with focal aress of hemorrhage in the surrounding parenchyma. Specific other inflammation fs not identified. Yn R(IVaERgTsis tissue nas clefts, supporting freezing artifact. There fs acute cToengeenstiieon. in the tase. Specific fnflemation on degeneration fs not XIONEY- Not present. HheEaArRtT..tisHseuaer.t tissue fs replacing kidney. There 1s acute congestion fn the 5L.ivemr eThais tiissue 12 scutely congested with mild autolysis. There are o fev Scpoemctiefcitcionostheorf cehoasnigneoph1i5lsnotandpremsoernot.nicItneatrheceTlivlesr.fn the portal triad areas. oKrIDNgElYo-merTuhliasr diasmsaugee. 1s acutely congested with no evidence of specific tubular TLiVEoR-mTheis tissue 12 mildly autolyzed with acute congestion. Eosinophils iernethperomTiinveern.t i the porte] triad areas. Specific other change 15 nat present SKlIaDnHeEYr-utarThdeamraegnea.l tiSspsecuiefiics atcouxtiecliytyco15ngneostt.edfdweintthiFineod.evidence of tubular or uLIVERR.eTaai:s tissue is acutely congested with an creased mers of sIcyamtotheorceytdesthnrodugheooustinotphheilhsepaitnicthetispsauret,al Tthreiadhepasrteosc.ytesThetheeomssienlovepshilasrearien etxrtarmesm.elybutgoondo octohnedritisopne.cifiTchercehan{g3eso1n5eprfersaecntturiinngtohfe tihveerThvteirs,sues.uggesting dKIeOgNeEnYe-ratiThoinsortiisnfelaimsmataicounteliys ciodnegnetsitfeide.d inHotheevidseenccteionosf osfpecKiidfniecy.tublar vnc ssariezo0nzzron, uk 000420 Continues on ext age... USFW 1016 WRMEEQUESSPTEICNIGESD:R: D347cuonzzraon,ol UNKNOWN UE ANaTIAL ID: DRY RUN CREEK V2EE6rS9sT0oOnNV,/ORODEaSARCI0DPsGROE-SEA2EV7EE 3#209 ap 108: (QETZ1TaIrOe0s0o-e : REPCREIINeVTEEnDD:: 119702U0N1S977 0926 Rr Resor Live ems ssi 15 vierrsaemit10eTnumtoylybzeeddewittho afcrutoesctongaersttiifoanc,t. ThSepreefcs ific, ener change 13 not fdentifiec. CIONEY. Renal tissue was not Sdentified in this section. EuEE o mne ev:eerreiaietnrteia.stsiuoeTnhe1srnaeac1oustcecsluoyrnreecdosnuggiegnsetstethdieownpiotrothfalafrltedreizaaiudntgoalrayersatisis.f.actMilfdn the thssue. CIoNEr- The renal tissue {5 Tightly autolyzed with acute congestion and 10 Siner specific inflamation. xXebIoehasIE:E sonupenac15veveersy aafriedlpyreasuetnolyiznedporwtiatlh atcruitaed caornegse.stioSnp.ecifSiccattoetrheedr Srframmation is not fdentified. . Coney.iTis OE triessssouueeprenn5aergaest,ciuotsneulg1ysesocttoi.nnggeesntotedipofitietenhdtiamilinldotfhaeuttrroaevlneyassl.isp.aSrpeTenhcceihrfyeisc.are En Y. REF Eh-e2e:trerietrsiasevtsei.sss.:ueScaS1stpteecarhcerudtieclcyofsncifonenocgatenisiotlnesdo.randcThhIaenyrgmeepc11sytsoeltsmasa1trdeemnoptrifeaisueetdno.tlysiins CnOeONrEY.SafTehcetiorneonr tdiesgseuneeraftsioancut1e5lynotconigdeesntteifdiewdi.th sila autolysis. Specific 2BEErE esd: eran. reScetprieeocnhioeeofoveTtrvyeerroctwniasnosguene 1t515ofoatpf.1dilwdyennatuiLtFmoislehyeaz.csydtewsithfnmitnhieaaplortal CTooenmetyi.eicdThonrseaims triesnasluepa15reanfclhydmlsy.autolyzed. Specific inflamation 5 ot ossaTIAZInZ2T0, UNE 000441 Continued on Next Page... USFW 1017 RWEEQ/USESPTEICNIGESD:R:| U0N3K3N4O7W1N42001227301, UNK WIINAL ID: DRY RUN CREEK W2E8S9TOVNO/OREDABCRIOPGREOJAEVCET 4209 EDISON, KJ 08837-3675 ARP 104: (0672173)7060500-82 RECEIVED: PRINTED: 153UN97 1720197 092 Pages 7 ese: VR-97-001030 RESEARCH MHICA7: LarIeVER-osinTohpisniltsissanude 1lsympahcouitdelycelclosngeinstethdewiptohrtanlo terviiaddencaeresosf.auStoolmyesisse.paraTthieorne Lo| OSfpectihfeichetpoaxtiocciyttyesorhasinofceccutriroend.1s Anoctuteidcenotnigfeisetdionfn1sthepar1tiveorf ttihsesuree.action. . KtuIbDuHlEaYr-,chTahnegersenaalretniostsupereissenatc.utely congested with mild autolysis. Specific 8LI.VER110T-h6i:s autolysis of tlhievehreptaitsoscuyetedsemaonndstraactuetse ecovnigdeesntcieono.f fSrceaetztienrgedarteiofsaicnotpwhiiltsh fla are present in the portal triad areas, but they sre mininal in number. ftKruIebDeuKzlEiaYnr-gdeTahgreetinferarecantatlioanntdifssmsiuleidddeenamtuoitofnlisyetsdriasti.enstKhtiiisnsismukaieldnseeiypn.afrlaetmiaotniocnonsainsdtenontewviitdhence of . cLcI.VER-veT1h0s: section of are a fev collections of lliyvmerphoicsytaecsu,telpylascmoangecsetlelds waintdhemoislidnopahuitloslysiins.theThere taciosflsleuewec.tsicoanSt.pteecrieEfdpiictihnoeftllhiaeomriadtcohcraeynlglescelfalsrsenopitanrttihdeeonftsiitfnhieuesdoc.iodlsletchtreodugmhaotuertiatlh.e lTihveerre are KIONEY-. tubular elTehemenrtesnalin tithsesuekidinseyacaurteelyin ceoxntgreesnteeldywigtohodmiclodndiatuitoonlyswiist.h The no evidence of specific autolysis. 0LI.VER-11.T.h2e2:liver tissue in the liver parenchyma. is mildly Specific ctoelmloudlearratienlfyiltaruattoiloynzedfswintoht sone pignent identified. In cshoamnegeareiass,nottheprelsievnetr. tissue is severely autolyzed. Specific degenerative KsieIncOfoNlnEadYma-arty.iTohnis istinsostueotihsermwoidseeratiedleyntiafuiteodlyziendthaendresncaulteltyisscuoen.gestDeedg.enerSapteicoinfic1s EE. 1a9: 1347102001227301, Unk Continued on Next Page... 000442 USFW 1018 RRJ EiQvUaElSTI1N0;G DDRR:Y RNNOOCRREEK ue V7EE2D3SI0STOOWNN,OROEDHABQCRI0DP8GR8OE3J7EA-CV3TE6748208 RAEaCEpIV0ED:: (1Q56070218755)770605G0-86 TaPwe:: us8? 0528 Ctr: VR . researc E LIER.eThe EO TvoetrhArsoercstapietocyniesfsiacraercehsaTanigrgeent1lo5yf ianuetoliynzfelduwmttohrysauptreocceosngeisntinoen. not senile. portal \ (ion. The rentotisosnueint45ersatuitcailay)zednfwliatmhastciuotne c1o3ngnetstiloenn.tifSipeedc.ific | fI racLaCEs taisvsraunetn1y5amnwgsi.0rrleyTghuestsuaetralfysinzoafendldoomtmwanaiclttloahermnmyrautleciteloilefnlnosec,n1acslsTihafdrineescnsltsusidfueoipfepdo:rts seme OE CEonEr. areeton, Miriaa porta] tr Taheenerreantaiontisosrueinffsraamuettoilosnzed1sviitdhenstciuftieed.congestion. Wo specific OE Ge I 6. aE7Te veSretteisosafusreoatm1ye5sattaoscruyt1eslcypealrcltsongoiefnstttehhdee wsciiotnnhuescaotiiiddosntooffnmtesheidvseerrhtaeelpatsiitces. Teme. CEoNEr- Toe renaaissueso5nesmtoidoenratoeflyshiazuttoilsyszueed vuistwhelslo.me Tsehpeardaetginoenraotfiv1es erring secondonly. In sone areas, the autolysis 1s quite Severe. REEation en coofrtTevteeirontisofsuehepisativcerytswiuledlywitshutorleyzee]d wcietlhls.scuStceattered ns are present. n portal triad regions. tChIeONErYe.ne)Thteissrueeno15tivseislu:e 15 acutely congested, There fs mild autolysis in I T 1 eEse :sreea 15SopmmeicieiccfliiyconamsuotsootfloyszseeoTdsTiuvntigotarhhilsdsoengeearndeevria8dteifnoecnwe1To3yfpooftcr.eyeiizdeiesnngtiifnietdh:e arrazonzzron, une 000443 Continued on Next Page... USFW 1019 WREeQU/ESSPTEICNIGESD:R:| LCNaKuIOTWIKAZOZ01, INK WpsIA 10: GRY RN CREEK VESTONREAC pRO3EC)T 2ED8I5S0ONW,OOJDBR0IBDGBEY7V-3E6745209 180 108: (0672113Y7060500-8262 REPCREIINVTEEDD:: 179200105977 0928 nae: 8 Caste: 9700103 researc KIONEY- The renal tissue 1s s1ightly autolyzed with no other specific } change. : wLI.VER-meThae sTiver tissue 15 acutely congested with freezing artifact and mild Luton. Almost to nrlamation was 1dentified in the Tver: KpeIrGeHnEcYh-ymsT.he Treunbau]lartidsesgueene1rsataicounteloyr cinotnegressttiecdiavlithnfsluammeasteipoanrat5ionotof the Toentiries. Sunazonzrson, cKLuKI.tVoElRy.1s-i0s-T.8o:e HTeirpv-ae.rtotcieslsluuelar15vaaccuutoellyatcioonngesatneddstanhitamtiilodntoofmohdeerahteepatocytes hIensfloacmcautriroend i1ns tnohte tGiEsNsSuIeF.iedT.hreThe1 grsoanneslvaarctuyatiozfattihoen.hepaStpoeccyitfeisc and the congescion sspears to be metabolicanly norman XIInDfHlEaYm-matiTohne r1e5nanlottifsasenuteir1i5esa.cutely congested vith mild autolysis. Spectfic wLIVErR-eTnhe Tover tissue 1s demonstrating granulated cells with tviascsuuoel.izstSioonne.eoTshienroephi1l5s1adnd sIuytmoolhyasc1ystesanadreacpurteesecnotngeInstitohne areas. Degeneration 1s sceurring secondurity. pionrttahle tTrvieerd eKvIiDdNeEnYce oTfheanryenaolthetrfssspueeciffsics1tigunbtlaylaourtoldyezpeednewriatthiveaccutheancgoengestion and no wLI.VER.11Th:e Tiver tissue 35 acutely congested with aiid to moderate aSthuoeteoclpHyoisrcitsa.lpartkrAsiiaftdeewrcreeosalsclteiwcoitntisho.nssmaSolfH)ClIsyrmIapCnhuoTcooytntnseetsre.ainndflThaeemosmseaitnio1openhHiol1nsssanorsveppsperreenste0inftbreeidn. XSpIeDcNiEfYi-c Tihneflraemnast)iotniss1useno5t5 sJcouetnetliyfieceo.ngested with mild autolysis. Other wwe vx 000444 Continued on ext Pe... USFW 1020 \EES/STPIENCGIESD:R: QIUTIAZ001227301, UNKKOWK UNK \[MAL ID: DRY RUN CREEK. 2W6E9S0TONV/OROEDABCRIDPGREOJEACVTE #209 EDISON, KJ 08837-3679 13765086 ARP 108: RECEIVED: (1069732079)7000-2 PRINPTAEGDE:: 170011097 0928 oases: VR-97-001030 RESEARCH iLIVEtRh.e pTohritsatitsrsiuaed iasresasc.utelDyegeconnegreasttieodn wiisthocrcaurrerinegosmiinnoipmhailllsy.andOtThyemrhocytes .L specific inflamation is not identified. XofIONtEuYb-ulesTheorreinnatlersttiistsiuael is acutely ares. congested with no specific degeneration - 0L0I.VER.11-Th6i:s tissue Sone ymphocytes in is acutely the portal ctroinagdestaerdessw.ithWiclodlletcotmioodnesraofte eoasuitnoolpyhsiilss haansd Specific other change is not identified. p orurred in this Miver tissue. KIDNEY The rena) Autolysis. There arteissfuoecaldemcoonlsltercattieosnsacoufteincsopnigsessattieodn with mild protein in to moderate sone - Rubules. Mo other specific reaction or change is identified. PLPI.VER.REF-T8h-i1s0:tissue "ome coTlections of iTsymapchuotceyltyescoenngdesetoesdinaonpdhilvseryinmitlhdelypoartuatlolytzreide.d There areas. are There is more severe autolysis over itd fibrosis is the capsule with part sone fofortehiegncmoaltleercitailon.in the capsule os well. KIONEY- The renal tissue is acutely congested with no specific degeneration of tubules. 0U"lt.vheerr.1i-nDTf-hlia8sm:mattisosruyeceisllsacuatreelyprceosnegnetstiend.andLyamrpohuoncdytpeosr,taeostirnioapdhialrse,ss.and & few Specific inflamation or toxicity is not identified. KIDNEY- The degeneration orefnatlubutliesssuecanis slightly autolyzed. be identified. No evidence of infection or RLSRIy.VmEoRn.oRcEyFtT-ehAsiS,sD atnidssupelasimssaccuetlellsyarceongpersetseedntviitnhtmhoedeproarttae]auttroilaydsiasr.essE.osiSnpoephciilfsi,c degeneration of the Tver tissue is not identified. The celluler infiltration in the portal triad areas is moderate. KIDNEY- The renal tissue is autolyzed and acutely congested. Specific 03347142001227301, UNK Continued on Next Page... 000445 USFW 1021 ANE/SPECIES: REQUESTING DR: 03347142001227301, UNKNOWN UKK ANIMAL un 1D: DRY RUN CREEK MESTON/REAC PROJECT 2E8D9I0SONW,OOKDJBR0I8D8G3E7-A3V6E794209 ARP 104: 13765086 (06727)000-22 RECEIVED: 190057 PRINPATGEED:: 1721U1L97 0528 CSE: VR-97-001030 RESEARCH tubular degeneration 1s not identified fn the kidney. , Ss. REF-E-2: LIVER- The Tiver tissue is acutely congested with sone vacuolization or . granularity of hepatocytes. in the portal triad aress. SpSeccaitftiecreodtheeorsindoepgheinlesratainodn Ioyrmphioncfyltaemsatairoenpriessennott identified. KIDNEYThere is mTihledrdeniallatattiisosnueofistahecuttuebluylacrongeelsetmeedn.ts,Mibludt autolysis fs present. this may be from freezing artifact. COMMENTS: s TSheevereaolsinpoaprhtisliocf tihnefiplotrrtaatliontrwiiadthaorteahsersucpeplolrstsanda epithelioid cells in parasitic infestation which would be a comon migration through otchceurlrievnerce tiisnswuieldin rtohdeenstes.animTahlesre (v2e7r/y45 lilkievleyr is parasitic samples). The aanciumtaelsc,onganedstitohnisssuupgpgoersttssana vacaurtieatidoenathb.etweTehne cauotlolleycstiisoniosfvatriisesduebeantdweetnhethe time of frozen. deTahten.hydrForneeepzihnrgosiasrtiinfacotnesukgigdensetysaptpheaatrssatmoe of be the tissues an acquired were disease, and many animals Tive a incidental. There vere long tine with these three liver sections changes. This lesion vas that demonstrated sone type of bacteria] bacterial infection infection with fron suppurative and the enviroment necrotizing process. This or nonspecific infection. could be The areas of heaorrhage facter in the cianusteheofkiddenaetyh.or liver suggested the possibility of traums s| s 0716/97 (LDM/ndp) Verified by: L. D. McGill, D.V.K.. Ph.D., DACVP. Veterinary Pathologist electronic signature 3712001227301, UNK For Histopathology Consultation Call: 1-800-426-2099 000446 END OF CHART USFW 1022 $3 T TT TT C VR 2 5y LT Ee ill g Hb | Ri H ii =il 5 8g3531! IWm IIm:to I l C eT ,ae Iai iika I 1 in dp Ls 3g A ii =B =2:1H S4 UhITE: 0 HHH HE 4 AiHS C I IT TT =Hi(535 i i |A| Ha[RUT IRR TIT WEL (REECE ee iis SEE 8 134733 ] EEERERERN FT 3 mEirErip| HT | [I . S ill] ill ii [GITEHR 5 gf All] _ iti " Haga IH ll SIE = 2 (TTT EE ~ LT pi 2 A ih SR anit INE ) Alm, 10 Rn wm 3 : qf TTs Ip pr ait Ee ill {REET sie s aRTL/ C he ey gm Bi 3 EI a GT hs: ) "40 . . ToDxriyAcP,RPuTEneNsCiDrnIgXkRsCehpeors - Washington, NWoovoedmbCoeurnt1y9,67West Virginia 000450 USFW 1026 _---- EINAL REPORT: TOXICITY ASSESSMENT OF SEDIMENTS FROM THE DRY RUN CREEK SITE WITH THE FRESHWATER INVERTEBRATE, HYALELLA AZTECA - . _-- TESTGUIDELINE: [EPA 600/R-94/024 EREPAREDFOR: Roy F. Weston, Inc. Build(iGnSgA2R0a9riAtnanneDxep(oBtay F) Edi2so8n9,0 NWeoowdbJerrisdegye08A8v3e7n-u3e879 Phone: (908) 321-4200 PERFORMING LABORATORY: QST Environmental Inc. 404 SW 140th Terrace Newberry, Florida 32669-3000 Phone: (352) 332-3318 STUDYID: Roy F Weston Project No. 3347-142-001-2273 QST Project No. 3197232-0100-3100 July 1997 000451 USFW 1027 DRY RUN CREREOKYHFY.AWLEESLTLOAN.TEISCT.S , QSTPROTECT 1972521003100 EXECUTIVE SUMMARY Wwihtohltehesefdriemsehnwtatoexr iinivyertteesbtrsatwee,rHeyacloenldluataezdteacta,QoSnTsEanmvpilreosnmcoelnlieaclteIdncf.r,oimn tNheewDbreryrRyu,nFlCorreiecsk, Seifee,reTnhceeesfefdeictmecnrti,tarnidfoornethlabtoesrtastowreyrecosnutrrvoilvsaledainmdengtrowwetrh.e uAseodtainl tohef4tosxiiecistyedtiesmtse.nsA,ftoenre1f0ield d~Hayyasloeflaexzproescuareb,ehvweereenwtehreelnaboorsiagtuoirfyiccanotrdioffseerdeincmeesnt(Pa=n0d.t0h5e)fiienltdhreesfuerrveinvcaelsaenddimgernotw(t3h00o)f. Tahbeorreatwoerryeconnotrsoilgnsiefdiciamnetntd,iftfheerefniceelsd (rePf=e0r.e0nc5e)siendtihmeensutr(v3i0v0a)l,oafnHdyaalneylolfatahzteecsaedbiemrewnetesnsathmeples - caoblolreactteodryfrcoonmtrtohle aDnrdy fRieulnd CrerfeeerkenSciete.sedGirmoewntths,, mweaasssuirgendif2icsadntrlyywdeiiffgehrteontfH(y=a0l.el0l5a)afztreocma,girnotwhteh in as sediments from sample stations 303 (Upper length of Hyalella azteca, in the laboratory Tributary A) and control and field 305 (Area ID. Growth, measured reference sediments, was . % significantly diferent (=0.05) from growth in sedimens from sample sition 305 (Area I. 000452 2 USFW 1028 _--m DRY RUN CREREOKYHFY.AWLEESLTLOAN,TEISNTC.S sSTTrPRuORsECTTmATmsaeN0o31m00 TABLE OF CONTENTS Section Page EXECUTIVE SUMMARY 2 TABLE OF CONTENTS 3 LIST OF TABLES 4 LIST OF APPENDICES 4 10 INTRODUCTION s - 2.0 MATERIALS AND METHODS 5 21 TEST SAMPLES 22 OVERLYING WATER : 23 TEST ORGANISMS 24 TEST DESIGN 2.5 REFERENCE TOXICANT TEST 3.0 STATISTICAL ANALYSIS 8 4.0 RESULTS AND DISCUSSION 9 - 4.1 42 RWEHFOELREENSCEEDITMOEXNITCTAONXTITCEISTTY TEST 50 CONCLUSION 10 6.0 REFERENCES n 3 000453 USFW 1029 DRYoRSTUNPRCORTEERECOKTYHMYFI.ATWLEEESLTLO0AN1T.0E3SN1CT0.S0 roman for he samples ae presented in Appendis A. All samples wer sored in refrigerator 414 2C duthretesitingnperigod. 22 ve OVERLYING WATER water used as overlying or ilion water was hard recontned reshvaie With hardnesos f - w13e0lmtg/oLc. aasaCahCeO,tesatnid eanaanldkawlainsitiy eofd116wimtgh/dLeiaosniCzAedCvOa.tTeh1e0wacahirevweatshebdiensieredd fhraormdoacdsescp | 2"n3e tess TweErSeTcOonRdGucAteNdeIaucSshiM)nSgH.Juavzetieclae b(siencoenddofrriomrdChnesaarp,ea2k:e3C2ulmtumrels,onHgeaynedswVeiAg.hiTnnge _ aspupprpolxiiemrastberleyed0i.ens2tg4inamgngdcohnodlidioinnsg.coTnhdeirieofnosr,e,suocrhgaanitsmesmwpeererhaeladnd<w4athsouhtasrdrniesrs,oWeersetsimilar tnointhtoisoienng,ofwTtehastrtowrigtahnitsesmssdwielraetoancwclaitmeartfeod 3to apnerycdenitffofrernecceeiivninwgatweatrecrh.eAmlilstHr.y abzytdeicluutisnegdhinethe freesctesivappeared to be normal and healthy at tes initiation. 24 TESTDESIGN " Prior to use in conaners and tienstingg,asthessoendigmepnatn.saamnpdlehsewneprertehsorsouegdhltyh`rhooumgohgaen2izmemd imnetshehirNoyrriegxinsaclreen freimnogv,e Asntoyneo,bspelravnattidoenbsrims,adaendweirndeigreencooursdeodrgoanniasmdsa.ilyNloogadshdeeit.onTlhewatteesrt vweasssealsdduesdeddufroirnhge pesito,ssraeyfesrewnecree, 4o7r0lambLoragtloarsys jcaornst(o1l3scemdimheeingthtwenrde i7ntormodduicaemdetiennt)o. thAptperstoxcihmaamtbeelrys 1a0n0d gramsof uniformly leveled. ded to each test One-hundred and seventy-five chamber o provide a rato of 1 millers (175 part sediment mL) of overlying water were 1.75 pars overlying water. The e{sntiaclhawmabteerrsquwaelirteytmheeansaulrleowmeednsowseeretaokveenrnaingdhttwhiettheotutoragearantiisomns. Awfetreerrtahendsoemalliyngadpdeerdio(d0.tthhee dividual est chambers, loading only one replicate at ame unl loading was complete. The 6 000454 USFW 1030 - DRY RUN CREREOKYHFY.AWLEESLTLOAN,TEISCT.S ST PROTECT A19T2201000100 `whole sediment tests were conducted using eight replicatesoften organisms per replicatefor a toral of 80 H. azteca per sample. The test vessels were labeled with the site samplenumberand the replicate number (A through H), and the test area was identified by the project manager, project number, test type and schedule. `The durationofthe staic-renewal test was 10 days during which the overlying water in each replicate exposure chamber was renewed twice daily. During renewals, approximately 75 percent of the overlying water was siphoned through a 0.1 mm mesh sieve. Any test organisms trapped in the sieve were pipenied back into the appropriate test chamber. New overlying water was then slowly siphoned back into the test chamber while diverting the flow onto the sid of the test chamber to minimize resuspension of the sediments. Hyalella azteca were fed 1.5 mL algae, yeasutwout chowcereal leaves mixture (Aquatic Biosystems, Fort Collins, Colorado) per replicate, supplemented with 0.1 g of an aged, ground rabbit chow (Jonesville Feed Seed Store, Newberry, Florida). and Tetramin (That Fish Place, Lancaster, Pennsylvania) daily following renewals of overlying water The tests were conducted in a waterbath adjusted to maintain a temperature of 23 + 1 C under `ambient laboratory illumination with a daily photoperiod of 16 hours of light (710 Lux) and hours of darkness. Test chambers were not aerated at any time during the test, Temperature, pH, and dissolved oxygen concentrations (DO) were measured daily, and ammonia, conductivity, hardness and alkalinity were measured at the beginning and end of the test. Water quality parameters . (semperature, pH. DO, and conductivity) were measured prior to and immediately following renewal of overlying water. Water quality measurements were taken with the following instruments: temperature Fisher Scieniific digital thermocouple; pH-SA 290A Orion pH meter with an Orion 91-57 triode; dissolved oxygen--YS1, Model 57 DO meter; conductiviry--YSI, Model 33 SCT conductivity meter; ammonia~ Orion Model 290A ammonia meter equipped with a Model 95-12 ammonia electrode; alkalinity and hardness~EDTA titration method. All instruments used to `perform the water quality measurements were calibrated prior to use. 7 000455 USFW 1031 DRYoRrUNPCORERSEoTKvHAFY. AWLEESTLTLOANT.I EISCT.S romoenas rhoom sraemfpelreenscaetsieodnim3e0n3ts(,UwpapsersiTrgiibfuitcanrtylyA)diaffder3e0n5((PA=v0e.s09I).fGrroomwgthr, moea2sured 2s . CromeenrhofotofH. saasmpelce,s.anTgheedlefnrgotmhs2.o8famllmsuprevrivoirnggaonirsgman(i30s3a awnede30w9)i(n0 2t.9emanogersgofan geatiasemdeaon einegotfeHt.sc,eTchaerbeewoewreeennothseglfabiocraatonrydofeneonessed(iPm=e0nt.0a9nditnhge rfioeldw eetnsceefrsoendsee,mGernow,thw,asmesaisgnuirfeicdan1t5lmy edaifnfrleenntgt(h=of0H..09a)gtfeocaminghreowbonsreoimneGntonfoomand ample sution 305. Nreo,adfveerresnecbee,haavnidorlalaboobrsaeorrvyatcioonntsowlerseedriemceonrsdeadpdpuerairnegdhheetaeslt. aAnld nfotrhmealesatseosrtgramniisnmastiionnhe B 42 ne REFERENCE TOXICANT TEST 56-hour LC or the Hacc reference toxicant est was calculated 0 be 21.1 ug CACI/L: ' ians95iperreanng:escoonffitdheenecsetloirmgianoifsm1s8.u5s1e1d0i24Q.S0T8. gC/oLp.iTshoeftLheCrevfaelrueencfaellosxwcainit etshte nroarmdaala : - 2nd satstical reports are provided in Appendix C. 5.0 CONCLUSION - Urndoewr tohf cH.onddieiocnsboefwtheeensahye,btoherste rweyreconnotoslignsidfiicmanetndiaffderienecdesr(ePfe=r0e.n0c9e)seidnismuernvti.vaSluanndil o(0..0a8teroimn tsuhrvaibvoarlsitnoraynycoonfrtohle Danrdy fRieulnd CrerfeecrkenScietesesdeidmiemnetnss.waGsronwoths,igmniefaiscuanrteldy adsifmeereannt tryewnetigh(po-f=0H..08e) fcromignrtohwtfhieind sreedfiemreenntcse afnrdomsbsoarmaptloersytactoionnrsl30s3edainmden3t0s5.waFsinsalliy,ggraownah. eingsiufriecdanat5 dmiefafnereenn(gP=o0.f0.5)afzreocmagirnotwhtehliabosreadtiomreynctonftrrooml saanmdplfeiesdarteifoenr3en0c.e sediments was 10 000456 USFW 1032 - 6.0 REFERENCES ORY RUN CRERBoHvYFAWLEESLTLOAN.TEBSTiS erTmromaTnhvAmiyamo ic - GPuhlylseiyo,loDgy..D.U,nAi.eMr.sByoeolfteWry,oamnidngH.,L.AprBielrg1m9a1n.. 199). Toxstar 3.4. Departmentof Zoology and Hamilton, M.A., R.C. Russo, and R.V. Thurston. 1977. Trimmed Spearman-Karber Methodfor Estimating Median Lethal Concentrations in Toxicity Bioassays. Environmental Science and `Technology. 11(7):714-719; Correction 12(4):417 (1978). Snedecor, G.W. and W.G. Cochran, 1980. Statistical Methods. 7th Edition. The Iowa State University Press, Ames, lowa. - U.S. Environmental Protection Agency (EPA). 1994. Methods for Measuring theToxicityand Bioaccumulation of Sediment-Associated Contaminants With Freshwater Invertebrates. EPA/600/R94/02. June 1994. Cincinnai, OH, 1988. U.S. Environmental Protection Agency (EPA). 1988. ComputerProgramand Users Guidefor - Probit and Dunnert's Analysis ofDatafrom Acute and Short Term Chronic Toxicity Tests with Aquatic Organisms. Prepared by Sutistical Support Staff, Computer Sciences Corporation. Prepared for the Biological Methods Branch, Environmental Monitoring and Support Laboratory, u 000457 USFW 1033 giiEsHl 2 1po48|le|e|slele2l5T EH EERE EE LEsgHl E|%% 3 HEE BEEEREE Ep t |&5|5|s|c|E(B(El z z 3 g 2 g zl: i 9 als 2 [=3]=|=1= 2 : g2 z 8z> leg]| ale " 32 SSs |i|S: 2 H8H ZF 22 = =z : gal3[E3|53 i2 [ealalalelslalel EH|t EEE EEE z 8 33 i 818588 |sEoe|lsl|A|aldEl]5s4 igi : 2% E 218s |, 233 ZF2 ESE HE 3g Zgsz [<i 8& $2 2 0%52dm =2: zlH8A|R8 gizE, z it 2BS 5o8vg3iszs 22$ 2 : USFW 1034 I. ei [ee Table 2. Survival and Gr `Run Creek Site J] owth of Hyalella During a 10-Day Se Pe2e [i[zn aTzorxeiccaitEyxTpeossted(PtaogeWh1oolfe2S)ediments From The |Dry " H 10 22 ole H 10 28 Q18 ? H 10 29 018 H 0 B a 18 000459 USFW 1035 | DRoYsRUmNoCrReERcEoKrvHm.YAWiLEESLTsLONA.TmEDSoCT.S Table 2. Survival and Growth of Hyalella azteca Exposed to `Whole Sediments From The Dry Run Creek Site During a 10-Day Toxicity Test (Page 2 0f 2) Sample ID SNoor.iAvlav)e_| |MeawnmL)ength | iMciean D(rmyn - A5 c 11005 2288 27 001173 on 21 on bE E 1100 10 c 5 2288 29 o01n6 020 - . | 2 06) 223p o0i.1s8 Arav BA c 111000 3208 28 00128 016 DEF 111000 c To 222839 00o.11m65 28 0 2 - H 01000 22s2 0o2l0s *"STiegnnifoircgaantnliysmdsifefexrpeonste(dPp=e0r.0re5p)lifcratoem (JRaEboPr)atory control and field reference sediment 000460 1 USFW 1036 . -_-- DRY RUNCREEROKYHYF.ALWEESLTLOANT,EISNCT.S eSTTmRoOExCTTmrimmumoimwe - Appendix A: Chain-of-Custody and Traffic Information 000461 USFW 1037 cn TH JOT Bes Ls 22 3~+ [TY] TR[TEH 3 | , | HH : Z(2 & { i3| < EQJ RrITrE FRHh `Wil 1 LReElSeil J} in i 4| Bl oo [mee oe aih H ELHET ; TSHpF HE TTT 2 {ae EHH PE TT, LIE the =e I 53PI 2 Siiladi fae bo 23 RIE [a TTETIHETR TaY5 iy |S { " "53 GGT NIT] :EE 1 OL DRY RUNCREREOKYHYF.AwLEESLTLOANT,ESINTC.S eee -- STOPROEECT miswOaSi Appendix B: Hyalella azteca Sediment Toxicity Test Raw Data 000463 USFW 1039 AEqnuvaitrioncmTeonxtiaclolSocgiyencLeabo&rEantgoirnyeering, Inc. Gainesville, Florida Project: 3(97z32-ofc3o1o-0 Page: ___ QA Form Number: 018 ESE Effective: APR 1993 || hela re = l obo Overlubg hose cles ums cossd osmo ei ene DsRescee tsoed se w2 ot n| ec ner | eniocel Bn f Ui o-- Dissoi lueQ on ae of o eo n>yodbee r speor || Fe ady e ee p ad { Ne 0. coneg nclols dcosncgee(devfeo)n. a: n a o ]| | i oy obi vali tenioek. deat red ard | lL oid. o- reads TotF. No ochos fed YT | | Cl2p2sJ = n Overlum 2 roy renewed ; toxd o )+ | ced: e25 e nDe ee> te eneaenll | me tt eds iedcoe | oe s41 me meooce oowerrlinnyy oe crisesc rearb ed: ddaez ks totia neDr sn omDod red. ccoammnecr || | cds ase. oo [iin emooaQtueir n, i ls 75F, po - .| _ o reracal Z Some oehle o cenpd sed bdhed socbe ef odes do esl 2 5$msl -- (s Le teeth) e.ed9.eec-tK | 1 000464 ||| usFw ios -- AEqnuvaitriocnmTeonxtailcolSocgiyenLcaebo&raEtngoirnyeering, Inc. Gainesville, Florida ESE QA Form NumPbaegre:: O18 Effective: APR 1993 I Project: 3197232 -otoo ~3iee rrr mo Tesh dermivaded (Povo) ; camn- 0: 75sec, | | rr 0| 0 -- rr ------1| l2 Ffr 000909090900 rr rr | { I ---- I1 --_---- OU04ES i i USFW-1041 seed HERRERA EEWE EHE Pa ggeeCs3s EEsu i g2g2 ols8 g8g|o%))8z" ]xRB|gi ea2ss 5LE% R 85\ 11] :2 58<52%8 M SeE=l1=Gl31a3133 | 8Hed) | |e z ooIl 0 %g3 8w8s 0 alc] > oSEE - 8&[9t]] |e Y glolt S :gal {oulf=l3zT1i]:e2l NEg5 aIgEe| HB ERENT 2 211 1 mn MIE EE | NNHBoE|H>|E8gIl ER2C8282EA ,2 58 | |g H2: IE T ILH175eAiE 1lBseERH1E:1E2H2 E5EC528.EHEo5-ZrR2E|E88[T3H 2R8]] E11R]|g22H311]ES3]8) - 1122112]8] ||5223531088| ll2 EZE|=| g|Z5335]8 2858458 Eg1l5=] a[g35?3581)5e81l|8o8uE||8s8A8E8Ez|~2]s g S|silll)| o0| v r1 H 8] E881 128 pond ak 1 d . [2] aallees ~m~edEl=AEE|AoReE|gE LE LEaD1 I8CsEI 2Th ol | sll I -- de | sil| a ?c Egll| &= "lz | FAEEE Sl A 3eg|l 1 | 1||" B 2. (l I =h1e0%e E l ee E ld Z| 1c | |. "s od17] 1o-E l18e BEWSE @ 2 239 3E& IS= 111 1 Ei. IN I kvK 5 HEM 3 31s 17 <P elt "Ate |---t IC =| > 53LE | I13 03FI ME za 22 Sie1, Ed sli|e 8 J so FLE PE BEoR11E lad.l=RE1= E%H=] 2E % gBE o|le2lEALl Ezl Sos EPRkeEd2|es lE zg HEA io] H28E5a|) 11E4t1e0l 1 |B== le|e] EEEsReesret)n |z.2l}eEFlALNlEAELsRNElEEANeR sEIELEETtiEeisddeee8s 18 dz 9 > }Ts 3 3eE 2a:l0AR| NEFE5 R| E2EeE2 H EColeFHARET AEL E2ER 1ERE FRE2E :23 ged EgF3eHIo Ri= EINERRHEagE7e 1] |I a gRegas E rgeTggs |FE2|3H x2H]H8H]I]HN e HHHHE||E=EEE&Rg alalikaicl hall Wi Kli ak lakAl geslL 1 QToSnTcElnovgiyrLonimeGntieseF,L EaFAFFEOCRMTITNOIGN:VE1E1909.137 Ei oEr F ci id SAMPLES comTvan TEST SPECS. (0) [elotnoA[2 ALK (opm) | su) | (mel)| (umbosicm) Timur[eon[99[30 [200 [ome | oo oor] lasing [6[oa[=T=Toa oe| -- |vrefme [oe os| lehaln2[e Joes[= =Toaler|= |wee [wows| [eben [ona] =T=Togfeo] -- |we [eeu| let Je Joa[=[=Toaleal =[ -- [oo uc] luzatr s|Bfone [ZT =T5a[28] = |Sac Joyus | fellteeebsssbtonTe+[luaeJ[foassst[[[|==--T[T =HJa eamfTq oeoo[||=-- =|| |SGoeeo T[[ooomcooenares|]| drier 210 Tear| =[= Jeofoe | = | wre Toomer] ehatno]c Jes Jase[cor [re[re[2e0|-- [oooma] lose T wwe [oamos] [elo of aToTcTo[[7 on[ion[ion| won | on [von 16 | on| w wm Tum| Jrome] [elles2 acme|Come] gn] vere[2a[2ema]came|Core|mone] 2 [est [elotlen lege[seme coreseme[see|come] 7['s ene[6ene] em] ert| mit| cont] ema]scog [mnond cont] cing Joein] [elastin 2]emo] ena Teme] seml mal 5eal 7et] mtilomyen] [elotler [7ere[nn[@er [3cove |vm |Ae |S pra| 26 Joowee] 3 000467 2 FE RSETPA=TRESPULGICAACTEE CN-N=O OCNOENDN UCETID RVITEYNAERLGKEN~CAELKALI--NIAT=Y.AVEAB=M ABMEPRLDP EXURSESROTOIND a TEMP = TEMPERATURE HA =HAR RDND ESS ~~ YTC = YEAST/ TROUT CHOW/CEROPHYLL a a erael T A e peeie| 0) ALK opm) (mg/L)| (umhosiem) lelgie1n] 6 lo|o=t| Ce eoT= Ton[lmea ||= = [|wvrreelneL|emoownse|] ar [eel= |we [enue e eeeEa T T ==TTT=olasgleenal]= =[|v= ee [ews] [avus | Ta = Tea = Tahrffaaf==f[worme [eon] eee] [hc t|aJoa Te | =| T=[= aloe] Jafoe = [= |= |we leewel lena ee fasius con[13 [ue[220 | -- moowe] EoE omm +[5[el [ wTe ewere[ nTo+e[[oonlLannu [fuowe]] ' ' e eT eTeotTl o0|T ea|ll[e0na[] 0 lleeoon]) TET= sT= o TOoNloiT dPoilTIo [orTo PlIE led Ee TT TT ha Ee o e reaTeodTrceoaa[loeoa[leer|[nee][sooemnallitoenmeellouo)s ei eTToeoneTlsoeneT[oreneT[orene[Liroenal[iooon nl[itoonne bows] meme) Commens: @ ee o12EN (FO) USFW 1044 oiToTee To Te J, Jom Joes] SAMPLED Ses | resvsrecies asjeeoste------ [etnies oJ 0) [29 lelatr [8Teen ALK Tulse Tea -- T-- (su) | (mg)| (umhosicm) [17 [16[300 Jee J79[76|-- Tories Jomo] Towne] [eho fester TeTeen| ToTae] --T=Tig =T--Tre TeoI-- Toee oa| --[wre Toms] Toon] [leetitySJTeETJoesssoTl==TT--=T[ooowlles]]-- =[ [ye= e TJoovmeo]] llebestoerT[eabJoanaoTl--=TT--=Taosg(a5na|= = [|owrree Toren] om] [fs[etleottnset2L|ooCJTTooossros[T[uf==teTT] ==colTToaoogf[Taeqnq[[|=e=| T|oo=rm[Ja oom m]] ffomosveenyonT ]wT TeTe o 1 T+Tm oT wv Tom] l[eetannoJf voonTTieonTToonT[oon on To oe[oon[oe Te] TToo oy letmbn2] esto To 0 To Tr T ToTTT T y[Toar foo e liste po preeneah] oo>Tdeinso[vlegT[oOerT a]snee[ ] oT > [w roaJoovne]) l loni[a 2eenein|zvseenreee []230e]mnge|oome[oma[1ennfroma| 10 oer] USFW 1045 ps E oe meA m YE E clEiT imie[A6LJ(oCo)on|ALo =K [fo(=oop)|[[71Gu18)[|3(6me[ [10l)[(aum= sboos/cml) us mfao e Lm meoewae sr|) p poe te p eS TTToeTTTaaan[ |[= ==[ TLu= we Leama] eer] e Me eto e e T e TTToobTaeobose[==[[wNree [lmmmeveenecne] hia e = Toe hhaea lana[[[ == =[ [[vo=ee[[eeeeree]e] ple ee T TelaTw [en | goo| -- |woone) Et m TTTneTToerw[Teoe snw[[o+n[oo n[s en[ofmea] : eT eTo oTo[w eresn[[[nvrweet[ [[rieocw ee[[ro rommae] |Lato[[freeenoue] eSToTTTeeroaeT[cowneTpea na [N nena[|0 [Lond sis oon ee ealsoeotn[[2maaolt sseemoer]lm(oonas|]zocnaoftoseaesd de Ee enon Ton len [sn [ion leone] TPooc-- o La: GainesF,L ervoineTFvoeRMrNoov:e 0191937 it dOl Eol c SAMPLEID mos |TESTS thPcaE deC ca IES. 0) ALK (opm) | (su) | (mg/L)| (umhos/cm) [ehny0]ATee lusfns Jeol[1s[16[RT [Gre | onm ome] [ehwin |B [one] --[--To--e[l ve/e ae|o e n| w| ledoin2]cfs] --|= TooTeo| -- | wre [wows| left [Done|=|--Taelae] = |vee [onuse lon "JeTau| =[=Tonl0a =|-- Too us] [hele s[EJess| =T- [oeTes =|vr [oy we| lehsko Jefear[= | Toafae|-- |ve [owove] leholn Ju os |=[=Toe[a9 = |wee [oopine| lebsintafac [|= [=Toplae[=[ -- Too] [labor2 8Jeeq|=T= Ira fee[= | gre Jo waa] [eho] c o3ofmfe[cothaTen [zoe| -- [moons] losses Teme [oon 4ToTeTo[[7To|w [wm] [oirof on[on |nwa [ion | on [ron |wnJrow] lebatnToToToTo[ena rome] ema]@ Jem] llama] 0TuToTwTo[0 [ [To[oo food clatin [rena [rama][roca|sea[vena[wn| sem [mo ua] les[ wv [0TNTNTNTNTNNJue] [disk ef2ame[ane]ann| seme [zeman[cee| enn|cone moend [etn[oe[iene] [won|zen] soma]some]zens frevel lest |2ema = ion] eon] Ser[ema]2 oe]=orlpon ue) lulader2]zene |soma]senn|2a |sen| dome|Some]2ems roms| [chalero] | Commens on Tien [an| oa] oa[oa[an [an [ious] 3 000471 3 REV RAESPT-ARTESPILRIECAATCEE CWoNO =OCNOENDN UCETVID RV<IETVYEARGLEKN~CAELKALIAN=IATLYIVEAMPb~=ABMEPALDEXNUSF=OTFOND 8 TEMP = TEMPERATURE HA =HAR RDND ESS ~~YTC = YEAST/TROUT CHOW/CEROPHYLL i coms al FE olid (C) ALK (su) | (mg/L) | (umhos/cm) leltr16 [zat| -- [=[39 [am| = [vrei lehter2cfos| =|--Jpelag| = [wee [oeisan] [rows] [oi [pier oo Je pos] oan | =| =[ --fonlee| = [oo las|= [ore [= leouzo| Teor] [iySE[maa| =[=[17[ew [hn fe one]=[= [agfoe = = | vyre[vue| |we [ooau] [ohn7[aJoes|=|=falas| = |we leh tA zea|=[= Ppalze|=| = [eo veel [ese] [chino] [elirian 10] & [rma| =[=[mala Foal Ipelitelcor[1.8[eo [ = |wre [20| -- [vowo] [weoma [ose fosow] 2[ wma [c[[&[7[o[ 1] un [ow | l[ehioso|oned[[m0n [ | ooo[Ton[|on[oo n[w on|lioemne[|rmooen]] lesbo2] ow |oo [|0 0[wolo ow fps] 0Iw[vw[wv [wd Tova] l[eesletc er *2|[5reemna||rreennaa|]tseennt]] zseenmee]] \efnmnt]|zzeenee]] (coornel| t ome lfouonnwoios]] Lin 0] en Lion[on [on | on [von[on [ton [mene] z 000472 " QSSSoaTrEtnovinroDnommaentmale Somat ---- QAFORM:_QI7C : [reeTapgone ToneTeTemeTome TorJo-g ovoToor Toa | [rs [[aode [oo[] [29|| [26[5] [2| [220s] [le| [30[we] [a0[a] [20|s| [22[eo| [29[=| [oe| [za]s] [30 [4] [sow] [32[0] SoDEv. RANGE [0af |Sm.DEv. (025 SDE. [od [STODEV. 124-23 |RANGE 24-3.2 |RANGE [27-3-2 |RANGE lar[Jr Tau [Jo[aa [1] [es [2| [as [3] [28 [5 | [22[4| [es[s| [ze |<| [22 [c| |6-Wo 22-3.5 [| [wE=r1ace ; STD. DEV. [so[| [se[9| |[21--T--[=av1emace [-- 30 T[wve] mos l[ s[29[] avemor 093 |STD.DEV. |'35 |sTD.DEV. 03% |SsopEv. [[2295] [p38 z2 3 000473 QeTEsnia umeenss SaH roma Er EEEr E [FromoTnte: 3r1125tom fi |TESTSECES bl alece Or =] (mm) * (mm) (mm) c [3|=0| | (mm) [io| I's] | [ole] [er |=| [ezls]: [21 | | | fe] [27[a| [os[=] [seal [sqle] RSANEGES 2ouo.32 |[SRmAoNpGeEv. [[2e5a-u33||RsAmNoGpEEv. 2[o6d-s32| RSTADNGDEEV. 2s0. 92.4 OTe es [0] [2 |21| c [24| | [3.0] lao |e| To] [ao|o| [esle| [es le] Dol [30Ia| [ole] [szlel ar|e| [21 [a] [sale] [rmroremmtey STD. DEV. RANGE l0u.234:3|| SRTAD.NGDEEV. oll |csrpore 000474 | zz3 [2-6-3 | STD. DEV. RANGE 205-2-]33| SRTAD.NGDEEV. 20:-04-03.2 o 5 TQoSxiTcEonlvoigryoDnempeanraulment `Guincavlle, Florida EoaFFoRFM:Eo CTIc VE * [2 [r= J(mim)mov oe Ji(mmp) JonTorTomeTove ooope| [ofa Tes[elsTee[fe [og[Vo [50| [22[3] [2a 2] [2d [4] [22[5] le| [ale] [ase] [23 [+] [so[a|[33[a] [ag[a] [=1 [--Te]l RASTND.GDEEV. 233-3 [|Rsa.NpGeEv. _ [[20.4-03:5|R|AsTNDG.DEEV. b0a3s0a |[SrTDa. nDeEV. [5a-3g] a Te Tee [Tr oe [0Te . lex[2] LatTy] [a0|e] [s| [arls] [ese] [a] les[71 [Tw] [20%] [230] STD. DEV. z2 RANGE 0-23 [STD.DEV. | 0-35 |STD. DEV. ps3 | RANGE 23-3. | RANGE oy |SD.Ev. 2-3-3] |RANGE [049 2.53.0 5 000475 3 Eee somes [FromcTTbe:sires: arm Pa T o TeeF (mm) gies |TESTSRRCES thockes LeFr rfe | l]l (mm) (mm) =<| (mm) - ~ or] als] a [ee] ls] rs . oTro Gite] [GCoealle] [[ealdee]] 1 Gael feel i STD.DEV. |o4z |STD.DEV. | 22 |STD.DEV. ot |sD.DEv. |ou8 25-30 - oC]Cg EY HE IFCCO [EaV[I| Ei RANGE 21-33 |RANGE 25-33 |RANGE Ra ~34|RANGE 1 ele Te0]] eae] B[oallee]] [ed Te] [Eo [-1 [=[=] c2 STD.DEV. 23) |sm.pev. |o36 |sm.pev. |eab |sm.DEv. [03) ~ 000476 3 Qa PSeTEnvironemenmtalt S QAFORMA :_QuiC [one rer T(immm)eTome[i Tim [ow rowTac fomJoor To(mmm)e| [fa JaeJoJoTea Tv Je [zs|] [sz[2] [32 [3] Fo] [zeTu] [27|] [s] Ce| [ee] [2] [22[7] [se | [22 [| [299] [a] [zt a] [23[a] Lol [sie] [fzs|=] [--Tel STD. DEV. RANGE 033 STD. DEV. 0-27 STD. DEV. 0-35 | STD. DEV. [311-32| RANGE 2:3-3.1 |RANGE. 2.2-3-2| RANGE sz[1Tr[zoTi Jo [ae[1 Ts og 34-30 [e] [a] [0] [22 [s| [so|e | 22 [2] [zs[5] [2c[8] [28[eo] [sola] [22Ta] [28 Teel RSATND.GDEEV. 205-2-332 | SRTAD.NGDEEV. 1--330. | STD. DEV. RANGE 129|u| [22s] [29]9] =1=1 oag STD. DEV. 2.52.3 |RANGE [--] oe 26-22] 000477 srw 1053 Ea qm [FoToTJoa(mmme) [oorTem LTo(mm) e[ove[1= Je[(mmm)eJoz|e Tic(mm) | re E ooe] meTe] [[eolloe I~] erTo] ere] mo Be] GEelTal] [ede] [ee] [2s[| STD. DEV. : Po FTeelaeTeoo]I] Lf[eeTTleU]]To f[ee0e]l RANGE. 024 |sm.pev. 25-3| RANGE [030 |[sm.Dev [2.3-3-2|RANGE. oa3 |STD.DEV. 24-3.) |RANGE |o-4 2-3-0 i1rJ Drrelier] [feleeI ] [FelYe] el [zefwl [er[=e] [ze] Doris rover STD. DEV. RANGE 0:24 | STD. DEV. 25-32 |RANGE Jom Gwe 02 STD. DEV. 2.b-3-2| RANGE 024 |STD.DEV. 3-3]| RANGE | 0-3) 2.42.4 000478 USFW 1054 --_ Ceo pa arom za PR NGSIO TETC SUBJECT: TEST ORGANISM SURVIVAL AND WEIGHTS [supe Toon[Rep[wo ive | Taewi | orswiw | Neowin) | averse | [e [o2 ats [c1 ass |0 ous | [2]c 10Toazez |oaped|onz | [41>[0Toawes |oawe|oz | Cobol ST a | oan | cass |ose |? [Tr]a Tow | ogond|023 | [71s io [os|oaot |oz | [sJu |o%mw |o0doe |09 | [a[4Two [og0z|oie |os| [e|o2 aes |1 oaue|0 oar | [nw [clo[oazs|ay | oz | 300 |x lte Toseda|pgzeq|oie | ong [s |o0a2e 9| 0a3teo |our | [so]T0429 |04295| 02 | [w |04289 | 0ao z77|ong | [nla]8 [owe[oasos| ong | [ee][om |osest?|ote | 1 [s |osmc |0437o ] ous | 303 [eo]10 |09223 | 09235| cuz | 0.15 [2[=] 0Ton|oa232]|osx | [=] &[ous |ote | os| [21] [oad| odd|ous| [4[wn [0Toael | 09m|ox| Balance sed; SPUR CaerUsed_0S-80 py: Due [sift 000979 srw 105 eTstees J onsen _-- amn Eeronr TcaoeiL[rosp[nstine[|reecws B|rooamdaenn | navies[aoe|| P5TTc osTiee lTToooaasmodl[o [ooomaaenrl[|ooezxe||| 04 30d [CPaolTTeo]oa9ol||ooodaaorrss[[[ooeomamem|||ooonznt||| TP o[+ wo |w |ooaarwsst[|ooaazo rtd||ooxn|| Coo[io |ome|osesz|os| : 30S Cel[o<|1 0 [Te] wo ||ooaazssae|[ots| oz| |omar|oaze| ous | ors" . eT eTol& ||a o0aasds||0c4ao 3m3e3|]oonko|| T[ Fuew[o+w1a twoo |||oooaazz2its|||ooosmmsy|||ooonuisse||| 500 [FFmalTce{T[oiiooo[||oodanoussm||ooosasoiezswae|||ooairtse ||| OW CCooTo+[to ||ooawess)[|oasernst||oozzeo|| Fos[nl 0loa [oad[ozo| Balance Used: SEWED CalculatorUsed: LS-Q0 By: pan pae:_7/3[20 000480 USFW 1056 TDirlye:Runa:dCrrye.ewk2Tox TestsT-r-aHn.sfoarzmt:ecaNOWTeRigAhNtSFORM ANOVA TABLE 1OURCE DF Setween 2 Within (Error) 21 `otal 23 ss 0.005 0.012 0.021 - SCirnicteicalF F> Cvarliuteica=l F3.4R7EJECT(0.0H5o,:2,A2l1)l equal Hs F o.00a ez 0.001 TTT i 000481 USFW 1057 DFrilye:Runa:Cdrreye.wk2Tox TestsT-r-aHn.sfoarzmt:ecNsOWeTiRgAhNtSFORM DUNNETT'S TEST - TABLE 1 OF 2 Ho:Control<Treatment GROUP IDENTIFICATION TRANSFORMED MEAN MEOARNIGCIANLACLULUANTIETDS IN T STAT SIG 1 2 300 (Ref) 103 00..114859 0.151 00..114859 0.151 3.727 + 3.195 + 3 308 Dunnett table value = 2.03 (1 Tailed value, P=0.05, df=20,2) FDirlye:Runa:dCrrye.ewk2Tox TestsT-r-aHn.sfoarzmt:ecaNOWTeRigAhNtSFORM DUNNETT'S TEST - TABLE 2 OF 2 Ho:Control<Treatment JROUP . IDENTIFICATION NOM OF REPS M(iInNimOuRImG.SigUNIDTiSf)f %COoNfTROL DFIRFOFMERCEONNCTEROL 1 2 300 (Ref) 103 8 8 0.024 0.024 12.6 12.6 0.044 0.038 3 308 8 USFW 1058 000482 n"rlye:Runa:dCrrye.ewkiTox TestsT-r-aHn.sfoarzmt:ecaNOWTeRigAhNtSFORMATION ANOVA TABLE SOURCE DF `etween 5 Within (Error) 42 .otal 47 ss 0.025 0.021 0.046 MS 0.005 0.001 CSirnicteicalF F> vCrailtuieca=l F2.R45EJECT(0.0H5o,:5,A4l0)l equal F 9.988 Tee ,00483 USFW 1059 o"riyle:RunasdCrrye.ewklTox TestsT-r-aHn.sfoarzmt:ecNaOWeTlRgAhNtSFORMATION DUNNETT'S TEST - TABLE 1 OF 2 Ho: Control<Treatment 20UP IDENTIFICATION TRMANESAFONRMED MEAONRIGCIANLACLULUANTEIDTSIN T STAT SIG - 21 30C0on(tRreofl) 00..210899 303 0.145 000...211084995 511...774085083 + _ 33 5 303048 00..119531 306 0.185 00..119532 0.185 52..114214 + 6 nett table value = 2.31 (1 Tailed Value, P=0.05, dE=40,5) r"iyle:RunarCdrreye.wklTox TestsT-r-aHn.sfoarzmt:ecaNOWeTiRgAhNtSFORMATION DUNNETT'S TEST - TABLE 2 OF 2 Ho:Control<Treatment - xoup IDENTIFICATION RNEOPMSOF M(iInNimORuImG.SigUNIDTiSf)f %COoNfTROL DFIRFOFMERCEONNCTEROL 11 3 30c0ont(Rreofl) 8 8 303 8 0.0.002266 0.026 1122..44 12.4 0.0.002604 . 0.016 45 303045 88 306 8 0.0.002266 1122..44 0.0.002548 6 USFW 1060 000484 Dirlye:Runa:dCrrye.e1k1Tox TestsT-r-aHn.sfoarzmt:ecaNOLTeRngAtNhSFORMATION ANOVA TABLE 1OURCE oF etween 5 Within (Error) 42 otal 47 ss Ms 0.108 0.022 0.356 0.008 0.465 CSirnicteicalF F> vCarliuteica=l F2.4R5EJEC(T0.0H5o,:5,4A0l)l equal F 2.559 Tee : 000485 USFW 1061 sPriyle:Runa:Cdrreye.1k1Tox TestsT-r-aHn.sfoarzmt:ecaNOLTeRngAtNhSFORMATION Ho:Control<Treatment DUNNETT'S TEST - TABLE 1 OF 2 TRANSFORMED MEOANRIGCIANLACLULUANTEIDTSIN T STAT SIG sROUP IDENTIFICATION 1 control MEAN 2.925 22..992255 0.000 23 4 300 (R3ef0)3 22..982357 308 2.913 22..981337 2.800 1.0.920701 2.718 + 65 330065 22..880602 2.862 1.357 Sunmett table value = 2.31 (2 Tailed Value, P=0.05, d=40,5) isrlye:RunadCrrye.e1klTox TestsT-r-aHn.sfoarzmt:ecaNOLeTnRgAtNhSFORMATION DUNNETT'S TEST - TABLE 2 OF 2 Ho:Control<Treatment ;RoUP IDENTIFICATION NOM OF REPS M(iInNimORuImG.SigUNIDTiSf)f COoNfTROL DFIRFOFMERCEONNCTEROL 12 30C0ont(Rreofl) 8 8 rr 0.0.110066 33..66 00..000808 : a3 5 303043 88 308 8 00..110066 0.106 3366 36 00..011235 0.063 6 308 5 000486 USFW 1062 DFriyle:Runa:dCrrye.esk1Tox TestsT-r-aHn.sfoarzmt:ecaNOsTuRrAvNiSvFaOlRMATION ANOVA TABLE SOURCE oF setween 5 Within (Error) a2 otal 47 ss Ms 1.167 0.233 8.750 0.208 5.917 csirnicteicalF F< vCrailtuieca=l F2.4F5AIL (T0O.0R5E,J5,E4C0T) Ho: All equal F 1.120 or 000487 USFW 1063 oHryeRunRCareyesk Tox TestsS-r-ain.sfoarzmt:ecBaOsTuRrvAiNvSaFlORMATION Ho:Control<Treatment DUNNETT'S TEST - TABLE 1 OF 2 TRAMNESAFNORMED| MEAONRICGAILNCAULLAUTNEIDTSIN T STAT SIG OUP IDENTIFICATION 1 30c0o nt(Rreofl) 150..705000 105..070500 9.625 -10..058458 23 i5 330038 305 5.57.56205 9.625 10.000 1055...076052005 -01.0..005304508 i c 306 riiianie vate s 21 Tailed Value, pe0.05, afd0S) SJeiye!RunasaCrrye.esktTox TestsS-r-aHn.sfoarzmt:ecaNOsTurRvAiNvSaFlORMATION Ho: Control<Treatment DUNNETT'S TEST soup IDENTIFICATION TABLE 2 OF 2 RoEmPSor M(iInNimORuImG.SigUNIDTiSf)f C%ONofTROL DFIRFOF`EcRoENnCTEROL or 12 3 300con(tRreSofs)l 88 Jos 8 00..552277 0.527 5s.ia sis -o00l..i20a50s00 sls 0.125 35 c JJoss 88 00..552277 sa -0.250 USFW 1084 000488 DRY RUNCRESEOKYHYF.ALWEESLTLOANT.EDSiTC.S asTParECT P0T ai Appendix C: Reference Toxicant Test Raw Data 000489 USFW 1065 E ilz TI 2220 2F % E |=BE 8EeEn a2C5mna2r] 28u85l,58x4= 1[38e32238 [2 &i92 i1 225 REN2 IN 2 -Ses 3 -- x [g7' -z 0 a2 852 - Es "a |asfd| If In ~8w3og vi " Sll HEw8e32g nI--nn |=] 2E2 ]| t > SSe lal d=12 2] 25.2 113] glleole| 2u5z%.|bo g eo 5 3) z J = g1. ~=2JS1l|8g822%s.523 |[|S32288s2]] |z8 o |E]]al= a Ne :a - Z2aB|5H3A 4 ol EeHllHuefeM|E28 R20E2]wzw||38Eczs03s03sE3a| 2gEQe2l) ([|22 8 5 1 115=12 {| |2& 8S1i%c5||2o%e||28a28t8E80e 8 (<2 8ails S|lsxl salssl $(2 2311332|858(|s0e8e83d%ed(~]3 SIT) |z --|Z|58|28282 | 25] E |83 L 2A H i el2) |Z Cj |=e (added 2 ol sSlyl LL - - 1 |8 g3ss . 3 4 i= fx [. { 33 u :g Aled S| = 15] 1=0181 4el<] {Led t TiS. {ig=lz . a2 z a2inn 252 " 82 LS28e5egngt 8583838 3HEgE L2Eeu3e?%> E22E283L3 | | 5 sh I wo 4 sd 5e]l%e =oo. { - -. Feef - | o1f8 [= Fl =fed 221s <<" A< HYBEEE YT] | 3 dle"1A9|= d2id[HEe 8W8E1s]2 oZl]:2EI1R3:1=5). 2.8 g ==| |39gES3l= A5. RBElE El1"2l):1|3l)e8 8 &2 |d2g 7= BEoNE ees8 #u=| l8e os |. "18g1:1 ll:llEjeel=3]<]sle Ell]: 1%5]8 a of B-s g2a8als.le* le] 1H 8]eH llslEelE2d2 > | LTZ28A]Elo] 52s28e7eRsE|Sle[|B2125c1l11l8581l222Lkee|d=d4z2 Susie | iEaanlzislalE] IE PERE 52E ved|e lgEigphaly slellc]elel= 8 H3A3RsB _TT e E ~ eH 858=|IHEsHteHlIl2BlHlHglz=EE8= S: S88 88me2r 881 2|& als)= LL AL 1 J< 8"= F22H] | Be Be25]2 2] 18 glHEN7 . EE a. & . Ail 2z Ele |] ( o| | a il :5 1)33h p 33 fo S a zM:Bl Ex LEEE7 pi] 1) of] E gEzLl d | oyp I5 i a2f -3 HR Ha5f1Hf2 | . 812 HH gfe io) 7 IK HE [af 8 ; i1xB ist| L2E i ee eb bd i ST Ex H2 . 23Sh 3 =Els1)g(]5 i1Is=]ol0l8) 8 2(2|2| 22 f 112 2 } 2 % BA LE ARE: , i3 . "3 2 219 210 219 of eof en SE0%ie5s h2il olJ i lny o IO 58%s &c &5 5 g3e4al li) 2Ei5g%: ol] E75E0E0]3 o 22358 8 Hs3SoeuHeiz)i | | E25588%5sHS = 2Eg534185 Ps % = sgglic ALL LF SET] 5z 3 Hi - lsB%E BE23Y1HENIt . 48 1] e 1, I-T | Vv) ;: |J y5z 3::| iEia i inx 81 |: HER E;:l fy Lal,g [2 ==5| 1%35 |] | = 1212 } | |, H |z goaeg< ae 3: | | ay | LE 2H1H. i | og|z2 Ae | | [1 38 g2h| dd ( a1 : lc 0 1K | AHHHHR kIs: 1 - i A2 lySd i {+/+ he7l Y3 J:IC | 2|2| 2 : IT m EE | , 28E:%u 8 "1 A ; JuL) LLL=:E} LL; 11 | 1 AE] of laEle 4 S<28f, fi2 deel 125Bo] ~- | \ g :TT | Al 0 HE] : H Ei sa] IL NE131 Fea HR2KE E Ea2d 9s 1 : 1] | Na g |28 a| #5: B |E || eE223irdreEAdR | 3-J38 nBg ly Ehgeglk| | |] | sal fof |] "ifEilEEH | | z:. gz 0|1:= | | g a1 15 |, ls gi HE | { wm lies l 1 F[| Z8lRf1|5%E] =ER~z || AElE FE=LL i "13 8 | 1lE5o31l123] = | ||| 4H EH3gglsi|] Ial | Eg EC E L LL | C SN H lsI 1HI2 BY 1 Il| | | 2filE F5)1]51 fOII[eEelS] T.EgEld | nmi|i}s | | | SEE 01 1H:1:1E EHEol of |1201 35g3g3) | |Ba LIE~ S]| | [rl 4e i; $ge5e:! | EE|TI| 5| EN l E:ig | 25302 25of 52%% 8 e2o2|1 | | i EB53g s Ry 28A 5=X5N[ E|fHE eeEl H LI - 1I]zz $E25]E 5]I Ll] I Er| a }| BHZQ] EZRODAK RIMMED SPEARMAN-KARBER METHOD. VERSION 1.5 DATE: 6/23/97 TEST NUMBER: 1 DURATION: 96 h TSOPXECIICEASN:T : H. CdaCzlt2eca RAW DATA: Concentration Number Mortalities . com -e-- (ug/LJ)oo 8.00 Expos1e0d 10 oo 10 1 3126..0000 54.00 100 1100 126.00 10 10 SPEARMAN-KARBER TRIM: -o0% SPEARMAN-KARBER55E%STILMOAWTEERS:CONFIDLECN5C0E:: 55% UPPER CONFIDENCE: 1281..5111 24.08 DATE: 6/23/97 TEST NUMBER: 1 DURATION: 96 h STPOEXCIICEASN:T : H. CdaCzlt2eca RSAWSDASTA: Ctoungcrmeyntration NEuxmpboesred 10 Mortalities o Joo 16.6.0000 1100 1 3524..0000 126.00 1100 100 10 10 SPEARMAN-KARBER TRIM: 00% . SPEARMAN-KARBER 55E%STILMOAWTEERS:CONFIDELNcCs0E:: 2116..1511 95% UPPER CONFIDENCE: 24.08 WOULD YOU LIKE TO HAVE A COPY SENT TO THE PRINTER(Y/N)? - WOULD YOU LIKE TO CONTINUE (Y/N)? 000494 USFW 1070 Environmental Science & Engineering, Inc. Aquatic Toxicolegy Laboratory Gainesville, Florida Project: 3/97232-0100-3i00 _ Page: ESE QA Form Number: 018 Effective: APR 1993 Creal -- A6eD or Ses, zed, 3c, Jes [| spe ced0 crete poze 0 zec. | | er ---- | ie gece oO bhoecoegunrrz?e v byobord d. p. || f cbr reardD at neegeen one ct) wo | be crdagen. [ses L 3oco een Pebbles, rocks ond roo f| EL sed sate, La eee ee l low coctis, plant debris, sland oder. | E I S tindIeS n | | vesce don 175 wo > aredar ones added | ih ob ke tlnlen me oveting onde | eel 0 waleb re vp msec | D. Owe. aebee fhe gedaan lf este oo ye eonndoese, || 1, azdece Alef each dog} vessel -- ne abnoweal ee bouncer | ooass she D. pO ~m an x >6.0 I eeled. comn-g sed vp do { Cab mbes over dwt aren 73 IL,so cordon 73 onoSk bad ii bara fend & | TO ie fin) USFW 1071 me | Lolo lw AEqnuvaitriocnmTenotxailcolSocgieyncLeabo&rEantgoirnyeering, Inc: ESE QA Form Numpbaegers: Effective: M0A20R 1993 Gainesville, Florida sumopcr: WATER ALKALINITY WORKSHEFT | -- [oSpSenerbseTwanceernSanto br PTreo5jCecStpecNiuemsb:er:| 3(1723Z-olee Hoes [pata By: __t2 eter Gloglan mime: _le3> ery of masor correction Factor (smieurie (based on Amid): 092 standarddairzdaiztaitoinoonoff 2M2750! _ti_tra_nt_): _--_1L.--OZ -- |B| csToienschtnasd|i|nssatmphraea|aI tpiduce n | Inisttiaanl | RBeuazdeitng RFienaadTliongpBuHr(eatL)| TiUtsreadnt | AlTkoatlailnity (mg/L 2s || | f fuaneittisn)e T| Tvo(lmuu)me || (Taob) |T (mL) 4.5 | 4.2 (nL) -- caco3) PET Foe T==TTeeeo TTauao[l=TTa oo|| ee asl =las | EFoo TTee o e T=[Teeoef{ oco =TT oc | Fo Tee = ere eefmal= [uel rr -- tr ug 2a as | ayy 13 us| II EN _ [catcatation of Total Alkalinities > 20 mg/L 28caco3: | i Total Alkalinity = --B--x --N x--50--,00--0 -- nL sample : vhere BN == =nortmiatlriattyedof acid | f total Alkalinity x Correction Factor = [coorrrreeccttede)d) TTootral AI l--ka-- linity -- poetlecuifeteion of Total Alkalinities < 20 mg/L as Caco3: { Total Alkalinity = --(28-- -C) -- x N--X 50 0,00 00 nL sample ."here B Cc = = tploita4l.5mL total mL titrant titrant to to 000496 1{ USFW 1072 N = pnHorm4.a2lity of acid || AEqnuvaitriocnmTeonxtailcolSocgiyencLeabo&rEantgoirnyeering, Inc. Gainesville, Florida Page: EESfEfeQcAtiFvoer:m NFoE.B: 0139913 T SUBJECT: WATER HARDNESS WORKSHEET Ni [sponsors __ \oesler /0n Gm Crest Project Number: 3l37732-o(eo | Test substance: _Seliwenk [oveclyry Test species: _\hazlece | SE --ee _T--eter -- { [| pata By: pM Date: Gliafan Time: \ Ss" { [ Normality of EDTA Titrant: __o.olm 1 BCor rrecrtior n F: actor (based on standardization of EDTA Titrant): er _0.99 -- I I T [initial | Final Total | TOTAL 1 Test | sample | Dilute | Buret Buret | Titrant HARDNESS { cnointc'sn) |f vo(lmur)me || @tn)of| Re(amnd)ing | R(eaaLd)ing U(sm1e)d || (co(rmrge/Lc)ted) | FSon2ts2Jee |I =ToeI Tui Ji or I| no || lent[ioe | =TooTusTus | ne [osos flT iioe|[I | = = TLI ooooTrJoesa i[[oage||! ee wg || E i i Foor Tan |!ae [sor[7 oo [F see [wo |i | =Fi ooii Tae = Too Tosa i q wm [sa I|!i 5s ug | | { |r! rr { frr 1 r I r Tf { I7 r i r i r i i y {|[ ii [ i r i rr 7I r ii1i| calculation of Total Hardness (mg/L as Caco): A x B X 1,000 / mi Sample | "here AB == mmgL CoafcOT3itreaqnuti,valaenndt to 1.00 mL EDTA Titrant (1 mg cacos = 1 mL EDTA Titrant) { . 00497 i Total Hardness x Correction Factor = [corrected] Total Hardness f| USFW 1073 EEEE---- FINALREPORT: CHRONIC TOXICITY OF SURFACE WATER SAMPLES FROM THE DRY RUN CREEK SITE WITH THE FATHEAD MINNOW, Pimephales promelas : - PREPARED FOR: RGoSyAF.RarWietsatnoDneIpnoc.t Building 209 Annex (Bay F) 2890 Woodbridge Avenue Edison, NJ 08837-3679 Phone: (908) 321-4200 Fax: (908) 3214021 PREPARED BY: QST Environmental, Inc. 404 SW 140th Terrace Newberry, Florida 32669-3000 Phone: (352) 332-3318 - Fax: (352) 333-6622 STUDYID: Roy F. Weston No. 3347-142-001-2273 QST No. 3197232-0100-3100 July 1997 000498 USFW 1074 : DReYtRMRUONOYECF.RTEWMEEKSTTCOHoNR.OmNIINICC.S EXECUTIVE SUMMARY `Short-term Science & chronic toxicity tests were. Engineering, Inc.) with the conducted at QST Environmental Inc. fathead minnow, Pimephales promelas, (formerlyEnvironmental on surface watersamples crooltlehc,tedAfrtoamalthoefD4rysiRusnurCfraeceekwSaitee.rTshaempelfefse,cocnreiefiiealdforreftehreecncherosnaimcpolxei,ciatnyd toenstes lwaebroerastuorrvyivcaolntarnodl sdiafmfpelree,ncewser(eP=u0s.e0d8)ininthtehecshuirovniivcaltoaxnidcigtry otwestths. ofAPfiemrep7hadlaeyssporfomeexlpaossubree,etehnerethewelraebonraotosriygaciofnitcraonlt water and the reference water from sample sation 2273-00203. Survival of Pimephales promelas in the laboratory control and imephales promelas in field reference surface water water was from sample significandy sation 2051 different (P=0.05) from survival (Upper Tributary A). There were of no Saingdniafnicyanotfdtihfefesruernfcaecse(wPa=t0e.r05s)amipnltehse cgorlolwectthedoffPriommetphhealDersypRruomneClraesebketSwieteenThtheecfhiielodrircefneor-eonbcseewravteedr- effec concenation (NOEC) values for Pimephales promelas survival were 100 percent water for samples fwraosmlseassmptlheansa1t0io0nspe2r2c7en3t-2w0a1te(rArfeoar IsVu)r,fa2c0e41wa(tAerreafrI)o,masnadm2p0l6e)s(taUtpipoenr2T0r5i)bu(tUaprypeBr).TrTihbeutNarOyEAC).vaTlhuee - NOEC for Pimephales promelas growth was 100 percent for all of the surface water samples collected from the Dry Run Creek Site n 000499 USFW 1075 `TABLE OF CONTENTS SECTION EXECUTIVE SUMMARY TABLE OF CONTENTS LIST OF TABLES 1.0 INTRODUCTION 20 MATERIALS AND METHODS 21 Test Samples 22 Test Organisms 23 Control Water 24 Test Methods 25 Reference Toxicant Tests 26 Stistical Analyses 3.0 RESULTS AND DISCUSSION 3.1 Chronic Toxicity Tests 32 Reference Toxicant Tests 40 CONCLUSION 5.0 REFERENCES DRY RRUONYCF.REWEEKSCTHORNO.NIINCC.S OST PROTECT imo PAGE 2 3 4 s s 7 8 9 000500 3 USFW 1076 DRY RRUoNvCFR.EWrEEKSCToHORNO.NmIINCC.S LIST OF TABLES Table1 WPaimteeprhaQulaelsiptyroMmeealsausroenmeSnutrfRaacnegWeasteDrurSianmgpClhersoCniocleTcoesidctryoTmestthse wDirtyh Run Creek Site 10 Table 2 e`FSrumrovomivtJaleunaetnod12SGturhrofrawoctuehghWoaf1t9Pe,irm1eS9pa9hm7aplleess pFrroomemltahse DDurryinRguma 7C-rDaey CSihtreonCiocnducted u - LIST OF APPENDICES AAppppeennddiixx AB CPhimaeipnhoafl-eCsupsroodmyelaansdTTersa:ffDiactaInformation Appendix C Reference Toxican Test Daa 000501 s USFW 1077 DRY RRUONYCFR.EWEEKSCTHORNO,NIINCCS. SST PHORCT PTI 1.0 INTRODUCTION QST Environmental Inc. (formerly Environmental Science & Engineering, Inc.) conducted short-term chronic toxicity tests with surface water samples from the Dry Run Creek Site. The tests were conducted from June 12 through 19, 1997, using the fathead minnow, Pimephales promelas. The criteria for effect were survival and growth (measured as dry weight). All of th original raw data pertaining to the chronic toxicity tests are maintained at QST Environmental Inc. 404 SW 140th Terrace, Newberry, Florida 326693000. 2.0 MATERIALS AND METHODS 21 TESTSAMPLES Five grab samples of surface water were collected by Roy F. Weston, Inc. personnel on June 10, 1997 and shipped to QST on ice at 4 2 2 C. The samples, identified as 2273-00201, 2273-00203, 2041, 205) and 206). were collected from Area IV, Reference area, Area Il, Upper Tributary A, and Upper Tributary B, respectively. A cross reference of the sample identification and sampling location is presented in Tables Vand 2. All of the samples were received on June 12, 1997 and were stored in a refrigerator at 4 2 C during the testing period. Prior to use in the chronic tests, samples were allowed to equilibrate to test temperature. The toxicity tests were iniiatedon June 12, 1997, within 12 hours of sample receipt. Sample chain-of-custody and other traffic information are provided in Appendix A. 22 IESTORGANISMS Pimephalespromelas were obiained from Florida Bioassay Supply. Gainesville, Florida, and were less than 24 hours old at test initiation. All the test organisms appeared to be in normal condition and were acclimated to dilution water and test temperature prior to esting. 23 CONTROLWATER Control water used for holding and sample dilutions for the P. promelas tests was moderately hard reconstituted freshwater with a hardness of 76 mg/L as CaCO, and an alkalinityof64 mg/L as CaCO, 5 000502 USFW 1078 "DRY RRUONYCFR.EWEEKSCTHORNO,NIINCC.S eens 24 All tests TESIMETHODS were performed accordingtothe guidelines provided in ~Shont-Term Methods for Estimating the Chronic Toxicity of Effluents and Receiving Waters to Freshwater Organisms," EPA/600/4-91/002 (EPA 1994) Torhecotensttrsolwewraetecro.ndFuicftteedeninP.34p0rmomLelcarsystwaelrlieziinegsgeldaspsedrisrheepsliccaotnet,aiannidng2t5he0emLreoplficastietes, field were reference, tested pec concentration. P. promelas were fed 0. 15 mLofbrine shrimp nauplii (Artemia salina) per replicate twice. ally Ime concentration of surface water selected fo the chronic toxiiy ess were 0 (filuon water contro) and 100 percent sce or t solutions were field reference water. renewed daily during The tests were conducted from June12through 19, 1997 and th test. During each renewal approximately 75 percentofthe tPch.oenpdterusoctmeedlaast atetsetmoprercaontteroolfs2o5luti1onsCwuenrdeerreRnuoerweesdcewnitthigfhrienshgly(apmrbeipeanrteldsbteosrttosorlyutlimonisn.atTeisotns)wweirteh 2 daily photoperiod of 16 ours light (855 Lue) and 8 hours darkness. Test temperature was mainiained with the aid ofa recirculating waterbath Iahnde epHs.ts wAetrtehemocnoincolruesdioanttoefstthincihroonnicanedxpdoasluyrets,haemrmeonfioar mcoonrsaelnittrya,ttieomnpsewraetruerem,edaissusroeldveodnOXpYoEoElne.d amples rom the 3 replicates ofeach sample using an Orion 290A ammonia mete equipped with an Orion 95-12 ammonia probe nt the conclusion of the tests, the mean vansferingth fish in each replicate into dry weights pre-weighed of surviving P. aluminum pans, promelas were detemined insing with deionized water by 0 Lemove lowed excess to cool food, and drying in a desiccator a the pans and fish room temperature at and 100 C for then each 18 pan hours. After was weighed. drying, the The group pans were dry weight of each replicate was then determined by difference. 6 000503 USFW 1078 DRrY RoRUoNvsCFR.EWEEKShCTHOoRNO.mNIINCC.S 2M.5onREreFfeErRenEceNtCoxEicTaOntXtIeCtAusNiTngTpEoStaTssSium chloride (KC were conducted to evaluate th sensviy ofthe test 2,000and organisms. 4,000 mg The KCUL refere . The nce toxican reference t test concentrations us toxicant tsk exposures ed were 0 (con and condiions trol), were 250 the , s 500, amea 1,000. those of the chronic toxicity tests. 2.6 STATISTICALANALYSES Satisical analyses of th chronic data on survival and growth (messured as dry weight) were evaluated using the TOXSTAT computer program (WEST, Inc. and Gulley, 1994). Theno-observed-effect concentration (NOEC) values for the reference toxicant and each of the test samples were determined using he TOXSTAT computer program. The NOEC is defined sth highest concentrationofreference toxicant or tes sample whichis ot significantly diferent (P=0.05) from th contrl for a given endpoint (e.g survival, under the specified conditions of exposure. 3.0 RESULTS AND DISCUSSION. 31 Tes: CHRONICTOXICITY TEST conditions remained within accepiabl Imi for the dursion ofth chron toxic tests. A summary . of the water quality meesurements is resend in Table 1. Dissolved oxygen levels remained sbove 60 percent saurtion, pH ranged from 7.4 10 8.3 an tet temperatures remained in the range of 24.1 025.8 C for the duration ofthe ests (Table 1). Sample conductivities ranged from 270 0 350 shoe (Table 1). At the end of the exposure period ammonia concenzaons i he P. promelas exposures were measured 10 determineifsome of th observed morality was due to mmria. Ammonia was detected inal ofthe samplesa concentrations ranging from 0.27 me/L (convo) to 0.35 mg/L 2047) (Tabe 1). Ammonia was ule out 5 causative agent ince the measure (0 ammonia concentrations would not result in enough unionized ammonia to result inthe observed morality. Survival and growth daa for the P. promelas chronic toxicity ess are presented in Table 2. After 7 days of exposure, survival of P. promelas in th dion water control and field reference exposures was 93 percent and 87 percent, respectively. Survival of P. promelas inthe sc wter samples ranged from 58 7 000504 USFW 1080 DRY RRUONYCFR.EWEEKSCTHORNO.NIINCCS ee eewoees percent via (2051) to 100 percent of .promelas bewee (204) and n he labor 2060). There were no atory conol wie an significant di ial ne fferences (P=0.05) eld reference wate in r the om sSamcplae nstattiondi2f2e7r3e-nt0.02(0P3=.0.S0u9rv)ivfaolomfsPu.rvpirvoamleilnassuirnfatchee lwaabtoerratforoymcosnatmrpolleansdatfiioelnd2r0ef8erTenacbelwea2te)r was Grow mean ta for. weigh of spurrovmievliansg,P.mperaosmuerleadsasinmehanabdorryawteriyghctonitnolmilnldigrfiaemlsd,riesfperreencse esanmpileTsaabfleer 2. The days Tnfeeaxcpcoenptraeblweeriei0s.3(72m0g.2p5ermgorlgoagnaisnminmdin0t.h4e2cmogntpoelreoxprogsaunress,) rfeosrpetcitsivetlesyt.. TBhhe mveaalunesryweweiWghit nof rales in este wate samples ranged fom 0.39 m pe orgasm (275.201 and 2051) 10 0.42 mg per organism berween labo (203) ratory acnodnt2e0l4,1).elTdherreefewreerncee,noansidgnainfyicoafntt hdifsfietreewncaets ( e P=0.05) samples. in gro wth o f P. promelas Copies of the relevant raw das pertaining tothe chronic (oxic ets are provided in Appendix B 32 REFERENCETOXICANTTEST "fTeherecnhrcoenitcoxNiOcEanC for P. rsuls pwreormeelwaisthsiunrvciovnatlroalndligmrioswtohf were both reference tdoextiecramntinteedsttopbeerf5o0r0memdgatKCQIS/TL.. The The reals of the reference toxicant tes demonsiried tht the tess organisms wee within their expected sensiiviy ranges. Copies of the referee toxicant raw daa are provided in Appendix C. Under the condions ofth toxicity tests, 4.0 CONCLUSION survival and growth of Pimephales promelas i the laboratory cwaotnetrr,ol SwuarvtievawlasofnPoitmseipghnailfiecsanptrlyomdeifaesreinntt(hPe=l0a.b0o5ra)tofrryomcosnutrovlivawlataenrdagnrdowfitehldinretfheerefniceeldwraetfeerrevnacse n20i5f)ic(aUnptpleyrdiTfrfiebruetna:r(y PA=).0.T0h5erreowmerseurvniovasligofnPiifmiacpahdailfeesrpernocmeesl(aPs=i0n.v05a)teinsathmeplgerforvohm osfamPpilmeepshaatlieosn romeasbetweenhe lborstory coil wate an any of the surfce water samples cllced from the Dry Run Creek Site. The chronic no-observed-effect concentration (NOEC) values for Pimephales promelas 8 ' USFW 1081 000505 DRY RRUONYCFR.EWEEKSCTHORNO,NIINCC.S 9ST PROTECT Bio survival were all 100 percent water for samples from sample stations 2273-201 (Area IV), 204] (Area I), `and 206] (Upper Tributary B). The NOEC value for survival was less than 100 percent water for surface water from sample sation 205 (Upper Tributary A). The NOEC for Pimephalespromelas growth was 100 percent for all of the surface water samples collected from the Dry Run Creek Site. 5.0 REFERENCES 1. United States Environmental Protection Agency. 1994. Short-Term Methodsfor Estimating the Chronic Toxicity of Efiuents and Receiving Waters to Freshwater Organisms, 4th Edition, EPAJ600/4-91/002. Environmenal Monitoring and Support Laboratory. Cincinnati, Ohio. April 1994 2 WEST, Inc. Inc. 1402 S. aGnrdeGeullelyeyH.WDY. ,19C9h4eyTenOnXeS,TWATY. 8V2e0r0s7i.on 3.4. Copyright License Granted to WEST, 9 000506 USFW 1082 E GT a oo i ve Foret on,Crt Toi Te i Pls promelas on Tee Surface Water Samples Collectedfromthe re Dry Run Creek Site ooerfTooy Cosas Trier JJoo(mrg/L)*T[mo(eC)mae Jon [ams [oo(mmg/mLe) [[rmones [or ower [m[ommw | (pmbos/cm) [man | TTiammers ooww Jamsse[[more o[reessas oswosso|| "Range of Armionia 14 measurements was measured on (ptoeomlpeedrastaumrpel,espHfraonmdtdhiess3orlevpeldicoaxtyesge(nd)ayan7d) u2simnegasaunrOermieonnts29(c0oAndaucmtmiovinriya) 000507 10 USFW 1083 St J RATS SOILERIN rl Rela Surface Water Samples From the Dry Run Creek Site Conducted From June 12 through 19, 1997 [femo f TT we retew TTeOirganwimsm (mmg) [omoomms TDreeve[ Tw wo [enw]| 5TTT eerm |ww oTn ow] [T 0 omerm 0aTn ous] "Forty-five organisms were exposed per concentration. 3 000508 USFW 1084 DRT RRUONYCA FR.EWEEKSCTHOT RNO.NIINCC.S Appendix A: Chain-of-Custody and Traffic Information 000509 USFW 1085 Hh EI | o ~ S22& F(YINUITnlf | p[H I Ag TIE TH FTINTRI ell: Era La NL || . iil =! k H 1 E3 frIelln iiif 1L iE : : Iao, [1 SLR[LLL eS 1A sloflsi / es Sls ii:is 2133kSE | 3 cot BI or To 583 oe: A IIIT Ss 283 Ell E# G 98 3 5 usFw toss LIFSEs iN FRU FITEaE LE | o 253 [HINTTTAE || Ee TRI 8 i | RINTAT) ee A 5|c8 2 TMM i JT \ =i ll ] H ff FE HA 3 i gid[TTL sec 2 JF323 AEN eg ad IIT li g SE: ol TH N iil 2) 5 N lig ge 1 $53 a USFW 1087 Ness: = B11 * =H "H3I(TIT NITITT IIIUAAE,E(L| |eEH aA FTIITIL i INTTIT fete| 28olga E[i oT mM, <|&) al a sate ALL [RHINITIS JTTr it Jl[Ne RTT 3 ] Hi ad [ETN ge 3 gel) 2 3 ll i: Ell 1H A LL iS N Bh ISIE TI a] USFW 1088 Nissan 3 DRTY RRUA NOCYFR.EWpEEXSaCTHORNmO.NIINCC.S i Appendix B: Pimephales promelas Test Data - 000513 USFW 1089 Environmental Science & Engineering, Inc. Aquatic Toxicology Laboratory Gainesville, Florida Page: ESE QA Form No.: 621 Effective: FEB 1993 "SUBTECT: WATER HARDNESS WORKSHEET fSgpeosntsosru:bstaRnOcYe:F.iWrEfiSeTOWNA Project Number: test species: _2P4.9_1p2rm3e2la-sO|CO30 | ci = [Data by: Clair wo Date: _lrzlan Time: lea [W--o_r--marity of EDTA Titrant: _ oo-- m --| { correction Factor (based on standardization of EDTA Titrant): _0.93 rr | I T [tnitial | Final | Total | Toman 1 | coTnesct'n | Vsoalmupmlee || Ditluote | RBeuadrientg | ReBaudrientg| | TiUtsreadnt | HA(RmDgN/ELS)S {I f (units)| (mL) feet Too (mL) fj (mu) |=loo fonbaal i (mL) ; (mL) i{ [corrected] we | J [| zo [oe | = [oo [et | es || 10 [oslee|=Too[en Ter | oo = | mle I |I =Ti oo Tne [ Two! Iwa|| Pjfio eezeois 1leieo[Tf ==TTf oooe[[wToew iTor Tne ||i an we |] | Ir {rr rr Tr ir x r |i1 i{ rf|| I i i| i| i | Frrrr TI T ! { 1| i | | | | | rrr I fi i i i I | f -- f calculation of Total Hardness (mg/L as Cac03): A x B x 1,000 / mL Sample | "here AB == mmLg oCfacoT3itreaqnuti,valanednt to 1.00 mL EDTA Titrant USFW 1090 ! (1 mg CaC03 = 1 mL EDTA Titrant) { Total Hardness x Correction Factor = (corrected) Total Haraness 000514 | AEqnuvaitriocnmTeontxailcolSocgieyncLeabo&raEtnogirnyeering, Inc. ESE QA Form NumPbaeger:: 020 Effective: MAR 1993 Gainesville, Florida -- SomsECT: WATER ALKALINITY WORKSHEET | [sponsors _ --t._ weston) Project Number: A310p7r2o3me2la-eOlov3iev}I Test Substance: joaDattea BByY:: Pmooo Fes Wotev pate: Test Species: [ __leefl2[an TTRimEe: __leGe MSe { Normality of H2s04 (Sulfuric Acid): O.oz Correction Factor (based on standardization of H2504 titrant): 1,02 b cToeosstts1 | sampre |T Dilute |I IBniutrieatl | RFienaadlinBgur(enit) | pitrant | Al`kTaoltianlity (mg/L as {| (udneiftisn)e|| Vo(lauL)me (TmoL) ---- Read(miLn)g 4.5To|pH4.2 yc (UasLe)d | cacos) | FFoeoseTrTeieeee IT| ===TTloeooeoJJJoaeans[ll=-=TLLwoeaaallTuieees || CIik oliii e I|! :eo i| G3 | 3 d| |i e F o | Tl = oe ol|er s --r Ll oe|| us rr r1 r b r] T rr calculation of Total Alkalinities > 20 mg/L as CacO3: | Total Alkalinity = ----B x--N--x --50,--000---- =L sample , where B= NI mhLortmiattriattyedof acid | i f| omoottear1 p alxaliT noiftyToTotaltxalcorA=rlexcatliionnitiFI eascto<r2=0 m(gcc/ooLrrrreeaccstteeCdda))c0T3To:o"ttaall AMY Al0ka0l5Cin1iYtSy -- CalculaotiT f Total Alkalinity = --(2--8---C)a--Lx--sNa--mxpl--e50--,0--00-- , where B = = tpoHta4l.5mL total mw titrant eitrant o | toy | | USFW 1091 N = PnHorm4a.2lity of acid Aquatic Toxicology Department ESE QA Form Number: 106 [o owesromoonw c ormoonove ens] `est Substance: Suyfmio h/Adex Project Number: 2 oo] [Co Jfaume[iears|] ocon foonseJ[oorweosc|| meceeree | [[2Jietne[oitee]] ewooe|[66s5 oorrseomc|[aprecog p]| Ce Jdubueofieoe| vo T|e6s TTeoeens|prs | ErLoaTreeeTroes E Towne Toue [5JJuuel[ioene|| woeo|| 0635 JTooivcrnocc||ppeomrpe]| [DeJTuitee T[oere|] mee || 0bs TToowmnee]|paoireg]| : eeL-- T ennT Po) CT TT Tr T1 T] T CT T ] 1 C Cr TT111] r EE T T 1 T] SET E tTE --1i--c -_ TT ] USFW 1092 -- Environmental Science & Engineering, Inc. AmeTosiepleTa Project: 31972ic3o 2Ii:e DAILY10G { Page: __ BE OR festive: APR 1993 en emmy Loe ol ee Soa deen popoe re | | peclomeded do des) pros 4 rece 24 bos oll. i peomales Sly Shon eA pilots ' | C1 ms ged op do ponies ciedeloh | | Giza mo dosh solabens ; moored a obzerved) lots Cele ani 24, mee 2sieoC Berd | | iimme Gedib bens cefen deedduke| | | reads e244 Leew. 263C. foseh 1 histones dest seloleenys rendered sbsenseDdssh CU cells ea Meo ees 252C. Cag) | lian moo deb gefebeens. meoed 4 ob bs | 1 ceeds con e243, ex: 2S7% Based ! | Le on ois x clu irs wee gly anded for I od piles de bo selenide lo ior (alates | re > 9 mall) | Lehn moe cowed) deh sobobums; mandorel ercQ desl. | | pduid for goersedsaden, Dao eso Clif mn eh iereco pd |_elifan eno = anael) dmb solobions ; cdinied Ln om oEDo Monel rondt mans 24, x: 253% Rear i | USFW 1093 1 Environmental Science & Engineering, Inc. Aquatic Toxicology Laboratory Gainesville, Florida Project: 3197232 010-3 0s Page: ___ ESE QA Form Number: 018 Effective: APR 1993 _ |fi tepdnleespdot opel | et vetvewowy, [mleos covedomyom maven cir og| ita] ===| [se ire Con y | I ce oe ee ea . b EP e eaS e e -- LL seer ew F [e 0 zoey e 0 033 r 0 1| [climbsoonestospmesel fon cen, td| tied 00 0 000 00000 0 i f |1 -- k 1 000518 | L _ USFW 1094 Environmental Science & Engineering, Inc. AGaqiunaetsivcilTloex,icFolloorgiydaLaboratory Page: EFFECTIVOEA: FOJRAMN: 190f | SUBJECT: FATHEAD MINNOW SHORT-TERM CHRONIC TOXICITY TEST sponsor: Roy E. Weston !| mest serum: Qicfae Wake PROJECT NUMBER: 3197232 00D 31 TEST SPECIES: Pimephales prome: ri r -= ANIMAL HISTORY | SOURCE OF LARVAE: _ Flevida Grasso | LarvAE 107 NO.: __ 47-42. SEE PAGE No.: T8 OF ANIMAL RECEIPT LOG DATE OF HATCH: _.li2fa9 CONDITION OF LARVAE: mov | SEE PAGE No.: Yl _ OF FISH HOLDING LOG FOR RAW DATA ON LARVAE HISTOF TEST CONDITIONS || TDIEASMTETCEORN:TAI1N0E0Rmn [|TREESTTGHTS:OLUTION[v[oTrELSuTMEC:HAMBER [OTLESUTMES:OLUTION [cToEmSpTosCToTNI:C | mETGHT: 50 mm ~ de. So mt Pr GLASS | PROTOCOL: pap)iecly.aifooz. TYPE LIGHTING:ff,mescant PHOTOPERTOD: !&5- | DILUTION WATER: modirabely Word Recomshvied water EFFLUENT DATA FOUND ON PAGE NO.: (S| _ OF EFFLUENT LOG | TEST SOLUTIONS SPLIT INTO 3 EQUAL AMOUNTS ircsiesiell 28 Pl Pl Navi Fo) Bd | TEsT concentration | con- | eh [eet [eet | oot | emt | voLumMe oF EfPLEERE ADDED ( mi ) pind S22| 7se| so| 7se| 150 VOLUME OF DILUTION WATER ( mC ) ase| -- | ADDITIONAL COMMENTS: __oeterkedl DATA RECORDED BY: FORM: FHMCHR1 ono - bate: _ Gli2fan -- USFW 1095 -- -- 000519 Amine pe a BE ---- . [summers [2 cles _ SHORT-TERM CHRONIC TOXICITYTEST 1] f sponsor: BY FE. wegon) mest subseance: Lo mmmtin" " or Day: o Project Number: 3147232 -0lpo-300|D -- -- Flot]Toeere] wee|Fru(371)|[==a ] e| [fzeatmentT ] [Mive TV)wNee vl|old |sNeevjolld]| ae Neew |JwNewjo--ia1| [Cou] He ER FE] El 3 om rm Floogre f21s er IvJ1o1] =] food, [21w[v [Js | 200 [seal=] Cees LeIW ETT MEoodr [ C3 T FES AeV o oe TaeTo2 T loots [2sIW Toy[= I-- ~ EE CI 0 ores VA loots [21s[0 Twa TeaT=T gerus= fan]= | 205 EleTo BOTTT= oye][=] ele Tw JIT oT | Ere Ee ee] | 20g [21s[Tn] 1 | LC ere TT pDlL TT TTT 1 eee L__ fel [| TTTTT------+T11% L [rise fo | pate: -- Gay Tine: _|STO | fiComments : I [Recorded by: [OrMieont2e6r0:8 | vMseit-e5r7: Date: Zlel Recorded by: SMeate3r: Raeet~eumres Mretsesr: | { 2r o -- -- 000520 BE Err [some p peprovate, e _smons rtoms conic soxiciny seer] sponsors Bay F. WEE) reac substance: Surfae Weber | pay: 1 Project Number: 4a1232 -olve iow | + rmTee[ln7 Pt1 atne|[oensenn]|t_n_ eva|[Rmeal/Am|)|c7on0a (um||hBTeeohmops(l0d)1|| od PlsToI-1 =[7 1-1] L leo LITT= 11-) Moe ls|o Tarlo fstfon[= Foch] - EE ----n = Moore --1= [21s[2Taslar foulo l=Teoclour] oer Ps[wo IT =T [-T- (oot [ore STEE] { A I leTo Felelehel=lobe felis | [=== = [=1= [ 100, GlsTo Tole = lela] | sons lw ed=o T_T} ES esmor = e 1-1] EEE fools[od rrr 71} Fr rT 1s 2 $4290A De-l = Ss |& jooosRl RRS coed peel ME miner Sn mar | 2 ammo oR ---- [eee e eer e] Day: z Project Number: 3141232 --Olco-3 100 | + P[PrreJ a4t[Pamaliteveen]jotbs|erv|N T e [oila |w N[Peo w(m[g/oLl)||d cone (umhos)||THeemwpjor(e0') || p|[ r FFrL5e[EforEoleSasfree[eao] = = =[r pails] EEE NMolewlE PeeTo 1leI feorya=fTealoes] F[> or fPeeeTLoo TT ale fe o = TTeoel]] |=CfEeeTT TE To ET=e T=] Msoors [ PleoTolL efeohrl= = e Teal] Mo,ll DEeTPo fefIelmala = Tol] 4 IE erem To eo ==] | NE E E r r Tr rr r 1 [ooosze fcomments: Io ee [Recorded by|: Jeter: Heter: ee Meter: Jee || z AnkeTepe EefoactBRiEve: oocetober 1989 [su~msumsaeEcr: PDoeceotrclses sSsHoOrRTr-rTeEmRsMcCoHRnONiIcCsToxmiecrInTyymTEeSsTt |] | sponsor: Zoy EF. WeSma) pay: 2 mest substance: Sufi Walt | Project Number: Z147232-000-3100 | + irrrentmens[r7er Pal+ve onsen |T_meps8T5ira [p[o R(SmeH/L|)|cond0(bum"hos)|| T2e2mp20(10||2) foe] [ee[o -T_[- --T[- -TT| | 100% Pl To ToedosJoefu[=loceloe] loo PlslwTTT 0-T = T-[-] |= Tere To Torre = 1-1-1 [ 10% PlsTo Talo falel= Lochs] Cmbmpritenoe --_-- Fioog [21sToTa afafn Sia] = -- slo] Sabon els[=] I CEs |=[=== | looy, [>Tio Toetoe faz Je fos | = loeslone] Sst Sle ell ene) E> elsfan[==T=T= -T [-1-1 | love, PTs] lolol] = eho] |pprpfef= -T-1 -- [- 1-1 A rrr 1 A An 8 i fe T1 1 z comments: [recorded by|:reser: "reer: | Meter: | meters zg Fe: oe| eeeere reer wie | ---- hee 560523 Aqyacic Torteoleny Dejarcaint : sponsor: Roy F. WESN) EffoenctBi2ve8: october 1585 mest substance: brie Wader ] Day: 4 Project Number: 3(47232 -Ol3jo0 | + fi r~ roataent[[r'Fep[]na4iveT JobI ser|ywew"orapn [JRooew(mSg/iLa) T | nd_(umhos) Nel | "Temp (0)| [Coho | ig, Codsey | Co|ser Pls[eFo eolus|f= ooTolon] Po Tog [T= [| CEI II I I = [21 [nfholafos hol -- Tooled] ple TeTT =T oT ls[oI =T] T] [le[eotnafoofeafol= oseloed] lsIe To =T T | og Pleo Tolar Toifa | = asaleo) oogrpifus [=I=LTTT = 1-1-1 Fog, [2le[0 al fechi| = level |sosy Plafeed =f-T-= T- T_T T} Poy PlsTr ffudocho = Lohal | cor ffs[~T-T-T-=TT-_1T"} errrrrr pte IFT FT 1 8 fcomments: Recorded by:|| Metenearn:a || meMtSSer: Meptaer: | meter: z [000524 REET ANT Dever elm nine: _uco | % L SURTE:CT: 1 proralay sponsor: RoY Fu WESTIN pay: 5 SHORI-TERN CHRONIC TOXICITY Toor 1 test substance: _Surface Wade 4| project Numwer: 347232-03b0D> | a - 'reatment Alive observ| New |Old New [01d New New [01a J [ PlsTe alms feloe| -- [orf] |Conte flo [= ToT T=1 17.1 LL CNNE I IEEIE ES | ot Polo [eo Tiefeofow lool = Toco| | oor [2sTeTT =T 177] II EE ES Foo | sear [2TeToedlre [sofen [an| els Tow [TTT TT -- [oolou] --"T-T_1 | H ; ee] Prof, [21sTo JogJoiJon J[ as = [mel | | ody IE EEE yy ! Sl RyAN[== 1&9, | Jel fo] = Jmcla] | 2057 Fleet T_T TT T] - delafo TT blood, 2le [oeBolofeeb -- Fuh] [moe 2s[=TT 1 -- T 1-1] --! / | Eee 1 | s Lf |TT TT 1 71% i| E braitnee::e "T"ooies ||| RbeaMtcesetoa:errrd:eed||yCMr"eta 5mer:mo----Mtre--eitme--er::----_oneMoe:ter: z |aS I 000525 Ante Tego ree re = 2 -ober 1989 . sponsor: Rey . wWesTm fpay: bb Test Substance: Gtr Water { project numver: 24232 -cloo--3100 | 7 Rete =e el ml | |(cS[lESePIPry YoS Eo SEYPPr Pey II 1o-osy1p]y AloRrs Plrs E1EIl 0 SN PMoRoOtS EPXuIN FreeYd[E inJeefoe[ar|y = Tous] Mcalol og FPlEs[AA E=Jmfee foufon| = Teilo=ne] P| sRAoTTn T lefe I T TF T 1-1] EEE oer| IE = | Mooty,al CPlBs|r=o aEE [feefoelee] = Teese] |e PsTo fT TT =] I 3 ta | Eee I I. 1000526 [53te ia [Recorded By: mm -- |I [tiusm e le atr e: olin mime: iy |S EARS SEs - sponsors RW eyTE o ST mest substance: CieWar | bays TT project numer: 2H1232-000310D | + |I rreatment| + [mive-- obsJ|Neeewr[oevld|P|Neewnpiaa |[iNeeow o [|| aMewrord a|| | un] Bnlwn|food|==[=aa[] =fen| 3=c0 [Toes] T-T-] |[oomr Pee |= =f las --o Jes r = eas [m |=[w]d] | 207 Elsi -1-1-1- [-1-] [ oo lor PloTo [oe[= [ TTolofe= rT] o- so= [T=-TD-om1e] FL oot e PleeodI=lal=e| s=o T1oTloee] | S047 Plslo I-11 = [-[-1 LL | oot CFlFa TEo E Ifalle] I ssc [lel 2oET lofod |=[= [1= 1-1] 07% pug Ts To PlsIs [fos[fo] eo| lad] ET =T T=] {2 Perero =r = 1-1 | rrr rr | fF er rT r T ds iL bate: Jako [| Recorded bhy:i-- Ta| @ 5; 2343 u2t2 [83 E8 E5E. SHuEEEgEEH Fs ESE | SR | s2 E l 5of dEqE53 R 5FEIERFEe efgfs -- SEns| 48 - osBellgeiEd|loEg[PE Fs of "vl = vlzez] =| =||v vvw | ElgE, | F E55 [_c &aglFsE|2 T2E2 i5Pr || |= eo of o2 fCdaluYl oo~f]+ S| Sv vel FS]wl] \ of EE sw 2FE= EnSzE gl < | 5S238 EE EEaE E E oHl ZE | E RE ESERS ERY E HE3 Egll 255 | %2 =HslEaNy llEe&2tEa| E2 E9 RBElEglEalREBEEoRE8CBf =SEEfEy eo (dedddsy | | 827 | S| S| | | o| 8 S| of 6] 4] EEE TE EEE : 3 |Z[4 28 Joly <| | o| f 9 V|< Q E g5 [8=]| 5E2& 3 s#z3 || E56 EBEsEs 2g "sl os] oe eldof %3 g El 1 Z| 83 S ovsl8 3B] 883 a [EEEE = 23 . USFW 1104 2 ig g Sea SEEEEEIE|.ER Ez g 5. [ade 22 FY | BE SE1|53 o|'SGeEs-| 54E8E.5= |P[ETExE EE[EoEzCLsgE| =58- B22 gE | |EB|egsEsE || Ex= EE fFeE |E8E. t 2228 | Z| of EE 23f9a9 l|lisE2sl al| lo | B 22E 3 9 9. > " 7 5 3 P|| 39 3 g do 9 | 9 9 of of rf v| ov a oo ol o God ul SS gu eggs ol of 7 &l Ya =S| ooff osfl o9o %9Gl JE8 Ezzz || u22 " Sloss. | 8 3 EE ER B: Y ldJ [ 53E SS||2 S| E3 o| g| 4 o|f S 0 3E14 : FERRER E 88 Eeld T |] B3E5Y E5EEkE Es |]gOE) 1: 1 hv2o o2y|b] dWglw doh 23 GEE E = 2) = = 8 g g = : | : i ! TTL + USFW 1105 SpinyonCog Weston/Dry Run Creek - 2.prong suv P. promelas survival ANOVA TABLE wo el2s5s]ln Combel vs. Rares source oF setween 1 Within (Error) 4 total 5 ss 0.007 0.036 0.043 us F 0.007 0.731 0.005 CSirnicteicalF<F Cvrailtuieca=l F7.7F1AIL (T0O.0R5,E1J,E4C)T Ho: All equal Weston/Dry Run Creek - P. promelas survival File: wpps Transform: NO TRANSFORM EQUAL VARIANCE t-TEST - TABLE 1 OF 2 Ho: Control Treatment ROUP IDENTIFICATION MERN `TRANSFORMED MEOARNIGCIANLACLULUANTIETDS I~N T STAT SIG 23 203 (reCfoernecnrcoe)l 0.0.583603 00.896330 0.855 2 sample t table value = 2.13 (1 Tailed Value, P=0.05, df=4,1) UNEQUAL VARIANCE t-TEST Ho:Control <Treatment ROUP IDENTIFICATION TRANMSEFAONRMED MEOARNIGCIANLACLULUANTIETDSI~N T STAT SIG 12 203 (refeCroenntczeo)l 0.i983630 00..856330 0.855 2 sample t table value = 2.35 (1 Tailed Value, P=0.05, df=3,1) eilset:onw/oroys Run CreeTrkan-sfPo.rmp:romNeOlaTsRANsSuFrOviRvMal EQUAL VARIANCE -TEST - TABLE 2 OF 2 ROUP IDENTIFICATION RNEUPMSOF M(iInNimOuRImG.SigUNIDTiSf)f 12 203 (reCfeornetnrcoe)l 33 0.166 UNEQUAL VARIANCE t-TEST USFW 1106 Ho:Control Treatment C%ONofTROL DsIhFoFwERCEONNCTEROL 17.9 oT 0.067 Ho: Control<Treatment 000530 vp IDENTIFICATION NRUEMPSOF MiiNnimORuImG.SiUgNIDTiSf)f %COoNfTROL DIFFROFMERCEONNCTEROL 21 203 (recfeornetnrcoe)l 33 0.183 15.7 0.067 - 000531 USFW 1107 "Wielset:onw/pDprsy Run CreTerkan-sfPo.rmp:romAeRlCasSINsEu(rSvQiUvAaRlE ROOT(Y)) ANOVA TABLE 25 mo ost gore _ourcE DF etween 4 Within (Error) 10 otal 1 ss 0.652 0.086 0.778 us F 0.173 20.182 0.008 SCirnicteicalF F> vCrailtuieca=l F3.4R8EJECT(0.0H5o,:4,A1l0)l equal FWielset:onw/pDprsy Run CreeTkran-sfPo.rmp:romAeRlCaSsINsEur(vSiQvUaAlRE ROOT(Y)) . DUNNETT'S TEST - TABLE 1 OF 2 Ho:Control<Treatment WT 0UPT . 23 35 IDENTIFICATION Reference (203) 220041 220068 `TRAMNESAFNORMED 11.3241s0 10l8s6a71 leds MEAONRIGCIANLACLULAUTNIETDS IN T STAT SIG 00..585633 0.1.508000 1.000 -31..085378 3a.l0s5a7 + Dunnett table value = 2.47 (1 Tailed Value, P=0.05, df=10,4) "eston/Dry Run Creek - P. promelas survival ile: wpps Transform: ARC SINE(SQUARE ROOT(Y)) DUNNETT'S TEST - TABLE 2 OF 2 Ho:Control<Treatment SROUP IDENTIFICATION RNEUPMSOF M(iInNimORuImG.SigUNIDTiSf)f C%ONofTROL FDRIOFMFERCEONNCTEROL 21 Reference (22030)0 3 3 33 220045 53 5 206 3 00..114466 11770.00 -000.103870 001114466 11770000 00..123873 000532 USFW 1108 `eston/Dry "ile: wppg Run CreTerkans-foPr.m:proNmOelTaRsANSdFryORwMeAiTgIhOtN spiro - Wilk's test for normality wo of28 lan >= 0.008 i= 0.970 rFitiEcalIW ((pp=o o0.l0o5n) ((nn== 1258)) == 00..888315 Jata PASS normality test at P=0.01 level. Continue analysis. J"ielset:onw/pDprgy Run CreTerkans-foPr.m.proNmOelTaRsANSdFryORMweAiTgIhOtN lialrctuileactte'sd tBIeststfaotristhiocmog=eneit3y.04of variance aibbllee CChhii--ssqquuaarree vvaalluuee = = 135..2285 ((aallpphhaa = = 0.01, 0.05, df df = = 4) 4) - ca PASS BI homogeneity test at 0.01 level. Continue analysis. ~ ~ - TT - 000533 USFW 1109 Wielset:onw/pDprgy Run CreeTkran-sfPo.rmp:romNeOlaTsRANdSrFyOwReMiAgThItON ANOVA TABLE _ovrez oF ss ctween i aloo within (Error) 10 0.008 otal 1 0.011 ol2st wo oe oe ns r 0001 0.748 0.001 or or Critical F value = 3.48 (0.05,4,10) Since F < Critical F FAIL TO REJECT Ho: All equal wteisetogna/Dersy Run CreeTkran-sfPo.rnp:romNeolaTsRAdNrSyFOwReMiAgThItON DUNNETT'S TEST - TABLE 1 OF2 Ho: Control<Treatnent UP IDENTIFICATION TRAVNESRFNORMED| MEOARNIGCIANLACLULAUNTIETDS|IN T STAT SIG 1 Reference (203) C2:3 223000ss1 : Soe sinner: table value = 3.47 0.417 0.417 0.000...344351180707 00.0..334581077 01F..25o5030 0.410 0.278 (i Tailed Value, Peo 05, af-10,4) saHesttonv/eDrrey Run CreeTkran-sfPo.rnp:romNeolaTsRANdrSyFOwReMiAgThItON DUNNETT'S TEST - TABLE 2 OF 2 Ko: Control<Treatment SOUP IDENTIFICATION RNEUPMSO|F M(iInNiOmRuImG.SigUNIDTiSf)f C%ONofTROL `PDRIOFNFECROENNTCREOL 2: 3 Reference (20230)0 33 Joi 3 00..005539 114.02 00..000300 :: JSooes 33 0.ol005s5s 1133 00..000277 00534 USFW 1110 DRp YRROUe NYCF.REWeEEKSCTTHORNO.N]IINCCS. Appendix C: Reference Toxicant Test Raw Data 000535 USFW 1111 Environmental Science& Engineering, Inc. Aquatic Toxicology Laboratory .eference Toxicant Control C CHRONIC RSpeefceireesn:cePiTmoexipchaanlte:sPportoamsesliausm chloride (KCI) Runby: TMMo Date: deo me oftk) =) off Test No. 20 19 18 1167 15 - 1134 2 11 190 87 6 5 4 3 2 1 Survival NOEC (mg/L) 500 500 500 550000 500 550000 500 500 550000 550000 500 500 500 500 500 500 Growth NOEC (mg/L) 500 500 500 550000 500 550000 500 500 550000 550000 500 500 500 500 500 500 Date Jung? Mar97 Jang7 D0Oecct9956 Sep JJuuligge Apr95 Mar96 FJaenbg9s6 DOcetcg8s5 Jugs Apras Febgs Octg4 Sep94 Aug94 Average NOEC(Surv) Two x Standard Dev. (SURV.) . ATvweorax gSetaNnOdEaCr(dGrDoewvt.h()G:ROW. 500 mgfL 0 mg/L 5000 mmgg/lLL. Note: Control chart is not available due to no deviations from average. - 000536 USFW 1112 EnviartoincmeTnotxailcolSocgiyencLeabo&raEtnogrinyeering, Inc. Page: EFFECTIVQEA: FOJRAMN: 1095913 AGaqiunesville, Florida SUBJECT: FATHEAD MINNOW SHORT-TERM CHRONIC TOXICITY TEST [TSponsor: (misc. rest EFFLUENT: Poh ssvm chloila | -- cre) PROJECT NUMBER: _ Rel TOX. | TEST SPECIES: Pimephales promelas | _ -- I -- N [SOURCE OF LARVAE: _Flewhe Gw nas e Ses sDATE OF HATCH: _c[otl | | Larvae ror wo.: 92-39 CONDITION OF LARVAE: Fem RECEIPT LOG { SEE PAGE No.: | ez pace ro.: 17 139 OF OF ANIMAL FISH HOLDING LOG FOR RAW DATA ON LARVAE HISTORY l Iozor conmamnen |IEST TEST SOLUTION CONDITIONS [TEST CHAMBER [TEST SOLUTION OLUME: l[cToESmTpocsoTnTTIAOTNN:ER| || HPDEIrIAoGMmHEoTTc:EoRL::50s1m003pmpm c[HuEI4G0HT:mem TYPElvLoIr3GuH4mT0EI:NmGL:n [oresien2d 50 PmHCOTOPERIOGDL:ATSSP[7CS || | | DILUTION ErriuENT WATER: aolpcadely ted DATA FOUND ON PAGE NO.: _---- Qaconsirholed der OF EFFLUENT 100 | I -- _---- | TEST SOLUTIONS SPLIT INTO 3_ EQUAL AMOUNTS | TES(Ta-CeOteNiCuEeNnTtR)ATIO(mNl) | TCORNO=L 52e| seo 2200| 4oT EE | [vorume | ADDED or ( mseess) uekenles--mck| NA 188 | 325| 75 $2| 3eo | {|pvooALTuEMRe o(eFmeDoIL))UTION L[PisTo sO b ||prreleedm s[=[0 L ] | | aoprrzonar comsenrs: __Kol Sheen: [0.09 Kd i (900 ob of od) pod econ rate J ) | DATA RECORDED BY: MO - pate: _b (0319 000537 | FORM: FHMCHRL USFW 1113 mI 0 BE mr NR [so~nsunBTeECTt: Ppprooemelless --__ssuwoorn-mmoemmsacmmmmoomuicrTooxzaeImTYmTEeSTr --] [sponsors _mm | pay: o ness substance: ee Project Number: _ Qef Tom | EER pF el l[elo ea lsTofI a] f- a 1o=e1f1r-" i7]] Le o Pree hateT Tw feoTul | 2s ET[5 ]sTo]HEI EETH = so [ElPeToPE 9TTTProTa = 1P0o | PCereToo e oe of e= TTaTal] BN C Cero I rae Ee { eee PPf leeloedT em = = [7] A eC5lRsTITISoNPE TPEoIer= oy= r CE e I Ir I --e or EET TTrE [000550 [r FR "s ai |nBeenea pMi yaemims e. ws |) 8 Aquatic Toxicology peparcent 2a -- TT Ee ap o "oonIEcT: f, promis S ShorrenCHRONICTOXICITYTEST | | sponsor: __Mhze: pays ___|_______ Test supstance: __KCO 1 project Numer:"efx | BlFe wcP O Ts l elmae eE r[oaro lI lEeeirlo]s] FLe PTSr T A eea r ee e leBdY] | = EE X e2EH --T] |J EorTeoaTe oole [oe otfos|S z=ee mu[r=a]] I| oo oPsrLoesal to = s[d1 || omr e P[Eeef Toe otloeo loeT [oe dr[oTtt | s=rer e o LlonsE loo|] I I CTx reoo TFre eeoa I meln = [Pl=S=] --| | E r r rrr r orr r r re r Tr, Comments: Recorvdeed by:| Mseateirn: || Moeotler: MSeotrerd: mreetesr: || U8s EER Lm ~ [emma Pps women monic soncry mer] | Sponsor: _miBec. Test Substance: xa] r[btowoes goF--[e5= ebl etT foT r[emroePro oFjeoctum Nlumsbe"r:col_ m ecTo@ omxoTo[f rmosoa]| | Fe]| |Pepedonfu we | ool | 1 = 1-1] L| o lleleeIlTo]o PiT pc=hhTe= l= e1TT= -a7l1 -e1] 250 [21s [[= ~[=| [| [=] I:P paeleo|I JeobL alI er = ee]1u-l1]] | see [2]. =To _ ee oo] EEEred i ra feuTae] ooo coe EleEETTTT [oclour] To I Eo 5Me = = | [Plo | ooo [o Jews[ols -- o |=n [od] LedIT T T T 107] -- FT [ | [-[- 1-1] FEE = | | ! [ | Ee | = L freL e Lfe|yTorImTe|TTT | Ee T [me b11= PL oos=e mp ee S See foe Rd e Wm ee paie: w weae mI aRE m--m o SORIECTT prprowelas EE en Dopomsors _poe. mest swstance: KCL | pay: 3 Project muver: ETE | pFf a[b7TaodevTeonorsero |senevjore sf [[neovicuhe r[ f a|]| a ovsee re l[ven neeaveds||] PRR FeEE eS - f leo PsaloobTaolloc-lTeeo0| uel _a=m_e 1o.wl]] etre rr-- r ES e reoafr ealite la] me m1ab=e]] ooo PaEfeelmloPal o ee = 1r-e1l-e1) LT e OpT e rr L TTE C e S p r rH r rr r Wr N r EP T TTr T e T t r TT 1% || r Er r rr r r rr Tg Comments: [Recorded by: | Meter: Meter: Meter: Meter: | 2 AquaticToxicology Deparement Gainesville, Florida Page: QA Form: 053 fsponsor: _mise. mest substance: xa pe [Ft en [rot Fol [= Timi| FpayC: n__)e_T]r_e4 a]pa1ve1ovs|e|vrevfoyoldnpr[o[jW0eecvtp(moN olrd |u | coQ m nwdefwb cmommxe on||) r wreewr: o1l0d]| ol [P2rse[ teoJPoT hofaT Tse T T7a7d] CNIT CS EN | EE et a ey | eso --r ele [eeTT I |. PEE wo | [= 1-T1-] e [2[0Jeolisfono [v0] 2=0 [reclun] |[ joco Ier lefot T& TT 7-= 7)i --T ECf2 e E--E = ES =a ] Ee | _ | 1] | rrr EET | -- elL | r [ | Hee Poose BEIR RET en ewe Lol [comments [TT 111711 | 2: ------ by: | Jase eid Jame Mess g mI PE -- [Toe ne sone wm] -- =-- | sponsors _mame me -------------------- mest swstance: _KCL | | bey: s ERR TR Project Number: fal Tox I A eX FX PSUR ElP=S|EIfraloo[wifas|E2Slo=acTouc] | FFree[releaelr ha e]a w=ole Shd o] | 250 TPerlerT efottofo =T=l = =T [[o-Io-]] 1s[ feosfetpa] Blele 11 mse [oefoun] = [-1-1 Lhe por fl -- [loJollet [sols 1a| pore 1] owe lous] | woo [P11 fwd I~ =] [-T-1 cr rrr rr Corrrrr rrrrT L e C rr rr rr IE I I | e C rr r rr r rr TLE 00; 0543 frriee!esefnrainy B tyTe rime: s L_uwiEs | AGaqiunaetsivcilTloex,icoFlloorgiydaDepartment oA Fpoargne:: Effective: O0c53tober 195s [ SUBIECT: Ppuwcles SHORT-TERM Toxiciry Ter | | pay: Project Number: __ @al { BC Jofate over] PF [00 (m|g con/d(aLmo) s) | Temp (0)| | [rcatnent) [hive[onserv] [PlsTe New [ola ola | evjold fealna| rev 206 [Newjoi|c Jourfour] [ Contel elslo -T-T-T-T7 717] peo [oe[0JoTTT T : EE leis]| ov] [ -- 1 [-]| EE { |=T=Ta Teel2e05s0f[peelouos] (eco Foe ere or | Eee | pL rT FC rrr 11 I Ey { el rTT T Ll [T J T TE 7 1s on pL | [| comments: [reconrdoed by:|| m_esatzesro:n || Mpeetter: sVeeteesr: fMeotser: | z > psi ee aRE Em _ [So~ mer PDoorroremelsos esmooRmT_TERMcCmHRoOnNIC rToOXdIeCInTtYmTEeSr T ]| EE aEE Sponsor: __DisC. gest Substance: __KCl [Tabor [ee PR pay: ___{ ProjectNumber: [i __Ref ox | esa P Pleoo I= la = fm]= = [1=] | l eeeooe e [he e= =l e TI=e oba] || pF eo Plla e eeo r ol m re = ==e 1r -1-e0s1] I | EP a fee IEEI = Ee feel = PE Tle] o e Se o e e ==] C EHrr A rr E | rr rr r Ll e Cr r rrr rrr r rr Lo |e pCr rr rr r rt rs | errr rr Ls El CES2EE2csEE43 |[EYg) Fs 13393 . > 5 $89{ COREE LZ5. al vl Eile FEE | 3 3 3 & gE = = 2x o| 9 9 ElsSE 5o| oo q 53 dq o| o| 9 BleEE lost 2E[1iE2E38E58E|| 5B[Ex.E Ha EErEeEs| [ELEx. x To2E8F | 2 gE 2F) E 5E~ | g=l) l 5 leses] 3&8a : 5| 2 w2Al vl v=lv| v7 v ) =| vl 7 I ZSENT F I Y EH E Y oyl o8 aofA F d8el aullaWl ogda3 2S| o|l d9| &<|58 9 9|9G QggE rE . } ;: :: 8 Ex | : zE=X <Se5BE%Rq =S | R | =f of 8 8 OofH Sof T& HY Sof e0 Agad YS 5 52% o| of o| S| of of of S| od s| ~ i g E| i BE L pd = [B|98E g gSE5 (5P|L5E8S || oSFk TBE PE #53E GcEaEg | VEi N= 7 ov < 3 2l3E9 ELEN TM] | 3 9 l= e |] : 13) of 088 93 :. of Vw . USFW 1122 -- EINALREPORT: TOXICITY ASSESSMENT OF SOIL SAMPLES FROM THE DRY RUN CREEK SITE WITH THE LUMBRICID EARTHWORM, EISENIA FOETIDA TESTGUIDELINE: EPA-600/3-88/029 EREPAREDFOR: Roy F. Weston Inc. GSA Raritan Depot P.O. Building 209 Annex (Bay F) - 2850 Woodbridge Avenue Edison, NJ 08837-3679 Phone: (908) 321-4200 Fax: (908) 321-4021 PERFORMINGLABORATORY: QST Environmental Inc. 404 SW 140th Terrace NewbPehornrey:, F(l3o5r2i)da33322.636391-83000 STUDYID: Roy F. Weston No. 3347-142-001-2273 QST No. 3197232:0100-3100 Jy 1997 0005477 USFW 1103 ory RpelxxiARaT[InVORt-- TE]STS EXECUTIVE SUMMARY hel il icity ss were conduc st QST Enviromental In. in Gainesville, Florida, ia he huma bricoiddeoarfrtrthheweoerrsmi,tsEyilsaeenntidasfwooeetrriedoas,ruotrnaoslanmapncldeosbcinoolslsceclutmseudwlfterioeomnwtephedoDinryt.eRuAxn CtrcleeokefSsifst.oeu.TAhseeir enyoe at pfeorrness(h=0r0 inevcssuwvasonf eEdriinsafnyofdeeswampelesh.eTBebrrswoerye 0cool sooiltsha0ondnthanetmfhpieeeldirreefvweirtehncoref iEsoairllfironmf.hosaimieplbe ssartmaptluieosn.t9h0Ae4.bfTrhae2rre 1yw4e-rcdeoynntoio. lsisghnlisfincnandt eidxiefpfroeersefenecresee toaneoawopromtesntwefroereslldeindhiescoumapmicnnfsor sNoicioonnise1s4 cepvatso deedriBvreoghheovt rve sstnfonpaetsotfe prsiucm.e.AdeFquraotenmEseofoxiidvisossswerweassebntitonCeaomxicseArsical! Somics for chemical ase 2 000548 uate DRY RUN CREEK EARRTOHYWFO.RWMETSETSOTNS OSTPROTECT B19T220103100 TABLE OF CONTENTS Sestion EXECUTIVE SUMMARY TABLE OF CONTENTS LIST OF TABLES LIST OF APPENDICES 10 INTRODUCTION 20 MATERIALS AND METHODS 21 TEST SAMPLES 22 TEST ORGANISMS 23 MOISTURE FRACTION DETERMINATION 24 WATER HOLDING CAPACITY DETERMINATION 22.65 HTOYXDIRCAITTIYOTNESOTFDSEOSILIGSNAMPLES 27 REFERENCE TOXICANT TEST 3.0 STATISTICAL ANALYSIS 40 RESULTS AND DISCUSSION 41 WHOLE SOIL TOXICITY TEST 42 REFERENCE TOXICANT TEST 50 CONCLUSION 6.0 REFERENCES Rage 2 3 4 4 5 5 9 9 n : n 3 000549 USFW 1125 Rov F. WESTON [DRY ROUSNTCPRREOETKECETAMRITTHTWOSR0M10T3E1S0TS0 LIST OF TABLES Rage Table 1 pToHxiVcailtuyeTsesotf WSoiitlhStahmeplLeusmbFrricoimdtEhearDtrhywoRrumn, CEriseeenkiaDfuoreirnigdaa 28-Day 13 Table? Percent Moisture Content of Soils From the Dry Run Creek Site Used in the 28-Day Toxicity Tests 14 Table3 CSurreveikvaSlioefDEuirsiennigaafo2e6r-iDdaayExTpooxisceidtytoTeSositl Samples From the Dry Run 15 Tabled GCrreoewkthSiotfe EDiusreinnigaf2o2e8r-dDaaEyxTpooxsiecdittyoTSeositl Samples From the Dry Run 1 LIST OF APPENDICES Appendix A: Chain-of-Cusiody and Traffic Information Appendix B: Eisenia foerida Soil Toxicity Test Raw Da Appendix C: Reference Toxican Test Raw Data 4 000550 USFW 1126 DRY RUN CREEX EARRToHvWeO.RwMeTsEtSoTnS ast PROTECT tsTzi030 1.0 INTRODUCTION `Whole soil toxicity tests were conducted at QST Environmental Inc. (Formerly Environmental Science & Engineering, Inc.) with soil samples collcted from the Dry Run Creek Site to determine. the relative toxicity and bioaccumulation potentialofthe constituentsinthe test samples. The test organism used for soil tests was the lumbricid earthworm, Eiseniafoerida. The effect criteria for the toxicity tests were survival and bioaccumulation potential. Growth was also measured as wet weight in milligrams. The tests were conducted following a modified ASTM GuidelineE 1676-95 entitled Standard Guidefor Conducring a Laboratory Soil Toxiciy Test With Lumbricid Earthworm Eiseniafoetida, a `modified EPA guideline EPA/600/3-88/029 entitled Protocolsfor Short Term Screening of Hazardous Waste Sites. Roy F. Weston, Inc. protocols, and QST in-house standard operating procedures. All of the original raw data pertaining to this study are maintained at QST, 404 SW 140h Terrace, Newberry, Florida 32669-3000. 2.0 MATEARNIDMAETLHOSDS 21 TEST SAMPLES . Test soils were collected as grab samples from the Dry Run Creek Site by Roy F. Weston, Inc personnel on June 12. 1997, and were received at the QST laboratory on June 13, 1997. The test . samples, identified as 900, 901, 902, 903 and 904 (reference), were collected from Area I, Area I, Area lll, Area IV and the reference area. respectively. Samples were received in quantities of approximately S gallons each ina five gallon pail. Upon receipt, the pails were opened and the contents checked against the chain-of-custody sheets to ensure that all the recorded samples were present. The temperatureofthe samples was then measured. Any observations made during the sample receipt and log-in operations were recorded in the sample receipt logbook. Chain-ofcustody and other traffic information peraining (0 the samples are presented in Appendix A. s 000551 USFW 1127 DRY RUN CREEK EARRTOHYWFO.RWMETSETSOTNS QT PROTECT iTS0103100 Caboraory control soil fo the carhworm bioassays was pest (Alachua County Feed and Seed Store, Gainesville, anificial soil comprising FL), 20% kaoline clay. 10% and sphagnum T0% grade 7us0esdiliicnathseantdox(icbiottyhefsrto.m AFlelldssapmaprleCosrwpeorraetisotonr.edEdignara,reFLf)r.igTewraotaoltrab4ora+to2ryCcopnrtiroorl soiulssewearnde during the testing period. The tests were initiated on June 16, 1997, witin 3 days of sample receipt. 22 The TEST ORGANISMS earthworms, E. foerida, used in the toxicity test were obtained from Carolina Biological `wSeuipgphliynCgobmepcawneeyn(3Bu0r0l-ngSi0o0n,mgNoeratchh,Caarnoldinfau)l.ly Tlhicellteastteoartgtaensitsnmisawceorne. >Al60ordgaaynoilsdmsadwuelrse. obiained from the same culture. The supplier's breeding and holding conditions were similar (0 those of the testing conditions therefore, the earthworms were held <24 hours prior use in the toxicity ests. 23 Upon MOISTURE FRACTION DETERMINATION receipt of the soil samples, 3 20 gram sub-sample of each ste, reference, and laboratory contr soil was removed from the receiving container and placed in a dried, preweighed. umbered aluminum pan. The sub-sample was dried in a Blue-M oven at100C for approximately The fina cry weight (x) was subtracted from the initial wet weight 3) of the sub-sample 24 hours. 2nd divided by the subsample weight (20 grams) to obtain the moisture fraction of the soil (equation: y-x grams/20 grams) 24 WATER HOLDING Subsamples (10 grams) of the CAPACITY dry soil were DETERMINATION placed in a 30 mi beaker, and an equal weight of deionized water wafsunandedledanadndevmeinxlyedhyidnrtoataedsrwriyt.h dAeiocnriezpeedpwaapteerr.fiTlehre, wfeoildgehdt ionftothqeuafrutnenresl, awnads placed ina plastic hydrated paper was measured (x grams). The funnel was then set on a beaker and the soil slurry poured ino the funnel; a minimal amount of deionized water was used to lightly rinse any remaining soil from the beaker and sti rod. Aluminum foil was placed over the funnel and the. 6 USFW 1128 000552 DRY RUN CREEKEARTROHYWOFR.WMETSETSOTSN. - QT PROIECT PI2R01003100 stem was allowed to drain for approximately 3 hours at room temperature. The final weight of he funnel was measured (y grams) and the water holding capacity was determined (equation: x grams -y grams). 25 HYDRATION OF SOILS Test soils were hydrated to 75 percent of their water holding capacity with deionized water prior to use in the toxicity tests. The amount of deionized water added to each individual test soil was determined according to the following equation: Hydration water 10be added (mL/100 g) = THW - EHW TPHHYWD(txoa(lPhAySdrxatWioHnCw,ate+r d(ePsiWrSedx, mL/100 WHC,)] 8) = EHW (PAS (existing x MF) +hyd(rPatWiSonx water, ME)] mL/100 x 100 8) = wPhAeSre=PpHroYpDort=iopnroopfoarntiifoincioaf shoyidlriantitoesntrseoqilui(ree.gd.(c.0g..5)0.75) WPWHSC,= =prwoaptoerrtihoonlodfinwgasctaepascaimtyploef(tdhieluatritoifni)ciianl tshoeilteisntmsLoi/l100 WHC, MF, = =mowiastteurrehoflrdacitnigoncaopfactihteyaorfdftichiltesstoisample in mL/100 g ME, = moisture fraction of the test sample: Soil samples with excess moisture content were allowed (0 air-dry at foo temperature prior (0 use in the toxicity ests. 26 TOXICITY TEST DESIGN The Eiseniafoerida ests were 14-day survival bioassays with an additional 14-day exposure for bioaccumulation potential determination using tes sols rom the Dry Run Creek Site sample sarions referenced above. The sit, reference, and laboratory control soils were used without dilution. Approximately 2.500 grams ofa thoroughly homogenized soil, hydrated to 75 percent of its water holding capacity. were placed into each of three replicate test chambers labeled replicate A. Band ). The test chambers used were 3.78 L glass jas covered with a plastic sheet with air 5 000553 USFW 1129 [DRY RUN CREEK EARRToHvWOFRWMETSETSOTNS QT PROIECT MTR0I3I00 orarnedsoommlytospeltectaeldl,owwefiogrheaidr,eaxncdhalnogaed.edToonintiotpiatoeftehaecthesrtesp,liacpaptreotxeismt,atfeiellyd 1r3ef0ereeancre,woorlmabwoerarteory coobnsterrovlesdoifloran2d4 ahloluorwsedfotroabnuyrruonwu:suianltobtehheavsoiiolr. T(ch.ge. wloarckmosfibnuerarcohwienxgp,osiunraectjiavrewpeorsteutreheonn scuornfdauccet)eadndapraothoomlotgeimcpaelrastyumrpet,o2m0s +(.2.Ch.emwoirtthhaagdianigl.y pshwoeltloipnegr,ioedloonfgcaotinotni)n.uTouhse leasbtosrawteorrey SAuumpicnoactoinotnin(u5o2u0sLtuexm)p.erTaetsutreteOmpOeraFnrienwoa3stmeemapseurraetudrceocnotinnzuoolujsalry cboyntpalianciinngg 2th0e0pgrroabmesooffa yordrcaontterdolcosnotilrowlitsohil.25SmoiLl poHf dweaisonmizeeadsuwraetderonfodr3ay00miannudtedsa.y2T8hebypHevweanslythmeinximnegasSurgerdamussionfgtaesnt Orion SA 290 pH meter equipped with an Orion 91-57 wiode. nt 7-day intervals, the coniens of each replicate chamber were empiicd ono glass pan ( observe hanedmoernruhmaegriantge, tshweeltleistngo,rgaanndisemlso.ngaTthieonw.oTrhmespwreerseenccoeuonfteedggasndanodboserryveodunfgoirnmotrhaelitetsyt,s soils was iismoulnuotsed(.e.gE.arttohucwhorwmisthwearsemcaolnssipdateurleadattotbhee daentaedriiofrtehnedy).diTdhneotsorielsspwoenrde10r.e3hygdernattleedm,ecwhhaennical nweecreessnaorty,ferdetduurrniendg ttohethienietisatl c1h3admabyesrso.f atensdtitnhge, whoowremvserr,eloonaddeadyon14(0appopfrotxhiemastiel.lyT2e1stgorragmasniofsms aged. ground alfalfa pellets (Alachua County Feed and Seed Store, Gainesville, FL) were added to each replicate test, ied reference, 2nd laboratory control chamber following organism observation O"Tnhedoaryga26n.isalmsoirngeaancihsmrsepwliecraeterweemroevecdlefarnoedm ahnedtkesetptchoanmbweertsf,ilotebrsepravpeedr,icnoZuinptleodc.?anbdagwseifgohred. approximately 24 hours purge their gut contents. Acfhteemricdaelpuarnaatliyosens,.thTesetarotrhgwaonirsmmsswferroemperaepcahrreedplfiocratsehispammepnlte twoeCroelculmebainaedAnaanldytpilcaacledSetrovgiectehserfoirn ounce amber glass jas. labeled with the sample idenificaion number, replicate number, date and sponsor's name, and frozen at -10 C. The frozen samples were then shipped on dy ice under 5 000554 USFW 1130 DRY RUN CREEK EARRTOHYWFO.RWMESTETSOTNS. GST PROECT m19n201003100 chain-of-custody to Columbia Analytical Services, Kelso, Washington, for chemical analyses. Chain-of-custody documentation and other traffic informatiaroen provided in Appendix A. 27 REFERENCE TOXICANT TEST A monthly reference toxicant tes using 2-chloroacetamidea the reference toxicant was performed 0 determine the general condition of the earthworms used in the toxicity tests. The concentrations of 2-chloroacetamide selected for the reference toxicant test were 0 (contol), 8, 16, 32, 64 and 128 g/L. A stock solution of reference toxicant was prepared in deionized waterand mixed with control soil o the desired concentrations. TenE. foerida were exposed per control of reference toxicant concentration for 7 days without any replication. The reference toxicant tests were. performed under the same conditions as the toxicity tests . 3.0 STATISTICALANALYSIS Mean survival and growth data were evaluated by a statistical comparison of the Dry Run Creek Site samples with the reference and laboratory control samples using appropriate statistical procedures. Analysis of variance followed by the Duncan's Multiple Range Test (Snedecor and Cochran, 1980), and Dunnett's t-test (EPA, 1988; Gulley and WEST, Inc. 1994) were used to - dreefteerremnicneetsotxaitcisatnitcawlhsiicgnhifciacuasnecse.SOThpeermceendtiamnorlteatlhiatlycoofnctehntrteasttioonrg(aLnCi,ys)m,stuhnedecornctheentsrpaetciiofnieodf conditions of exposure, was calculated using the Trimmed Spearman-Karber Statistical Computer Program (Hamilton et. al. 1977). 4.0 RESANU DDILSCUTSSISON 41 WHOLE SOIL TOXICITY TEST Debris, including small stones and plant material, was removed from some of the soil samples prior 10 use in testing. Some indigenous earthworms were found in the soil samples and were removed during the sorting process. Test conditions, including lighting, temperature, and pH values remained at acceptable levels throughout th testing period. Test temperature remained in the range 0f 20. 2 C throughout the duration of the test. No pH adjustments were made for anyofthe 9 000555 USFW 1131 DRY RUN CPRREOETKECETAmRRToHRvW.ORwiME0Ts3ETS1OT)NS Samples used for testing. pH ranged from 4.2 (sboratory control) 7.0 standard units (903) t$h2r0ouLguxh.outTthhepdeurrcaetnitonmiofstthreeteosftt(hTabslies1).usLeidighnttihntebnsiiotaycocuvmeurltahteiotenstesairseaawcapsremseeansiuerdedintToabbele 3. Percent moisture ranged from 12.0 (sboraory contol)9 20.7 (sie sample 900). Copies of he relevant raw data peraining to tis test are provided in AppendixB `Survival data for viosccumulaton E. foerida after the phase are presented 14-day sub-chronic exposure in Table 3. Air 14 days of period and subsequent 14-day exposure, survival of E. foeida in the site, field reference, and laboratory control samples were all 100 percent. This indicated that tahbeotreastosrsyoiclsondriadlnoatndshfoewdarneyfesruebn-ccehrsooinliscwtaoxsicoitsy. siTghneifi1c4a-ndtlayy dsiufrfveirveanlto(fPE0..f0o5et)idfaroinm tshuervival in any of the site soils (Table 3). Tahenboioarccutmiuslsautifoorn cphheamsiecwaalsannaoltysmeesanitn a(l0l dofettheremirnepeliscuravtiev.oTrshheipa,ddbiuttornaatlhelrabtooroabtioariyncaodnetqroulate eduxpploiscuarteesaenlryessu.seNdotomboraailnityadwsagsuaotbseeravredwoinramniysosfuth0spaemrpfloersmamfear tthsepi2k8e-dmaaytrexipxosspuirkee p2enrdioad.borAaftoerythceo2nv-odlaysabmipolaecscuwmausla1t0i0onppehcaste,fsourrvalilvaolfothfe reEp.lficoaetdeas.inTthhee s2i8e-,daiylsurrveifveorresnhciep, of . foesda in the laboratory conzol and field reference sols was not significantly different (P=0.05) from survivorship in anyofth site sail. i GheroiniwtiaolfwEe.igfhotse.idAavwearsagmeepaesrucreendtaagsevigertowwetihgohft Ei.nfmoielliidgaraimnsthaendDrcyonRveurnteCdre0ekpeSiictenstoiblassreadngoend fperrocmen3t2a.g4epgerrcoewntth(w9e0r2)e t3o8.504.a3ndpe4r3c.e9ntpe(r9c0e3n)t.,Arveesrpaecgteivlealbyor(aTtaobrlyec4o)n.tAodlegaunadtfeemlasrsefoefrence soi earthworm tissue was availble for chemical analyses for all of the st, fied reference and aboratory control samples (Table 4) 000556 10 USFW 1132 Diy uNCEE EArRoTr.IvwTeOsERtSoTMxS PROTECT 172 1003100 Behavioral observations recorded during the test included lethargy. At the endofthe 28-day `exposure period, there was egg and young production in severalofthe exposure chambers. Copies of the relevant raw data and sutistical reports pertaining tothistestareprovided in Appendix B. 42 REFERENCE TOXICANT TEST The LC, ofthe reference toxicant est was determined 0 be 37.3 pg 2-chlorosceiamide/L with 95 percent confidence limits of 30.1 and 46.3 ug 2-chloroscetamide/L, respectively. The LCs value fel within the contra limits of reference toxicant tests performed at QST, indicating that the organisms were healthy and within their normal sensiviy ranges. Copies of the relevant raw data pertaining to th reference toxicant test are provided in Appendix C. 5.0 CONCLUSION Under the conditions of the study no sub-chronic oxicty was nosed in any of the site, field reference, or laboratory control soils. There were no significant differences (P.<0.05) in survival ofE oerda berween the laboratory comirl sol, the field reference sil, and any of the sie soils collected from the Dry Run Creek Site. Adequate mass of. foerida tissue was availabe for chemical analyses in al of the soil samples. Percent moisture of the sie soils used in the toxicity {esis ranged from 12.010 20.7 percen 6.0 REFERENCES LAambeorriactaonrySoScoiieltyTofsocriTyesTteisntg waintdh MLautmebrirailcsi.d AEaSrTthMwoErm1,67E6i.s9e5.niaSftoaenrdiadar.d GAuSiTdeMfo(r11C.o0n8d)u:c19t9i5n.g a GWr.eEe.ne,MilJle.rC.. 1C9L88.. BParrotteolcso.lWs.Jf.or WShaorrtteTneHricmkSsc,reBe.nRi.ngPoarfkhHuarzsat,rdGo.uLs. WLaisntdeerS,itSes.,A.EPPAet/eSrOsOo/n3:and 88102. UGunlilevye.rsDi.Do.f WayndomWiEnSgT. Inc. 1994. Toxtar 3.4. Deparment of Zoology and Physiology, EHsatniimlaotinn,g MM.eAd.ianR.LCe.kaRlusCsoon.ceanntdraRt.iVo.nsThiunrsTtoonx.ic19B7i1o.asTsaryism.meEdnvSipreoanrmmeannt-aKlaSrcbieerncMeeatnhdodfor Technology. 11(7):114-719; Correction 12(6)41 (1978. nu 000557 USFW 1133 DRY ONCRmEoEKrEcAe-- RTnIWOTaERSTMS `v0S.n5e.ederEconyrv,iGrr.eoWsn.,maeAnnndePWs.,rG.iIoowCaonochfArbagnuc,ry1f9o8(0mE.PA`A)S.tcaiti1es9ta8ic6na.ldMSCeohtmohproudtTse.err7PmtrhCoEhgdirotainona.TdThoUesiefroswTaGeSsuttisadteweiftohr E D BOee pwia t eody SoeBrae,SuEpnpioo.nSmefs,iaCloMmopsourSiignaendsSCuogrppoorrtatLiaonb.ora. Cincnoa, OF. 1985 000558 2 USFW 1134 c om L So Table 1. ys ms pH Values of Soil Samples roe From the Dry Run Creek During a 28-Day Toxicity Test Sample ID Location ET pH CT-- (su) fEmo rweir Jo Jfeo | b=o TrJ eern feo T fee | bo fhe Tf o a] + pH measured in standard units (su) 13 000559 USFW 1135 ccmaun moriwns Table 2. Percent Moisaure Content of Soils From the Dry Run Creek Site Used in the 28-Day en . 000560 USFW 1136 oR Rwchs ARTrIoVrO.RMseTsEtSoTnS aor rornn50s 00 Tale 3. DSuurrviinvgal3o2f8E.sDanyiaTofxoiuciitdyaTEexsposed t Sol Samples From the Dry Run Creek Ste SURVIVAL (PERCENT)* Semple | Loeaeen Control No.1| Lab NE) mo [mo [mo B 130 130 130 130 c 30 130 10 130 Conrol No.2 | Lab A mo m0 [mo [mo 390 (100) | 390 (100) | 390 (100) | 390(100) B 130 130 130 130 Aral SE mm [mo c 130 10 0 30 390 (100) | 390 (100) | 390 (100) |390 (100) B 130 130 130 130 c 20 0 0 130 390 (100) | 390 (100) | 390 (100) | 390 (100) Areal BIE[m0 BBoo m[moo [[mm0o c 130 130 10 130 390 (100) | 390 (100) | 390(100)|390 (100) 02 reat BNE[m0 mBoo [[mm00 [mm00 Cc 130 130 0 30 390 (100) | 390 (100) | 390 (100) | 390 (100) 0 Area lv Bao [mmoo m0o {[mmoo [mmo0 Reference Cc 10 130 30 130 B a m[mo B0o (m00 |[m0 390 (100) | 390 (100)| 390 (100) | 390 (100) c 0 30 130 0 390 (100) | 390 (100) {390 (100) | 390 (100) + Approximatelyonehundred and thiry organisms exposed pe replicate 1s 000561 USFW 1137 DRY RaU5NTCPRREOETKECETAGRRTIoHvTWOF.R0WM1ETS0ETSO1TNS Tare 4. GDurroiwntgh aof28Ei-sDeanyiaTfooeeidia Exposed Test to Sil Samples From the Dry Run Creek Site Sample | Location Initial Weight| (me) Final Weight| (mp) Growth @* Control No. 1 | Lab AB 3330.67 42520 33759 c 5322 55082 23860 Control No. 2 | Lab AB 32105 455027 a58s4 c a5s17 2610 111 Areal AB 330522 aw5s 256743 c 1363 46141 63913 Areal A B 335631 59028 33693 c 35587 551003 22059 . 902 Areal AB 331150 3566 411463 c Le a8 406 312 a3 324 903 Area lV BA 332007 455254 72027 c 3352506 25023 2503 Reference AB 330056 2wa9 54026 c 3n166 8522 4350 +PAeprpcreonxtimgartoewlth13=0(oArngaalniwesimgshtex-ponsieadlpewreirgehptl)i/ciantieial weigh x 100 1 USFW 1138 000562 DRY RUN CREEK EARRToHvW.ORwMeTsEtSoTnS QT PROTECT Eni310 Appendix A: Chain-of-Custody and Traffic Information USFW 1139 . 000563 | o 3<3 [ FFFFFB ITEFIIIHTRHAH RTARER fa] | FIT:. Wi, I Slr SRHlHTT J ) =LL 1gHBlIe2s,EA L = ] TIT 1. oF [RETTIHEL <g5 pi r ih TI | 23g oil (I mn ey [ \ sSeEkE g5f3 AAT adTPT 3352 ee iTR1 S SREE ELL 8 833 8 \ 23 | SIs if sez |HHH H Jr 11h 0 ki... Il,l! TnL i[TTT |e eo [THAT [2 [TTT] o 5% SCITE E i|e | iN i ee | Fi TIN, mo | |RN B 8 H 0 AE : ill] aR oi 3 i | SOCTT oe (FT ! 4] NOAA TTN 2s fe[| 0 TITTY hes ; a ng = 8833 =3 [NTT = oli HHH ih. il Te 3 88 [TTT usw 1141 ET] Bass. HS | m miiR EY. o T2b d1 T [E A HF ) A] se 2m| i(inTilE Co H Ag3 RCCT| t IT TTH ITIe T EEr EN) (ots Ll|8(33 Eh Bill : 8B I] THT ll 3 g | oor JT H0EJ gil [TR TT el || 18[TTLLTTTTTTTTTRTY ee j {iy Er HEHEHE M5OkL l+el 2.4 WEEE ) <I 588 5888 kl gas HHH USFW 1142 IH. i PU ul 3scLETTT HR dH = =< J IH =: TTT HH ED] 3 TT [2 EIT AC A iiL i ill 8 |i Li iihii] i TiLl z | En 0 iE] i JR . i: | I E, il SL)7 ses os Bi {i171 =I iciIa HEHHHHE i i i c2w HH USFW 1143 [1 | Fg1 gassas J TIMI 8 | so Fo =: TET TTT a3||| 1A] LAAT hee Hl essiilrion ie : gl, DIA). 4 2132 [1111 ENTE i 5 N | A inst Roi 3 oV| dl H [IITTNl IONLNE Ei3EE]e| A TTT tit gL, = Lo {ig HHA] way a H1 la mHoil1lg Hin wi 3 off MERI | HE 1 HI Lo ll ce: = stn By: T-13e81 10:24 5062827873 332 233 66223 2 24 |g) 1k WITTE He : . EA L HHH] Elg e : . | m A TTATIn TARTAIRATAIRATRLN 18o1a8) AT2[LITE e | a SiSERiEF H CETTaTH TnTTiITI nIIEli,|ES1 iRHlOUlHI SHAT sac A id iea iel E TTR E . 1 oo USFW 1145 SEHR ee SrHI o an 12 I BILpiL + wn Le eh Sad WHIT 4 pr it JH ill SORT sts i EI I5 EEL dE mx USFW 1146 ee DRY RUN CREEK EARRToHvWOF.RwMETsEtSoTNS `ostPRORCT P197301003100 Appendix B: Eiseniafoetida Soil Toxicity Test Raw Data 000571 USFW 1147 | | v Is &xi.1 anen S3B7o2e3rr20.1e00 Ft T m em | [m deln a] wldeeen] ofa |[srmna|e yoLmerT ms| FEe R Trim|mse rni|e=)| sie Hs fTroien[= o osto|e L [oe cte s [soTos lastSal) nasal SH Fie [ooz |Home Joo [l0 o L[zaege#too [[nnaeunk[[seue]| sfear] -- fr ee er en 1 1 --r 1T -- r r r r 11 1 . -- rr | Eo eDy age J WaterHoldingCapacity(WHC) = `Figal Weight -Initial Weight = = + USFW 1148 000572 Eeis CceeeernE me | zee | ee [io |nse | | SAMPLESPLACEDIBLUEMOVENAT: 1215" Hn ReMoveDAT: 31S wn | , Ere | mmm Bet commece mgtcea ee) [com | oserr[ooze [B21 [ovese] | _ aco Iocaeas| woe [1202 |oeeny| [8 |ose [ 15027[2344 |ores| az |odzoe| ts0zs( [12460 am 12724 | ac 5.0253 [12:533 | | 1 --rrr | rrr1 r 1 r 1 [| { 000573 USFW 1149 Environmental Science &Engineering, Inc. Aquatic Toxicglomy nersn project: 3147232 Olen3loeDAILY 10_6 o5 an FormoFremcecNutamigbveeer::: APR 1993 _ _ { alan mee @ectuel) eeo q sl tfoes sewples (semgle 1s Gov, el, do ra ere D sheol0 + f ca uPrine, r c u]] is oii~ei atos_ccoor y on | ee | lenmo Set poral free ddo oceor do | l 4 2 eo Tl orna iiftn) ole he co ecanrl CCoiott esphageus fon. | pen,seZtotseibanclsnd]|e ae ercafo tS esnB d T ee eeeonnss ce tfeoett | oe do elo see eee resl coo d ee | re i pet Cee. | [easi aau4 == [a[liasoy(seulad-=]CConer)Utoesyd |! NT : ld(oC |] er s--e8.a2 | ee eee = or cach Somple , scl placed oe 1 pleche plete ood | herogen orn bey bal), Rocks, plead dbo sodRaness | el bpenclely 2.5ks o nll on | on i core) mde htbo ob ded ced ghd. ~I30 eres (230 | w Male ad onl amei]yl L oonnda conkinsoss, Sloonoer!escan} mth 0n0t0574 USF)W 1150 Environmental Science & Engineering, Inc. Aquatic Toxicology Laboratory Gainesville, Florida Project: 3147732 0lee-3ieo oaTiY 100 Page: ESE QA Form Number: 018 Effective: APR 1993 -- ] Felonco comon cols domeCompe); pos colsG87 faav0). | fms nscn 0bcit wn ot ees Leel te eee Lolo ooo comacodemeee(zea, | Lalithn wor comecuds gee caer. | | ehoknmowcxmqcdsgovConey | ry Loin oo. conn conte vorp(amg | SP Lo rmel = cebd)viene ey, [dott smcconn coliomer(a0) pomstec | I (mooct an |onee opencelegee(am) | [oikioowom:coemma coh oerte(ueedy 1| [[ holy =e auAst widv eeovssoFedGvroei w)elT.uGtsubwoorlil stwetdieaand || [i[L rmh yoy =--sdoeuvtiaee.eAdeico2ppds0GoiahmngSgoTnuo,rXPudeuleidallie | [thleoy ove vende oreGre) Ti TY - amb eeds 11 FOC) | Lally ay. oma vesdsJ (212C 000575 | Tun -- ama ~vesds 11F HQ) USFW 1151 GEainesvaille,rFlorida Project No: 31472-03(020 310 Client: Roy T. rReviised:mJunee1997 West, Test Species: E- Le dA TT cael.A copsffeodl~otoymuso!f hdvaiza ali] = etarey | fll --sy coa e eden2 CO -- ) Retireidciel did oll. Oopnuin foueach | li 000576 | 1 USFW 1152 +<5x 5Egl ro|E]IE5E%) |=|63[IPe8EaE8sE 4] 35iH8o | FH P| luE]T]2|E[8E2]~]83RB % 3z3 2 8 | d|=8|127[12E]|%85 = g [aA |[2z gi)Eagg R ll 1e F1se1ll58-sE5126Rle 0El-HaNlI2= Eo2fa 8(REERT55ES7] A z =3 |v 21118] 7 i)borfsNioselEEl|NEE|g8f)eH| MEg8d)EEomen] 2 | a3 ha] w 11EMRIE|8 || OlE8s5d1l2sEE E5 R[EGg Ng IE 1 -| { 7 . l| gloalle15o)l,ze 1a dsl|[NE5NE22.t2e3e [E[32355%]] |[2521] (lES5l1f88lo1e||582852ae5f1138|8-2|88cg55t52tZ25E|225(85)]%) |[Z|[]5 [vow2 | 7R2 gicS H s1l2Eg8l1])"A 75[||8B =E35337815%51|A 5||5g<38|||338I358E258585H%%HA(IR((22583))REE1(2M}5 & 2wl = 5 1l2e1f82)] |c-o-uXl|s5d(|2B38Ez||(8o8pd8u5en8sd2|| 25e52k]) ||233 uli & TT TT | 2 H5 |f a2es]gl |0 1H.Hils i I: | 2fx0 ETlRE olf z[*[ed 1EHE] 5 HE E FE g |- bMe 4EI4-S3 NE1E8R0 13H * i gso F| I15zEI I=LYRiEY HEELiEE la<HIME=2 |]]=&| i8g5 z aESgL) l o | =.oT ge i5: eI| l {lo= loafell RFs E[[EZE22e7dY8YEBEgs0E hlEeEE=]oLoN t IH --- -elfE jz lS=idlsfLLsS1E 8 . 1502151: 2 2 w83g32gos [ il| oF8EsrEEofs =|= i35E5.Tn%3T | -a E < 2r%e Ewao L|l5Es2 LL1L 5sIHi]l: E1LH}E21LH3R02E8f5E]g 8 o85s |.|2= iogflleal18iS ]isg||azllEE> 2 2332385 52P&5330:1 | | CBTololoef] o8f3 1] Io] E5E2R222ElZsIBhEeNE|e]Hl E112A31SMeHfEHelIiEE2HLl1EE]s8|1MS3tE8E E2533.:5ol% ils ElE187I [33 2g4.e73d 2538%50 IVsAEFts2 2 [le78s|55g=2i33a55Bo8g5Ee3d3|lsEe|]YEgUgHaelli]eloEe|]=gEl(loee|lllEsE3IE233 szssev ele 2a 5 1B E]218 2 = EEL | 58283TglEe |T Alules) elsel=a] 5 gE 2ol 1.5];eeggleeg={s|D1%2ICE=ED7]REEDE=EENEmEED=. BEEF alee [le A]42 [ol Be 2) i I: ET TRE EEEE HIElgRE[REETE] E 242431434822 229472k 5fl| EEEREEEENERENERED = 2g | =1=1| = Ee ETEles BS [A A all TE eR, | | 1-58] 82 I S| 3] 8 of [Ee . 2 iC 2 (12 pAA Tle |EE ENNENNMNEREN NE R ETE 2a VEEL] Teal elalal Lela gale [glgl2 lL gl |3 AFA EE I ERICE I EE EL Tall leRREE VELL ae Le Le [eH [CLE TLLL elegs 12:0| dg lae i 3 e 3~ e 2 < 8[Pk aE3z 5&3 Hess |= | 000578 USFW 1154 | TEL Je PA sel | 2 | If =[sEi Tl F>L TTTT Bk e bE ala[TTT 8 | IZ eel 2dale] Talal] Z|1][ae]7 IEs H2fHFH le EEE R IeTF oe Jia]dla [Adal[dal[TE E 8 8 || 2<] oof+ 2/22 7 222 2[2|2 Es 2 iF:e NL147NE7RRRC[IlEaElEN[E4RAR[E4EAANN[N1N]Nl-t.: | LLL Te ool Ja of of [ol af al TTT BE fl 3 E[ E Ea T ERe [FE [eas EEENNRNNN : HIEA EEE RE] EE2 gEz E3 EofERESEsL EelD( E EvS L 2 L TTT] := . iZ E Al d- L E FTe TES PE ES AEEE TE to | EE, ELLE [LH Ee ii: i -- rr E PSR H13sEEHHEEEHEHERSA 9 I S| & BL L S&S Jnl nl ond -- --_--e USFW 1155 DRY RUNCREEKEARsoTrsH. WwEOTsERTSOTMNS -- poems Appendix C: Reference Toxicant Test Raw Data 000580 USFW 1156 - Es EnvirSocinenmce&eEnngitneearinlg. inc. Sing ESEQA Form Number 1127 Eisenia foetida Reference Toxicant Test - erm Teco| [rromiommnes{arom Jommrane | fore sins Em Vi onmeem inn fee] ETT ' Preto SCP-A-OC Low oo[g =[r [e+e Twn || =| [ox |52cc [somag 5cC we |CL[C vo TC ee [io] oe [ TvT= 135 19| [=To Tee = 1 |==JoTieTo Jelel 0 1 [TeTo Jelo] c = Jol [ [o o T Two w o TEeAHlaTsnS]] |< Tio [m w5erS S RrEr |-- 2 Se 000581 USFW 1157 | A me TsT o tH ina mm m? Eins foodsRefeTroxeicanntcTeest oJ civmoinerresefm ormes s|| eemme------ : fre i Test Organism History. TestContainer:Gass 1pit ar (7.5 om with, 15aomrbyeg). b [o J eon se e r omeoe n em [lrem ommsee ecse ses w|| [ormeneo [cmon| 0 | oremroea| |=| [ | + [w[ | =| ww |] =| [ee[eon [eon[| e we | wee e | | eweoe ||ee oeoo | |\O_N|] wee r|s =o1|. =e | 1= 71 | N| TeTele TN] Te ee [Te T\| cr [emed| one 0 -- 000582 USFwW 1158 RIMMED SPEARMAN-KARBER METHOD. VERSION 1.5 -STDPAOETXCEI:IECSA:NMTa)'yE. 236f-,echtl4io6dr1soacetamidTeEST NOMBER: 3 DoRaTION: 7 a RTAWEDATTA: CSonecnein)tration NExupmobseerTdo Mortalities o 12200012.000000 i3io0 o`0 165001.0000 i1o0 T1o0 SPEARMAN-KARBER TRIN: Joo SPEARVAN-KARBER S535E3%STIULMPOAPNTESERRS:CCOONNFFIIDDEELNNCCCSEEO..: i33076i.33362t 000583 USFW 1159 ENVIRONMENTAL June 24, 1997 _ DRr.oFyMi.kWeeHsotomne Inc. } GBuSilAdiRnagri2t0a9n,DAepmoetx (Bay F) 2E8di5s0onW,ooNd)br0i88d3g7e-3A6v7e9nue RE: TPorxoijceicttyNAon.al3y3s4i7s-o1f4S2e-d0i0m1e-n2t2,73Soil and `Surface Water Samples from the Dry Run Creek Site, Dear Mark PD leas fo ind enScoluottsheesde,cqaudenest.ewoPrreempaosrstussrefedoviitenhwetthahebeobpvieoo-arrceecfsuemrauelnnactesideontndotmeisectsyyhotaeusvrtescbcoeomenmdneunsctteesnd{tbo0yCQionlScuTomrbpEionravaitArinooannlmynteinchaaell final repors Please contact me at (352) 333-2626 if you have any questions. SQiSncTerEelNyV. IRONMENTAL INC. - ~~-- CosanC=hoa = JTooexiOcwoluosguy-YLaawb.MPahn.aDg.er 000554 USFW 1160 PO. Box 170%. Gace FL 32602-1703 hone 352-332-3316, FAX 363-353-6623 Formers Enoronmenl Scns & Enginssons. oe ENVIRONMENTAL y Jay 23,1997 RDr.oFyM.ikWeeHsoomne oc GBuSiAinagri2a05n,DAenponrs Bay 2E8d90o,WooNdJbr0i3d8g5e73A6v7e5nue RE: TPorxoijceicttyNAon.al3ys5i4s7o1f4S2ed0i0m1en5t3,7Soil and Surface Water Samples from the Dry Run Creek Site, Dear Mike: Please find enclosed, the final reports for the above-referenced toxicity tests conducted by QST eEnevinroonmnengtalofInHc.ycYlolulre cahansgesmansswoemlplaes 3t0h5osewaotf ovuorr QSAouniut hsaveebemen sinclausdexdpien cthde rbeoposrmtes.ntTthhee `number was rounded off from 2.837 which was different from 2.80 (sample 305). Please contact me at (352) 333-2626 if you have any questions or require additional information. SQiSncTerEelNyV.IRONMENTAL INC --_i7--k (Cr. was fas\ + JToosxiOcwoulosgey-YLaawb,MPahrDa.ger 000585 USFW 1161 0.x 1705 GeoFL S,470 Phone 352352518, FAX 35-35-4422 Pott he atop APPENDIX D. DryFRiuelnd CNroeteeks ste `Washington,`WNooovdemCboeurnt1y9,97West Virginia 000586 USFW 1162 gt ag | 3 % i k 1fa8il0gos i Tad pLByyie Gab eh ESEB ul - } pe Jett os 3588 3 -- = 4 2@ T 2, . x Oc * TT on, : A-- ] So IT v3 -- 8 tH a \ "a Tenens 3B: oA AA , Hae 3 3}see Zr . ib -- : RBIVE =r 83 $e zo 5 i F3138 3 pt. usw tes 1Le% AY3 CO: 5) IER a 3: * | Ly Y[I oid 1 fh Q . aR ie Ja, By o3d )ff| $H 33 ul Ai {hYs ;| i oo i 2 Ni 3 hyos A ne -- Podi : g cen SEroenreanriai8n HayE , co: rubs natint I IRRYSE 3s3:.%.72 i,HtERSFR 5 IOU HW wG T i2Ld84E% FenBog { gy 7 ie | ie Logi 1H SEE SEii dt z til2 I2 a sit i RL Tog ET Uy z = Zug `2 3 - 208=, 1S3 s 9 3 23 o< F22E2R2R50I0E8R2 Ts23 THeceii 3 TUEOUNINQ LL, Gwavee zg 2 SRh SSS CUNY SS afsognfy 3% Jaf SE SE MENY gp g {3 . AERRERAE 9=s SSD, on - wifnai1sns 3394 Pri| i 113843488 338 dM << i[o:g i 14 L 1s CIyves 88 Hal sit 3 n33p, En00p0ld 0 > IAN ~ 4 3 USFW 1167 aia id -- RR TXY 0 fa wu Oo--= Roantedlog g3 ts4 shidartiTigiesess 5 } _S3EEkd yi wail 8CS $Se NES [8 RTERERALE STRLRYEs AQ GAAS J ERRIRRRRR 000592 USFW 1168 Bs8gur8p9y3 + Fo 2 3 25 4 Shuiaigg ) SESS g <LUoL Ley - *3 * . ev. o ip Elie Somhhe SIT S TET 3 EERS R52asy eR OR838883 +hy 3I hed3 4K 3 2 {Hd "4 SR 2 : ' Ys 2 83g3 8 3 We & = Wow os . 000593 USFW 1169 2 zeano dH coupuuongenien | 2 38% 8< 3 x oO tt TEREESEE]~ x 8 && So? 8% 4 4b 3 5V y + I3 { CC oEyeNSrEEe L yaISgv eilcs eas ~ T3ORARIeTRR2RIRNRIRRL 5 3m9u8b8b35l0l8p3TERRES < 2o wv =3 - =- 3Q 8 8 f8 od= e BFT. 33 2doH y o geSiosfsas =S8o8s3a80 cfb0e0a2S8= EE] a. a0 OY Je 33 TS2Oo3Lz3A-3W22-L35E2 &B S2a_8pg8ua1aqu2ds3le 2EF g80p6eenRg2lRdw" :| USFW 1170 - HE a|| LEE RUE DWE9 RLEgE3 hSEEg Rl & 3 >: hes ie | eteise Elden x : 3 . 5 L3 sy 3 2s os T38R,<E8 J EBSeEe: | SEUERSE gE JHTarenenn S83l sGDmREuBRneSyeYyY Sl 3Ta0ryig0eyyy oF : SU g 308 3% fe: 3 Bo id 8. 2 gd #2 x < FeBoReSdT Sgi5Rgasay 3RSc g4 s22Te3Qg85a5(3 TB9aS0sn0au2wnoyausd gSRoRoEdSRSNEYSBaXy . i USFW 1172 . 32 s 3 o BSSSARS T y 5 FEITNLEsaIi ~ Lo F2%2e8e3arFYn%d_ q3 SSoEoRRE Fl SEeoyy S| Is9w9osQusu WRITER AH EGGS CHLOE TG ~ BT & a3 - REHASH ERE | BSaHS nSge s EsRE SRAuse ' of. RSwEonE: 1 B ove s ssavFafegyn (msR Ss = = USFW 1173 .3 edvise Hod <I <Q wg Ee _. weweos _ STE Bile 2 # CL Ered SH hE ud "yzy 3 \ US wl T 2 e kl 13y 2 22 N 39 3H >BodToc < gt sPipobd ag" 8 oS UsFW 1174 KN Fmekn NOTA forus ld LS 3 SRL g SE4Giss 3 Cols A Q ty 2M% R 3 SA E oo . ia x g _4 SNER IEgl RaIdERB Sx. STP NAHaR RIxAE TSREnINS" EEh SNTo aS un . a o Ssiir]] xN i N ) SX = $A [J RZe &%e EE+ SUE a we ss +: 3 3 .E &) 2 ki3 = 253 CBok 3 ons 2 AV SNS 2 ASE x [~T ANOo = ; ~~ -- TIEN oo HE 3 hae Nfl [- Si. AR: a ahlds S3 HE TT S5aeSdA 5 LIBaRreRs SaPloRe TINX, 98] OSRo ) SORL ETR toF ENC CIT LINEN SONN= ---;RN wdwx v & = I IRE E AS SSS E NS TSa C A Lo Na BEYESRa WE -- 3S 2ayy 3 "De wLeUyE 0 33<s N<e v0~ NA T3. n s wOu3s0 2 SIS SS pst 300T 8 1 WD v3 I= E \ VA CC S. C CTa 3a5%w ON ro | N I EI =| * 5=~ =~ IT FSJ ROE OSNRT 4 3 Ay ON Ix 3X FRAN W9 OaOE Sle al RRE IE S RIERIEs De SS Sif Ly EBA REE s : Ef 2pi 5 i 4 CoH } 1 1] 1] i : A. E Ea :: *- : "4 ST = >. De aa LAAN 280Sa%n EFYan RU TER RAST<~Nz =x ASS INTE RT Sa Io 5 ERIR NTRNEE= wh PN RSSUT SWE S T = on -- Tre CogdN) Ed SLLIYE = CER| S58 JIE WO ~SR| 2S AR TAR < ND S2 < 5 a +n 3> AoNND = T XT= R ~ LEE | UT gar eles = ee ee SEIEW LY ARIS NC INS TATLa TT eeeAsS PCYONRIASTIT [[WOARNEFRRE 3S5H0T I2A3 FOYa 2 TET NF BowsorLnob ReSaR uA es Sa RY Ciel e REISE =i = S Ae 17S :\ Gey x Fou 3 SRT SERT 7 Noo- EXEy~ Re . . 000601 LW = o33s: &: --| hem a. eal XI =o $2070. ~ ST FS. Sa ns R riR -- - Tr-- <5 N TI ATN 1 LRT on i : 000 | =3"3WN Fok i J5 5" - DS t T A SA EENTES I T S m Sha E SEENy SPopIe lunS es CE SS IN E STT EST 32E On BSPa ER CNETrl S--mSaARTTMI NyT=eTe . i ERCe.S ionc e~ n 1 T dli Sha o E Aces OTRONN NaTTT i EEY re e eRBD . Sh YoJ n LU TIN L.i 1 = HE [SN ESI. SE 2 / 3 oo AN 5z ey - I] . "Pe 00602 2 SOE E Te I r Vr d-nley | | ! [Gender LAE forte Lod ! AB nl Blain 1 | i --f Cya | -- gro] pecamiseds | \F-/9 Tn | -- fie. TF phe |! -- LR FIST | FT #07 fez sd pe | _ flee #30 j freaZZ EAT foc | | ! | Fo : i pid | Po ! |i I| i | } | ! || foosa rv . ai! 9 Hi PT Z FEEL CE Pi RI RE - -- D _.. -- = == ---- ET i= E wy id USFW 1183 : | ! loa i i | bo : il bh so ' | So Be bh " wrt ly |v . \ i { | :i hn - aero J +=DRAFT123195DO NOTCITEORQUOTE ** Checklist for Ecological Assessment/Sampling 1. SITE DESCRIPTION sie tame: Dry Run Coek Location: _n: hus [ Coury Wo 1 -- (oy -- ci --sae:io pot Vicglrio 2. Latinude: 3. wri tespresafe Longimde: sie?_Lund ace cco us B0euies lsthiste fstsie visit? yes oo If o, anach iprors ofprevious sie Viisfav)alia,ble Datel) of previoussi vss) 5. Pleas ansch tothe checklist USGS topographic maps)ofthe se, if avallable. ove sera on ce se phorgrphs vals esJ 11s, pleseschsn valle rs) oe he `map at the conclusion of this section. Xe " = " Proton Coren bone pre cased 000619 5 USFW 1195 =DRAFT12319DONOTCITE OR QUOTE ** 9. DSoataenpyaprokst,ciNaatliyosneacasnivSetaetnevimroormmmmeennzeals,arweeadsaenxdiss,apdrjaaiciecnpto1loersi"prRoxiemitmy eo fhlreoosdbipl,ea<in.rs.a.n,Fdedweertallaanndds are nxabuaysobvious:donoaero"withou confirminginfornaion. Onlucuy Sa. Polecaasseopnroovnidtehethseesoaupr.ce(s) ofinforaaionusedto deny esesenscveareas,anindicatethiegeoeral 10. Wha typeoffacil islocaied atesie? =Chemical = Mamfacuring X Oter (specify). dln Ming C Wasidisposal 11. Wlhevaetls?arethesuspecedconaminanisof concern ate ie?If pow,wha arethemasini copeeamrason Currently boiwy omorsigred 12, Check any penal routes of offie migration ofcontaminanis observed a the ste: = Swales = Depressions, 2 Runoff = Wintbown pariculses =Omer pecity__allyas aps 2Drainage dishes Vehicular waffic ------ 13. 1 known, whatsthe approximate depth(0 hewater able?__Se repr = PR ( 14. Ifoltlhoewdiinrgecdtoieosntofesusrufrafacceerruunnooffffapdpiasrcehaartgef?romIndsiitceatoebasletratvaaptyi2.onyse?s bo Ifyes,towhichofthe 2 sutace war >Grousdvater = Sewer 2Callecion impoundment 15. 1s there 2 navigable waterbody of bury 13 navigable waerbody? Byes Ono, Ed USFW 1196 000620 = DRAFT12/31/95 DO NOTCITE OR QUOTE ** IA. SUMMARYOFOBSERVATIONSANDSITESETTING Th ak ae hod prdctin foam dnaof OP on de Londfith. Namarews (X17) fom, prmmeddy de T cmd Aone famants dd Aloe or Day Rn, Ao rein wiht fren he Aeneid, co prune ares ob win Day fon na fom JJI a ta em oven ok Lois shen Senden apnaen wn dy a a dern addon Take partidily dy dong = Amman meni B sh ompletedby__/ZTVTi AdtionalPreparer sie Mamger_L one Due__4/3c/s 2 Aftuiaton_AZ A5c USFW 1197 000621 + DRAFT 12315DO NOT CITE OR QUOTE = 5. Badnse obsevaions,bowdese i heserbiavegesin? Come frm Com ne. orenmEL> 1 An rethereopr en(are,barren)fiedareas presen attesie? yes CooIfyes, lease prunpiins swam =Outed Xovercpeitr_fides Lone wud Form 2 Wsperseageof esi i pen kd (_CL% 37% sere. Iie 5. Wht te dorms pets Provide phorgrag, if aval Gcoon,nggraves ek ds onvesie ap. 4 Whatstheapproximaie average eigh oftre dominantplan? A. - 5. Destecvergeuiaonbcoveer:53 Dense C sme Pac i. MsceLLANEOUS E fodgribigrhiiopberirT dior " 3 Brseteamttn sn lyr See " USFW 1198 000622 os DRAFT 1231/95 DO NOT CITE OR QUOTE ** 11, AQUATIC HABITAT CHECKLIST ~ NON-FLOWING SYSTEMS ystems are ohen associ wih wetland abi. Plsse ~ NA 1710 Section V. Weland Haba Note: AChqecutuist. 1. What typeofapea-waer,oonfowiagsysiem is resea a si? == ANaaumreailalGoyndc.realaekde)(ago, rescrvo, canal. impoundoess) 2. mown, whats the name(s) ofte waterbody) 0of dace 0 be sie? 3. ita waterbody s press, whit iskpown uses (recreation, oavigadon, ic 4. Whats he approximate size of the waierbody(ies)" acre(s). 5. 1sanyaquaticvegertonpresen? Cyes C00 If yes.please densifythe typeofvegerasionpresentif own. = Emerge submergent = Floating 6. Ifknown, what i the deofphe water? 2. What is the general composition of the substrate? Check all at apply. = Bearock = Sand (coarse) = Muck (Bnefblack) = Boulder (>10in) =Silt (fixe) = Debris = Cobble 251000) = Mart Gels) 3 Destin = Gavel 0.12510) = Clay liek) S Come = Other (specify). 8 Whatis the source of water in the waierbody" = River/Sueam/Creek = Groundwater = industria discharge = Surface runoff 5 Other (specify). 000623 USFW 1199 ** DRAFT 12/3D1O/N9OT5 CITE OR QUOTE = 14. Whatobservarions.ifany,weremadeatthe waterbodyregardingthepresenceandlorabsenceofbec macroinvenebraes, fish, birds, mammals, ec." 000624 hd USFW 1200 << DRAFT129195DONOT CITE OR QUOTE== se owmei5?ye cermin. [| oI ys, lesen Kusdge oF 0 formantvs idi Summer deydewS ing 54 + tre chpfom if wri ys 0 yes pls dere 0 dicode wan [a0 (oy Bea > Lae Geet = Dhue River 4 terree dgrm wae a0andwh2e?tyeersoeadsnha1rei0sofofrfmationsaval, pls nly See whet Lo. entasn Feldpes sd obmeetviaimoessoftv1ir 0quWalsity oaftFweersemraidneo,eFoprboespps areelcoor x3 wee L=3 Depts (8) Di pen Vets pect ie) mperaure (dep ofth wir 3 hich hereading vas he, > mm Dan Dissolved oxygen Dam Dan `Salinity TSecuridi(kcedae.p lig B i, i,> op) Lert Ober (specify). usFW 1201 a 000625 ++ DRAFT 12:15 DO NOT CITE OR QUOTE * V. WETLAND HABITAT CHECKLIST |} 1. Bsais?e DoynessFeovo ano vali fori, redesig orKnow wedsdfs rec se oPvsern. FthoeedseueeasSoafbisAeBrevcaysossnd10fikoe iis dewrema(s5i.onUSGS Topographic Maps, Nain Wend 2. BTaesoreed,odEnatkce. vyecseao.insporf3otv0eedrswaiccik.se.<.isronog r3vaworefirtytw.eie)n,tlaa1obwtedasnpuhadlbessenicponcnetihet)iidnns'(.. sanding 3. Wr ype)ofvegetation ae prsi ie wend? == SSuimememn =S WEnoeopden = ous pest), . 4. PPrrotvoiseapheonftao dKneorwisuofspoeenvdewgeanns.rsebtlien 2.0d around te wean (high, colo, ec. Provide a 5. W1shasatnting waatpsrproesennt?arayoefs55 0wateIre5., iAs i wae: Fresh Brackish Pi comp quae . 1. 13 in Cosco Ti ~ Ante bias ~ NoFlowin Syseas. 6 oh evidncof ooding aese? Wx observations were od? = Buussng CS Wamms S Mudcnds = Destine = erdescr betow) USFW 1202 000626 g2 Q :& 22 5 LE 53 fH2gA om i: @8 2 ig i5 s 82 3 S50 ir5 Be : gf : 3 wgJ&: -= 8 g gE Z ljssssss< sa aaeaqaaq Som moO Oo ]sSso2H23m3o5O33O 2582583 2 of 3 38 8 Sa ae jut 5 z:3 [] SS USFW 1203 000627 g ; USFW 1204 000628 EN TN R23 eas Ae EA as EE wa T SNEEWA RRKAE NNYES ileNES D) S<2)R, I(Esse== Ja H=e Fw TSN VARIA Api NN. ZN TW EAC Thee) is cq m S Ne E ST m TLYRo TrS eT= emRiE E3 e 3 ee g GH WaEs T 5RSEi Sp T M2 AT ESR AT E EE SNE ATSEle N (A aT = = RA FL S 2 2 X N = eae ZT 0d; J <7 NECK 6 CL) {TAQ SENAY ZL LCAT S S)S ) SNN a A SYEN AA=SmA s SNeA2RS7a SeJL AhCT yL . VSL A SN AS EE.Sm=oti AANSNL SNOKNHEoSn, s SS elE ah s AY , pa 5] of LIER CLT Sc Sele EES AS) SEN 8 S BNEE XNR NER RY IA N E EEE Sed 8 WE =m SHcAE Y s nSeNRSINe AC e KEN EfDsT & AN BANG EN (oo ay SvBe BAliJ J7o W\ SN Nz) : oa COpNeY W(U ==E>AE 3NE5E7N=ExN 7CZ OG R N RYI 2r 2 GA =]N= ReE iN$ Th i. I or t .i- WashingtoDn,rSWyaAoPRotPadnEaCNCoDrAeuIennXk.iiEsWeest Virginia November 195) USFW 1208 000630 ios 000631 USFW 1207 sfsEsPasEsEsEsIsEiEsDs Fis ag ed :< - H OBREEREHEINEILHEI Po Zi io iLzr. $287 i i EIRgH RsEEiaHisE aEyE EEE cr E TIRE E ETR EERRTI EREETE E E iC ]of Fgggmpasssams og BST 97 9 ST ST TT 0% Tie EE ii : F gEBRgEEEREEaEIEeRNE: 1: I :i - sesssesnnn i =F zsssesesad USFW 1208 000632 gf 215% < : i USFW 1209 000633 Workehest size: 100000 cells Madr Ya w One-Way Analysis of Variance ASSnoauelryeesri|s ofoVr5arianc7e.05f85or LIPI2D.u6s3 12.26 (0.000+ Tseeatlt 2a0 allessea ols Inaividual 95% Cla For Mean Ls2evel FO oslo ol8m Be (astedronoPmool)ed SEDe av 13 ola oles (mae) :3 P 7 SSEsR oolissse (meen) (rmemmranennn Pooled Stoev = 0.4636 IX) 0 ose One-Way Analysis of Variance ASSnooaulrpyceseirs BET of CoV"raraianoce s5f5or 9 aos FLUORmIHDasE we os* om Tal Level ko mae wean stoey BIamnsdeiodvimdounaelPono9l5te%dCl lSatDeFo vor Mo ean se s23 : GY i eaall doo OER aEaslNiaSms Hb T n Cn en ) EE Pooled stoev = 86.46 5 150 280 One-Way Analysis of Variance ASSneuairltyefs"eirs of"oVr5ariancseu5fsor Alumoisnuveme 0.3v 0.93%> TSEoItRaTlT 2a0 g3essaseiseies 2278 Individual 95% Cla For Mean 5L2ever 3Todweeealn Bssteeolnws oBaosetst on Fooled t SEDev s I rr reaes tree ney :5 DPo ERdlEe sCaHoS lI Pooled spew = 476.2 o 001000 One-Way Analysis of Variance ASSnopaluiytesirs of"oV3rariance158f8or Sariun8us 2.. _ Sos ETottal 02 a3s8es 51 BIansdeidvidounalPoo95l%edCISsEDeFovr Mean L82ever 3wTooamernan wsSteeoenmy TaImEetIIEIRR--IELE-- E L ee USFW 1210 000634 33pooted spew$s0= asB12is:2o9 as9s1e8s o pr 20 Terrme5) Oannael-yWsiasy oAfnaVlayrsiiasnocfeVf5ao8rriaBnecreyllxisy Souter or ops 0-3r O80 ssEaomupXrlsee L 320U0 Qoolloooooonssassdidsz? 0g..c0o0v0271 Iansdievidounalpo9o5l%edCisseveFovr Kean L5over 2oNmo0e1.0n1l7 |0c.l8So0n0Ee0r0 e (noe (ee mmmtCzoazmezme mmm=m) 25 3 sI O0loolisneo oGlo183e2 (cme oom 0.015 0.030 Pooled stdav = 0.01647 Oannael-yWsiasy oAfnCaoVlrayrsiiasnocfeV5fa5orriaCnacdenivets Soute 238x 008 ETesorcooarlus 3Z0o g00lo00ua37g3se0 g0.o0s01s7 ITansdeidvidounalpo9o5l%edCIsstveFovr Mean IITNT L5evel 13 oOl.oawsseo0an0no 00.0s130e66e30y37 meemesmeJ TTII ( [otC] t 233pooled soev15= 0G0.l00o44ss3s4 8o0l0oaz%is t See mToop ne o.ae0 0.10 Oannael-yWsiasy oAfnalVayrsiiasnocfeV5faorriaCnaclecitums Source of e 05r 0.650 sEororruoarrlce | 21305 s1Ieoiieas1so3em8us4e00rs9 9s7u08s6304 ITanssevdidounalpo9o5l%edCisseveFvor Mean e L0evel 33 2we%an zee Stpheeyy 78% e Irm I (trei)o I tmt o) ) 233 s 1 ohmn uReEs Joe ass 30000 |m 4000 50000 booted stoev = 9853 One-Way analysis Analysis of of Variance Variance 5f8or Chromivss Sourte oF % oox osm SSeecmoprre 1 HE oyno2 1n0oa80 a3 TIneaiilvidounalpo9o5l%eeCisstpFeovr m Mean e L5over pgwsean sSehy TD E em 000635 USFW 1211 23 3 2fies ss SOE Pooled StDev = 20.38 e1B1l.S9a% ({e r(rmeonmaime tpmmam--ay--=e --=t= -20 CTT wT One-Way Analysis of Variance ASSnoiaulrtyceseiss ofDFV"5arianoce .sfsorocoobal.tus 0.38 0.769 ETrortoarl 10 1L2a1s2s3 oloro Individual 95% CIs For Mean Lo2ever 13PN AINolaM+me+sasn + 0SlE3D0emS Y BoaeE smeedmoanroPtonolt--emde--nSitDiSelvo.eeeeomgteeemeaono)ooman (rm=easa=tmmemrn) 33 S2 oolliszceoo oolliossezss (renmeemeommintmeeeeeeeeman} Pooled StDev = 0.2648 Sos oss oso ous One-Way Analysis of Variance ASSnoeauelrpytlseeisr ofoFV3arianc1e6.2Ef1Sor Copperus s 1.H3N0 0.306 TEortraolr 03 eToelsle is Individual 95% CIs For Mean Loevel x5 61380 1e 0909 B(arsoedmeornme mPoeoelmemdmStteDmemmvmmn emmemmmr) 23 : i$ Se3sa0 oss zimee 0166 (smmmm(mremsierarmotmveimemono=mtmem]em) Pooled stoev = 2.037 io 6.0 5.0 000 One-Way Analysis of Variance ASSnoaaumlzpytlseei|rs ofOVF3arianc2e6s46fs0or Iron us e820 ETrortoarl 1270 e181301712812 106813 Lsever 2 2NUo iM0enaln soaz 3S6t8Deedv ams S sa2s 130.6 33 3 aisle 503 Pooled stoev = 326.4 0.08: 0.968 oIBnaodsmieedvsiedoounailPmos9oe5lm4emdoCmISestzDeeFvoir-sMgema--nssmeeeoos (mmmmommrfom(roeomemmemmmermaormmnmnme)maenee=nye) (mmm III s 300 500 500 One-Way Analysis of Variance ASSoneuamrlcypesei|rs ofoFV3arianc0e.05f58or Lead0.0u2s8 0.3 0.542 ETortraolr 017 337m9 ole Individual 95% Cis For Mean Level x ean stmev Boaesemd on Pooled Stoev ees USFW 1212 000636 3: 22PpooeSuossm oSfemaimennr (C e (o [T e rm I eno 3 rooted sive = 0.4672 eT ea OAaBaonineglim-ysWeentasyooAffnpausivalrneTsayzsiiasnocfeVS faorriaMnacgE eneEelsNst:RoI s E oe BFelEen 2am FIncivyidund 95% cis rox Has 3:3 2yiPoomodnmemey EEHpeeYnse o f e h eT r m m m, : sootes seer = 29:7 ToT OaaT Gmanmanletiye-aynT tWastasyoToAffnyaa3sivalnesayzsiiasnocfe8Vg LfaEorriaHnacg neganOeMSWsIG Een WR $:3 2ypPoo2gpE%mmR diSNPnnnR rooted sinev = 10.88 ae et IIndiviidual 55%acies rror Hoan Ct IJE e E T E m n TTR w OSpESoonmspweiliyHe-egniWasatsyoAoffna3vlToayuzssiiin0asennolc0cfeVealSfSroirEanHVoSceEereeRGsmy, Et :3i 2 oogoop eoem 0fSg.eie8mes%s rooted scvev = 0.01559 ash ous2 nIcnievsidundP95o% cnisyrox Haan (ee rC t y IID fo Tae blow OapH smnoeaestr-eyTWsesasyoToAffnyaa2stvelne ayrsiiasn5ocfe VGffaxorriaNniccekeallSRs, He est eee cis Fo Hean me 5 ndtviadeunS98% e 000637 USFW 1213 Lgevel 3N oMseaon :32 123sesaTslseoes Pooled stDev = 8.371 SStyDey los TmCeeI-omemmmteofeemcmmemmtmeasnaena)e|epeo aunilon (Seesespmarmeesantnesmzssraenese)iets) we Tos Ten Thee One-Way Analysis of Variance SASnooauelrystseti.s ofor%v%ariaainacaeaed5fsor Poatvaesesstidys BHEEY 31 shiaessenoeerr asosite L2oever 3 iIo dMoseems FRE Sat0sDe9ev IH : $0 Es IB Pooled seoev = 2152 08. 0.2 IBeanesdeiesvit dounalPo9oe l5edCI$sEn DeFovr Mee an t TTIIIIIIepIaIrrIiIniIeIcaIeIiIeITr (eoonsssnsnniniommnmener? Tso 10080| 12800 15000 One-Way Analysis of Variance SSAonauarlrtytesi.s ofoVr5ariansceed5fi8or Sodisuemluls SToEaY 4a)0 zadesmeaanr d0s08 L2gevel 2NIoomdameenns sa5tlahsy :5 3Do ORdReee EdEeSo Pooled stew = 375.4 olr ow SIBannsdeitdvitodnnuaI lFooo9el5%emdR CmlsaaiDneFtE vorommMoetaN nagamnanE m) (pi rraI bry thi) Ssoo acm 4500 One-Way Analysis of Variance ASsonuuarmltyees.e ofToVPrDarisncoeat5fsor Vanaod.wiousese ous. 0.936> TBmaelt m5w Sveims olan Individual 95% cls For Mean oLevel I e03n0 osfwfasy SS( aeseesdc fonRIFi oRotMednsido er ma 32 3D Oolsdweo oollseesn : pC eam n Lupnncs Pooled stew = 0.6409 ole ewe oes 10 One-Way Analysis of Variance ASSnooauplrrytaasi+srn of"fVo3rarianc1e55f88or RESTS som Zinc 1u3$s%5 0ar ous Tl om ao Individual 95% Cia For Mean USFW 1214 000638 : 2wIeoNswEE 3: Poe pooted sEvey = 13:35 sey us eBS aesed on Pooe lE eTd 5ETPs eYIerE ee mE t % am 5 000639 USFW 1215 Worksheet size: 100000 cells So TL One-Way Analysis of Variance SAonuarldyesis Tod ofDFVariance 5f5or 1 29627 Al 296x2s7 ETeortoarl 112 sroesisssz 70se7 Loevel No 3w1e.a7n 2s6w0a.y8 3 7 aa 26807 Pooled soev = 265.7 0.43- 0.530 oBIansdoeidvicdounaelPoCo9i5%endcIlSsedeeFvorlMeeandSer (ooo omrmlmloLeIrLrLmnIoIaIIIIIIIIID ny Teo 320 a0 sao One-Way Analysis of Variance SAonuarlcyesi|s ofDFVariance 5f5or lipid xs Eelorc or 51 loesees 0o.s3e2s Total 0 sass Lsevel N5 1.M0e7a8n0 0.S5t7h2e0v 3 6 1s one Pooled stoev = 0.6572 1a- 0.282 oIBanosdeeisdvcimdoouniaelPiooo9cl5e%edcCmIsesciDoeFovoirepMeeamnomeececoes (oooo--oee oooeeee oooii)i) oso 1700 150 2.00 One-Way Analysis of Variance TSAooncuarlcyesis ofDFV1arian2c2e262sf0sor FL2226u2s0 2.63: 0.133 Eoetraolr 112 1s1isu3ias0se sess Lever HN Mean StDey oBIaonsdoeiodvoieodsnutaelPioo9oo5lm%eidcCeISostdeeeFvos.rimMmeeamneetmmmeees 3g H a80s.0 aE s er ----] t Pooled stoev = 291.0 o 250 500 One-Way Analysis of Variance SAonuarlcyesis ofOFVariance 5f8or Barismus sTeorcor un1 32.478 23..0465 Total 12 sols Lsevel 5 7M.e78a5n s1.w0a7y2 5 7 sleza ise Pooled stev = 1.570 1.42r 0.289 --BIanesdneiedveisdotunaI lPoo9l5e%dCSstDE eFvo.r ean R (someeccoe(oomeoieoeorneesoemotoene)semnaeey 72 54 56 One-Way Analysis of Variance USFW 1216 000640 afnoaalrytseis loc of ovF1arian3ce.8sf8sor ai Bariumus 2308a a2 ous EeTortoarl 7i 30s SEDEY IamngdeimdvidonunalPto9o5le%edCmIsstDmeFT) vorTmMTeean mer Lsever $ NwSo elwoebasn $nens Coe rn ee) 72 5.4 56 Pooled snev = 1.570 One-Way Analysis of Variance ASnoaulrytseis ioe ofoVFFaroianace lsfsor Tse Cadmiunks ooae nanr 0.298 ETeorcoar 3no ae IansdaidvidounalPo9o5l%edCISstDr eFvor Mean L03Pe"ovoelled stoevut= o90.4F 3s 830802 T 0M.3N67 0e .( 00 eC0m .2I5 e Ir 0.50 0.75 One-Way Analysis of Variance ASnoaulrytesis Toc of oVFariieaancrea0f5eo5r 11 18015000 1Caa3l7ciaucHmse 38001364 3.01= 0d ETeorcoarl 12 $32392308 ean StDsy IoJnadosievmideounammlPeoo9rom8le%emmdmCemISmstmDmeFmivonrr)MoeamneoetT Loevel 3 5 2a6s85e0 Pooled stoev = 6168 8058055 (commmm Cee 33000 | 30000 35000 One-Way Analysis of Variance ASnoaulrycseis Toc of oVF1ariance11E9f1S0o2r ChromiuuBsm oarH 108 oss ETeortoarl 112 1202 IBansdeidvidounalPoo95l%edCIsscoeFvor Mean Level x5 vdeoann sSitpeey oI me SI L I Ie I) '3 3 Pooled Stoev = 10.40 oo 50 To 1.0 One-Way Analysis of Variance ASnoaulrycesi|s Toc of OFVTario ance.f55or ola Cob0a.l0t1u0s7 oleae 0.32r 0.58% TEootraolr a1 oem Individual 95% CIs For Mean 000641 usSFW 1217 $ $ oode ser Pooled SeDev = 0.1839 Based on Pooled seoev osea TrI eT re 024 0.38 ows One-Way Analysis of Variance Analysis of variance for Copper Bm ioe BaToaoNadEn a8l $ PLI oe SS rooted stbev = 1.726 One-Way Analysis of Variance aa fdoalyais ofhyvTarioancelfior Troncoulss [EmAronooEE+mI .8 $ Doae SR Footed stpev = 164.3 odd eed P Individue al 958 Cis Tor Mean CpT r I TTT Te nd. oad, TSnaetvidualo9o58tCIBsoarsor Mean II IeesemsmI mspmimmbuesnzeny Tee One-Way Analysis of Variance dafnooalsysis ofoyvTarioancesf8or Leadoluss Bmeemoa pIeSe 838 5$ L$ ooonky oSas rooted stoev = 0.5131 neh: ooh, Individual 95% Cis ror ean ...emmmeImscIemmnemeesemrmene} TT Tee One-Way Analysis of Variance aSfneySalHysis ofhovTyarieancelifor Nagneesliiu aedr oad. H Eoa n Hadem INE Individual 95% Ci ror Mean $ ome ad rooted ste = 131.8 Toes I eran, hee hee ee USFW 1218 000642 One-Way aSnoaulrycseis Analysis of of CoVrariance Variance 5f8or Mangaaneses lEeSel, 2alTanaoeeao siz S T o3 th aUllHe Fooled stoev = 9-551 One-Way aSnaarlay"sis Analysis of Variance of"hvorariancef3or Mercou.ryhms Blfoeer, aBinTodahalss ob 3 Bo SMEe SSEes Pooled stoev = 0.5583 use5 0.347 TInedeidvidounalFoo95t%edCIsstoeFvor Mean et C) II 7.0 Tao 21.0 28.0 oa* 0.587> oInaditviedunalFo9o5t%edCIsspayF.or ean CC IT II I Teo oss e.0 One-Way aTnoaalrytesis Analysis ofVaria ofCoVTrarianc1e %5for nce NickelMv3s Ze ioeNalon aammien zee 5S e noe es G$se Pooled spew = 4.384 oon oe> IIndiividCuhaloo9t5e%dCisstaFyor Mean e Co m m 00 2s io 7s One-Way nSoaatryss"is Analysis of Vari of CovrTariangcoesal5fsor ance Potassosmiavyed ETfoRee D, 5al aasbsuoesree azansie 53 yo EgeEs SIpeEy Pooled StDev = 2056 0.9 0-670 i Individaualen9t5e%dCIsstoeFvor Mean I CI II T) 8400 9600 ~"losoo0 TT One-Way aTnoaultye"sis oAfn"aolVT rayrsiiO asnocfeRVf5aorriaSnecleenoiduwess lmiseeeR, aoln amlae ae caBsN owen> 000643 USFW 1219 Loove No 2M.e0a0n0 3 7 17e Pooled Sthev = 1.015 BIansdeidviodnualPoo9l5e4dCSItsDeFvo.r Mean 1S.t2D6e5v 0786 m(meem(etoimmoem-rmmmommm mieceaiooe oeeeoomormoe eooeienoenm)lmt etnnls}o 120 Teo 2.40 3.00 One-Way AnalysisofVariance Asnoaulrydesis loc of OFV1 ariance575sf6sor Sodiu9m7u5s 0.01r 0.41 TEoetraolr 1121 1188776540501537 1704978 Lever Mean seoev oBIanesdeeiedvisodnnuaT lPoo95l%O edCISesvN eFvo.r S Hean IL 3s i5 33880672 PFLJJ i att Pooled stoev = 1306 2800 3500 4200ss00 One-Way Analysis of Variance SAnoaulrycsei|s ofOFVariance sfsor EeTorcor 41 0l.e0s0s1 Total 1 ile Lsevel HN 0.M5e0a0n0 3 7 014857 Pooled Stbev = 0.3895 VanadiXusm o0.l0s0z1 0.S4t5D1E7Y 0.3288 0.H0N0 0.945 BIansdeidvidounalPoo9l5e%dClsstbeFvor Mean |o(e(-scmoe-moomimmmmmimoomeoeemererreooeoeiereezseeerooesomeeteemosmsoeo-moeeeemeoeeomcoi)oeon)e 0.20 0.40 oo 0.80 One-Way Analysis of Variance SAonuarlcyesi|s ofDFVariance 5f8or Zinc us Eelorcor 13 51277752 w7z52 Total 2 10047 3oLever 10M1e.a0n0 S13D.E3Y0 7 Pls 3806 236 ous) oBIaonsdeeiodveisodinueamlPoooo9ml5se%odmCoISsstsoeeFvoarmmetmaeneeemnceess (remmmm[LmI e mmti i) on Pooled Stdev = 27.43 5 5 100 120 USFW 1220 000644 122 Masn coskanese size: 100000 cols PLAT TissoE OagBfunnalaeeiiye-syeiWaeialsyoeoAffnra8vlaaysrsiiiaasnneoc3feeV0aff%rooriran cLeioOpiqOdVER, nela ae mi fSodieisuais sety ceeror Hesn 5:33 W3ER oogoSrEgeimBe SesSaeSmm TCm T I m Im T TL, trmeeemeeny USE : rooted 3G seve = 06087 Cee TETT Ee OaaTfonniaaeieiy-arypiWaeiasyoToAffnegaa8sivalneayrsiiasnocEfeoVGlofaorrriaFnlcueorGaitFmeOeG esopo oe mr BdR r fraiyidst a) 95e ci ror Hoan :33 N E3R mg haRgeae 8aE3l CTC Um C TIIEITm I II III, )T i rooted Iomgs sioev = 7272 TTT ES OaaTnnnasedeiy-syiWssliaayooAffnyae8rivalTneerayrsiiasndLocfeEtVffHaofrriaMMnlcNuenoGTientees espo od2 fEmlEer Lansiviidonle98 cHsoeTyox Newn ::} CP3}R ooooEnnnnyJ + aNRed G E m eE C em rE I t I [Er : rooted 3 stpew = ous 34:7 TTR One-Way Analysis of Variance ApBonaaeylaytissisooffyasiVoTncoeariance (oQUErS orioTna)e we2 oa EE SRCE Lnsiyicon)i930 CIos erox asm 000645 Lsevel N3o 10M.e8a0n0 312 33 silselse 3200707 : 3 ise Pooled stoev = 3.612 S3.t8D0E0Y mmmmi meteeeeeceeee a1lasm (mHem cmaIsm Imamgssassy 3s3e0n8 (sem(mommmmmm-eeafnitoaimielelnli)mn) 1050 wow. One-Way Analysis of Variance ASonuarlcyesis Sample 1 ofCF4Vari0a.n0c2e625f93or CadmiuEms 0.00657 Eortraolr 1108 0o1l0o8s1i2s7s 0.00673 Lsevel N3 0.07M3e3a3n 0.0s3to2e1y 321 33 0oll1o2s3o3o30 o0.l0i1972382 3 001667 0l041Ss h 3 0101667 000877 0.95a 0.467 BsIansdeeidvimodnuaolPoo9el5%edoCIISsttdSeFevorIrMeacn enn toFrammmmmmsmasmfuemmesaaAsammemeph)e--y ((-eomioimioe-m-ooooImerioaoie-imoiaomiooist))emammeatony Pooled stoev = 0.08202 0.00 oo ozo One-Way Analysis of Variance wa sAonuarlcyesis| sample 1 ofDFvariance fssor 4 1021893 CalciuEms 255473 0.85r 0.527 sTeortoarl 1140 33001357420903 301540 Level N Mean Shey IBtanmsdeeiedvieodsuntalePol9oo5lo0edmCeSsntibeFevotrlMgeeaeneeeeeeen s21 333 a2ossee20l6lr70 a73026z.22 J (eremaoa-- aaimomotoommoaaesbamenmmynen) 33 33 a23s50e00 e277i18 (mstI ecmomotececo-- ioil) Pooled StDev = 549.1 1800 2300 3000 3600 One-Way Analysis of Variance Asonuarlcyesis ofOFVariance EfSor Chromiuusm r ESrarmoprle 1 04 2e0e.7e1 5f.e1d8 0.63 0.613 Total Wo esl Individual 95% Cls For Mean Lsever u3 2M.e8a6n S0t.D2e8v9 |Boaos(mesedocrio-snooroPioeoicliteaodseesSostoaboemvomomieienm)emmmesicee 1z 3 3EE 20100 30 3a 20O 17s00 (sserCoecmcmmoE mmmmeprmeoaoteiuiiimn)yeens|a) 3 3 slo sia {==zozasspmtmmemimeane) Pooled stoev = 2.732 0.0 3.0 0 5.0 One-Way Analysis of Variance ASonuarlcyesi|s ofDFVariance EfSor Cobalts USFW 1222 000646 -- 3b poausle SoIeS e1a0.v98ensreSclAeSoesrr or Hea pwmeire 0 9 Sine 0.500235% Tg ap n r i Te 3 050% losess (rm 51 %3} 0SSG. aloones O99 3 GGSa0esee8ss ri ee ee oo 33: anes 33 50" Gaeee 0.0533y2ariance o One-Way Analysis of anes 5Py STOyEs EA= for Hes nSEaerSryersL N wert T2ea%os oa? i1taess voSthedi oer S20 g II Se e m p5eer 38y5h .w50n00 03/.o550e000m00 gine I P pe C eee m wo 335 i y }y Shaese gem Te 0.6870 ooet-edWa5yAn"alysis of vafroiran1c20 us alv 0 HeS ona AEalLisTML "of NR owPianePsny 1h LaealestCresre2els?SLi ivgeorr mmlre 3 aad 3=E2zX] g a E me ei a r 32 er = rg3eer 3 y3} 3 anmseeeene Bree s wT 5i Jooned 3 59 2 riance One-Way ASnalyEsisEof Va(<or LeStIwRs ol= os sor Hes s ml waelets tLs ToL M eopesond oo naalussGsndveAete? E Toe sever g So = L5over o 83 0Gv.e 2i0a0e9 Cg3Ra0]s8 e Ser m C , e "alli 31 3 33 as 0.18687 0.308392s3 Tee 3 y o006477 ' USFW 12 gsOBdrnoapeeEi-ryeWsLiasyooAffnguariuvnle ayssiiasngpcoefeeVlffaoorrxiasncneWmedRsm]agneny mrOOEE :5 PYooen mwry : rooted stoew Pome = 20.0 fRsOodnapaeip-yisWsei,asy oAfnoarpuesvClnsleayssiiasncoeef Vfffaorrriaaancnmeneeysn min 8m :;;:5 Y3H3PI omoEemnEe BE aRmmEed rooted stom + 3.78 edd od B fastE a 33I cto ror wasn II CI I, STIRey es se R neiviE du a9T crs ror wean {r Eom es mmmmmm TET mF aOBrnaIeEi-yWsLiaR sy oAfnavlayssiiaSE osncoEoef VEdfaorriaH vneccseoeuusyd ::;: ooP}og ogegohogmike ocoSaRaime Sa rooted stoe=n 0.09962 1d oad B TE I C E T Ee I e C mmI m ee gBpaOrnmaieeiE-rysWsiaLsyAonTfalcgfueviyneassioisaongcfeeVRalgfroirraunnicecekelwNd,hE aod ed mIooR REPL 5;: 3}YooeERngp PgeHln m m nm mi m m USFW 1224 000648 3P:ooled stoev33= 6s6.2i:1l17o7 1P32O SE o t CI20 ee140e One-Way Analysis of Variance ASnoaulrytesis Source of oVFOfariaasniceeacs5fr5or 16 137206667 Potassuisy 1e27a2s26e6s7 0.67r 07 TEortraolr 18 163009332 HInadsievdidounalPoo95l%edCIsstoFeovr Mean Le0 vel 1 3 3 a2T000T0:0 3 so eEyl 2007 Tio( mmmoIaaoIme tIemm=m=I rmmn) e) s52 33 i2oms0o0 pooled stoev = 3704 a020 E TeooI o|I20I 000 24000 One-Way Analysis of Variance aSSnoeaumlrpyllseeis| ofoFV4arian2ce01fs8osr 2039 Sodiumus 2co9s 2.05x 0.162 ETrortoarl 110 S355 | Sthey FIonadmsieveidoeunamlPoe9o5l%emdCeIssteDeFmvorsMeranmensT Lsevel 1 5 33 aemneearn Sle 11508221%6 (mm(mIT)ReIen) IRIE 25 i 33 aSEE pooled stdev = 17:34 awse 25 cme FE) 7 100 One-Way Analysis of Variance ASSnooauslztycseei|s ofOVFOFarianoocaelsiafEsSor Vanadivvns 0g0o3n2e ss5 0 ETrortoarl 116 olsen ster FID unsdeidvidoe unalPo9o5le %edCisstom Feovr Mee an r Lsever 1 L E 30 0C m3e%m SI low L ( (w--m mmmm mmmmmiIi) II) 2i3 33 0E.2E00S0 Pooled scoev = 0.1980 Golliens [x Teen 0.25 oso ours One-Way Analysis of Variance aSSnooaulrpyceesi|rs ofOFVaariancaensfdsor en Zine us 32%s ossx 0.30 000649 TEortraolr 90 sosle Individual 95% Cis For Mean USFW 1225 sL1evel y 3w oseMneearn 5:: EOE RES OR Pooled StDev = 6.357 4ern8in>gsawvoerke`nae:s\tplainnt fmitle': Es tsteoer 2lase BarsT eedsoTn IPE oRolEedeR setI Deervee nt gae ara) s RRENE meeEomt rmee) amamemedene} EEE ST Ta ws a:\plant.mew USFW 1226 000650 Wem OJnnaet-yWaiasy oAfnalvayrsiiasnocfeV5fao5rria\ncLeipiidss SfLoocaaotrioeinse OFTPT 0 Bren 0% goolpls0ee%nn g0.0a52% L5evel g 1 3 op gwdeesn 30RD oossieele She 33: 33o0opSe Soikna pooled Stoev = 0:2291 07r 0 E IndiviCduaalFoI o95tS %edI CissEDIOFoVr WeI an ( eem m m m m I m ym I ) y) C oem eso 078 One-Way aSnoaalrysseis AofnaOlvFayrsiiasjnoocsfemaVsfa3oorriaAnucemzinneWnis O47r 0.758 sLIocoatruiorn ce Segsssaezn sesild oIndtividounalFoo95tI %edCISsedoFovr HeI an Level i yIo OaNgweEeny a asmsmsiee GR S ePEm -- CI m i --I i ] e z3i 3 3 3 aHmE aedsee T III : sos ison | 2400 pooled stoev = 765.1 Oannael-yWsiasy oAfnaVlayrsiiasnocfeV&faorriaAnsceenicfs Tor oe 00 BBLeoaeatikoetn"e 5Ue aw5 loers El 4g1e7 IInidsievai`dounalpo9o5l%edCIsseoeFovr Measnoomemet Level wwe sI ev Basee d onPoole edm TOYe 5:3 3 3 33 3Bamdes aPaliEemes EE e erC ImI I mmI I mmn ipooled sepev3 = s 2:082 20 Wo wo To Oannaet-yWsiasy AofnalvayrsiiasnocfeV5fa8orriaBnAcZeiUTus or net* 00 SSLoocoaatriuotnze a El SNOT 031e03i g20e7 Inadsiividounalpo9o5l%edCIsstDeFvor Mean 000651 L5evel I Yeo e7.s00s0 I TICR IE IS USFW 1227 2 3 8% 23: 3I3 1O3GU3eS3 Pooled seoev = 4.553 ud1i5ek2se8 (semeI mmmmmm ooanrememm emnpemne)a, rmnereeey Too 10 200 One-Way Analysis of Variance ASInoarltyen"sis Boren oforv"0ariaoncoe l5f8or a6 ome Be0r.y0l0l0ii8ev Glooisk mE ens L53over WI Ioanmieean 0o.l0ase5ne5:y 25: 33JOo0Sl8a8Ey% ooolleoedwasEes Pooied stew = 0.03524 0.53 0.mid SSI3nadeiSdviodSnualFRoo95tIC%eodCeElSmaemvwMeFeroerOsmMmeEtamn SmmNYtot} ((m e = {mSm i II (I, Slow oom edz ois One-Way aSnoaullyesis Analysis of oforvariance VfaorriEaanc acentuen i r ten Cf sa0dl oer wal 0.000> BT It aab gSusseh ola: Individual 95% CIs For Mean L5gover 3EORP RmeSan SEsemNenv Be iaed on Poole Red ISeoev n (reamramens 333 33 IOREB BER OofTdaRee ((moeee) Pooled stoev = 0.2125 Te TEs Theo ae One-Way Analysis of Variianacence ASI Bonenarclttynesis of"aoV8r%arian7JcsieeoatSfooorSCaRlTcessiaIoeuocmoo/ Tal i aoseoco L5over I 33 aBI 000 I 002%0 :3: 33IOd8WeRRnE odPeoEeoEl Pooled seoev = 184.4 suse: oom IBansdveiidvviodounalPo9i5et%dCslSeeveeFror Mean (m emmeeI entCly IEE (mmm)com sos asso azo asso One-Way Analysis of Variance ASlnealeley'nse ofovr%ariance355for Chrom0iu%im EToRmTa a18 w2ie de oes- oe> USFW 1205 000652  mean sedmy oIBanesdeiedviedounmaelPoeo9tl5me%odTmClTSmstaTDmFeTaovmrImMIaemIamnImmImI==I=N) T Loavel 12 y 33 h diege 3 Glee ozoedams 1i28 ee-C(mmomI mitimI imnmmiaminlmeme) I 3ipooled stoev3 = f1.e36o4 a7 S is 30 Ws One-Way Analysis of Variance analysis of variance 5f5or Cobaltus ozrea) 28 SSEozoucurortrtefon oF4 4 Tocal 1 1286a.l00s0o08s o-l0s0e%o a.sy= 0.0 IndividualPo9o5l%edCisstDFeovr Mean Loevel xys roan soStsepe S fae se mon myI ) mnI ememe ee nte) i2 3 I 330 ToSE ahne 3 som ooasimee (ElEeLE ) i Pooled stDev = 0-938 7s 5.0 10.5 One-Way Analysis of Variance aSsnouaulrsyceseies ofOVFDTarianc5e 8EfSor 52.00 COPRaer,nus agerr S20 (O007 EeTortoarl 01 a07le0 mean seDev BIJanasddeiedvdiodonunaBlPoo9o5l%edCis(stmeoemFevomrmmmMemaeenmmmen) Loevel 12 wYoel 3 3m dloesm eLlmo (oe mmmm n mi )g 33 3 3 0i8m alse Ce) 14.0 Ts 20 pooled stdev = 2:280 One-Way Analysis of Variance ASsnooaulsryteseiss of ovFPLarianmcee sf5oo5r 16 2s0087 Irosneauns 326007 06 0.776 EeTortoarl 1 ssiesT mean Stoes BaIfsnuedsiedvdiodonunaPlPooo9ol5le%eddCTisOstDYeFovr CII Mean tomy Loevel 1 w 3 0l0h0e 3g] 7sS8ee1s.es0 (CPe iI-- Ie --n --] 233pooled stoev33= Bf5ee6e9r-n2 sseees 500 CI120I0 1800 2400 One-Way Analysis of Variance 000653 USFW 1229 ASnoaulrycseis ofDFVariancessfor ELrorcoartion 104 01.535446 Total 1 1ls00 oLevel n3 21 33 43 33 Pooled Stoev = 1.M0e2a0n0 01..6080303 00..79836373 0.3942 Lead us 00.10s8 0.S5E0D8O6Y 0o.l1s026992 00l132879828 0.56 0.700> BmIaonsmdeimdvoimdosunmamlPmoeo9ml5me%mdmCeISmstmdmeFovooro-Msesasnmsmoosooot PE-- amma team) |(mmm(mmmmmmmm mmmmmmmmm-mtme mmmmmtmmemmrmmmme memmmmmmma=m-m)me -)Sam 0.40 .80 1.20 1.60 One-Way Analysis of Variance ASnoaulrycesis Location ofOFVariancesfsor 4 39293 Magnesuisu 9823 ETrortoarl 1140 10889036670 8507 Level n3w 21 3 330 3 3 3 Pooled Stoev = 10M5e3a.n3 ss9a3ld7 10607 83.1 1S2t8D.e6y J5105C0173J 26a 1.42r 0.29 BmIamnsmdeimdvmimdoounmatlPmooo9ol5m%emdmCmISmstmegFmvonrmoMseeaonmsmoooooos eammorammammmm--------) C((Nmmme-- mmmmmmmm--mmmmme--tsetmo--msmmmm--mmmmom-- menn)) [R---- 500 1000 1100 One-Way Analysis of Variance ASnoaulzycseis Location ofDVFariancesfsor 4 1309 Manganeuss 327 Tsortraolr b1s0 88562123 B61 Level N3 7M7ea0n0 8S6E.D5E1Y 21 3 33 0s0o0l3e3r 395..5510 3 sala 7.23 3 3 76.87 22037 Pooled StDev = 29.35 0.38r 0.818 --BIaonsodeoidvoimdoounmatlmPmo9om5lm%emdmmCImSstmbteFovonrmmsMesamnemseomoeoos (<eemmmm(mmmmmmmmmmsm=m=mmmmemtmmmmmmomnm)annnann) L(Emmmmmmmeemtommmnna-- naes)) (rmmemmmmmmtomommmmmme-) 60 50 120 One-Way Analysis of Variance ASonuarlcyesis location of OVFariance fssor & 55.10 Nickel us 13.78 ErTortoarl [0rE T21t8}7 2.15 Lsevel n3 sM.e26a7n 2S.t5D3e2y 21 3 33 a3l1s1e6r7 0s.7a88 3 30633 01924 : 3 30233 Oise 6.30r (0.008i] B-IaonsodeimdvmitdoounmamlPmoeo9ml5me%edmCdISmstmhmeFmvomrmmMsegamnmmommoooie IRIS (mmmmmms[ t-smr omo)--] (-m(mmmmmmmmm=rmmtmmmmmmmmmmno)) USFW 1230 000654 pooled stoav = 1-479 2.5 5.0 7.5 10.0 One-Way Analysis of Variance ASsnooauulrycrsecies of oVFOTariaancgee5fr5or 16 desesr Fotassuisi jeeasseesn 078a O EeToccoarl 1 sean mem sey ZFD unsdeidvidoe unalPo9o5li %edCISsEDt eFVo) r Mee an r Lsevel 1 3] sGSeeieesnr oe1me00se0.0 C P ICIe a IITI 233Pooled stoev33 = sd 6a68a.3 7W50S: 720m0m s000 | 8800 5600 One-Way Analysis of Variance aSsnooauulrycresci|es ofOVFPDariancaaebaf5o5or Selenis5 g0e3e 1.80 030% ETrortaolr sN o s IBansdeidvidounalPo9o5le %edCIsstoeFvor Mee an Loe1 vel 3 M39ed0ae8sm0 GtS0oh0ge0oy0 e ((--m---mmm-mmimiiiITITIITIIIIIIIIIIII)Ley Geer osm (III 23 3 33 3 s3e0e ooiso0m00 Te (ermmammeemm) 2.10 2.80 350 pooled stoev = 0.5774 One-Way Analysis of Variance ASsnooauulryczsecies of OvFOoarioapnocersdfsyor 16 0.001067 Soi.lcve0r0ums 01000307 1.68 O00 ETeortoarl 12 olen wen | sthe IuD nsdeidvii dounalpon o95l%erdC)Im ssEoeFovro Meannt Lsevel 12 U ]3 oGl.o0seieer 060 o0..00005s7m7 Olona (me(ememmmmmrm=mzes) (mS mm e 0.00877 r) 5ifooled stev33 = SC0.ll0oo1s0se3sr3 clos clos o.(oasem0e.080 0.075 One-Way Analysis of Variance aSonoauwlryteesirs of orVOTarianucne dfE)oSr 16 9ago00 Sodiumus a9g4e00n0 137: 0 TEoctraolr 3 1asa33 roan sper IFoantsdeiedviR dounalPo9o5l%edCI iSstDeFvor MeSaEnE L5evel xUo aseen si2 pa 000655 USFW 1231 z1 33 :3 330 Pooled StDev = a46s00e.0 a e33 00 306.6 55l0.o8 20000 [RE (C mmmmmmm--m--m--mmy nnnnaaan) Ee rann--] 3850 4200 4ss0 3500 One-Way Analysis of Varian--ce SAonuarlcyesis foeation of DVF4ar0i.a0n0c2e226Ef7Eor0-- `.T0h0a5ll5i6u7m TEortraolr 1140 001.0000207541363 00000517 oL1evel n3u 0.03M6e6a6n7 3 0.056667 32 3 33 001.002310606070 3 0loz6ee7 Paoled StDev = 0.007188 0.01S1E5D4E7Y 00.000005070704 00..000075673784 10.77: 0.001 BIoanosdseimdvoimdoounmaelPmooo9wl5se%mdmCmISmstodmeFmvomrmbMeemasnenmmmmteees LE] (mmmmmene) (-==-(=z=(otem=mm-m-mr=m=et-me)emenna)n) 0.015 0.030 0.045 0.060 One-Way Analysis of Variance ASnoaulrycseis Location ofOVFariance fssor 4 2.52 Vanadiuusm 0.63 TEortraolr 10 222802183 2127 oL1evel 3 3Me0an 2S.t2De6v 3 30 des 32 3 3ER3E 200 3 she R12T9 alee Pooled StDev = 1.508 0.28e 0.886 --BIaonssdeiidvmimdoounfaelPmooo9ml5me%mdoCsISostshmeFevorrmeM--eeaonet--oooo. oo (mm(tmmmmmmmamemimamemmmmemtmeomommmemnmememmsa)an) rees-- et] 1s 3.0 as One-Way Analysis of Variance ASnoaulrycesis Tocasion of OVFariance sfsor 4 173.3 Zinc us 43.3 sTeortoarl 110 83003.0 0.0 L1evel nu3 weer 3 1000 = 5.77 10000 32 3 33 11223013030. 30 am a0l.0s0 5177 Pooled stDev = 7.75 0.12. 0.59 BIansdeidvidounalPoo9l5e%dCISstheFvor Mean (rm(rrmmmmmmmmmmmemmtmmmmmmmmmnm)nan) (mmmmmmt mmm(tmommmmommmmmer mnm)tmmmmnnnen) 110 120 130 000656 USFW 1232 Fisw Tissv e ANALYSIS OsYnnoaeut-ryWesiany Aofna"ovlpayrsiiasnocfeV5faorriancLeipaibdms ner oss EeTlozcroar T i7 LE nEnw ue oInglivideuaalFo9oE 5t%edCelseeDr eFvor eNeanmne L3evel o1omger25nek sEzeRoe eST CI ImI I mI :3 FE 2.5 so Pooled stDev = 1.293 -2.5 0.0 One-Way aTnaarltyesis oAfnaolvfTyasrieisa.nlocfe Vl5fao5rriaFnlcueoaroidisee Tsloeetraolr 1 ashese ase L33evel w:o owmegeaes 1s mSmeRYrR MR i Pooled Sthev = 181.1 oerr ose o LInndievidosnalPm o9o5l%edC CissEoe eFovr MeI an n oT C oo m) mm 250 500 " One-Way aSnoautryeesis AofnaovflPayrsiioasornscfeiVsf5ahorria@nWoceimTeDr) e001r 0.002 fTBoroeeelr aooet assess TIanadeiividounalPo9s5in %esCisstoFeovr Nee sn L33evel o3I waoemsenco0 AR se700e71.y03 e(emmmmremen)prm-- Ein : 3 pooled sepev = 496:8 TT Tee ses 4800 One-Way Analysis of Variance Analysis Eieezor of vT F aria anceE ifor R oem Seem ear 0002 idsal 95% CIs For Nean Total Level 3.95ve0m see n TLnedeidv on posted stoT ev meen 0.007 (rome) 3i5 F 1 LR SS Shem mn hei 230 Pooled stoev = 0-206 One-Way Analysis. of Variance USFW 1233 000657 Hanseiyeis ofcpvpariance pforGmE,T) EeToreor i2 20T0e6n5 12a02l.d2 Total & 2207 L:3evel 2:No 531M52esa%n ssaeaapenny 3 3 Tslss7 4l785 sas2 0.000 BIansdeidviodnualPoo9l5e%dCISstdeFvor Mean o(emieecom)nl[SR RISpNr RNENN Pooled stoev = 4.696 20 WRT One-Way Analysis of Variance mpraeiyais ofcpvsariance e for GeAf TD i, Eriorcor 24 000.001282167 001.0000013173 37.22 0.003 ota & olozs7as Individual 95% Cla For Mean LZever 2 0.1o7M0e0a0n 0.0s2e8o2a8y BSaoseed sotn PTooleRd SN tbevR--E ----R--N 33 33 oolloolmeoeor oOlio2lisn (---ee-n(nF)euntanasy Pooled stDev = 0.01947 5i000 0.07 o.140 0.210 One-Way Analysis of Variance SAonuarltyesis of"Zovrariance 5f8or CadmiuHms * _? Eortraor 4 L3ever N2 :3 23 Pooled stoev = oolloolsotsayr 0.2H3e5a0n0 001l1a50530303 0.05140 0026 0.0S6i3D6e4v 0l.o0s07e0s7 BIsanisdieimdveimdoeunaolmPomo9ml5ae%mdtCmISestmDeFevomrmsMseeatnmmmmmenet (m=mmmE nmrocioimn ) [-- 012 aa o.3s o.e One-Way Analysis of Variance SAonuarltyesis ofTovrariance sfsor CalciumNs r ETrloortcaolr 24 20106272685226178 75@0s5s7a0e6l70 & 316953406 0.11 0.897 Level W Mean sway o BIansdeiedvidom unalPoeo9l5e%sdCIIsn stRbeFvolr Meeannfl 53 22 223350000 FE1EJ --r --------r ------ 3 5 mm 12228 (rreemeomeoeeoeeooo) Pooled stoev = 864 10000 20000 30000 40000 One-Way Analysis of Variance ASonuarlcyesis| ofDVFariance 5f5or ChromiXusm id 2 sous 503 1ssB os USF, 1234 000658 sHrooerl iomea esa gener aISndEiivRidCTuhalIoo9St5e%SdCIsS steFvorT He eanSe L3govel : oy 3 RE wae% EsnI wRaEs m es m T s) I e sooted stoev = 6.733 5a2 One-Way Analysis of Variance Analysis Eiooecor of Variance for@aaity iTaEnse onliaens nos 0.00 Tot Lover oEs yi mean soe S TInedeidvidounalPo9s5tt %edCIsstoeFyor MF eI an RA oles qranrwhsanny 33 : IHoR se aRlisees en] Te ia eo Pooled stoev = 0.1771 One-Way Banrailey's?is Analysis of Variance ofSoVTraroianscei5f8or Coppaegrv6s 2s 00 TSfeoeeacolr H PoE E ome soy aIDnsdEiivRidoSuaaTlecI9t5e%IdCNIssiTpeFGvortemT eneneee . L35evel : o1TE oe eER amseLoaE las enI eIrI I oI I, 30 Pooled Seow = 63413 oF oo Ex One-Way Analysis of Variance Aainoaeely"sis Serer of ToVTrariaanTchFeeodSfeor siecsoamoaussz 36.08 0.003> Tonal HE LIantdeiiviidounaloo9t5e%dCIsstoeFvor r Mee an L33aval : FIITR oDausdse daRelEes (emmmtemnn) Co ee Pooled stoew = 317.5 Tio 200 3000 One-Way aaompagtpyiasis Analysis of of operiven sariance Variance forE(@EaD>t Ia CE pElrocryor iHE onoEEoe ooo snttvigunt 908 1s ror bean u USFW 1235 000659 Lzevel 3 2 2 1.M6e2a5n0 oso o0.ls2it6so1em6v : 3 012000 0.0958 Pooled stoev = 0.1735 One-Way Analysis of Variance SAonuarldyesis| loc ofoFVariance 5f3or T aew7s Magnesuisu 0638 ETrortoarl 5i easressezss assis L3evel 3 I o1mese5m0 2 aslo seesesr 71 3 3 zs aesls Pooled stoev = 262.5 One-Way Analysis of Variance --BaeseedniontI Pooled StDE av GeameR nteans) (==-i--=[ ) R-- ooo oe a01s 2.97: 0. Be Iansdeidvi{odrnueaelnPoaC o9ml5e e%mdmCISmstI bDeFmvomrnMnI et a)n ee (emmoooesoooen) Too ass zea0 STooeurce| Eeror DFD3 aa7l3s3s Total & sas . Level z Iw onmesan :3 F ERC C Pooled stdev = 13.56 7% 0s- 0.00 183 sewev BImansdenidviTodnuRalIPoSo9l5I %edClSstoeFvoR r Mean s eds (ooktsomourensmpsmasna}nent are] a 120 One-Way Analysis of Variance ASonuarlcyesis loc ofOFVariance sfsor 2 ead Nickelus 22.8 ETeoztoarl i& alsoss Tels L3ove 3 2 3 7m.e3a0n0 20200 s4e.pee0ve 0lal : Ons ae Pooled stoev = 2.559 3.43 0.16 IBansdeidvidounalPo9o5l%edCISstbeFvor Mean ometnmlr Ie ee)ns (ee mmomemme zismemeen) 0.0 0 To iso One-Way Analysis of Variance ASnoaulrytesis Toc ofoVFariance 5f5or 2 isos Potassisu 802143 0.55 0.615 ETrortoarl 54 75483360208060 147500 Individual 95% CIs For Mean L7evel F zs n Based oI ne Pooled StI oev. I USFW 1236 000660 3 23 aleiso 1469750 (eommmmmmI mmnmI mtemI memmmeme) 3 rooted stoev = 1207 ross Then ie mess One-Way Analysis of Variance SAnuarlyesis Toc of oVFZarie anceef55or 5 30 Selen1i5kus5n as ase oa ETroriorl alee Seev BIoansdeeidveidoeunamlPoe9o5ls%ediCISmsEDeeFVo-r iMeeanTnTTI L3evel 3 ioaisMsenewF o2ear2 ep( ra II. IT : E fooled stev = 1.138 5.0 is EX One-Way Analysis of Variance Analysis i`Sooeurce of oVFT%oar6oi.oa0on0scs0ee2el0fly0or 00.s00i0l00v00e35ri0zuss0 6.86F (o (9G.05xs 1 > ETrortoarl 010008857 wea | semen o BIansdeidvi=do=un=a=lP=o19o75le =%eIdTCTISTstTD)eFVor Mem an L3evel 3 0 3 50..001300908000 080.1.000001000000000000 ((--=-=------=t==7IIIL teeny 3 posled Sede = 0.007073 oeoo o.o1s | 0.030 0.085 One-Way Analysis of Variance SAnoaulrylseis Toc of CoVT raria ancee5f5or i sits Sodisuemuys 137578 0.26. 0.78v0 Eoerraolr ez30es iInsdeidvidounalPo9om5l%edaCISsttDeFovr Mean -------- L3evel 3 FIp R ooasssso 3 elco BesEeosEsii e I C t I I m I I ) i Pooled stoev = 370-3 Js 4000 4500 One-Way Analysis of Variance analysis of Variancefor@aniivn) loc 3E 06.108002053000000 00.00000102255000 $0.00 0-003 TEoetraolr 000026000 mean | sede oBIanosdeiedvi-doTunahlPoeo9il5e%idCeIStesDeeFvo.sreMseaenreetner)TIT L2evel 3 5 %2 oOl.o0s5s5o0n0o0 0:030000 000...000000770000770130 _(z=t==) (remnten s 000661 USFW 1237 Pooled stoey = 0.005000 oc. 0.000 0.060 One-Way Analysis of Variance aSeonsaarikyea"is of"ovTrarianscoe.ssf50or Qenasian) 04s sai, 0.003> TSoemearr :idE ab Wise BIlnedeidvidounalro5o5t%edCItsoFeor Mean L35evel 3IoeSSmdenm gasleaTpsesy SltTRJIRMEOR.o Eate ---- i E+ Pooled stoav = 0.7627 oo Fy To 7 One-Way Analysis of Variance SAfonoaearkleyTMsis Borer of"ov2rariance 15f8or iam Zinc 3Bus aer5 on> Teal Level PE wean seoey 2ISn5od0irdvtidof unalFoo9t5l e%dCItsbo eFvor Mee an s IIIS 33: iIomO aasnH s NaE0 I CI IID Pooled stew = 17.59 100 Ee 0 000662 USFW 1235 One-Way Analysis of Variance Sa SEI One-Way Analysis of Variance One-Way Analysis ofVariance One-Way Analysis of Variance Hee on oted sever 000663 USFw 1239 Level 1 3N 3 13M0ea0n0 omnes 32 : 33 3 1a3s30l0o0 Ils Pooled Stoev = 27.05 1S4tD8e3y aslse mm(eS(mIcmIomeTmoTemImmpImmeImeIzmIemmImeIeieIimIztoTeeNmeDes)mmmemteoene s9ell6s4 ails (emmmmI mmmp ioeI zizoooL iooS n), 120 150 Er One-Way Analysis of Variance ASnoaulrytseis| Sinple 1 ofoFVariance sfsor 4 0.2687 ETrortoarl 10 ooleleesr L1ever 5 1.H0o0a0n0 3 100000 32 Ss 333 1a210l00m0000a00 Pooled stoev = 0.2582 BerylitSus 0.066) 1.00r 0.452 olose SDev oBIanesdeeiedvaiwdocuntalrPoeo9sl5se%odmCeiSestsoemFvomremMeemasnmteemsees 003100000000 ols ((-r----i-ioi-o-o-mmrHieeomoomsooemeoseoseaoneons))lessscrsasasy 00..00000000 ((-zom-m-ez=smomommsttzeasonznoiaaoino)) 5.50 1720 150 One-Way Analysis of Variance SAonuarliyesis| Sample 1 ofOVF&aria1n0c6e5405f50or Calciums 266350 0.30 0.874 TEortraolr 1160 10e04s28i33 esIs Individual 95% CIs For Mean Lsevel 3N 26M08e.a7n 9S9t6D0e3v |eBamsre(tdseoiomnimooPmmosroailoeeordmmaSeitroDoeeisvomimisieieleytmmeeees 23 Bb3 33FRE0a3eJ 3 P 12a7e000l3SE a (ACToImmer eeeee peenns] 30ORSS MS my Pooled stdev = 947.5 2000 3000 4000 One-Way Analysis of Variance SAonuarlcyesis| sample 1 ofOVFariance 5f5or 4 5803 Chromixusm 2606 TEortraolr F0r 15903 isis Lsevel 3 u33M%ean 3138 SdteDenv 20m :23 333 22108338338 2e3l0oosss Pacled stDev = 3.952 156. 0.263 BIoanosdseiedvoiodiuneaolPoor9o5il%egd-CiISisteDeFivosrctMmeasnesseemtes (eemmmmCeeromamemrsieis)esteetmenteaneesnenyzny (memmmomm{rsiimimomoeieimomnb)armmnnnnd 1550 20.0 30 30.0 One-Way Analysis of Variance SAnoaulrycseis ofoVFariance sfsor Cobalts USFW 1240 000664 sraomprler Total 0& 1 21336.37 390.0 239.32 1.68 0.231 Individual 95% Cla For Mean Level N Vvo+an SEDO + Boaosmedmmocn pPmooelmemdmSmtmDemvemmrsesmeoII Er. L 1 23 333 s2laelle0o0s0 329.:.5e01e02d 1.000 J [--pr-- (I) s 3 7000 Pooled stoev = 4-830 12.0 18.0 24.0 One-Way Analysis of Variance ASnoaulrycseis Sample 1 of DVF4ariance65s.fs6or Copperus 1263:043 0.70r 0.608 TEoctraolr 01 229383..93 BIansdeiodviedowunaelPso9om5l%eedmCIS-stmoeFmovremMemaTn TTIINT Loevel 5 aseioa0n0 3B S8E.D5e5y7 Sih imep I er n ee] e) 21 3 33 m30a.0a00 30% 3e.s60e6 Ge (JR mmm)a] 3 Pooled SeDev = 4.830 15.0 20.0 25.0 One-Way Analysis of Variance ASnoaulrycesis Source. of DVFariance sfsor 10l3a68m14a66s67 Iron us a36a6n1e4n6s6y7 ue' 0.375 TEortraolr 14 539500000 SEDev aIensedei-dviodouenaslPom9oi5l%e--dCsIStseoemFvo.mrnMTeaInTIIITT Lsevel 1 N5 3 2e87a8n7 22633 3 32700 s9091084 (mmmmmmmm=m(tmmmomm=mr m)mmmamte] mm=mmmomT) 5805 mommmmmmmmmmm==n) 2s3Pooled Stoev33 = n6e05r1 424203 ( lo(ci o |i280i 00 )35000 One-Way Analysis of Variance ASnoaulrycseis Sample L of DVF4ariances9f0so9r Lead 2u2s7 8s 0.30 0.871 TEortraolr 140 7s5a5s5s BInadsieevdmidotunmalPmoi9o5lm%ed-CmIStsmDeeFvom.rmMTeTanIETTIIT oLevel 3 3 awseea?n 263 St5D0e8Y) mTm(iimmmemeeemD) FE ---- 21 3 330 3 2si4e8n) dso Soar e062 -- (m I te ) ee) 4 Pooled StDev = 27.49 28 so 5 000665 USFW 1241 One-Way Analysis of Variance SAnoaulryiseis| Semple ofoVF6aria2n0c0e005f73or Magnesiusu e027 2.41* 0.118 Tfoetramle 1160 a26s0o6e1s3e3o 269813 Individual 95% CIs For Mean Lsevel 3 OEBm0eEa0Sn 3S3E0he8v BeamsedI on PooI le ed SI cDeve ISe 50 (eee) z1 33 333 bd30se0od0 Is38aE6es C (smer mmmse eeTmer) --eeot ) me) Pooled Stbev = 499.6 2100 2800 3%00 4200 One-Way Analysis of Variance _ Saonaarldyesis| eer ofoFVFariasnaces5fs5or Mangankess ase 2.67r 0.0% Tfoetmaele 1180 31653s93109s6 163920 Individual 95% Cis For Hean Lsever 5 3 ah eslo Based on Pooled Sstdeev adnonso eC ee 21 33 33 DDeulo 3 omit ssuse? amis {remonmC sammpmy en (eemmtreiey Pooled StDev = 404.3 So 120 | 1800 One-Way Analysis of Variance SASonouarrldyteseirs| ofoFvariance sfsor "m0 Nickelus 01 TBorteaelr 1l0a 3e08es 188 sL1evel N3 2ew8e8a7n ISS 5S.tD0emv 3S 32 3 33IB h263nS 33 EedN laesee Pooled stdev = 4.351 uss- 02s BoIanmsdeeicdviilodunhallPloi9oi5lo%eedsCISetstDeoFveo.mreMeenaonmmmeevies (emeJ nJ ts)] nt ee (een) orme Go a0 25.0 0.0 One-Way Analysis of Variance SAnoaalcylseis Snier of"oV6rarianecsessssfs0or Potassiuys 172160 0.98 0.458 ETrortoarl 110 21473467557333 1483 Individual 95% CIs For Mean Lsevel N3 mmoeaon 3300 sStsDesv oBasmednoin Pe oF oled St tdev. O m atie 30000 (smmemmeeoriiinee) 21 3 seer 5033 J a] USFW 1242 000666 33 3 3 aS se Pooled stdev = 418.1 4E2o4 e (smmemm mmmiTR) Toco aso 2000 One-Way Analysis of Variance aSnoaulrycsei|s Sece of OVFPhariancselsfysor tp aml Sodiumus a3g1e8 asi 00? TSoatmpalle 6 sen Hews sepew IB--ansdreidvoidounnalFlo9oll5ediCIsTstvteFovreMeeaeI n erre Lsove 12 J 3 a$st8er 3 Wise sF.0s0s0e zw (memeC)hm eesy (emommiormzeen) 5:Pooled stdev33= ORS6lS.e1E4e8 7e.8n3 mm 3 m 5% One-Way Analysis of Variance aSSnoauelbyeseis of CoVPrLariancael5fs5or 10 aa VanadiuSms eits] zsr 0a fToeteabl 1% seo mean sepev oIBanmsdeiedvildounlalPlo9of5l%ledmCISestomeFvosrI mMemaon eeeee Lsaver 1z 5IOaNsEi 3 Gsm samimmses ee Ce I Cee (cmmmmmmtome) 5iPooled StDev33 = SB 5o-6o45 zReEdE Je ee Tm ho wo eo One-Way Analysis of Variance ASnoaulrycseis Swe of oVF%%ariancseesfssor 0 50017 Zinc us a5p00a3 ms 00 Erorroarl 1 sess spew IBSnamaseietvdiIdounIalPTo9ol5l%edoCISestomeFvoreMeeamn rees Loevel 12 37 aavsaein Goo assaoanme (em(mmemmmm(rnmomeam)r)e) (mmm 33Pooled spew3EI = 8I 9.0490 ResoC s ps t 5 50 000667 USFW 1243 bMi ee2 nmoinstey H1 Bl [LITryE oar|T|||RFe EEFEphen persMsE,E: Re 32Fv2EeoenSF | IPTT TITIITTOE ET|IISTTREEEE 3:2 Cd2ht H+ |e $d 20 WETTER r | |IRS rie) (883) 5 F TUTE] 3 | 2 LACT TT My il] I me HE [LTTE] 33 | 5 <382 Li LU Effs [512] [LL STITdTk PF = Y 000ees USFW 1244 = i: :. fd ee =TT ph: come | 300 TETE (BC come [320|cme [sme | 5: EE Co|3m01 Bem mee (BEE EE |AGIEERAEEEEREE EE |B] E EREEHEEREEIERA] 8 85 0 BAEERAERAEN E al SRH LHEIEFIAEHA EARH EEEARI IHEBEREEAEEEIIE RRERAERERA EEERR AEEEARsAAYs: Ee bzs= RERAASLELEAEAHEEEEEAAEHBEEAAEH EEEAALEE RRAAeREBAA ERREEEERARAAELH boe:e CH SIlEI PIEE E EBIEEH E8 B5 EEE EAEEE]IREAEH REEARE8AE E8EARtENz: CEERI EE EE EE EE EEE - slefe lune oleae lele|s]els = clas Ele A EAH EA a]EEAEHEEAEL ReARs A REAEEAE Bee L|EEEEEEEEEEEEEEELEEEEE EE R E R EREE E ]! ESr=eotne [|EE0As|lHEalE2 eAfLBEEe)lEGElAHaER)lEAEEelsEHBEEEeRBlE])eINsEAlEeRAlEReAlEHElESe. mt (papel lalblElelElolalalals v ETeEmcn Z g EID097930 000669 i ---------- mm AT re i iHyipph r if pE hEE o) _- pf r 1| lh dl ith : wt Loh nt | 1din Tamil 22 EID097931 v 000670 TERT oe |G | 055 E52] EEE] E|E EAE Eu EIEAARRRAEAAE RRIRAE AEIAEARRAEARAL EAARRAENIRAE AARNAALIRAE EAARRIRAAAE NL fBe=amn CSv|v IgEREEEEEEEIlEE| LEB BIBEE E |E|E |E SE BEEEE EEEEE] E]]|3 |]EBEE p= le EB EIEIL EBs: fPerame APIEEAREAEEEIRA|NBI|AIEESRAE2AR0 E I5 RAE8 : ElEEARelAecRE5AcRRE A5RA8N 8A1RR3EAR:|SF = ree : (A5E [ABREAE[AEAVREAR Elalilel zl EAE EAR E A AREAE E AR ] A tigls EEE PIELER EE) 50 BE 50): EAEEIRRAE EIRARE ARE AEIERARAAE EIRAEAR AE ARAE RAN EENieeo=eem, pp bEl lmElBm lR leeEEllBB zm2|eeE8 (lERaa5 lEleE8 lIEgsB8|eeB elBE(l E lnEell ell=sEE e ]LeEE ] l: poo | uj| | ml gis v STiEmER gg EID097932 g 000671 f BT ShTe EeT f en e y he : ie pC 1L 3 eet H ie e re k beeeeentd, | 000672 : Epfee petti a GSE ~2- Ze==feiz RE = ad H jff frh in o e n fof fe protec] i a Ba. SgeeafE xB = an Hb H pff ee o, ffvo| `| i : vited;JiAhssainpidl) i Z 2 oro 000673 idvon ff eta eo 2 La 288% 28 < =f I Lh EE2 2 2 2ssaanai3a2g2l8d = af = = $ E2585s8 BYPRE cae fevsi3sif sR = ad . j2 aElF l[.B2R 8 eo. os23# | 3 2g 2.~2~ B28RnI2RcE8S2I8R% 2U8S 2 &53 i aonnnniBsslBfE B28R 2= 9wRm 33 cefangonel 2sEirEiizeze.i5a3latiE2H. gi,n2iz3zicnaE=if )ysi ik go EID097935 g 000674 - [2 B|E pram i poLo5s55s5s5m5s5m5m5a5z55a5z5a2a2z5a2z5a2a35z5a2n5a2a3d5]) 835555333 I898988EE22323323] i i Ei L 3 SS55855EE558585588E852882383Y ihi34:38 FE 3 .55555559553352222535533333 : 3RE1| 33sssssasoiaassgsiieiiisiiis $di E3OEE ii =3 fF 3 lB : pny = 5 3b555005935333233333333333323) <3E3i3EasoassyssssssaEaEREasasssaTgIEIiYsIiRaEaRi8a5a5c3eYe SE 5 : a 3]i 2 3 i bs | 2, iT3iE3ao88dcE8ie8a,gaoSac2IdiEn-$Ii33Ii.Ra33If3pEncSSnoSEinAnSiSeIiExNyReNyEs 25I g2g 2 F3 Ei ZEg3e3l8g5g3500aetacsizcisceczad s 000675 gip09T36 B Ee i] E =m , Cm , [gm IHi 1p fg m a hy TT a Lil aliTio Bithy iii || : i} EiID097937 g 000676 : footed Fes Fi g - i fpeseseeensninsnsnsiatanasy } Hu%p y doo oo0s 050s 055e53s 525s 233e 299s 253533 4I [ :1 grr Hoyyyovssossyssvrvssiaiaanny i eenomeE f1i 8 br A F2H iR7fE5EE% E3|It.aa E&yf00oo0TrIiiIiiiiiiianianany i= FigR2e thoes $55333333333335775778R8aaRT F #4 ho552552522232235222322233323) 41 1 3 s 1551, iEzg g E Le Se$e2%3. dia aa~Siz.n5i7itz3fghpisc=na2afaziiiiiygl | g g2 EID097938 000677 ` SO he rE eon cof ol [EE cf [ie me GL EEEEE EEEE EE Eom LE EEE EEE EEE See [EE EE EEEE EEE Rmtme | EG E E E E EEEEE E E EEEEEE ] ELLE ge iE EEEE E ESaeme mmm | EEHHeEEHLE LEEAE EE EREEARERE EEEEE AEReAEEE AEEEAEeE A bm Ee E EEE E EE] od ELLIE Ee a EE EEEE EE] rm EE E EEE E EEE bromlEE AH e EH EEE AH mm (ELE EEE ERHE EA EAEEAEE A EE Ee e eela EHEAAHHAEAHHHAHEAH AEA AAAEE RA NRRH EEIANEAE AARHARA ERH AAAR ERAARARE RRAABE |EtcSomemranLLEEH E AE E EE E AH EE RANE E AE E RR AE NEREEIIREEAARE Ae RRRs AEeANAEe Ae REAAE |Sm irvine) 2 EID097939 Ss 000678 _--ss e I e ee._-- pn le e_-- = = -- ee e ee e EE we wn dg 2 ;- TABSLEmVC OSitmooer eese : opTr,s |[condmTMion [condiTM on [condaTM ou [c-- odon col" 5= E TSc gILlEEalS lu eBeBe lel el a|e ne le n els B aa ]l EsoT] lg yYeAB n|ga]lE l:eEL|s eocorn gggllllauuul eee lsaulu|leleeellluajsalll|eeeell|ssusl|lievs||e ]glagylle |eesl|lnnanlllleeee]|ll:tss le i B e-ARAglEuAeR B AEAeEAuE AtEelREA ]RA E|A slEAelu EA FeEm on ea b [EElassEaB ls eEa aa E lellBelB BseEelEsg|s8elaa es]]BE e):i pooaawemr lss s|v ulllluaaluellreege llssaBB R sl lYe |n EL|uls E EelfsBB ale |u eeE |BeElE ] eellsae R ]l: e]l] Eee [EERE EE rmmreaeaeeelen|| S 0R(ARlEE fR uE lASEE nAIBLEEE uEm EEE e EEAEn B EE eE Eaa ElE e E EAE] |nE ]E ' ova me sr Sslllouapu gye e laltasells eellEanlllEee|lERseelleeealylealleelelaln]lll|a]eestl: a fimo Ee scE llauln ee s ullaetellEndElleen|Blnlele elela elaluln elelel]nln]n]eee fSao B c s sllnl lleesea AllEyRn eEaEus lelaAE lns AaEe eAull AeReEnA em Em re |EEl AvE lB AuRaleAeo RB s|esnlulelueilnellnneeellusluleevfsnn]le pha 5 Soomancrom liulBtdll leeeeduls seleeevulilulnuleelee|lsanlllel eellll aalulluje eleeellil lnnnnl]le leeee phmaeemy peer | vgvElaR ulmEee | 8 BV Pm g s B Bly Ee l ele en Eus a lEaen l aa alleeel|aaa a]lllen snl|]n]nnl]]ttE p oAroeo ese ) Lgev |EllRuundlleyeSlu gB nn eBleV yE lHluE leE eaBasllleeeE lluRnslE leelnnBl]]eeE 7ftim nrt imtieie nmtppoeseo)tssk 5 EID097941 & g 000680 2 3 $i : i} Hf 12.528. I i J:{ k gi Tl kill 3 | | hl :z Hs2Id E3 zak | EID097942 g 000681 Ia i Hiyo PE 1: 5 BH $138 zi} ait hi | EID097943 g 000682 |, E gf Hi 3 3 iB2jS5e50l%d [2 | &8 2 FE kdl Hl| E : : 28 i Z EID097944 : 000683 : i 12 FE h 224, n1 Lo saosssEaas 3g HE] Li BY 185358 2 89 [iJ emma i': B3ibooo 255] i] 5 E 9=3] gpEi=tCC 2 Eyakiid 1. : g EID097945 g 000684 Thi itt IH 3ibHi ki i : EID097946 8 000685 hind jia ff heeedd 3 ooo ovacl ikxg 1, flo Liman 14 HE iE Ie H1} il pbo e 2P 1 g: bLsi ilot oae nzzs cog] l | thd == 2 ihfo 41= si BiEREsZzzerg 131 : a L1i9 oeananz ii " | 24 EID097947 8 0006586 lalIs fH iEa:. 8tBi HH r =] 5 0 : 2 KE EID097948 8 000687 ih bp >i ennonnzsl I Ritheasaac fp e=tl cwo-nccs] ile Bitgzaseazad hes i 2 EgEiRilaRoann is El] F8=5y2:3;8 BRo3EESRPszasnany thes inl = 1fF Lothoooonoes +# 3 RobEssreevzy 3 ETFTEI FPEEFERE BHEeE F1 H EI : wast-ied ii33:a24 EERE TE 3 EID09T949 8 000658 fre-o=1 iIs [Ee] & Ss fi,gi if ed is:li E ERM Fi I3 REesg zi [8 | I FE=333 i+ | Me ii EERE 240 Jellies 108% : g EID097950 8 000689 +A : 3 52 ii ef [=i = 3 Hd 2 i Hi E.5. EE "1g =338 i "E72 i ] $822 [age 38 : E14 83 58 3 I 11 | loogzgl 0 | 1 :& ! _ | gi: s gg ! 3i5i2 8 HE 2i3 2E8H3 E HEHEEHEEEA . g EID097951 g 000690 so . TABLED CommB msescBAYFest Simi Nom WashWoiodCnoungty,iWesotVinrgi.nia hr al NI + [tiieSntsesaeneatnn SSS E lIl iTy SE a ]|s|E ala|sslIs] sl38]8| 885z 1E .o3D-Dticahiaoce ro:beere:ne. nee | S 0S S 533 | l 33 l l i 3(3 |s 3s 3p3) 31s] 333]3 B * y i tSie | 0S S | l 3l | i 3 i [ pp 3s 0s ] 32S lra eoesnns S FGa I lall I el |I si |I wi li alHe] H] ]|S E o ey ne s2eus eee | S GS P3 lal [3 3 a y [3l 3 ] 3a 33n 3 ] ] 2B A133] = rFem iosoea ue ee ns S a al l l y y s s s] i is s= |B [3 (333s eimai E4rSeTr ee rion |S SB ly[3 [l 333s 3 B S Sli li|p alsial]s ils8 feimerctemete [Sarno a SP1l3l a3 y alss |31i 33s s Sills SoSOr romne rooei S P PliE i laR ll aF |al la|l|s 2| S Pls 1 ala3 la| 3 3s]: 3s oPeemcoarseinn te | Sa 0 |133 l 303 | y 3 | 123) 31]3 : alilali z| 3 [ppomipermiaes || prmeteee S|l[ B LaYB l13 a|Bl3 S lBa3 lS a33I 32 ]S ] irciroeneet Foon a APSl1a3s]1l 33 l |3513l |32| = allyl) o[eProoytersemaassee aa Sllyl ispsy sa)s al sla s a lal lal] ) |3 |] bteoeenoinn Borremetmmocahene | S H 2a|l E 33 iE 3j[5y3i33 E3 EsE13 3l133 ]l ER2 sE [[mEranamaoiomonceime a S alldliy pssiisl]ls alysils sls rpeseiens aaldlylasls ala lala l [-- EID097952 000691 . TABLE 24. ConceDinytFranaotCfriMeoeeknts in Fecal Samples: Washinglon NWoavdemCboeurr1y9.57Wes Virginia CR mmoinniym 10 J a 2 Te T . [k pentium 1Plus | ow fe | a fas | ue | u1m cu nium hromin 110 | 13100| oso| 1300| amo| uso | 2 ico| 1a50 ospalet. ron 2 Do wleo | so o |sess|]pe | wowo] | mow0 | as136o flrisegoesium nganese 32 | se5o | lS | weeo || w3m | ws | wwomo || as3 so | em|| se | es | sToww ww iBecrtcy JPoas 1002 0| uso | nso | wo | smo | reso | r2me0| 1E3S00 isScdieunriom z2 2 | wo | suo | we | eo | sew | aso | 9s | Wonlsidsimum ne 2' Jl e2 lm dn lo | o2 lw3 ls5 Note: Blank spaces indicate compound not decid g EID097953 s 000692 To. TABLE 25. phi ConcentrationsofFluoride in Fecal Samples oe mm be Z2 EID097954 gg 000693 IEEE E l= E I - e - EE ] E fe | e-- -] elos Hse wl Ci1oH -__ = = ai i fo fl im th La EID097955 Z 000694 . PeTrAceBnLtECo2m6p(ocsointtid)o.n oFfreFquunecnticoynaalnFdeAebduinndgaGnrcoeuTpasbPlreeosfeaBtenintthhiecDMracyrRouimnveSnteubdryaAtreesa `Washingion, WDoeyodRuCnouCnrtoyc,k.West Virginia November 1997 Sampling Location Refere1 nce mn Iv [ColecorGatherer[CallciorFlere [Shredder scraper TPrederTVieOme| 21s 41 05 211s 527 22 2 s 8 2 g EID097956 s 000695 fr |En ( 4sa n 11 IH| }i(Adtm14 HH l ea PA mts po Fomor 3838-385-8-82 i i i Indy bit lili ii ! | ]: : EID097957 5 000696 contwo Pf s pee n1 l | Jre t BI I kop osfszeasin off jP l BEEm TXRE fpore F |EEd E]| . i I Tutt tnt: g EID097958 000697 - ree i Fe i! I sna 1 || [mr HT if3s451 :sfrzesstz of Ef J ETRE ! bern fr = slaemate zt 8s 1 [femme| ES s 38a%assfz sf f 2g} i s i all Iie Histhth &g EID097959 g 000698 . `TABLE 28. Concentra"tDiroynRsuonfFClrueoerkide in Small Marna Washingion, Wood County, West Virginia November 1957 es fov-vole 150 on-aa-2103 11700 nac2 1950 jCes 10 10 CC212 w | immw n1.0026s i15m0 nneesre 1a8s0 uic2s 1% ffm1o..Ccs-22s8e 0105 v.C5i2 wo | 1100 RvEeFD1-015 11500 ) per h2o-Er1t20ta0il1ed2S)hrew w| 0 w | iw fm8.-c-1100 1H5o0 ui.cC.-1173 11500 i.ce-2122 10 Bire-r12s+110) Bera wo | so | 11n50o0 rer1 00 | 100 Keerre2s0035) REFF-10 mwwo || 01100 [ipste Footed Mouse w |e vm5e-2192 w | 1i0w [RMaerad2o-w10JumpingMouse 10 12A-21s9 wo | 11600 i3is7 Lo Zz f11o5r-e25] u ulno g oe: Bias neopets 000699 F EID097960 - TABLWE 1a.Lihpd COiorooannnCocuCgtnonkWoadeMoanVmnigs,nTais Nowa 159 on ftrees | so [male TorTSowiebocsnonLb J 25i iBikeSen ||| ooamhm i5ion iffrrne | om iiiooose aEtenhn ||| ooonnh ifi-o ifWrrwese || oInR |ia erislns | | oe ok i wfeoni || im 4-39 nnWhcee2lra2 ||| ooatnmmh : iiono anfierns | |iie iaihs in ewoenns ||| otonse nica | on i1%2 Wveiesenh ||| ooimmo Ia53 3 aVaedls || oamm Nirds | os 355% Mieassno || o|0aW r%.s ri Riidg)g | os iH i 2" i sim | ow oe Sample 16 md ound np } z EID097961 000700 fessshimsnisat3 + . IN 4e%ls c=zoB. 203-%2-8 32 3 BE seston 6of pip2 sfessasencd ofof 1HFporshnssnishag oo 25 z[Eges -ez=ezzfzufsesccBisifmeanli-. gif ing 2i8gsPte a!3 zwgg2Essfg<eenc.-g88888:=zn38: $3Eny % . g535g380 Ri3e ~posssiBpsaoncgEzziEsssiie fi_ca ig [1 = a 5 8 3 I5E oo3zZoI2ifvoisszfgI3sZzzaailei"e 8E3E:x3d B = roxEvscmzS-xE seal bf3 apsete ii w2fs00:88028-38 og 2 i iif ames of i 383%-08a~-22808=80 i Leasszcsesnsnsana] i : Jl 4 EID097962 000701 22 2 El4 2 cEx8 Hr IE Si22sEif IE LI Hi 2 FE 3 ig Lz he 2 ii - 2 EID097963 g 000702 2] Ef 2g2!] 3,i; 5 2.3. Esk fag23d a 12 Sais Fh5 fF z ii! Ei] & i . ha 3 Bi 2 Z EID097964 g2 000703 E EE T E f WT SrE eE e b frE rre ai ) Prigf i [| frat ih fa et m Pp Phen Pp e me a fb petti TmEp RE ltd $33FE~s3~-350R-285] ld niltsgad Hat)? . : EID097965 000704 I rd Ee ie rip 1i| lt FiH rilie es TlHhElE] pF rimeet ee e|| i3 000705 Tole 34. ResuolfthseDArnyalRysainsCforeFeklSitue oinrEarithdwoerm Tissue Washingion. NWoovoedmbCeournt1y9.97West Virginia (@asedonDry Weight, mgs) [Teoryr =T=Y=17 oonnall 11BC oLbb quia | Lb 0iw I aonnrooll 2210 boon. Loib rat F0y 350 boboo0oisA Anraatl Aral m1m m bobioisc Awmaalll bora Aral m1n% 150 bo0o2sr8ac AArmal Amv 2050 m bobsoses boi AmAamalt Reference 211000 boboiisc. RReetfeereennccee 020 a g EID097967 2 000706 iHh th CB i3h i5 5 It Hi vf e iH i I i i i i g EID0Y' 2 000707 fretes HbyY BSpeEt E H Wi rt t Cf ji Ffipm eet t e fram me | i dn:i iis 2 EID097969 2 000708 St !LH tp hk diPH Hilt ooi| i! ii ? EIDO9T970 i 000709 re gig] g L3 3H 2FH a HE $3 oly gs 5 i:| Fir i g, EID097971 000710 :A `Table 39. Results of Histopathology for the Meadow Vole . ro. Lisation C1 Liver Kidney `Washington, Dry Run Creek Wood County, West Virginia, November 1997 D2ATE ENVIROMENTAL omnes `This tissue is very mildly autolyzed with acute congestion. There is some fracturingofthe tissue which may be due to freezing artifact. RSepencailfitcisostuheewracshannogteidisennioftieiddenitnihfiiesd.section. Location IE-8 Liver `This sectionofliver tissue is mildly autolyzed with minimal congestion. `There are very few eosinophils and lymphocytes in the portal triad areas. Specific other change is not identified. Kidney `The renal tissue is mildly autolyzed. Specific inflammation is not identified in this renal parenchyma, Location II-A-13 Liver "This tissue is acutely congested with freezing artifact. There are scattered inflammatory cells in the portal triad areas. These inflammatory cells include lymphocytes and some eosinophils. Acute congestion is present. Kidney `The renal tissue is acutely congested. There is mild freezing artifact in this | renal tissue. Significant tubular or glomerular change is not identified. Location LI-A-20 Liver This tissue is acutely congested. The tissue is well preserved and not autolyzed. There is some hemorrhage over the capsule. No degeneration or inflammation Kidney is otherwise identified. `This tissue is acutely congested. The renal tissue is well preserved, with no evidenceoftubular degeneration or specific other inflammatory process. There is no hemorrhage in the medullary tissue. Location I-A-24. Liver Kidney __ Location L-C-1 Liver Kidney This tissue demonstrates separationof the parenchyma as the result of freezing artifact with acute congestion. There are focalareasof hemorrhage: in the liver parenchyma. The renal tissue is acutely congested with definite freezing anifact. Specific otherinflammationorchance is not identified Tubulartoxicityis nox ened, This tissue is very mildly autolyzed with acute congestion. There is some cfrhaacntgureinsgonofttihdeenttiisfsiueedwhich may be due to freezing artifact. Specific other Renal tissue was not identified in this section. 2 g EID097916 3 000711 Table 39. Results of Histopathology for the Meadow Vole Dry Run Creek . Washington, Wood County, West November 1997 Virginia Loatoamncs Liver This tissue is fragmenting and demonstrates some separation asifthe tissue had been frozen. There is acute congestion ofthis liver tissue Kidney oTfhitshetipsasrueenicshsyempaa.ratIendfalsai mimtathioand obreeonxifcroczehna.ngTehsoerfetihseatcuubtuelecsonagreesntoitonidentified. Tocation L-C-7 Liver The liver tissue demonstrates freezing arifuct and acute congestion. There earxeudsactaitotne.redThfeocailnfcloallmemcattioornysopfrnoecuetsrsoipshvielrsyisnetvheereliivnerfoticsasluseiwteisthanfdbrisinous Kidney varied in size and shape. "The renal tissue is autolyzed with evidenceoffreezing amifuct, Specific tubular orclomerulardegeneration is not identified. LiT ver eill"iTvheerlpiaverrentcishsyumea.is miSlpedcliyftioc mceoldleurlaarteilnyflaauttioolynziesdnwoittihdesnotimfieedp.igImnenstominetahreeas, the Kidney "lTihviesr ttiissssuuee iiss smeovdeerrealtyelauytaoulytzoeldy.zedSpaencidfaiccudteegleynceornagteisvteedc.hanSgpeeciisfincotinpfrleasmenmtation Toon 06 is not otherwise identified inthe renal -- tissue. -- Degeneration s -- secondary Liver h"Tehpiastloicvyertetsisasnueddaecmuotnesctornagteesteivoind.enScceoatftefrreedezeionsginaorptihfialcstawriethprmeisledntauitnotlyhseisof the Kidney p"oTrhtearletnrailadtiasrseuaesd,ebmuotnstthreaytaersetmiisnsiuemaslepianrnatuimobnerc.onsistent with freezing artifact and mild autolysis. Minimal inflammation and no evidenceofwbular degeneration is identified in this kidney. LiT ver T "sTphleiltiivnegroftitshsueehdeepamtooncsyttreast.esMfirledezaiuntgolaytsiifsachtaswiotchcusrormeed isneptahreatliivoenrapnadrenchyma. Kidney `TAhceutreencaolngteissstuieonisimipladrltyoaftuhtoilsyzreeadctwiiotn.h acute congestion. No specific tubular dbeugtetnheirsamtaioynboerdiuneflammpartoibolnemissiwdientthifaiuedt.olyAsinsyastowxeillc,change is not identified, Toomen CES Liver --_-- "This tisue is acutely congested with collectionsofcosinpoils and some loycmcpuhrroecdytiensthiinstlhieveprotritsasluer. aSdpeacriefaisc. oMtihledr cthoamnogdeerisatnoetaiudteolnyisfiisedhas Kidney TThheerreeanarle tfioscsaulecdoelmloecntsitornastoefsinascpuitsescaotnegdepsrtoitoeninwiitnhsmoimledttuobumloesd.eraNtoe oautthoelrysis. 2 specific reaction or change is identified. g EID097917 2 000712 Table 39. Results ofDHrisytRopuanthCorleoegky for the Meadow Vale `Washington, Wood County, West Virginia November 1997 Z LivLoecrationmET "Thelivertissue is demonstrating granulated cells with vacuolzation. There is mild autolysis and acute congestion i the ver tissue, Some eosinophils and lymphocytes are present in the portal tisd areas. Degeneration is Kidney o"Tchceurrreinnalg tsiescsounedairsisllyi.ghtly autolyzed with acute congestion and no evidence ofany other specific wbular or degenerative change. Tocation T-CT4" Liver "The liver tissue is mildly autolyzed with multifocal areasofinflammation in the parenchyma. These inflammatory elements include neutrophils, lymphocytes, anMidniimrarelguploarrtamlotnroinsducilneflaarmcmealtlsi.onTihsisidsenutpipfoiretds some typeofinflammation. Kidney "dTehgeenreernaatiiosnsuoer iinfaluatmomlayzteidonwiistihdeanctuitfieedc.ongestion. No specific wbular Toraton C5 Liver "This issue demonstrates slight autolysis with acute congestion. There is one `sAmvaelrycofleewctcioolnloecftiloynmspohfoclyytmepshoaenydtepslaasnmdapelealssmianctehllesiantrersptriteisaelnatrseaasr.ound Kidney V"Tahsicsultiasrsueeleimevnetsr.y mTilhdelryeaiutnoolyezveiddweintcheonfo nevyidsepnecceiofifctootxhiecr cchhaannggee oirn th liver. inflammation Tocaton ILCT5 Liver "The liver tissue is acutely congested with freezing arifuct and mild autolysis. Kidney TAhlmeorsetnanlotiisnsfuleamismaactuitoenlywacsondgeensttieidewdiithtshoemievers.eparation ofthe parenchyma. TTD Tubular degeneration or interstitial inflammation is not identifieed rrr Liver "iTnhfilsaimsmsauteorisyacceultlselayrecopnrgeessetnetd.in aLnydmpahroocuyntdepso,rcaolsitrnioapdhaire,asa.ndSapefceifwiocther Kidney i"Tnhfelarmemnaaltitcinssoure tisoxsilciigthytliysanuottoliydzeendti.fieNd.o evidence ofinfection or degeneration Tocation IFES Liver oftubules can be identified. -- "This tissue is mildly autolyzed with some evidence offreezing afc. There are cSoplelceicftiiconhseopafteoocseilnluolpahrildsegaennderaatfieownliymnpohtocidyetnetsifiiendt.he portal triad areas Kidney "The renal issue is slightly autolyzed with no other specific change. EID097918 2 000713 Table 39. Results of Histopathologyforthe Meadow Vole Dry Run Creek Washington, Wood County, West Virginia November 1997 Liver "This tissue is acutely congested. The is bile retention and some apparent deposition of pigment in hepatocytes. The pigment may be ble or iron. Kidaey "pThairsetnicshsyuemai_sSapceuctieflyiccoontgheesrtiendflwaimtmhatfoicoanliasrneoatsoifdenhteimfioerdr.hage in the surrounding Tocation IV-E-10 Liver "This sectionofliver is acutely congested with mild autolysis. There are a few cEopliltehcetliioondscoeflllsyamrpehopcaryttoefs,tphleacsomlaleccetlelds amantdereioals.inoTphheilrseianrethaefceolwlescctiaotnt.ered inflammatory celli the sinusoids throughout the liver tissue. Specific other change is not identified. Kidaey eTlheemernetnaslitnitshsueekiisdanceuytealrye cinonegxetsrteemdelwyitghoomidlcdoanudtiotliysoins.witThhneotuebvuildaernce of specific autolysis. Tocation Liver REF-D-15 "This tissue is acutely congested, supporting acute death. There is very nmioldevliydmepnhcoeocyfttiocxipcliatsymaocrytoitcheirnfsipletcriaftiiocniinnflthaemmpaotritoaln tirniatdhearlievaesr.with Kidney e"Tvhiidsesneccetoifonosfigtniisfsicuaentistowxeilclitpyreosfeirnvfeedctwiiotnhoarcduetgeecnoenrgaetsitoinoon.faTnhyeroef is no the renal parenchymal tissues. Tom Liver ee "The liver tissue is acutely congested. Thereisalmostnoautolysis in this l`piovretraltitssruiea.d aSrecaast.terSepdeceiofsiicnionpfheicltsioanndorlcyhmapnhgoecyitsensotariedepnrtiefsieendt. in the. Kidney "The renal tissue is acutely congested with mild autolysis. Specific other infection or degeneration is not identified. : a EID09T919 gg 000714 . Table 39. (cont'd) ResultsofDrHyisRtuonpaCtrheoelokgy for the Shot-taled Shrew Washington, Wood County, West Virginia November 1997 LLoicaetion IILB-10 "The liver tissuei acutely congested with mild autolysis. Eosinophilic Tinhfeirlteraitsiosnohmaes soucgcguersrteidonionfthferepeozritnalg ranaidfacatreians.theMitidssuaeu.tolysis present. Kidney "spTehceirfeincailntfilsasmumeatisioslni.ghtly autolyzed with acute congestion and no other Tocation II-C-10 Liver The sectionsof iverin this slide include well preserved sections with acute congestion. Mild vacuolizationof hepatocytes has occurred throughout the liver tissue which is very likely normal appearance. Kidoey "The sectionofrenl tissue is well preserved with acute congestion. No evidenceof toxicity or inflammation is identified in his section. Tocation T-C15 Liver "tiTshsiuse.tisTshuiesisvaecruytleliy ckoiensgtlehsyeterdeswuiltthofstroamuemfar.agmTehnetraetiisonacoufttehe iver congestion and scatered eosinophils along the portal triad areas. Kidaey "This tissue is acutely congested witha focal area ofhemorthage over . tNhoe cbaapcstuelrei.a oTrheivsihdeenmcoerorfhatgoexiincciltiudysesidnenetuitfrioepdhiilnsthnedrecnlaoltifsosrumeation. Liver Tetewmen "This tissue is acutely congested with no evidence of autolysis. There aorfetheeoshienpoapthiolcsytaensdhlaysmopchcouirrdecd.llAicnuttheecpoonrgtaelsttiroiandiasrpeaarst, ofSothmeeresaecptairoant.ion Kidney STpheecirfeincaltotxiiscsiuteysoraicnufteecltyiocnonsgensotteiddewnittihfimeidlid atuhteollyisviesr.tiSspseuceific wbular changes are not present Tocation 1-C.22 Liver "This tissue is acutely congested with mild autolysis. There are a few collectionsof eosinophils and mononuclear cels in the portal triad areas. Kidney "SpTehciifiiscsuoethiesraccuhtaenlgyeciosnngoetstperdesweintthinnotheeviivdeern.ceof specific tubular or e Tocate ion INET glomerulardamage Liver "aTrheiscotlilsescuteidngeminonasntdcaartosufnrdeepzoirntgalantirifaadctarweiats.h acute congestion. Eosinophils Kidney cThoinsgetsitsisouenidempornessetnrta.teNsoseepvairdaetinocne,osfuapnpyorstpiencgiffircetezoixnigciayriofarctd.egeAnceurtateion is identified = EID097920 g&g 000715 Table 39. cont'd) ResultsoDfrHyisRtuonpaCtrheoelko.gy for the Shot-tailed Shrew Washington, WNoovoedmCboeurnt1y99,7West Virginia 2 LiLvoceartion IIE-12 p"Trhosmiinsesnuteiinstmhieldployrtaaultotrliyazdedarewaist.h aScpuetceifciocnogetshteirocn.hanEgoesiinonpohtilpsressreent Kidney in the liver. "The renal tissuei acutely congested with no evidenceof tubular or alomennlar damage. Specific tosciy is not identified. Tocation REF-A-6 Liver l"Tyhmipshtoicsystueesi,s aacnudtepllyacsomnagceesltlesdarweitphremsoednetriatteheauptoorltyaslist.riaEdosairneosp.hils, iSnpfeiclitfriactidonegienntehreatpioorntaortfahdlairveearstiisssmuoediesrnaotte.identified. Thecellular Kidney Tdehgeenreernaaltitoinssiueniostauidteonltyizfeidedainndtahecuktiedlnyecyo.ngested. Specific tubular Toeation REF-A-TT Liver a"Tnhdisetoissisnuoephisilascuitnetlhyecopnogreasltterdiewdiatrheaasn. inTchreeaesoesdinnoupmhbilesrsaorefslcyamtipehroecdytes tghoroodugchonoduittitohne. heTphateiec tsisssuoe.meTfhaecthuerpiantgocoyftthesetlhievemrs,esluvgegseasrteinign terxaturmeam,elbyut Kidney "mTohiostthiesrsusepesciafcicutcehlayncgoengiessptreeds.entNoinetvhiedievnecreotfisssupe.ecific tubular + Towation REFET Liver Kidney wTwihotisihsnssoepochmtieilosnsaoerpfeafripavrteeirsoenionstfwientlhtehpehreepspoearrttvoaecldy.ttersaT.dheaSrrceeaatsis.tearTcehudteenreceuotmnragoiepnshdtieilrosnoafnitdhtehelitviesrsue t"iiTnshfseluaremeinmsaahltiitsoitnsosliuonegiticshaeallctyuutbneuollryemscaoolnrggelsotmeerduwlii.th Tnhoeevpeildveinsceios dfiltaotxeidc.ityTuobfules 2ppear to be secondarily diated asthe result of is hydronephrosis 2 g g EID097921 000716 Table 39. (cont'd) ResultsofHistopathology for the Shot-tailed Shrew Washington, DWroyoRduCnouCnrteye,kWest Virginia November 1997 > LiLvoceartion REF-E-2 "The liver tissue is acutely congested with some vacuolizaton or granularity of hepatocytes. Scattered eosinophils and lymphocytes are present in the portal triad areas. Specific other degeneration or inflammation is not Kidney identified. The renal tissue is acutely congested. Mild autolysis is present. There is mild dilatationofthe tubular elements. but this may be from freezing artifact. Location REF-E-7 Liver This tissue is mildly autolyzed with acute congestion. There is acute congestion areas. The with scattered eosi autolytic change is nophil more s in and around the por severe around the gall tal bla triad dder Kidney than This in other tissue is sites. slightly autolyzed and acutely congested. Specific change -- Tocat_ ion R_ EF-F-_ 10 __oo rtoxif cityisi notiden ntifief d ection Liver "This sectionofliver tissue is very mildly autolyzed with acute congestion " and good collectionsofhepatic tissue with norma cls. Scattered Kidney eosinophils are present in The renal tissue is acutely portal triad congested. areas. There is mild autolysis in the renal tissue as well. = g g EID097922 * 000717 . Table 39. (cont'd) Resultsof HiDsrtyopRauthnolCorgeyekfor the Meadow Jumping Mouse Washington, WNoovoedmbCoeurnt1y9,97West Virginia or LLoicvaetrion IL-A-19 aTnhdetlyivmeprhsoeccyttieosnsaarreepsaritgohflythaeutionlfylzaemdmawtiotrhyapcruotececsosngienstthieonp.ortEaolsinophils Kidney r"Tihnedraerneaals.isOstuheeirs asupetcoilfyizcecdhwaintgheaicuntoetciodnegneisftiieodn.. Specific tubular degeneration or interstitial inflammation is not identified. LT ivers Tinhitsheistissusuee.hsSpcelceiffti,csiunpfploarmtmiantgiforneoezridneggaerniefraactt,ionThierneotsidaecnuttieficeodngestion Kida Liver er Not present---------------- Thi issue i lightly autolyzed with acute congestion. Specific inflammation Kiduey ToIrnhfedleargemenmnaaeltritaiotsnisouinse noisfottahcieudtenehtleiypfaicetodi.ncgteSispsteseucedifswiicnttohutbauirldeeaanrsticofhfiaemdno.gdeerisatnoetaiudtoelnytsiifsi.ed but his could be slered by the autolv process Tocation TB Liver TMhodeelriavetretiasustuoelyissiasciustpealrytocofntgheestceodllweicttihomniilndsteovemroadlesritaets.e aTuhtoelryesiasre Kidney ST{chvaaetstreeerneaTdlhietnirfsesluaiesmmiasactumtooerdyecrocaenltgleeslsiytniaotuhnteoolsfiytnzhuessdowiidisstshuoefstoahsimsewehsleelppaatTriahcteiiosdnseougefe.ntehriastive LiTovceartion B15 Tnheispasercetnicohnoymfa.issTuheeries maieldlcyolaluecttoiloynzseodfwliytmhpahcouitde ctiosnsgueesitnioonnethfroocuugshout Kidney TSchaettreernead eiossiunopihsialcsutaerleypcroesnegnets.ted. There is mild autolysis in th renal L-- iver Tshiissueissue is very mildly autoalyezepdrewsitehn aicnuptoerca--ol_ng--eisatdioanr.eas.ScaStpteecriefdic Kidney coothsihienrospihunifellsamiasmnaadtcuiltoyenmlpiyshconoconytgtieedssetnteidfiweid.th mild autolysis. There are focal reas potentialoftrauma. Specific ndammation oofrhdeemgoernrehraatgieo,nsiusgngoetstiidnengtified in th renal parenchyma. 2 2 EID097923 2 000718 - Table 39. (cont'd) Results of Histopathology for the Meadow Jumping Mouse Dry Run Creek Washington, WNoovoedmbCoeurnt1y9,97West Virginia Location II-A-19 . or Liver Tanhde lliyvmeprhsoeccyttieonssaarreepsalritghotftlyhaeutionlfylzaemdmawtiotrhyapcruotceecsosngienstthieonp.ortEaolsinophils triad areas. Other specific change is not identified. Kidney The renal tissue is autolyzed with acute congestion. Specific tubular degeneration or interstitial inflammation is not identified. Location LI-A-25 Liver "This tissue has clefts, supporting freezing artifact. There is acute congestion in the tissue. Specific inflammation or degeneration is not identified. Kidn rr Not present Liver This tissue is slightly autolyzed with acute congestion. Specific inflammation or degenerationofthe hepatic tissue is not identified. Kidney The renal tissue is acutely congested with areasof moderate autolysis. Inflammation but this could is not identified. be altered by the Specific tubular change autolytic process. is not identified . Tocation 157 Liver The liver tissue is acutely congested with mild to moderate autolysis. Moderate autolysis is partofthe collection in several sites. "There are. scattered inflammatory cells in the sinusoidsof this hepatic tissue. Kidney The renal tissue is moderately autolyzed with some separationof this is acute congestionofthis tissue as well. "The degenerative - tissue. change There is occurring secondarily._In some areas, the autolysis is quite severe, Location Liver ILI-B-25 This sectionof tissue is mildly autolyzed with . acute congestion throughout the parenchyma. There are collections of lymphoid tissue in one focus. `Scattered eosinophils are present. Kidney The renal tissue is acutely congested. There is mild autolysis in the renal tissue. Tocation Liver IV-A-15 Tehoisisntoipshsiulesiasnvderlyymmpihldolcyytaeustoalryezepdrewsietnhtiancupteaclongterisatdioanre.as.ScaStpteecriefdic Kidney other inflammation is This tissue is acutely not identified. congested with mild autolysis. There are focal areas of hemorrhage, suggesting a potentialoftrauma. Specific inflammation or degeneration is not identified in the renal parenchyma. 2 g EID097924 000719 so. `Table 39. (cont'd) Results of Histopathology for the White-footed Mouse Dry Run Creek Washington, Wood County, West Virginia November 1997 Location ID-8 = Liver The liver tissue is acutely congested with mild to moderate autolysis. Hepatocellular vacuolization and granulation ofthe hepatocytes has occurred in the tissue. There is some vacuolization. Specific inflammation is not identified. The granularityofthe hepatocytes and the `congestion appears to be metabolically normal. Kidney The renal tissue is acutely congested with mild autolysis. Specific inflammation is not identified. Tocation B19 "Liver "This liver tissue demonstrates areasoffreezing artifact with mild autolysis and acute congestion. There are collections oflymphoid tissue and eosinophils in focal areasof the portal triad collection. Kidney Twhiethraecnuatletcisosnugeesdteimoonn.stTrhateessespaormaetisoenpasruaptpioorntsoffrteuebzuilnagraerltiefmuceta.tsThere is acute congestion and hemorrhage over the capsular surface with congestion throughout the parenchyma. Specific other change or tubular degeneration is not identified Tocation IV-E22 Liver "This tissue is acutely congested with rareeosinophilsand lymphocytes inthe portal ried areas. Degeneration is occurring minimally. Other Kidney Tspheecirfeincailntfilsasmumeaitsizocnutiselnyotcoindgenetsitfeidedwith no specific degeneration of tubules of interstitial areas Toes Liver "This tissue is acutely congested and very mildly autolyzed. There are sMiolmdefcioblrloescistiiosnspaortfolfytmhpehoccoyltleecstiaonn.d eToshienroephiislmsoirnethseevpeorretaaluttroilaydsiasreoavser Kidney t`hTehecraepnsaulletiwsisutehissoamceutfeolryeciognngmeastteerdiawliitnhtnhoe cspaepcsiufliec adsegweenlelration of tubules. o EID09T925 g 000720 =i:1 z23.1g3 s g :3 8 il is2 ? 2g 5:2 gs : fg A= TdEri5:Ep5se2Ec2Ey8 Fsc52283z31g31a3%s9 d.i1ssx E 35 a EEERE fl2Ez=E=2E=s2i4ygF Fl8EE<cy 3 ISEnEiEEEE1 S i sgszsg 3 co 3 cFE-izxEzi2iEyg Bb 4 2 2g EID097926 8 000721 Co. | ii fesaferdsnfiasiacaaciy fl |p : i |sasgasfecsgta-esfeias i Bl eresznesssnsenzerensee } offfpsortntstoon EIsasisnisnan i i I asgoalagensfisefailels il : pr 4 fi Ji] ort EID097927 oi I i] fe il i } | SHRRARBUS SS tai i i ilesseeveseasyesijeasessy i ir] piald f I f8-nnoGasndeilonfoosony gigi 4 | RE 1 2 hil 5 13I3ILLE 000722 of sim off esp off pafemmannd off smmesient - i 28-233 i 28-233 i 2--a223fas i 3--23738n3 aif samen off sszes off sensesenaat off semsganeas i 2eeg- 4 gs2ge 4 astesrogfEe 4 asgeenogiae i fiat i ssa i ssnspesaant i pensgsiaend i h sages h sasEss h 33333053828 k 28888ARARAR $1 0% sm een 3 meee 3 meen ith Hise fia off ses ff ma Bl aime ppm pimped nmr iito f i i ssssss ; :il sz ] jB i md maei [EEE i i5 sania : iHiis sa3taz i2 45.5 g0... asnasn es | Hi]3 g-oauseslinnni.sens . iy se i i ie i wom | cones pass iy il Ti som | Bd isons | [i H ompedi ded popes hella |iff pomsinn Held "TSB001002 EiDas7o2s 000723 off pein off pmmemmn off sitesnn . i 2--2273853 i sgsieseenge i agafessenge off smspsteeal off semmemeenr off sessment 4 ssBegaegise i 33-Rgn93-82 4 22-Rggs-22 i Sp.geefpctiagnmn ff13 Bpasesslesss8 ofjl Zpssesdepszeest : bons Boome bss ihr ep ees eee TE Hl ypomess pfmsaes jf sin P; Uf o;bi osemsmameen;d s a mei loci i 4 gaanizinacy ! of Foundegaser i it ssssaziasst i i | i lisEsanss | k EasEsalss ! if smsestzim i! il HH [Jp eopeant | JF pape| } monies F1 oUepLdrsl Behl]i; hell. s 2u EID097929 000724