Document 50y22pZrDz172n9DJgJgLGOa5

8, ror 28,2017 April 28, 2017 MA innesota PT ollutioE n Control Argesncy 520 Lafayette Road North I st. Paul, Minnesota 55155-4194 I 6S1-2964300 rT af 800-657-3864 I Use your preferred relay service I info.pca@state.mn.us I Equal Opportunity Employer i. sean. Sweeney Ms. Jean B. Sweeney Cit Susana Offer Chief Sustainability Officer SW Emronment Heol safety and Sustanabity 3M Environment, Health, Safety and Sustainability SW Comer, Bling 3260.03 3M Center, Buildinf 224-05W-03 Spo i 553481000 St. Paul, MN 55144-1000 RE Nw Drinking Woter Halt Advisories for PFOA nd OS RE: New Drinking Water Health Advisories for PFOA and PFOS [-- Dear Ms. Sweeney: The Minesot Poluon onto Agency (PCA) isin recip of your ter dted March 20,2017. As background The Minnesota Pollution Control Agency (MPCA) is in receipt of your letter dated March 20, 2017. As background forth respons, he WPCA oes Compas (1) arin on ovr 3 01, ht the WPCA manded for this response, the MPCA notified 3M Company (3M) in writing on November 3, 2016, that the MPCA intended Tose remrsomant fom 34 ue Minmsors and the oy 2.7007, Seniamens Areemeanntd Consent to seek reimbursement from 3M under Minnesota law and the May 22, 2007, Settlement Agreement and Consent der 13007 Consan Order. o sdliona co the MPCA wouldb curingfo wate wl spin: Order (2007 Consent Order), for additional costs the MPCA would be incurring for water well samplinf, tation rant acted oon GAC) hr, nd provi of ower ores bet tthe installation of granular activated carbon (GAC) filters, and provision of bottled water to residents subject to the Wines Deparment of eat (MOH) weet wel iiss for prfunroocian ufone (5) and Minnesota Department of Health's/MDH) water well advisories for perfluorooctane sulfonate (PFOS) and soaraaceana en orony non Agu 2:25, te {ltrs oh MCA Deca 15, perfluorooctanoic acid (PFOA) issued on August 22, 2016.3M sent follow-up letters to the MPCA on December 15, Tor. at sebrory 307. he MPC respondetdo Fs tes on veh. 201. yout Merch 20, 2017 2016, and February 2, 2017. The MPCA responded to 3M's letters on March 3, 2017. In your March 20, 2017 Iter, ou oe ten FCA 8 it sven cra Qvesion 313 December 15, S016 ler, an eek letter, you state that the MPCA did not answer certain questions in 3M's December 15, 2016 letter, and seek addons nfomaton om the MPC additional information from the MPCA. HS STATE ny Sng ends First, you asked whether the State, the MPCA or MDH sent notices to others who might be the proximate cause of A eta aber abe ater the impact to the wells. As the MPCA stated in its March 3, 2017 letter, the homes that received the water well is se ps MPA pa rats SO HE Ft ras mama AY PFE advisories, and to which the MPCA is providing bottled water and GAC filters, are in areas impacted by PFC ete ar he ten 34 PC dip te fo r Wosngion County Loe releases from the three 3M PFC disposal sites and/or the Washington County Landfill. As the MPC stated ns March 3, 2017 ter 10 3, he MPCAbev that residential wells Washington As the MPCA stated in its March 3, 2017 letter to 3M, the MPCA believes that residential wells in Washintton County ht hove een pated 5C5, rea esl of elses of PEt roundwatt which rated st. County that have been impacted by PFCs, are a result of releases of PFCs to troundwater which originated at Cher he 3 dkposl es (Gol, Woodbury and Coto Grove), of fom the Woshingion County either the 3M PFC disposal sites (Oakdale, Woodbury and Cottage Grove), or from the Washington County andi As Mines ackmowedid Washiton Coty anwasiueld b 3h fr Gos of wastes Landfill. As 3M has acknowledled, Washington County Landfill was utilized by 3M for disposal of wastes comtaing FCs, an he Washgion Coun Lani ned nth provons f he 2007 Convent Orde. sin containing PFCs, and the Washinlton County Landfill is included in the provisions of the 2007 Consent Order. As in oe ot FCA or oly led for he crs assochted hth rls fom te Oke, Woody, and the past, MPCA has only billed 3M for the costs associated with releases from the Oakdale, Woodbury, and Coto ov shes. Torelore, th PCA ermine ht tere was ns bs 0 oon othr enc or he Cottage Grove sites. Therefore, the MPCA determined that there was no basis to notify any other entity for the Keene EC eee, othr thn 3M, who espns or remurang he MFCA or sch Cots under te identified PFC releases, other than 3M, who is responsible for reimbursing the MPCA for such costs under the Terms th 2007 Comnt order terms of the 2007 Consent Order. Secon, you that at hat onthe Sat decile woud suck embursemant fom 3, the WPCA sated Second, you asked at what point did the State decide it would seek reimbursement from 3M. As the MPCA stated ne er. 007 er, MICA form W on Aut 22 201, tht manent ec ecoroefy3 in its March 3, 2017 letter, the MPCA informed 3M on Aul~ust 22, 2016, that it intended to seek recovery of its oto 4, whi st sam dy ot MOH hd sh wat well srs ann some doy hat MPCA costs from 3M, which was the same day that MDH issued the water well advisories and the same day that MPCA a eps ron also informed local and state officials of the advisories. The MPCA has made every effort to keep 3M informed on ely bio 8 doin nt mater. a timely basis of its decisions in this matter. Exhibit 2683 22668833..00000011 PWMsas.g.eJJee2aann .B. Sweeney Sweeney APpargile 228,2017 April 28, 2017 TcThhaiirrldd,,lyyeoouu EaanssckkleeoddseffoodrraccsooApptiietesaoocffheemaaecchhnAtooiffstthaheecommmooprrreeetthhheaannnsi11v77e55 MwwaOatHteerrIswwteelollfl aaidndfvsoisoromrraiietesioaannnoddnttrhheesittdeeessntttirreaelsswutletsslooflfottchhaeetissoanasmm,pplleess collected. Enclosed as Attachment A is a comprehensive MDH list of information on residential Iwantfeorrmwaetliloandsviaslosroieasvaiislsaubelde aonndMPDFHC'ssaPmEpClewerelsuplatsgeoflwocaatteerdwaetlls sampled ince August 2016. water well advisories issued and PFC sample results of water wells sampled since August 2016. Additional well locations, Additional iintfoo:r/m/asntiwoan.hiseaallstohasvtaatiela,bules/ocnivMsDeHh/'shaPzFaCrwdeoubsp/atgoepilosc/aptfeedsa/tcurent hn. http://www.health.state.mn.us/divs/eh/hazardous/topics/pfcs/current.html. iFFonousurtrtathhl,,l,yyoocuuoraarssekkeesddpoffnoodrreccnoocppeiieewssitoohff tthhhoeemaeaccoccweenssessraasggrrieeneecmmleuednnittnssgwwwhheelelrreeadmmvioosroreeritethsh)aa,nnt11h1100lGGocAAaCCtifofinlitseerwrhsyeysrsteteemGmAssChhaafvvieeerbbseeeehnnave been iiainnncssscttteaaasllllllseeedadd,,,gacaronneddrreetthsmhepeeosnsnaaatdrmmespepnllciiinnenggpwlrraieetchsseuulhalttonssdmffreGoooAmmwCntthfeheiertswwr(eeisnllyllcsslutwwdehhmienesrgreehwattvehheleel baGGedAAevCCnisssosyyrtisseattsele)ml,messthdwwereeleroreeciainintnciosslttnuaadsllellewdeddh.i.neTTrAhheteetGllaoAccCohamfctiielotnaentrstso8o.fihfwaSwovhaehmeneprbrsleeeeen aTJrecooscuueurtsltrssseafqfogourrereshthetoomfssoeeernchhtsooopmamireeeesssionwwfipitatllhhalcGGaecAAcaCCensdffsiiltGtaeegArrsrCseiifennilmsstteteaanrllltlseesyddsatiiesnsmdiinnscccollhuruadrdveeeedsdpbiinoenneAAdntetttnianaccscehthamwmlileeetndnhttahAAro,e, maaisensnoconwluotndteeeedrddsaainbbwoohAvveetet.ra.ecW WhGimiAtthhCenrrfeteissBepp.reesScctawt mettoorpele yIhinnoussnuttdaarlrlrlleeeedddq,s,uebboosfotttchhfoopMOriDecHsoHopfiaeannstddhoeMfMsaPPallCCmaAAeccuulesseseetseaaarttgeaerm nemdepplmlaaacettceneetssflseeattattnegedrrrecaaeonnmrddreenaasttpt,eeommenpndplcellaanottceseeeaadwcccciiteeshasssschaaooggpmryreeeoeeofmmwetnenhtene.rt.steIIwnmnsphstlteeearaaetddeoGolfAfetCssteeefnrnildtdteiihnrnasggt wyyMooeOuureH thuuhssueeenssdMtrtPoeoCdnnsAoototiuifffsyyceoshhpootioemmseoeboootwfwantinheneerrassscacoomeffsettshhfleoeetwwteaiatrnteseartrnadwlweaealtllcilcoaaenddsovsvfiiassGoogArrryeyCe((fmAAitteettarnacstc,h(hemAmnteecinnloattscCCeh))dmaaeinnns tdda copy of the template letter that Dt)h.e template access agreement the template access agreement thatMDH that the MPCA uses to obtain access for installation of GAC filters (Attachment D). IiInnnsttthhaelelapptaaissottn,, otthfheeGAMMCPPCCfAiAeaarnnsddin33sMMteaaadggrroeefee3ddMtt,hhaaatnttdhhetehaMMtPP3CCAMAWwwooouuulllddd hhraeaivvemebttuhhreeseddiitrrheeeccttMccPoonCntAtaaccftotrwwciiotthshthhsooammseseooocwwinanteeerrdsswfoiortrh GAC fmfiniilatseentraralgliiannetssimottaeanllnlaaotttfiioiGonnnAaaCatnnfiddimltemmelaryasiinmnitnateesnnntneaaenanrcdc.ee.oI.ffTT33ooMMdd,awaatotneeu,d,l33dthMMiakthheaa3sstMorredweiiimosmcubbuluudsrrsssrteeehiddmsttbhahupeerpsMMreoPPatCChceAAh fofMooProCaatAggheeefnnroccrayypccopcoorssstosttasscarrhseesllooaactteireadedtesttdpooowGGndAiAthCCtoGffiPilAtEeeCCrr imiimmnapcpnraaecacatgtssseemttiooneddnnrrtuiinimnnkkbiianengrtgimwwofaeatdltyeeirrmnwwiaenenllgnllsewriian.ntIWWfea3rasMIshmhiwpinnagogctuttoolsdnnflCCirkoooeumuntnotPtyFyd,C,isstt,hchueeasmsMMoPtPhrCCiesAApaiiespsrpoomrppoaeeannncehttnootossrfuueoccathshhieddbirlisseaccsupusopsslsriuoiotoaninscos.nh.,WtWooititthrhehesrttphhtoeehnassdniiggtnoniiffPiicFcaCanntt cinocnrteiansueedinrneluimanbceeroonf GdrAinCkfinitgerws,awteoruilmdpsaectesmtfroobmePFpCrus,deanmtotroeevpaelrumatae.nent feasible solution, other than continued reliance on GAC filters, would seem to be prudent to evaluate. FMFiiPnnaaClllAlyy,,tyyaootuuedaasstkkheetdd awababotoueutrt ttwhheellssstaaattmuupssleoofsf tthhhaeedttebesestteiinnnggcooolfflttehhceet eaaddddfdiritotiimoonnmaalol 44r0000t--h55a00n004ww0e0ellllshs.a. mIInnesittssinMMaSaroruccthhh33W,, a22s00h11i77nllgeettttoteenrr,, the the CICMnooPfuuConnrtAtmyya,s,ttiiainntoenaadreintahrAsaotottfefwadicadehetanemntretiniwfsiiteeeAdldl rsPPaeFFfmCCepriimlemenppscaaehccdtatssdabffbroroevoememn titchnhoecellle33ucdMMteesddditisshfprpeooom sssaaalmlmspsiolitteeeressrateanhsdnau/ldnto/sor4ro0tf0thhteehhoeW WmsaeaesssmhhioiinnrngegSttootouhnntahCCnoW o4uu0ann0tstyyhwienLLlaganltnoddinfiilll. The The information in Attachment A referenced above includes the sample results of these more than 400 wells. I6Iff3yy1oo.uu75hh7aa-vv2ee5aa0nn9yqyourqeubseytseiti-oomnnassiloorartwwgooaurulylddkriliukeeegtteoordd@iissstccuaustssse.tthmhiinssummsa.atttteerr in in person, person, please please contact contact Gary Gary Krueger Krueger of of my my staff staff at at 651-757-2509 or by e-mail at i~arv.kruel~er@state.mn.us. SSiinncceerreellyy,, Ao, 4 Saha RKKaeatmthherrdyyinnatJ..ioSanthDeievrri,,sDDioiinrreeccttoorr simp Remediation Division KJS:jmp EEnncclloossuurreess:: AA`Atttttatacachchhmmmeeennnttt AA8-- MMMPODCHHACCsootmmpoprfGreehAheeCnnssaiicvvceeeslsissttaoogffrwweeeelmllleaannntdds sasaanmmppfliliilnnteggr ddinaastttaaal((lsasetnieotnees(lleseeccnttrtroinceicalleacllltyyr))onicalh) AA``AAttttttaattccaahhcchhmmmmeeeennnntttt CCB0 -- - MPCA list of GAC access agreements and filter installations MMOPCHAtetmepmlplaatteecoarccreessspoanrdeeenmceentto homeowners MDH template correspondence to homeowners (sent electronically) Attachment D - MPCA template access agreement cc: cc: TTGaoormmyHHHoooghgaeannns,,tMMeiDDnHH, 3M Company (w/attachments) Gary Hohenstein, 3M Company (w/attachments) 22668833..00000022 noni 02080 April 14, 2017 RE: Well Advisory for well with Minnesota Unique Well NumbJEer RE: Well Advisory for well with Minnesota Unique Well Number~ lod Located at Cotectedon Collected on ocThoankI you for alowing water sample ob collected ramyourwell Ts sampling pr ofa operative Thank you for allowing a water sample to be collected from your well. This sampling is part of a co-operative eeffffoorrtt bbyy tthhee MMiinnnneessoottaa DDeeppaarrttmmeenntt ooff HHeeaalltthh ((MMDDHH)) aanndd tthhee MMiinnnneessoottaa PPoolllluuttiioonn CCoonnttrrooll AAggeennccyy ((MMPCCAA)) To eve pero(FC erminegroundwater m south Wann Loum. Te to evaluate perfluorochemical (PFC) contamination in the groundwater in south Washinl~ton County. The amp ren fomyour wll re compared below 10 bth oe cent OW heli esd aloesanne sample results from your well are compared below to both the current MDH health based values and new WaterSole TestingRevue Gpase pr Bilin, pl EPA Health Advisory values issued in May. Water Sample Testing Results (in parts per billion, ppb): i `CChheemmiiccaall NNaammee hPi erera Sone PFO Perfluorooctane Sulfonate (PFOS): pri Perfluorooctanoic Acid (PFOA): Pertuoroabcud nporocn: Perfluorobutanoic Acid (PFBA): [Am 00598 ja) | AAmmoouunnttiinn YYoouurr W Weellll 0.092 ppb. ozo. 0.078 ppb. 0.28 ppb. | prinking Water citer op) Criteria (ppb) fo0.07 oor0.07 ,7 Perfluoropentanoic Acid (PFPeA): No Detection. NE Perfluorohexanoic Acid (PFHxA): errr TE FE Perfluorohexane Sulfonate (PFHxS): Perfluorobutane Sulfonate (PFBS): No Detection. Present below the reporting level, estimated to be om 0.016 ppb. haben - No Detection. NE 0.07 oooo 7 NE = None established; currently MDH and/or EPA does not have sufficient information to set health based exposure limits for these PFCs. NOTE: The drinking water criteria for PFOA, PFOS, and PFHxS are based on new EPA Lifetime Health Advisory values. MDH is currently reviewing these values. ---- What This Means For You: Th sample from your wll contin PECs concentrations hat, ther nial orncombination, The sample from your well contained PFCs at concentrations that, either individually or in combination, were sor ves of esiconern, Therefore Wo ean ell vio fo vou i referee were above levels of health concern. Therefore, MDH is issuing a well advisory for your well, reference nove iter with PE ls Shoe heath concer ae for enti showorewarshi,ng lomes and above. Water with PFC levels above health concern is safe for bathing, showering, or washing clothes and leanig ut shoot br se fo dking coe cleaning, but should not be used for drinkinf~ or cookinl~. 22668833..00000033 TTcohhoeekiMMniginn,nnaeenssdoottwaailPPlooclolllunutttiiaoocnnt CCyooonunttrrrooellgaAArggdeeinnncgcyyin((sMPtPaClClAaA)t)ioiwnlillolfpparrgoorvvaiidndeuelyyaooruuawwctiiitthvhabbtoeotdtttclleaeddrbwwoanatte(erGrAffCoo)rrdrdiitrinenkrkisinnyggsatanenddto treat cyYunoootuuoirlrkiwawnagGattAeeaCrrndooorrrwccoiooltlnhncnenoerenccptttaeiiorcontmnayttnoooeucncirtitte,yygwwaalaratdtteeienrrrng,,atiiinffestthwhtaaaaltttlaeiistsrioaasnvvuaapoiipllfalaabbyllgeceraaiinnnnubyyeoolauuprrrraoaacvrrteeiivada.ae. dte.BBdooTttcthtalleeerrdbdeowwnwaiatl(tGleerAbr eCwwi)nillfloillbtbceeeorspptsrrytoosovvtiieyddmoeeuddttoftooortryyeooauut eeruieinttihthmileebrarurttGhsheAeedC.bboootrtMttollPeetdChdeAwwrawaptitleeelrrrmsooearrnnGdGeAAinCCnt,fffoaiilrltlmtteeearrrtnssiayyostsnetteeawmmb.oa.utetMMroaoslslstuto,p,fpiiffylyonnouoctrat anaol lpbl,toeiofopfynrysooouvauirndrdeccdooa.snstssTahcttoecoercecssonwnnainelglecrbcteetettmonoeoccnicitttoyyfswwot rataotGteeAyrroCummfaaifolyytrebbr ee installation. reimbursed. installation. You willaso be contacted directly regarding bottled water delivery. MPCA will send information about all of your options and an access You will also be contacted directly rel~arding bottled water delivery. agreement for GAC filter WPPalleesaahssieennngootttoeen,, Ctthohueentnnyee.ww DEEPuPAAe vvtaaolltuuheeess nhhuaavvmeeberreressouufllttefeiddlteiinrnsMMthDDaHHt niisessseuudiinnlt~gobaaellaarirgngesetannluulmmedbbeienrrtoohffewwaefeflllecaatddevvdiissaoorrreiieae,ss in tinhe MPCA anticipates it may take several months to complete the instalationo al of Washington County. Due to the number of filters that need to be installed anticipates it may take several months to complete the installation of all of the systems in the affected the systems. area, the MPCA oIfryytoohuueihhraacvvoeenatlarrlareecaatdodyrywiiinnlsslttcaaollllneetddacaatGGyAAoCCufititloteedrretsseyysrstmteiemmneoorirfooyttohhueerrrswwyasattteeerrmttcrreaenaattmmmeeeenntttyssoyyussrttewemamtiinenyryotoururerahhtoommmeene,t, nMMePPeCCdsAA assnttaadffff 1or tdhiesciruscsownhtraatctaodrdiwtiilloncaolnttaecchtnyiocaultaonddesteyrsmteinmemiafiynotuernsaynscteemassciasntamnceeetyoyuoumrawyanteeredtr,ewahtmicehnmt anyeebdes and provided at no cost to you to discuss what additional technical provided at no cost to you. and system maintenance assistance you may need, which may be For More Information: F++ oVVVriiisssMiitttottMrhheDeeHIMMnfPwPoeCCrbmAAsiawwtteieeobbsn-siw:itteae v--wwhawewawwt..hpp.ccaas.t.sasttteaa.ttemen.mm.nnu..suu/ssd//iwwvaass/steeteh///ppeherarfzflaluuroodrrooouccshh/eetmomipciicacalslss/--pppiifcccsssindex.htm + VViissiit tMhDeHEPwAewbesbisteit-ew-wwiww.vhieapalt.h.ostavte.m/n.gus/rdivso/ehu/handzraidrndkoi-ungsw/wtaotpearic/sdt/rpifnceksi/innrgd-ew-axt.heartm-hlneal-th-advisories- pfoa-and-pfos Visit the EPA pfoa-and-pfos website - www.epa.gov/t~round-water-and-drinking-water/drinkinl~-water-health-advisories- fyou have questions or concerns, please feel free to contact us at the phone numbers and email addresses lIifsytoedubhealvoew.questions or concerns, please feel free to contact us at the phone numbers and email addresses fue TName listed below. Issue Name [AgAgeenncy [vhPohonnee [e_mEma_aitl ______| GAC Filter instalation Installation Narsarde |G Velo [WON Water Sample Results Results Health Concerns| SCiotnnesfuAolsrtsametaisotmnienUonntenitand Health Concerns Gary Krueger Ginny Yingling Site Assessment and Consultation Unit Information Line M PCA MDH MDH 651-757-2509 gary.krueger@state.mn.us | G20 | 651-201-4930 Vays rs virginia.yingling@state,mn.us TEIT014897 | health hazard@state mn vs 651-201-4897 health.hazard@state.mn.us sSiinncceerreellyy,, C,C,"":ih;!~, e FMf' 7e,...7....m. 3::;-~ Gi~ninnny Yiinngglliinnl~g HEHynydvdrirorogogeneomoleloonglt~iasislttHealth Division PE.n0v.irBoonxm6e4n9t7a5l Health Division SPt..OPa. uBlo,x M64N97555166:0975 St. Paul, MN 55164-0975 cccc:: GGPaaatrrryyiKcrKkurSueaegrgeaerfr,o,lMMeaPPnCC,AAMDH - Well Management Program SPtaetprihcaknSiearSaofoutleear,n,WMasDhHin-gWtoenll County Management Prol~ram Stephanie Sourer, Washington County 22668833..00000044 ta Pe 520LstoeysdoNrora |St.PaulMisra 55155419% | 6512966300 520 Lafayette Road North I St. Paul, Minnesota 55155-4194 I 6sl-296-6300 8506573804 | Us yous tered waysenice| opca@sernus |Eau OppeuntyEncl: 800-657-3864 I use your preferred relay service I info,pca@state.mn.us I Equal Opportunity Employer AApprriill 77,,22001177 Name ANdadmreess ALadkdereEslsmo, MN 55042 Lake Elmo, MN 55042 RREE:: GGrraannuullaarr AAccttiivvaatteedd CCaarrbboonn FFiilltteerrffoorrYYoouurr W Waatteerr SSuuppppllyy DDeeaarr NNaammee:: TTushheee yMMoiuinnrnneweseslooltwtaaatDDeeerppafarortrtmmdeernintntkooifnfgHHeaeanaldltthhco((oMMkDDinHHg)), rrbeeaccseeenntdtllyoyniisstsshuueeedddeaatewwceeltlliloaanddsvvoiifsscooerrryytarreiecncopomemrmmfelenundodirinncgghetthihcaaattlyysoouu(PddFCoos)nnooitnt yYuooseuurrywwoeuelrlllwwwaeatlleterwr..aTTtehhreefoMMriinndnnrieensskoointtaga aPPonoldllluucttoiiooonkninCCogon,ntbtrraooslleAAdggoeennnccthyye((MMdPPeCCteAAc))tihohaansss been providing bottled water to you of certain perfluorchemicals (PFCs) in been providing bottled water to you ssiinnccee tthhee iissssuuaanncceeooff MMDDHH''sswweellll aaddvviissoorryy lleettteerr.. AAssoouutltliinneedd iinn tthhee eenncclloosseedd ffaacctt sshheeeett,, ggrraannuullaarr aaccttiivvaatteedd ccaarrbboonn ((GGAACC)) ffiillteterrss aarree vveerryy eeffffeeccttiivvee iinn rreemmoovviinngg hPPFoFCuCssseffrroGomAmCwwfeelillel rwwaoatnteetrro..TyThohiuissrlelwetatttteeerrrssseeurrpvvpeelssy.ttooThiinenffoiornrmsmtayyloolauutitthohnaatatnyydoouumaaairreenteeelliinggaiibnbllceeettooofhhGaaAvvCee ftthihleeterMMwPPilCClAAbeiinnsastttaanlllaolacwwohshtooltleeo yYhooouuu..seTThhGeeAppCuufrrippltooessreeooonfftotthhyeeoGGurAAwCC affiitllettererrsiuisspttpoolyrr.eeTddhuuecceeinttshhteealcclaootnnicocenenntatrnraadttiimoonanssinooteffnPPaFFnCCcsseiinnoyyf ooGuuArrCwwfaialttteeerrr wssuuilpplppblleyy assoto you can no cost to you can uusseeyyoouurrwwataeterr iinn aa nnoorrmmaall ffaasshhiioonn.. MMeeaannwwhihlilee,, tthhee MMPPCCAA wwililll ccoonnttiinnuuee ttoo pprroovviiddee yyoouu wwiitthh bboottttlleedd wwaatteerr uunntitill tthhee GGAACC ffiiltteerr iiss iinnssttaalllleedd. `WWmeeasistnt tCCeeennnatnrtracalel aEEnnnvdviimrrooonnnimmteeonnrttiaanllgoCCofontnshsuluetltaGanAnttCss,,fiuulnnteddre.erTrhccioosnntitsrraatchctet wwsiaittmhhetthhceeonMMsPuPlCCtAiA,n,gwwfiliilllrmoovvweehrrsoseeaeeltsthoheecoiilnnlssettcaatllslaasttiiaoomnnp,,les of ymoauirntweenlalnwcaetearn.dCumlloingiatnorWinagteorf (thdebaGUAlCtrfailpteurr.eTSherisviicset)h,ealssaomuendcoernscuolntitnrgacftirmwitwhhtohealsMoPCcAo,llewcitlsl besamples of contacting you in the near future to make arrangements with you for the instalation your well water. Culligan Water (dba Ultrapure Service), also under contract with the contacting you in the near future to make arrangements with you for the installation of the GAC MPCA, will of the GAC ffbiileltteerr aanndd wwililll bbee rreessppoonnssiibbllee ffoorr tthhee aaccttuuaall mmaaiinntetneanncaenaacnnded ffiilltteerr cchhaannggee-o-outusts.. iFtileterrcchhaannggee--oouuttss aarree uussuuaallllyy ddoonnee oonnccee ppeerr yyeeaarr.. Prior to installation of the GAC filwteewril,l ask youtosign an Access Agreement which grants permission fPorrioMrPtoCAi,nsWtaelslattiCoenntorfatlheorGCAuCllfiiltegra,nw/eUlwtirllaaspstukaryfeoutotoenstigenr yaonuArcpcreospseArtgyrefeormtehnet pwuhripcohsgeorafnintsstpaelrlminisgsaionnd fmoorniMtPoCriAn,gWtheestpCerefnotrramlaonrcCe uolfligthaen/GUAltCraspyusrteems.taMffPtCoAenorteMr PyoCuAr cpornotpreacrttyorfosrtathffewiplulraplowsaeysofcionnsttaaclltinygouand before entering your property. monitoring the performance of before entering your property. the GAC system. MPCA or MPCA contractor staff will always contact you PPlleeaassee ssiiggnn aanndd rreettuurrnn tthhee eenncclloosseedd AAcccceessss AAggrreeeemmeennttiinn tthhee sseellff--aaddddrreesssseedd eennvveellooppee.. IIffyyoouu hhaavvee aannyy. qquueessttiioonnss aabboouutt GGAACC iter, filters, tthhee iinnssttaallllaattiioonnoofftthhee GGAACC ffiilltteerr,, tthhee AAcccceessss AAggrreeeemmeenntt,,oor iiff yyoouu cchhoooossee ttoo ddeecclliinnee tthhee MMPPCCAA''ss oofffefrettoro iinnssttaallllaa GGAACC oonn yyoouurr wwaatteerr ssuuppppllyy,, pplleeaassee ccaallll mmee aatt 665511--775577--22550099 oorr etemimamaioiltl haaytt ~lo.o.%yck.~kr.~re.m~u@.~gs.~te.a!ri.r~@e!.s..~t:~am.nt~.e.~u.is!.i.!i)..A,.~fu!is~nooalrr TMTiiPmmCLLAoocsckikrgrenememd,, coooffpmmyyywisslttaalffbf,e, aastten66t551t1o--77y55o77u--22f66o8r866yooourrreermmeacalolirldaastt. ~..!..,..q..~.~..!).~!.:.!..c_~.~i.!~.~.!~.~.~!.~9..:.!33.!3.:..~!.~. A final MPCA signed copy will be sent to you for your records. 22668833..00000055 Nome. PPaaggee22 AAppririll 77,,22001177 IImfafyiyonoutuahhiaanvvteeh eaallfrreielataeddryy(ii.nn.ssttcaahlllaleenddg eaa-GGouAAtCCs)ooprrrssoiivmmiiildlaaerrdffitilthteeerr n your home, you may be eligible finityeroumreehtosmteh,eysopuecmifaiycabteioenlsil~oifblae for the MPCA to MfoPrCthAeinMsPtaCllAedtoGAC fafmisiltaseeoirnrctiaaaannitnddetdyyhooweuiurtfrihlrrteeeittrnuus(rrtin.nael.ooafcfthitthoahneenogssfeiig-gyonnoeueuddtrs)AAficcplcctreeeorss,vssiodArAeggfdroreertheecmemoesfnetiltnst.eta.rsYYsmoooueuciemmatstaaeytydheaawllissstoophebbcceeoifneeiclnliiaeggtciiibotbllineeosnffoootrrfoarreaeMiimpPmubbbCluuAirrcssinewesmamtteaeenlnlrettdsooufGfpccpAoloCsyst,tss as provided by the MPCA's associated with installation as provided by the MPCA's HHoaafrrymmoiufuurll Substance Compensation Program (see enclosed filter, or for costs associated with connection to a Substance Compensation Program (see enclosed ipnufobrlimcatwioant)e.r information). supply, 1Iffyyoouu hhaavvee aannyy qquueessttiioonnss,, pplleeaassee ccoonnttaacctt meatthe me at the above above indicated indicated information. information. SSiinncceerreellyy,, GSGuaaprreyyrKvKirrsuuoeerggeerr SReumpeedrivaistoiron and Redevelopment Section RReemmedeidaiattiioonn Division and Redevelopment Section Remediation Division GK/Tucsa GK/TL:csa EEnncclloossuurreess cc: Ginny Yingling, Minnesota Department of Health cc: Ginny Yingling, Minnesota Department of Health 22668833..00000066 Me innesor ta Pollution Minnesota Pollution Control Agency en S5t2.0PaLula,faMyNett5e5R15o5a-d41N9o4rth Between MinAAneccsoccteaesPsossllutAAiogngCrroneetreeolmmAegeennnctty Between Minnesota Pollution Control Agency aanndd NNaam mee "adiross Address Lake Elmo, MN 55042 Lake Elmo, MN 55042 Srtund rogram Superfund Program oe Tp crs aren Dec Type: Access Agreement BBaacckkggrroouunndd csr he nests Epa espn and Laity ct (ERLA Wion S 150.17. uo. bh Mines Pursuant to the Minnesota Environmental Response and Liability Act (MERLA), Minn. Stat. 115B.17, subd. 4, the Minnesota EO Cae ne PCN vera oni estore no eps OF ong Pollution Control Agency (MPCA) is investigating the release or threatened release of perfluorochemicals (PFCs) in Washington os County. The PCA i crety ing ack in sgn toh concntatonsof PC hi vel trof sider ced at ho The MPCA is currently taking action in response to the concentrations of PFCs in the well water at the residence located at the Sees cantatas tn par). Thaconaniaioonns oeEFC xd Himsa Capitaof Honk address identified above (the Property). The concentrations of one or more PFCs exceed the Minnesota Department of Health's 0 ei nkLisHo a, coed creas of ts PECs cede Han io Lis (MDH) Health Risk Limits or Health Based Values, or the combined concentrations of multiple PFCs exceed the Health Risk Limits chi ene Ve aran cacaohe ay:o MY 1a amnesia ara Gg va or Health Based Values based on a calculation of the additivity, or MDH has recommended the use of an alternative drinking water py To sees ha ECconan nh to spp 1 0Porn na WPCA nah ad mn gant supply. To address the PFC contamination in the water supply at the Property, the MPCA will install and maintain a granular Sod cao (GAC fe wer ih oo Pop activated carbon (GAC) filter at the water supply at the Property. he WPCA. employes contacrs, a sgt, ve asthe Wines Deparment of Heh s auhrzed ci he The MPCA, its employees, contractors, and agents, as well as the Minnesota Department of Health, is authorized to enter the Jiabaooh A oe Property in order to take these actions under Minn. Stat. 115B. 17, subd. 4. AAggrreeeemmeenntt 1. Parts, Tr Pre tisArsmenat 1. Parties. The Parties to this Agreement are: & Vimesta Polten Gort Ager (PC: a5 a. Minnesota Pollution Control Agency (MPCA); and bb.. NN amea ((tthheem ""PPrrooppe eerrttyy OOwwnenre'r)".). 2 Access.ThePopa Owner herby cones ard autores 1 NPA, amps, contandragn,ts, a5 Access. The Property Owner hereby consents to and authorizes the MPCA, its employees, contractors, and agents, as eth M1 re Prager loan sans done preven, 5 ECAdns co, ono well as the MDH, to enter the Property including buildings and other improvements, as the MPCA deems necessary, on the Bape ot bo oun parons Property for the following purposes: a. TTooinisntsatlalll,, mmoonintiotorr,, ssaammppllee,, aanndd mmaaininttaaiinn GGAACC ffiiltleerrss oonntthheewwataeterr ssuuppppllyy oorr wweellll((ss)) uusseedd ffoorr ddoommeessttiicc Cohmeh p Crsaa tansnof nar PC ceed he MEWS sh Rk Lis (LL) consumption in which the concentrations of one or more PFCs exceed the MDH's Health Risk Limits (HRLs) or emi aces (91 cones cosets ms FC acd oR 0 VS sd Health Based Values (HBVs), or the combined concentrations of multiple PFCs exceed the HRLs or HBVs based nacass! mo ay on a calculation of the additivity; bo. Toone such ather test nd sping, ching samplifvnegh trbers ans GAC estan, 5 b. To conduct such other tests and sampling, including sampling of well water before and after GAC treatment, as PCA co nace. 1reg mr 0 ano hoa een 0450 FC the MPCA deems necessary, to investigate the nature and extent of the release or threatened release of PFCs. 5 WPCAobligations. The PCA wil ct he PropeOuna aes 6 hour bls raring ho Pert. Wot be 3. MPCA obligations. The MPCA will notify the Property Owner at least 48 hours before entering the Property. Work will be CSoancnaoGong enoof 500r5. 10.5070 ssh MFCR con ames oon wrk tnd conducted during the hours of 8:00 a.m. to 5:00 p.m. unless the MPCA receives permission to conduct work during different hours. 4 WPCA and Property Owner prcautons regarding work. 4. MPCA and Property Owner precautions regarding work. The MPA lout sti 8 vi reson rnc wi ufh rp. lary a. The MPCA will conduct its activities so as to avoid unreasonable interference with the use of the Property. if any Sonal Frogs iso deb 3 oof NECA acta, oe NFCA wl 000 50h a0 portion of the Property must be disturbed as a result of MPCA's activities, the MPCA will restore the property as Cosi rin condo 1 enon pres unor n rcumianes. close to its original condition as is reasonably possible under the circumstances. Th Propary ner wake reson procautotaones ah cupment of HPA ad fs contac b. The Property Owner will take reasonable precautions to ensure that the equipment of MPCA and its contractors eprops 450 wobon covi5tNoPdE. ayn. 5s an on the property is not damaged, and that the work being conducted by MPCA, its employees, agents and vaca Grane contractors is not disrupted. . pPoaisp.Tha NECA or contactors vil iansyncessrygems rt and arian GAC rs an he 5. Permits. The MPCA, or its contractors, will obtain any necessary permits to install and maintain GAC filters on the Property. mayen epcasatemnus www.pca.state.mn.us + 61296600 651-296-6300 + PFC GAd access agreement BOESTI6H 800-657-3864 rors + TTYESI2825Tor H0657064 ]-rY 651-282-5332 or 800-657-3864 + Availablienaltemative formats Available in alternative formats Page 1 o[ 3 22668833..00000077 6. TTPereossptteRRretesyusOlutwlstns..erTTuhhpeeoMMnPPtChCeAAPwwrioillplepprrrtooyvviOiddweenerrerepp'osorrtrtsseqoounnestththeetorreetsshuuellttMssPoofCf sAsaamfmporplilsinnuggc,,hssiuunrrfvvoeerymyasstiaaonnndd. tests tests onthe on the GAC GAC fier filter 0to the: the Property Owner upon the Property Owner's request to the MPCA for such information. 7. ePPfrrfooepcpteeirvrtteyydTTartraaeonnsfsffeaernr.s. faIIffrtt.hheeToohwwonneePrrrssohhpiiepprtoofytf OthhweenPePrrroopspehearrlttlyynooorrtoioffyfttthhheee wwMeelPlllCisAttr3raa0nnssdffaeeyrrrsreedpd,r,ittohthiisostAAhggerreeteermamneesnfnettrissannnudullllfaaornnwddarvvdooiitddhueuppnooannmttehhee `ea`aonfnfwdecncecctriuuvrrserrheeadnnla!ltteanaoddtoddifrfryteerssatsshnesooffMfettrPh.heCeTApphrreooofppPoforassoieepludderrepptyuuorrOccthhwraaansnseseefrrresrtthoowaittlhtlhheenionMMtPi1PfCy4CAtdAh.ae.ysMIIffoPtthfhCeesAuppcr3roho0ppfedeariartltyuyyrsett.rrpaarnniTosshrffeeetorrGddthAooeGeesstfriannenoolrst foowecocrcucaulunrdrdfforofroremraawanniayynrdrrenetsaahstseooanlnn,e,adttmhhoeeen othwenperrospheratllynportoifvyidtheed ManPCupAdaotfefdailaucrceetsostraagnrsefeemr ewnitthiins s1i4gndeadysbeotf wseuecnh tfahielunree.w TphroepeGrAtyCofwilnteerrwaonudldthreemMaPiCnAi.nstalled on the property provided an updated access agreement is signed between the new property owner and the MPCA. 8 MMaaiinntteennaannccee ooff GGAACC FFiilltteerrss.. aa.. TTnhhteeheMMwPPaCCtAeArmmsauapyypttleeyarrmmfiinntaahteteePmmraoaipiennrttteeynnaaisnnccdeeelooeffr,, maainnnddedssuubbbysseMeqqOuueHenntttlloyy orreelmmooonvgveee,r, tbthheeeaGGpAAuCCbffliiltehererawwlhthheenncottnhhceeecrcononnoccreeninfttraranatotiitoohnnessr of of PFCs. PFCs alternative source or water is made available. in the water supply at the Property is determined alternative source for water is made available. by MDH to no longer be a public health concern or if another bb.. TTaahehsshaeelllotoMMnhnggPPcCoaaCnssAAcwttehwihreeinlll,MMnnaODoantHHtyifiydfdutetehrhttteeeehrrePPmrmrriioornnppeeeeeassrtrttttmyyhheeeOOnwtccwonoonnenfeccrter3ehn3n0etw0trdraaadatttaiiyeoyorsnsnsssbbueooepffffpooPPlrryeFeFCiaiCttstteteiinhrnrtmemthhiiPneneraawowttapeeetassrteetmmryraasiswiuunnlppttepepblnnleyyaannatalhccteeetthheooeefxf,,pPPaearrnnonopddspeeerrrreteotyfymmtoaaohvrrveeeeessPnn,,rootothhplloeeeonrnGGgtgyeAAerOCCarawnuuppneuniurbtitbls.si.l.icc: health concern, any further treatment of the water supply at the Property will be the expense of the Property Owner. 9. MMPPCCAA LLiiaabbiilliittyy ffoorr GGAACC FFiilltteerrss.. a. TTarhheeeaPMltPCerCeAAd ossrhhaamlllil snnuoosttebbdeeaairnraaannnyyywllaiaaybb.lilittyyFoiifrfttehhxeeamGGpAAleCC, uuneniaistcs,h, ttGhheAeiiCr aaussnssiootccwiiiaaltteebddeffiiixnxtstuturarelesls,e,doowrriaathnnyythppeoorptrrioonnpeoorffptthihpeeinuugnniiattssndoorrvaffiilxxvttueurrseess[,0, uappnrrireootvvsaiwidlditeeelrlppernrdoootppoeerfrrumnwwciasattuiteeosrner dtarreseianatatnammtenienyctniw.pt.aatyeSS.dhh.ooFuuoTllrhddeettxhhMaeemPiinnCpsslAettaa,llslelheeaaddlclhppibipGpeiianAnrggConouornvvaitaablwlvviielelslsbeeefvvoreienrrpsebbtareeslleoaandlltatelewrreieitdhndjufftrrhryoe,ommpprtrtohohpepeeeoorrrtrigpygiiipdnnaiaanlmlgaiinangssnettda,allvloaaarttiilovootennh,s,ettrthhoee. harm caused as a resull of tis or oer misuse or aeration of units will not function as anticipated. The MPCA shall bear no harm caused as a result of this or other misuse or alteration of the units liability for the units. personal injury, property damage, or other b. EdExexcacetephpttcaaassuspperrdoovvbiidydeeaddnyiinnappcaatrroaarggroramapiphshs99i..oAAn,, ottfhheeaMnMyPPCeCmAApwlwiolyilllebbeeeoflliiatahbbelleesfftooarrteiinnijjuunrrtyyhetoopooerrrlflooossrssomaofnfpcpreroopopfeertrthtyyeoowrorppekerrdsseoosnncaarlliiibnnejjduurrayybooofvre, duuMeinnndadneteherrscccoiaitrrucacsuueTmmodsrstttbaayCnnlcacaeenissymwswahcheAtcertor,eer oMttihmhneenis.sssttiaaSotttnaeet,,.oiffaaapn3rp.yi7ri3vev6ama.ttpeeloppyeeerrsesoonon,f, twwhoeouuslltddatbbeeeinlliiatahbbleleefptooerttfhhoeermccallaaniimcmeaannottf,,thiinneaawccoccorokrrdddaaennsccceeribwwieittdhh atthhbeeo.ve, Minnesota Tort Claims Act, Minn. Stat. 3.736. 1100.. EExxiissttiinngg DDrriinnkkiinngg WWaattoerr FFiilltteerrss Installed Installed by by Property Property Owner. Owner. a. IsIfpftethcheiefPiPcrraootppieeornrttsyyoOOfwwGnAneeCrr hhunaaisstspprireenvsvitiooaluulsselldyybiinynssttthaaelllleMeddPCaaAnnd,d iisosrcciuurrtrrheenenttMllyyPooCppAeerraadtetiitnneggramaiGGneAAsCCthuuenniiGtt AoorrCffiiluetnerirtttohhraafttiddeooreeisss nnnoootlt mmaedeeeetqtutthahetee in srP`rPerpeGrmoomeApopcCoevievfruiirictnntniyayggttOiOooPPwrwnFFnCsfnCeseios,rrt,f aatGtohcchAecweceCenMMppetPutPdssnCCibtttAhAsyheeiwwtnMihMislelPltPoaCoPfClrAfflefoAeeTdpr'rSstabtrhhootyeefyffteehPPOrrerwrttoonoMoppeePieirnrnr,CtssttyytAaail,nOlOllcuoawairnunnndeiddefirnrtmmhgaaaeaaiGGinsMntsAAtaPoaCCiciCnniAuuaaatnndeiiGGtdeiAIAtncneCCssortstmaatuullsinlnnle,ieiettdwdsaaiaattltnnhltthddebheeemmGatPPAahirraionConptprteaaueeriistnrnnytpieyt,eo,dndosrrrbebiefybymimlitottoelhvhtvraeeyaoilslMMfoonPtPffoChCtttAehhAa.eed.PreeeIxoIxqfifpiutsstehatthrieienttneygg in `GGAuCmerunpirt ioor foilteirnsotwalnaetdionbyofthtehePGroApCerutyntObwynetrh,einMcPlCuAd.ing associated costs, will be the responsibility of the Property Owner prior to installation of the GAC unit by the MPCA. b. iIHfnttshhteealPPerrdoopbpeyerrttthyyeOOMwwPnnCeeArr,hhaathsseppMrreePvviCiooAuusswllyiyliinnossftftaaelrllletedod maaaiGGnAAtaCCinuunntiihtteoorGr ffAiiltCeerrussnittthhaaotrt mmfeeeee,ttsspttrhhoeevissdppeeedcciitfchiceaatPtiirooonnpsseoroftfyGGOAAwCCneuurnniisttsisgoonrrsfftiilhteiersrss. `iaPnarcscoctcpaeeelsslresstdyaaggbOryrweetneehemmereeMnintnPtsCaatannAlddl, etppdheeeGrrmmAMiiCttPssCfttihAheeerwMMuililPPto.CCffAAerTt1oht0oeiinmnsPsarppoieenpcctetatritttnhhyeethOiiewnnsnsGtteaaArlllCleemdduaGGnyiAAtroCGerquuufielnntseiittr,oorrrpfferioiltvieeirrdmte0obd dduteehttereerrPsmomreifoinnepmeexeireaastyddtneeiOqnqtwguuaanGcceAyyr Csoofifgihtnnhsseetatlhlised fier as provided under Minn. Stat. 1158.25 ~ Property Owner installed GAC filter unit. The filter as provided under Minn. Stat. 115B.25 - 1158.37, (Harmful Substance Compansalion) Property Owner may request reimbursement 115B.37.(Harmful Substance Compensation) of existing GAC installed 1111.. EMEffPffeeCccAttiivveeexeDDcauattteeesaantnhddisTTAeegrrrmmeieinnmaeatntiitoo.nn oTofhfiAAsggArreeeegmmerenntte.. sTTehhhaiilsmsAAtgeegrrremeneienmmaettenenttusipseoefnfffeereccmitiovvveeaulupopofonnthttheheeGddAaaClteeitthhtaarltttlhhoeecCaCtoeomdmmaimtstisshiseoionPnreeorpreoorftfytt.hhee MPCA executes this Agreement. This Agreement shall terminate upon removal of the GAC filter located at the Property. 1122. RtRaiikggehhtatssnyooffacMMtPiPoCCnAAauRRtheeossreeirrzvveeeddd.b.y NNuonotdthheiirnnggMEiinRnttLhhAiiss,AAoggfrroeeteehmmeerelnnattwsswhhiaatlllhbbreeecscpooenncsstttrrfuuoeeaddnttyooriliemilteitaoosrer dGoiirmmtiinhnrissehhatttehhneeediriggrhhettloeofafsttehheoefMMaPPhCCaAAzfatroodous. `substance or polutant or contaminant. take any action authorized by under MERLA, substance or pollutant or contaminant. or other law with respect to any release or threatened release of a hazardous pasate + SLTOG + www.pca.state.mn.us 651-7_96-6300 PFC GAC access agreement. PFC GAC access agreement OETA 800-657-3864 + TIY6512252 0r BETA TTY 651-282-5332 or 800-657-3864 + ollie Avai!.abte in in salttteermnaatthPiveoesfefoo2rrmm0a/att3ss Pa~e 2 of 3 22668833..00000088 13. PropertyOwner Contact Information. Al correspondence sent o the Property Owner shouldbeaddressed to: 13. Property Owner Contact Information. All correspondence sent to the Property Owner should be addressed to: NNaemme (pplleesasseeprpirningt:): SSttrreeeett aadddrreessss oorr PPOO BBooxx: CCiittyy,, SSttaattee ZZIIPP:: PPhhoonnee NNuummbebre:r: eem-maialil: cG.. MMPPCCAA CCoonnttaacctt IInnffoorrmmaatitioonn.. TThhee MMPPCCAA ccoonnttaaccttffoor tthhiiss pprroojjeeccttsis:: TTReiimmmeLLdiooacctkkirreoemnm Division M5RM2PeP0mCCLeAAadfiaaytieotnteDRidv.isiNo.n `T5SSe2aal0iinentptLhaPPoafaaunluey,l'e, 6tMMt5e1NN-R755d55.5711N-552.656.-844611.0944 TEEmemaleiaplil:htoinmeo:l6h5l1-o7c57k-2i6e86m@simantues. d. oMMmPPiCsCsAAioLLniiaaobfbiliailitntyyy.e. mTTphhleeoyMMePPeCCoAAf tsshhhaealllSl tbbaeeteiliaibnbllteeheffooprreiirnnfjjuourrryymttaooncoorer llooofsstsshooeffwpporrrookppeedrrtetyys,,cooirrbeppederrassbooonnvaaell, iinnujjunudrryyerootfrhddeeeacatithhr,,ccucmaasuutssaeenddcebbsyy awahnn eaarccett or or ttohhmeeisSSsttaiaottene,,oiifff aaa nppyrriievvamattepeloppeyerersseoonon,,f would be the State would be lab in the liable to the claimant performance of to the claimant, in accordance with the work described in accordance with Minn. Stat. 3.736. above, under the circumstances Minn. Stat. 3.736. where e. Effective Date. This Agreement shall be effective upon the date is signed by the MPCA. Effective Date. This Agreement shall be effective upon the date it is signed by the MPCA. 1. RtRaiikggehhttassnyooffacMMtPiPoCCnAAauRRteheossreeirrzvveeeddd.b.y NNtohoetthiMinninggnniensttohtsisa AAEgngvrrieereeommnemenentnttssahhlaalRlllebbseepccooonnnsssettrrauuneeddd LtooiamlbimiiltityooArrcddtiimm(iMinnEiisRshhLAtthh)eeorrriigoghhtetoorffttlhhaeew MMwiPPthCCAArettsoopect 10.any release orthreatened releaseof a hazardous substance or polutant take any action authorized by the Minnesota Environmental Response and to any release or threatened release of a hazardous substance or pollutant o contaminant Liability Act (MERLA) or contaminant. or other law with respect CCeerrttiiffiiccaattiioonn rBBeyyptrhteheseieirnrstsi,igtgnhnaeatitururareegssenbbteesll,oowws,u,cttchheeessuuonnrddsee,rrssaiinggdnneeadsdsrrieegppnrrsee.sseenntt tthhaatt tthheeyy hhaavvee aauutthhoorriittyy ttoo bbiinndd tthhee ppaarrttiieess tthheeyy. represent, their agents, successors, and assigns. MMiinnnneessoottaa PPoolllluuttiioonn CCoonnttrrooll AAggeennccyy PPrriinntt nnaammee;: GGaryaLLKKrrruueegygeerr oo TTiittlee:: SSuuppeerrvviissoorr SSiiggnnaatturere:: PPrrooppeerrttyy OOwwnneerr Phntname(s: Print name(s): SE SSiiggnnaattuurree(ss)): _ _ rus -- oDwatee: DaDtaete:: EE pcan + 651960 + PRwwCwG.ApCcac.csctaetses.mcynr.uesement 651-296-6300 B00AST3064 800-657-3864 + TIY6SN202.53020r 06ST 306+4 Avalablemetematieformats TrY 651-282-5332 or 800-657-3864 Avaitable in Pose 3of3 a!,ternative formats PFC GAC access a~treement Pa~e 3 of 3 22668833..00000099 GGrraannuullaarr AAccttiivvaatteedd CCaarrbboonn FFiilltteerrss MMininnneessoottaa PPoolllluuttiioonn .CCoonnttrrooll Agency J senate tos gly cnocnosnitdaemreindatteodbewaesllawfeastoeurrisceuosfually considered to be a safe source of U ddrriinnkkiinngg wwaatteerr.. WWhheenn aa wweellll bbeeccoommeess commit sve rem contaminated, a water treatment system (a ffiilltteerr wwiitthh ggrraannuullaarr aaccttiivvaatteedd ccaarrbboonn,, oorr GGAACC)) iiss aapprroovveenn mmeetthhoodd ffoorr rreemmoovviinngg gas chains he Troupin and opperegrrffallnuuiocorrocochchehmeemmiicicacalasllssliffkrreoomtmrticthhheelwowartoaeetreth.r.ylWWehnheeennand Cetin och wel cend bi contaminant levels in a well exceed healthced mi, heMimo Pollan Conol bAAaggseeenndccylyim((MiMtsPP, CCthAAe))MmmiaanyyneiinsnsostttaaallllPaaolwwlhuhotiololene--hhCooouunsstreeol GAC Mir Th hr rope th commits GAC filter. This filter traps the contaminants oatyour dking we mesnah so that your drinking water meets health- `bbaasseedd lliimmiittss.. TThhiiss ffaacctt sshheeeett iiss iinntteennddeedd ttoo provi you wi formation shot he fer provide you with information about the filter nd spe yon can ake 1 mre operas and steps you can take to ensure it operates over properly. Whats GAC? What is GAC? GGrraannuullaarr aaccttiivvaatteedd ccaarrbboonn iiss mmaaddee ffrroomm rraaww organiaul ha ovonut hellosr organic materials, such as coconut shells or CivicsNigh neater Hea sed coal, which are high in carbon. Heat is used Tose he suis wesof becuton The to activate the surface area of the carbon. The ardcuban remove crn cms activated carbon removes certain chemicals om th war posroiughnGgAC Fr from the water passing through a GAC filter by vappoe ihenmga nth GAC by trapping the chemical in the GAC. Tiowerer,ahr chemical. i ron nd However, other chemicals, like iron and ite,a oranaied to he catonnd nitrate, are not attracted to the carbon and Serena wt Seavey mar therefore are not effectively removed. J ---- It is important to know the level of Compiand nhe volumeof watered contaminants and the volume of water used oie eee he comet sre nd | components ofthe itrationsystem. All in order to determine the correct size and components of the filtration system. All trreeaattmmeennttsysysstteemmss rreeqquuiirreepprrooppeerr iinnssttaallllaattiioonn,, Pena montoing and rameraee periodic monitoring, and maintenance. Evenltyhe GAC oss 5 aly foray Eventually, the GAC loses its ability to trap nd remhemoi vend need oe and remove chemicals and it needs to be hinged Th MPC Geis when changed. The MPCA determines when MChtalhers need to be changed MPCA-installed filters need to be changed. nome ass he GAC can ct sever yrs In some cases, the GAC can last several years dependinong containlevels and weer depending on contaminant levels and water CClleeaannuupp/SiSupueprefurntdun#d1.0#15.0+5 JJaannuuaarryy 22000099 . AAbboouutt yyoouurr GGAACC ffiilltteerr ssyysstteemm AA wwhhoollee--hhoouussee ffiillteerr iiss iinnssttaalllleeddaatt aa ppooiinntt oonn ee on tw`hwiiellllhrroeemssuuleltt'siinwn ttarrteeeaarttmsmueepnnpttolyoffapalllullmwwabatitneegrr ttwhhhaattich ttrraavveellssttoo aannyy ffaauucceett oorr ffiixxttuurree iinn tthhee hhoommee.. espe etx ren hore Tffaayucpceiecttassllaaynn,ddthssepprrMiinnPkklCleeArr sswyyssittlelemmesxs..clIIuttdrreeemmoouovtvseeisdsetthhee Letsid srk 1remcn chemicals before they are ingested, inhaled, orembelie dh reneed, hat oorr ababtshoirnbg.edTthhirsouisghimtphoertsaknint dfourrisnogmweashing or bathing. This is important for some opcalig Ti important for some chemicals that readily evaporate from water chemi hat edly evap or easilyippass throug8h the skin. The ers re uly ylidrical in she The filters are usually cylindrical in shape and abot four et ll and 15 mehes in, and about four feet tall and 15 inches in ameter These Faer rally tle as diameter. These filters are usually installed as pan aibough moremaybe ried a pair, although more may be required in en Ts it some situations. Two filters arranged in sequence eennssuurree tthhaatt any organic any organic shania hat | 7] chemical that mightger | 1 might get path st past the first Hari filter is rapped by trapped by hesont the second. When oe When the oN MPCA rreeccoommmmeennddss jea filter be Serb changed out, onged fine the second fmiltoer vistoethde moved to the stints first position rPao and a new is filter is = 2 a3 51k zn Sail ad estos c-s1-05 use. Mores FolClontiAogrn 520 aoe 3.1.1. Pu, WN 5155-4104 wpaSao ns Minnesota Pollution Control Agency 520 Lafayette Rd. N., St. Paul, MN 55155-4194 www.pca.statemn.us TION SO0SHT e+TY 5135a2550095755520 Avan Sra ome 651-296-6300 , 800-657-3864 TTY 651-282-5332 or 800-657-3864 Available in alternative formats 22668833..00001100 ppilllaalcceepddiiinnetthheertssheeefccocohnnoaddngppeoro-ssioit"utimitoosnn...OOSfaftmteepnnleMMPpPoCCrAtAs lccooocnnatttrreaadccttoorrss wbeiflolrpee,rfboertmwetehne acnhdanagfee-routhtse. fSialemrsplaelploowrtsfrlocteastetidng of before, between and after the filters allow for testing of ttShhyeestwweaamttaeetrricaattmeeoaanccihhtior ollrooiccnaagttiiooannnd((ssaeeeemaddiii;naaggtreraanmma)n.)c. e schedule bSayssetedmoanticcomntoanmiitnoernintglaevnedlsaamndainatteenranucseesacrheeedsusleential based on t1o0 eennssuurree ctthohaantttatthmheeinGGaAAntCCleffviilelttleesrrssanffudunnwccttaiiotoennr ppurrsooeppeaerrrellyyesaasnneddntttihhaaaltt aa cchhaannggee--oouutt ooccccuurrss bbeeffoorree tthhee ssyysstteemm lloosseess iittss aabbiilliittyy ttoo t,tTrraaypp pcchhieemmciciaaaclalsslis.l.mypl,e water meter is installed wi|th the you periodically faometrer readiTasng, Trcp hi ciritiscal to Typically, a simple water meter is installed with the `GGAACC ffiilltteerr ttoo mmoonniittoorr wwaatteerr uussee.. TThhee MMPPCCAA wwiillll ccoonnttaacctt propery monitor you periodically properly monitor th performanceof for a meter reading. the performance of the GAC filer This is critical the GAC filler to sysysstteemm.. + Comertsing yr met wellwa omen What can | do to ensure that my drinking `Wwwaahttaeetrr crraeenmmaaI iidnnosstssoaaeffeen??sure that my drinking "The GAC fier system is designed to emove the T`choentGamAiCnanftilstedrestyesctteemd iins ydoeusrigwneeldl twoatreerm.oHvoewtehveer, ttechhnoeesnrruteearmeaarrtieenhassanoomttmsheeedeiifmtmiepepcorotrertcdtaaonnnintttiyssnttoueeueppsrsswfyyoooelouulpnwenreeaaeettddeer(t.po0Hratoaokpkweeeert(vyo0er, ensure .that the filter continues to operate properly: CyyCeeooaamnrrsmffioodorernnrncitietotrsnartttieanamgtaaiennynddaonucctrooslluiiifnfonforiprlmtrmeirvbeaabdtacecttweewrreieialall..swT,Thahefteesisreeanoranrecee a Tcrceoeossumuunlmlttiiyonnnggpucffbrolroniomctmahmsseeeaippnltttaiihcnctdssseypisnyaterpmtsrmisovetaonrttrefefmeewraretmtyilllliszbzs,eeerorafuutbseselne..tYYooouurr ppccroorooupvvnyiiotdydfeeptyyuhoobeuulircwwehitehsaialauts1hs0iliymdmhtopeplpuslearetrtteMmetsPetnkCkitiA.tm.sPaPtylaleefabafsseceeoanppbtrrlaeoocvvtitoiddee aa. ccI1ofhaaplytoteersosittfndtdeheeett"eersccetthsssuocclctoosklli"itfofotoryhrmoemuwbbraeaMcclttePetrorCiiaaAkiaalnlnstddhafeyyfoocbuuoacnnntteeeaeerciddta.,t0oyou mcmphraaelyyovreninnneetaeettddhe tt(oo"csththelemoomrcppikoonr"era)arrrtihiolleyymbwbyqyepulpaliasctsoksslkytthihlueelstffhiiilenteebrruapsscyytlesstreeieamrn, yttooou pccsaaurpepiavadceicatninyttcy.et.hTTbeeaaflclokkhrltoteoordiyynoooeiuunfrrgroMMtmhPiPsCCq. uAAisctksatlayffffuccsoionnngatacuctpt forfilter for + gAulildoawnctehebMefPorCeAdooinrgsthciosn.tractor to collect a AStsahalmemloppMwllPeetChooerrAccMdooenPndedCumuAccsttoimmtranaiietisncntetcseeosnnnaaartnnryacc,ceeatonoorndntttophhreecoossvlyyliessdctietetmamhewwhheenn tMMihmePpPoCMrAAtPaCnwwtAiittthhodemmmeoeemnttiesetriotrrreenaaaeddnciidennsggesssanrswwyuhh,reeeannncdoaansspktkreieodndv,u.iedTTdehhifitssheeiirss vveerryy ismysptoermtapnetrtofomrmoannictoer and ensure continued filter sIy tyfhsyotroeoumo uagarphreeleayran fwwofarlamyuysahffnrhrcooeemm. shhyoosmmteeefmfoboryraacwowemepeelkketooerrlymmooorpreee,n,ing. taauhsFfoiirlneotgeurragedndhyltayawppafltuooersrrhfffatahuocecedetstyffsorotrremaattioblferyaanscsctotoo33mkk00ipnmlmegiitipennluuyerntesposopbbgseeeneffisoonrrgee uT"cToshhiniinstsgawwmiaiilnlnllyahenwetplasptehrrraeemtfmomoorvvadeeyriaanhnnkayyivnebbgaaboccutrieelrcrtiioauaopookrriwnhoogitehlpeerurrtphoesGesA. C cffiiolltnteetrramssyyissnttaeenmmtswwtahasastnnmoottayiinnhuuassveee.. AbAullttihlhtoouuupgghhwrhraairrleee,,tbhbaeaccGtteeArriiCaa biin nettshhthe peeesycssysityesamstlteelmycocaannneccoofnonvrveerirxntttfaniniatttrsrtaantteedttoooytnoeiutn,nriigttew,chhwiilhcdirchehn ccaann + Cbheeecskpeycoiaulrlysytsoixeicm foomr inmfaanntsilanydbyasoiusntgocehnisldurreent.hat tatChchheceeirredecekaanrrtyeeaolnnuloory sllbeyeyaaspkkteassm,s, sooerordntthh(ahaaattomllntthoohienewnitsgshnyylgysstuitebnemntamrsseihhsaaaittssoesdnneootwnttassbbtueeerreeenntthoat Ra ps accidentally bypassed (allowing untreated water to reach the taps). Report any problems, changes in units, such a5 8 water softeno reverse osmosis toyour xwater p'rMeIssPuCrAe,stoarfufncuonstuaacltt.aste, to your MPCA staff contact. odor or apwpearance IIff yyoouu aarree iinnssttaalllliinngg ootthheerr ttyyppeessooff water water treatment treatment unititss,, such as a water softener or reverse oosmosis donsltgseysnesmsdodosoet compromise the operation uunniitt,, pplleeaassee wwoorrkk wwiitthh tthhee MMPPCCAA ttoo eennsusreure tthhaatt tthhee additional systems do not compromise the operation oofthef theGGAACC fifierlter sysystem. iPprnrookppieenrrlgyy wmmaaaitinnettaifinonreedyd,o, utthhaeenGGdyAAoCCuffiilftlaeerilssyyssthteaemtm wwmieillltl spprroovviiddee derlintkhi-nagsweadtelrimfoitrsyfoour tahnedcyoonutramfianmainlytsthfaotunmdeeintsyour wellhealth-based well. limits for the contaminants found in your |S NESTE CCoonnttaacctt iinnffoorrmmaattiioonn I1iffnsyytooaluulhahataivvoeneoqqruueoespstetiirooanntssiooornr cocfotonnhcceeermGnssArrCeegfgairalderirndsgiytstnhhtgeeem, cinosnttaalcltatitohen MorPoCpAerasttiaofnf ofptehrseonGwAhCo sfilatsesrisgynsetedm, your J TMponA contact the MPCA staff person who is project. The MPCA general telephone assigned to number is your 651-296-6300 or 800-657-3864. aIysfsoyoocuuiahhtaaevdveewqiqutuehesscttoiionontnassmrrieenggaaanrrtddsiinniggn hdhereiaanlttkhhinccgoonnwccaeetrrennrss lease c`acoAsonssntostaecacsicatsttmettehhdneetwMMaiitnimhndnnceCeososnonottsatuaamlDDtinaeetappinaaotrrsntmmiUennenindtttriooantffkH6iHn5ege1aa-wll2ta'h0t'1ses-rS,S4i8iptt9leee7aoser health hazard@stae ns. Assessment and Consultation health.hazard@state.mn.us. Unit at 651-201-4897 or ans Water from well TE Sampling pod (raw waled unfiltered) mn Sampling port =E (between GAC -- Sampling port (after GAC checks v/aler after both filters) am Treated (ltlterea) water to house faucels GDDAiiaCsggSrrayamsmtooeffm GAC System Les 1| 35] iE cE con1| go Canisters approximately feet tall ~----fB-oe Approximate~ mmm For canisters this size, each ftlter contains 90 pounds of GAG. GranuleActa Granular Activated CCaarrbboonn Firs- Filters 4105 c-sl-05 January 2009 January 2009 PPaaggee22 EY Nima - 22668833..00001111 e MinnesotaPollution Control Agency Minnesota Pollution Control Agency peastate.mn.v THHhiasafrarcmmtsfhefueut,llprSSepuaurebbdsbsytttaahennMiccnneeesoCCtaooPommllputpieonenCnosntsaroaltAtigieoonenny (MPPPCrrAo)oeggxplrraaianmsmhow individcuaanglest fTihniasncfaiaclt idfosheet, pprreoppaerretdy dbaymthaegeMoinrnpeesrosotanaPlojlluutrioyncCauosnetrdobl yAgheanrcmyfu(lMcPhCeAmi)ceaxlplsauibnsstahnocwes.individuals can get financial aid for property damage or personal injury caused by harmful chemical substances. WWhhaatt iiss tthhee HHaarrmmffuull SSuubbssttaannccee CCoommppeennssaattiioonn PPrrooggrraamm?? TTKhihneedsHHaoarfrmmnffuuullrSSuuobbsstptaranonpcceeerCCtoyommdpapemneasngaseatitifoornnomPPrreooxggprroaasmmur((eHHSStCCoFPh))awwramafssuclcrseuarbtesdteattnoccaeocsomtmpaepineennsnsaedatstecetppaee.rrssToohnnissswwehxhpooosssuuufrfffeeerrmccaeeyrrttoaaiimnn e fromkindswoaftienrj,ursyofo,roprroapiecrotyntdaammiangaetefdrobmy iemxpproospuerrelytodihsapromsfeudlosfuobrstdainsccehsaringeMdinchneemsioctaal. wasThiste,xppoesturorelemuma,y orcome agrictural chemical, from water, soil, or air agricultural chemicals. contaminated by improperly disposed of or discharged chemical waste, petroleum, or TcThhoeempHHaSSnCCyPP rwweaassspoeenststiaabbblileissohheerddth0toe dppraroomvvaiigddeee.aDaenncaaidsdmimioninnissistotrrnaattciivvoeempaleletnersrnanataiitiovvneeattrooeffimliianngdgellaabwwyssuutihittess CasoggmaamiinisssttsttihhoeeneppreerrossfootnnhooerrMPCA. TpTcrohhomeefepCCsoaosmnimmyoimnraseilsssssipiokoonnnneoesrwirblrrleeeedccfgeeoieivrvaeetbhssleeaadddavvabiimcoceueatgaaesj.unnDreeiceceeecssissssicaoarunryyssfreorodnobmmcoppmhhhyapysrseiminccfsiiuaaalnntsissounknbnosaotwrwaelnieecmdceaslg~d.eeeaaanbbbdiyletfhiinrneottomCoxxotichcmoeomlooMgigisynys,,nioefrnrsooeomrmtoahhfAeetthaaloelttrhhMnePyCA. Ganeras stat. professionals knowledgeable about injuries caused by harmful substances, a nd from the Minnesota Attorney General's staff. WWhhaatt kkiinnddss ooff ppeerrssoonnaall iinnjjuurryy aarree eelliiggiibbllee ffoorr ccoommppeennssaattiioonn?? IsInnujjbuusrriteeassncgeeliigaibnbdliemffoaorryccioonmmcplpuedenens:saattiioonn romfrom the the HSCP HSCP are are those those caused caused by by exposure exposure tto aan dentable identifiable harmful harmful subs+tancAecharnodnmicayorinpcrlougdree:ssive disease, ness or csabilty, reproductive disorder, or physical deormiy. A chronic or progressive disease, illness or disability, ssuucchh aass ccaanncceerr,, oorrggaanniicc nneerrvvoouuss ssyysstteemm ddiissoorrddeerr,, + AAriecnctpuuorttoeetdhddueiicsseeteniavavsesieerdssoisonoormrerccdnooetnnr,d,dipoittriirooopnvnhissdytteshhdicaaatttlhaaderreeepfacoorbbrmvyviiioortyuue.ssspaaofnfttseeirrbllmiemifoitteedtheeexxpproeoslseuuarrseeettioos hua anhrakmrnmfuofulwlonssuuubbnssattabanlncceeetrroeelleeaasseedd compensate the victim. into the environment, provided the party responsible for the release is unknown or unable to compensate the victim. W Whhaatt kkiinnddss ooff pprrooppeerrttyy ddaammaaggee aarree eelliiggiibbllee ffoorr ccoommppeennssaattiioonn?? Ifthecontaminatioan the person's principal residence, elgbe damages include: If +the coTTDnhhetaeepmarrreientaaamssteooionnnntaabboilslfeeaHccteootashslttetoohpffehrrareesspoplaanldc'asvinicpsgirenoiodnrgrctiddhpeeatccl ootrhnentstaiadwmmaeitninnecaaertt,innneoggltigGdbirrbeiinlenukisidnneaggdmfwwoaaragtdeteesirr inanattcglaau,dhheoo:mmee when when the the Minnesota Minnesota + STTDyhehseptearremretaabmsseooennnasatbtbolalefelcHlcoeoedssattltthtooophiirnansosstttaaealcdllltvaihsvveuaadmppaotohnrrammthietithtaiiegtgaahwtdtiiaouotnenetrssoynyssotttleemlbmevaauatstpaeodrhhoofnommtreeudsrwhiinhoekeninnnogftt.hhheearMMmPPfuCClAAshhuaabssstrraeencccoeomsm.mmeennddeedd a a + sLLayoosssrtsseeemssdffoboerfrottihrnhesetthasseaallleloeedwonofteforaa.phhrCoooomtmemeecpteaatnhetssulteamsthsainotahnhanenattlhmthheeidaaueppepptrtroaoaiis7sse5eoddi%lovmmafaaprtrkohkeeretitndvvitarlfu~ueusereioeinnfcttohehfeenhsstaalhrlmeeefwwupaalpsssrnunaebecssceeteasdssnsacmarearysyr.kddeuuteevt(ao0l3ae hanadrdtshheipsfeolrinthg eriocwe.ner. Compensation is limited to 75% of the difference in the appraised market value + aTThnhhardeedtisinhnhcecirrpeseaesasilslteienuddagtccipooorssnitcttetto.o smmealaliintnthtaeaiinpnrttowwpeoorrtreeyssdiidudeeennctceeossthwwehhceeonnntccaaamuuissneeaddtibbeyny.tthhee nabiofya inability of a property property owner owner nain a or ligheaprdrsohpiperstityudaatmioangeto stehllethcoemppreonpsearttyiodnues iced t $25,000 for to the contamination. zach os. CFloariemlsigfiobrlerepnrtoapleorrtybduasminaegse,ptrhoepceormtopyrensseactoionnd homes are not lgble. is limited to $25,000 for each loss. Claims for rental or business property or second homes are not eligible. Wiesta Polson CorlAgcy Minnesota Pollution Control Agency a 66551:~--229966--66330000 I| 880000--665577--33886644 oorr uusseeyyoouurrprpereffeerrrreeddrerellaayy sseerrvviiccee |I Info.pca@state.mn.us bray | cian January2017 I c-s1-01 aAvlaailabblleieinntaeltrenrnaattiivvee ffoorrmmaattss. 22668833..00001122 WWInjhuhraiaetstthttaytyppreeessnoootffeiignnijjvuuerrfiieoersscoaamrpreeensiiannteeiloliinggiiinbcbllluedee:ffoorr ccoommppeennssaattiioonn?? +Injuries that are not eligible for compensation include: iconmuprenesatthiaotnr.esult from workplace exposures andfor which Injuries that result from workplace exposures and for which an an award award sis made made under under worker's worker's The + Icormipsenscaautisoend.byuse persInanjurrieesscpaounssedefboyrutshee oorffecclooeannssseuuommfeetrrhpeprrohodadurucmctftsus.l. substancecannot fle acim. The person responsible for the release of the harmful substance cannot file a claim. oHHroolwwigbaalrreeeiniinunrjjeuu,rricieoemsspeccnoosammtpipoenennisnscalautdteeesdd?? For + Reimbursemeonrtmedial expenses. eligible injuries, compensation includes: + RReeiimmbbuursresmeemnetfnfootrr omsetdwicaagleesxpoerinsnecso.me andfr lst household abr. Comp+ensPRPaataeyiyimmmoenbenunftrtrsooeoffmsddteeenaawtttahhfgobebresenl,onesoeftsfiiwtttsaotgtouoessddeeeohppraeeinlnnddcdeoenlmtnabsetso.r.a,nadn for lost household death benefits Labor. imited 0 $24 000 each er yer. There mo mi Compensation on mecca expenses, but he maximum awar for lost wages, lost household labor, and deathd 0 ary benefitson person camo exceed is limited to $24,000 each Sp2e5r 0y,e0a0r.. There is no limit on medical expenses, but the maximum award to any one person cannot exceed ~250,000. IIss tthheerree Apersonal naauttriimlmieemllim immiittbs oonnleffdiillwininigg taatwhccollyaiaeiaimnrms??aft r the nur an d fs c o nn e c ti o n fo ex p o s u re 10 AHaprmefrsuolnsaulbinstjuarnycecwlaaismdimsucsotvbeerefidle.d within two years after the injury and its connection to exposure to a harmful substance was discovered. dAperteorpmeirnyeddamage aim mubsflted A property damal~e claim must be filed within within twtwo years years ferafter the the total total amount amount of of compensable compensable sss losses ancan be be determined. AAvree = tthhAeecrrleeimrrceeossnttnrroiitcbctetiiofolnendssbooyannpffeiirllsinoinnggwhaaocchllaaairimemc?e?ived compensation or the injury or damage from the + AAppaacrprltetayyrimsrreoencsspapcoonannnnssoniitobbltbleeebffrfooiirltrenhgdthaebnyrraeaceletpaliesnreesooiaonfnftcswthoheuherothhhaaaarnrsmmdirfubeuleclfessoiuuvrbbeessdtttaahcnenoccmMee.Pp. eCnAsaCtoiomnmifsosritohneeirnfjuorytohersdaammeagejufrroymorthe + amg a he same time. A person cannot bring an action dDaomubalgeeraetctohveersyaims eprtoimnibei.ted. If in a court and before the MPCA Commissioner for the same person accepts an award fom the MPCACommissioner, injury the p or ers on = + Double recovery is prohibited. If a person accepts an award from the MPCA Commissioner, the person fcaannpoetrsboinnhgaas raecctiivoendinacaovuorrtafbrletchoaurst jmuedgnmuernt,o dtahmeapgeres.on cant fle 3 am with the MPCA cannot bring an action in court for that same injury or damage. If a person has received a favorable court judgment, the person cannot file a claim with the MPCA Commisioner unless the judgment was not pid. Commissioner unless the judgment was not paid. poerrseonsdofeosfnoot npereodpaenryttdoamraegyeofil ma cliaiem. dfh0e1p5e%rosfotn hchoaomsoeusntto abwearrdeepdr.esNentoedibyeanxaitoosr eeestohen A person does not need an attorney to file a claim. If the person chooses to be represented by an attorney, the nur swards. attorney's fee for a property damage claim is limited to 15% of the amount awarded. No limit exists for fees on injury awards. AHHftooerwwanaairrneevescctillgaaaitimimonssofddaeeccciiimdd,eetddhebbMyyPCtthAheeComMMmiPPssCCioAAneCCrooormmCmomimsmississiisooinnoenersr??delegate drafsa preliminary AmGdcwileafattciaeihmiisrtioaaothnnnnetftitpnfoooorverrgelrrrsieaetmivvngiiiatnaeoeaotwwrirro.d.yndnaIIdfefroethnhcyfyeieasccoecdoonlemmac,cpimpietosehn,ionnestnhsalieatisistiiMmoaoacnnaPcccnCwweetAippitttthcCeeahdodanamnbbcmyyeehxtaxitpslhhplsleelaaieonnnccanglataaeeitiiriomotmnohn.aare.nnCTTtp,H,horiiieimststlbpmbiprmeerieisecclnsoloiaiimmomrmnyeieinnesscaari'frrrsisyanyildaddo.eele.ndlce.IsfigsithaAihooteneennoccdsisillraaacppiifemrrtmoosoaavfvtnhaniiedtdtcpeesihsrddeaontltiolootmttltihhssneaaeeanttriigyssffeiieedd whumcahrsiautawhtslniltebtthgbnneeegesserrpseerccecceooseenlniiiscmvsviaeiesisnndtdtsabsybreooyyftfhtdhaaheeennaecrfiidMMnso.ifPoCorAnCrfmAm,tAateahlCCrleoothhmhmceeimlasaamirrifimsiinsonilsa~groinombnbtnaeeecelffraoronrwwhericeitthatthhhrahiieeinlnlenCC33ngoo00gmtmehmddeiamathysyMisesssPisoopoiCfofnrAnerreeelrCiecmr,a,ecmiiiinvnnmeianiwwrilsh~yhiitnitdcchchgeehhnecemimpsrpoie'roorelsrnelemi.dmieeeAncivvnianiisadrdoireeoytyinnncsdcdceeeeencociaccifssaalitinnhooznnebbe..eedcTThii.hhnaniitsstlrTlorehondedguruececeeidds nororwiitgnhestsoejsudciacnialberehveieawr.d. After this informal hearing, the MPCA Commissioner's decision is finalized. There is no right to judicial review. soe2or2 Pal~e 2 of 3 [------ January 2017 I c-s1-01 22668833..00001133 + FtFohorerpapeiremsaonnratlnaisnnujdurortyhlcenilaCisomam,sm,itltshhseeiMMonPPeCCrAA'CCionomvmmeismtsiissgisatoioinnoenerrsmmhuouswstt ggoaranbntetccokommeppleenntssasatttioonnwwhheenn iinnffoorrmmaattiioonnpprroovviiddeedd bbyy the + The claimant claimant and the + TThhee ccllaaiimmaanntt Commissioner's investigation show it to be likely that: hhaass abnealngeibxlpnuortso aaennddeelnigtiibflieablolsehsa.rmful substace has an eligible injury and eligible losses. + + TThhee TThhee ccccllllaaaaiiiimmmmaaaannnntttt''s'shaeiesnxxjppbuooersyseuuncrraeeenxbvwpeaaosscseaddduuuseetoettdoaootnrthshiedigerrnneeitllfeifeiaiacassabeenloteolffyhttachhreoemntahfruarilrbmsiuutfbluesldtsastunoubcbsseytt.aaenncxcepfforrosomumrtaaeo ffatachceiilitthyyariinnmfMMuilinnnnseuesbsosottataa.n. ce inthe amount andduration oftheclaimant exposure. The claimant's injury can be caused or sil~nificantly contributed in the amount and duration of the claimant's exposure. to by exposure to the harmful substance tFFhooerr cpplrraooippmeearrnttyty addnaadmmaatghgeee Cdcoliammimmsiss,,sttihhoeeneMMrP'PsCCAiAnCvCoemosmmtiimgsasitsiisooionnnseerhr mmouwusstttggrrbaaennttkcceooymmppteehntns.saattiioonn whe when information information provided provided by by the + The claimant claimant and the has lige damage and eligible loses under the Commissioner's investigation show it to be likely tlhaavt:governing the HCP. + TArheelcelaasime afnrot mhaasfealigcibileindaMminangeesoatnad ceoliuglibdlehalovsesceasuusneddetrh preseonftche the law governing hthaermHfuSlCPs.ubstance on the A release from a facility in Minnesota could have caused the presence of the harmful substance on the pprrooppeertryty.. +The WPCA determinestha dining water or soi vapor corrective measures taken re comparable The MPCA determines that drinking water or soil vapor corrective measures taken are comparable to actions th agency would implement to protect public halt. actions the agency would implement to protect public health. FFoorr mmoorree iinnffoorrmmaattiioonn 6FF5oor1r.mm7o5or7ree.2ii5nn0ffo5o.rrmmaattiioonn or or to to abtalinm obtain a claim application application form, form, calcall Gary Gary Krueger, Krueger, MPCA MPCA Superynd Superf,und Program, Program, at at 6FPFor5oro1rg-aa7rnna5maa7u,-ut2thph5ol0ore9irait.staaettiirvveeefddeee0rssccMriiprntniio,pnoStoafitft.tohhn5e5iri1gghh1tt5ss0aan.nd2p5pr-ro3oc3nce6eddduMurireenssn tthhaattchgg.oovv7ee1rrnn0thhee arf Harmful Substance Substance Compensation Compensation MPCAwebsite Program, please ity: suns pcs sate ms. refer to Minn. Stat. 115B.25-36 and Minn. R. ch. 7190. MPCA website: http://www.pca.state.mn.us. sare Page 3 of 3 nay 01 | enn January 2017 1 c-sl-01 22668833..00001144