Document 4aYXGE375z2bx89e8doZQr48Q
American Exploration & Mining Association
10 M Post S t Sis. 30S | Spokane? WA 99201-0706 P. 509.024.1158 j F. 509.623.1241
5nfoiS1mlrengairsersca.org j www.rrsinsrsgaorerica.org
July 11,2017
Environmental Protection Agency Office of Resource Conservation and Recovery 1200 Pennsylvania Ave. NW Washington, D C. 20460
Re: Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes of Facilities in the Flardrock Mining Industry 82 Fed Reg. 3388 Docket ID No.: EPA-HQ-SFUND-2015-0781
Submitted via http://www.regulations, gov
The American Exploration & Mining Association (AEMA) submits the following comments on the Environmental Protection Agency's (EPA) proposal to establish financial responsibility requirements for the hardrock mining industry under CERCLA 108(b).
AEMA (formerly Northwest Mining Association) is a 122-year old, 2,000-member national association representing the minerals industry with members residing in 42 U.S. states, seven Canadian provinces or territories, and 10 other countries. AEMA is the recognized national voice for exploration, the junior mining sector, and maintaining access to public lands, and represents the entire mining life cycle, from exploration to reclamation and closure. More than 80% of our members are small businesses or work for small businesses. Most of our members are individual citizens.
Executive Summary
EPA's CERCLA 108(b) Proposed Rule for hardrock mining and beneficiation is a classic "solution in search o f a problem f a problem that clearly does not exist. For the reasons set forth below, AEMA submits that EPA should withdraw the regulations in the Proposed Rule and issue a Final Rule concluding that no additional financial responsibility for hardrock mining pursuant to CERCLA 108(b) is required. EPA has failed to establish that the degree and duration o f risk associated with the production, transportation, treatment, storage, or disposal o f hazardous substances for hardrock mining require a rule that imposes duplicative, onerous and economically devastating financial responsibility (FR) requirements. EPA has failed to recognize that federal land management agencies (FLMAs) and state mining regulatory programs reduce the degree and duration o f risk to minimal levels, and their financial assurance (FA) programs ensure that there is no un-bonded or unfunded risk of Superfund liability.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00001
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 2 of 35
EPA has failed to recognize that hardrock mining practices are significantly different today than in 1980 when CERCLA was enacted (See Appendix E, REVIEW OF ENVIRONMENTAL PROTECTIONAGENCY EFFORTS, FINANCIAL RESPONSIBILITY RULES, By the SOCIETY FOR MINING METALLURGY & EXPLORATION, INC., attached to the National Mining Association's [NMA's] comments). Over the past 35 years, mining practices have changed, engineering controls have been developed, plus federal and state regulatory programs and FA requirements have been adopted. Societal values have changed too, and industry became more aware of its impact on the environment.
The attached White Paper and exhibits (referenced hereinafter as "White Paper" and
incorporated by reference), HARDROCK MINING RECLAMA TION AND REGULATION - DEVELOPING SUSTAINABLE ENVIRONMENTAL PROTECTION THROUGH CHANGING VALUES, CHANGING LA JUSAND EXPERIENCE: A FEDERAL AND STA TE REGULATORY SUCCESS STORY,
explains the evolutionary process from historic mining to today, where hardrock mines are designed, permitted, built and operated for closure. Prior to 1970, hardrock mines were typically designed and built to maximize production and minimize cost with little or no regard for environmental values. This was no different than other industries.
However, beginning in the 1980s almost all new hardrock mines have been designed, built and operated to integrate long-term environmental closure and reclamation as a primary design standard, and this is required by current federal and state law. At the same time, the FLMAs and States have significantly evolved their FA programs with specific emphasis on post-closure care and maintenance, thereby minimizing the long-term potential for releases of hazardous substances and un-bonded agency liability.
Throughout 2016, AEMA participated as a Small Entity Representative (SER) during the Small Business Advocacy Review (SBAR) Panel required by the Small Business Regulatory Enforcement Fairness Act (SBREFA) amendments to the Regulatory Flexibility Act. During this process, the FLMAs and state mine regulatory and FA programs demonstrated that their regulations contain enforceable regulatory mechanisms with FA that effectively address each of EPA's 13 response cost categories in the Proposed Rule.
The FLMA and State mine regulatory and FA programs coupled with engineering controls and best practices reduce the degree and duration o f risk associated with the production, transportation, treatment, storage, or disposal o f hazardous substances to minimal levels and no additional FR requirements are necessary to protect the American taxpayer or the Superfund Trust Fund. These FLMA and state reclamation and closure requirements require more than reshaping land and revegetation. They require a mine to be designed, built, operated and closed to prevent the release of hazardous substances and ensure compliance with statutory and regulatory standards through the entire mine life cycle, including closure and post-closure.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00002
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 3 of 35
Initially, when CERCLA was passed on December 11, 1980,1Congress directed the Executive Branch to implement FR requirements in accordance with the "degree and duration o f risk" associated with the "production, transportation, treatment, storage or disposal of hazardous substances."12 This congressional authority was tied directly to the level of risk and the necessity for federal regulation.3 The President was granted discretion to implement these requirements, but required by Congress to 1) take into consideration the needs of the various industries for oversight and 2) consult with those who would provide financial backing for operations, to make sure appropriate funding would be available.4 As demonstrated below, these two requirements have not been satisfied by the Proposed Rule.
Nevertheless, at the time CERCLA was enacted, the Executive Branch did not take action, nor did it take action after the SARA amendments were implemented in 1986. Similarly, EPA took no action after it was delegated authority in 1987 through Executive Order 12580.5In the decades that have passed since CERCLA was enacted, it has been primarily the FLMAs and individual States that have filled this void and satisfied the need for FR requirements for the hardrock mining industry.
As explained in the attached White Paper to this comment letter and cited above, the FLMAs and states have increased their oversight of mine permitting and reclamation practices, and they have developed comprehensive schemes covering all aspects of the mine permitting, reclamation and FA process. It is unusual that government and industry agree on environmental issues. In this case, however, industry, States, FLMAs, and the U.S. Small Business Administration (SBA) have had the same message to EPA in the CERCLA 108 (b) rulemaking--that existing FR programs are working at modern mines and there is no need for a costly and duplicative EPA program.
FLMA and State programs tie FA requirements to each mine's individual permit stipulations for operations and closure, and these requirements are reviewed and updated by the FLMA and/or State on a continual basis. EPA's Proposed Rule ignores these existing FLMA and State schemes and ignores the adverse effect that duplicative federal oversight would have on these states and their citizens. Instead of considering the present degree of risk and taking into consideration required input from FA providers, EPA's Proposed Rule is the result of litigious pressure from anti-mining environmental groups and special interests. Without regard to facts, EPA's Proposed Rule duplicates FLMA and state agency requirements, creates conflicts of law, and bypasses local administrative authorities who have proven expertise in reviewing, permitting, and overseeing mining projects.
In developing its Proposed Rule, EPA has ignored the fact that advances in engineering controls, technology, mining industry best practices, and FLMA and State regulatory programs have lowered the "degree and duration o f risk" to a point that FR requirements pursuant to CERCLA
1 https://www.epa.gov/superfund/superfuncl-cercla-overview 242 USCA 9608(b)(1)
3 Id.
4 See 9608(b)(2). 5 52 FR 2923, 3, CFR, 1987 Comp., p. 193.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00003
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 4 of 35
108(b) for the hardrock mining industry are not required. Simply put, the EPA's Proposed Rule should not move forward because it exceeds the agency's authority under CERCLA; is unnecessary, duplicative, and conflicts with FLMA and State laws and regulations; relies on faulty, incomplete studies; and inappropriately targets the hardrock mining industry.
Elad EPA proposed a CERCLA 108(b) rule for hardrock mining in the 1980s, the agency might have been able to make a case that such a rule was supported by the evidence. At that time, federal and state mine regulatory programs were still evolving (See White Paper), and limited FA was often required. Several western mining states did not have mining regulatory programs until the early 1990s.
Over the past 25 - 30 years, these programs have greatly advanced, adapted to new information and responded to fill gaps in both their regulatory and FA programs as circumstances have required. These programs have proven effective as the National Academy of Sciences, in response to a request from Congress, determined in a comprehensive 1999 report entitled Hardrock Mining on Federal Lands. The Report concluded that the overall structure of federal and state laws and regulations that provide mining related environmental protection is complicated, but generally effective. Furthermore, in 1999, BLM and USFS responded to a 2011 letter from Sen. Lisa Murkowski (R-AK) that combined, the two FLMAs had approved more than 3,300 mining plans of operation since 1990, and none of those have been added to the CERCLA National Priorities list.67
In the preamble to the Proposed Rule, EPA admits that CERCLA 108(b) FR may not be necessary: "... there could be an associated risk that the ride willpotentially require financial responsibility that may never be required1" This stunning admission demonstrates the Proposed Rule is arbitrary and capricious. There can be no justification for proposing such a costly rule that may never be needed. EPA's proposal to impose, at a minimum8, a $7.1 billion superfluous CERCLA 108(b) FR program on the hardrock mining industry is completely untenable, especially in view of the minimal risk of unpermitted releases of hazardous substances.
Thus, the evidence is overwhelming that the CERCLA 108(b) mandate has been met by the FLMA and State regulatory and FA programs and no additional FR requirements pursuant CERCLA 108(b) are necessary to protect the federal Superfund program and the American taxpayer. The regulations in the Proposed Rule should be withdrawn and EPA should issue a Final Rule concluding that no additional FR requirements under CERCLA 108(b) are necessary for the hardrock mining industry.
6 The White Paper includes an analysis o f EPA's National Priorities List (NPL) for Mining and Milling Sites (MMS) completed in April, 2015 by Richard DeLong, Enviroscientists, Inc. (now EM Strategies). DeLong's analysis revealed that there are over 1,100 sites on the NPL and EPA classifies 100 as MMS. However, only 55 of those sites are actual mining operations where a mineral was extracted from the earth. The other 45 are mineral processing facilities not associated with a hardrock mine. The 55 hardrock mine sites breakdown into the following temporal classifications: 49 are prior to 1970; 5 are from 1970-1990; and one. Barite Hill in SC is post 1990. The DeLong analysis is included with the White Paper and incorporated by reference. 7FR at 3463 8 See Freeport-McMoRan comment letter dated May 5, 2017, at page 3, "a more representative value from EPA's regulatory impact analysis yields a figure of $15.7 billion."
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00004
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 5 of 35
I. CERCLA's Statutory Mandate has been met by the FLMAs and States' Mine Regulatory and FA Programs
CERCLA 108(b)(1) directly addresses the relationship of EPA's program to other Federal requirements. Specifically, Congress directed EPA to promulgate requirements for classes of facilities "in addition to those under subtitle C of the Solid Waste Disposal Act [42 U.S.C.A. 6921 et seq.] and other Federal law[.Y 42 U.S.C. 9608(b)(l) (emphasis added). EPA claims to "read this provision in a most straightforward way: Requirements in this proposed rule are quite literally `in addition to' whatever FR requirements may be imposed under other Federal lawsfor other purposes." 82 Fed. Reg. 3402 (emphasis added). EPA further argues that the phrase "in addition to" provides no "limitation on the applicability of this section." Id. Consequently, under EPA's reading of the statute, "CERCLA 108(b) requirements apply even where a hardrock mine or mineral processor may be subject to, for example, Federal reclamation bonding requirements." Id. at 3402-3403.
Contrary to EPA's position, a plain language interpretation of the "in addition to" language in the statute expressly limits EPA's authority and prohibits the agency from duplicating FR requirements that are in place pursuant to the Resource Conservation and Recovery Act (RCRA) (previously referred to as the Solid Waste Disposal Act) or other Federal laws that share the same purpose, includingfederal reclamation bonding requirements. The legislative history behind 108(b) supports this commonsense reading of the statute. Specifically, the Senate Report to CERCLA explained that "[i]t was not the intention of the Committee that operators of facilities covered by [RCRA FR requirements] be subject to two financial responsibility requirementsfor the same dangers" S. Rep. No. 96-848, at 92 (1980) (emphasis added). Instead, CERCLA 108(b) was intended to cover those facilities "who are not now covered by any [FR] requirements under [RCRA] section 3004(c) "9Id. (emphasis added).
While the statute and the legislative history call out RCRA FR requirements specifically, the phrase "other Federal law" clearly shows that Congress envisioned that duplication may also occur with other federal FR requirements and thus EPA should avoid duplicating these programs in a similar manner. Because EPA did not promulgate CERCLA 108(b) FR requirements in the 1980s as Congress directed, this phrase in the statute becomes even more central in interpreting EPA's appropriate regulatory role today as the federal regulatory landscape has substantially grown - particularly for the hardrock mining industry - to include other comprehensive programs that protect against the same risks that triggered Congressional action in the first place.10
9See also United States Treasury, The Adequacy ofPrivate Insurance Protection under Section 107 of the Comprehensive Environmental Response, Compensation, and Liability Act of 1980: A Report in Compliance with Section 301(b) ofP.L. 96-510 (June 1983), at 72 ("[F]acilities already covered by the financial responsibility requirements of RCRA and other federal law are not yet again by Section 108.")
10EPA argues that "if Congress intended to insert limitations based on other Federal law into CERCLA, it clearly stated them as such." 82 Fed. Reg. 3402. This argument is also not convincing in this context. In 1980, there were few similar programs on the statutory' books, with RCRA being the lead example. Congress could not have possibly predicted what other federal departments within the government would do in the future on this same subject matter. The phrase "other Federal programs" recognizes this basic reality. EPA's examples in other sections of CERCLA containing different limiting language are irrelevant to interpreting Section 108(b), which is clearly structured in a specific way to accomplish a purpose that would necessarily evolve over time. See
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00005
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 6 of 35
Thus, a plain reading of CERCLA 108(b) prohibits EPA from promulgating FR requirements for hardrock mines covered by FLMA FA. Congress recently reaffirmed this clear intent to avoid duplication in the Conference Committee Report attached to the Consolidated Appropriations Act of 2016 (Public Law 114-113): "Prior to proposing any rule pursuant to section 108(b) . . . the [EPA] Administrator is directed to . . . [include in an analysis] . . . the Agency's plan to avoid requiring financial assurances that are duplicative of those already required by other Federal agencies."
During the SBAR process, the FLMAs and four states made detailed presentations that revealed comprehensive regulatory and FA programs designed to prevent the release of hazardous substances and to provide FA in the event the operator is unable to complete reclamation and closure or take corrective action if and when necessary. These presentations demonstrated that all CERCLA 107 liabilities/obligations addressed by these programs are covered 100%. EPA failed to respond to the SERs and states on this point and has failed to explicitly identify any gaps in the FLMAs' and states' regulatory and FA programs that would justify a rule under CERCLA 108(b).
The six presentations revealed:
Well-developed and thorough programs that review, permit, oversee, and establish FA for mines under their jurisdiction. These programs take into account the unique geology, geography, terrain, climate, mining methods, engineering controls and management practices attributable to individual mines that reduce the degree and duration o f risk to appropriate or desirable levels.
That the FLMAs and States' regulatory and FA programs for hardrock mining clearly cover the release of hazardous substances, provide FA for closure and post closure activities, and demonstrate the functional equivalent of a CERCLA 108(b) rule.
That the only way a hardrock mining FA program can effectively work is if it is calculated on a site-specific basis. A nationwide FA program and/or a one-size-fits-all formula will not work. Therefore, EPA's proposed use of a general formula for all mines is arbitrary and capricious and contrary to the proven approaches used by other agencies with far more experience than EPA in regulating the hardrock mining industry.
That in several States, different regulatory agencies cover different aspects of mining, milling and processing, but together they provide complete coverage. This inter-agency approach works. A review of some of the reports of State hardrock mining regulatory and FA programs prepared by EPA's contractor indicates that the contractor did not consider the effectiveness of such inter-agency approaches.
Comment from The Honorable Darryl L. DePriest, Chief Council, Office of Advocacy, SBA at 4 (EPA-HQ-SFUND-2015-0781 1406) ("When Congress enacted CERCLA in 1980, there were few financial assurance requirements in either state or Federal regulations, and what requirements existed were largely untested.").
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00006
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 7 of 35
That the Bureau of Land Management (BLM), the U.S. Forest Service (USFS) and the States have the authority and regulatory tools to address unanticipated events at any time. They adapt to changing conditions or circumstances to prevent the release of hazardous substances. They have the authority to require plan and permit modifications and increase or reduce FA as needed. This is the principle of adaptive management that is ignored in EPA's Proposed Rule.
The fact BLM holds almost $3 billion and the USFS holds almost $1 billion and the States hold comparably large FA amounts, in addition to the value of long-term trust funds, that thoroughly cover not only land reclamation and closure but also post-closure water management, treatment, and monitoring. EPA has not demonstrated how these monies would not be sufficient to address any hazardous substance releases at currently operating or proposed mines.
That a CERCLA 108(b) rule would be duplicative and completely overlap existing FLMA and State FA programs.
That the expertise and experience to calculate FA for hardrock mines resides with the States and the FLMAs, and that EPA lacks this experience and expertise. The States and FLMAs have been calculating FA on a site-by-site basis for more than 25 years.
That operators, in cooperation with the FLMAs and States, are in the best position to prevent the release of hazardous substances and to ensure adequate FA to protect the taxpayer.
That a nationwide, one-size-fits-all FR standard is unworkable. It would be inappropriate, arbitrary and capricious to calculate FR at one site based on data from another site. There is no environmental support for a one-size-fits-all formula. It would be arbitrary to apply credits applicable at one site to a different site.
That neither the FLMAs nor the States see any basis for EPA moving forward with CERCLA 108(b) regulations.
It is clear there would be substantial if not complete overlap between the FLMA and State programs and an EPA CERCLA 108(b) program based on the information provided by EPA, the FLMAs and States during the SBAR process. EPA's Proposed Rule reveals that it would completely duplicate existing programs. Contrary to EPA's position that CERCLA 108(b) regulations are significantly different as compared to existing Federal and State requirements for hardrock mining facilities, the FLMA and State regulatory and FA requirements ensure not only permit compliance, they also reduce the degree and duration o f risk associated with the production, transportation, treatment, storage, or disposal o f hazardous substances to minimal levels, and require sufficient FA to protect the U.S. taxpayer and the Superfund Trust Fund. There is nothing left for EPA to cover.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00007
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 8 of 35
Given the comprehensive and robust hardrock mining regulatory and FA programs of the FLMAs and States, the burden is on EPA to show where and how a CERCLA 108(b) rule would not duplicate or preempt the State and FLMA programs. EPA must identify any gaps in the States' and FLMAs' hardrock mining regulatory and FA programs that would justify a CERCLA 108(b) FR rule. For the Proposed Rule, EPA has not identified any such gaps in existing programs and, as the record clearly indicates, EPA has not justified the proposed requirements.
When the SERs asked EPA to provide any site-specific example at active or proposed mining operations where a plausible hazardous release could occur that would not be addressed by existing programs, EPA could not do so. Instead, EPA has relied extensively on releases and clean-up actions at historic operations that do not represent current practice. The fact that such releases have not occurred and no Superfimd liability has been generated over the past decade further places the burden on EPA to demonstrate why a new national program is required.
EPA's analysis of State regulatory and FA programs is woefully inadequate. This is demonstrated by the comprehensive analysis of State programs, Review o f State Financial Responsibility Requirements for Hardrock Mines and the Response Categories in EPA's CERCLA 108(b) Proposed Rule, prepared by Debra Struhsacker and SRK Consulting for NMA and attached to NMA's comments as Appendix A (AEMA incorporates this report by reference). The Struhsacker-SRK analysis clearly demonstrates there are no gaps and a CERCLA 108(b) FR rule would duplicate, and therefore preempt state programs pursuant to CERCLA 114(d). Again, EPA has failed to demonstrate where any specific State program could reasonably be judged to not provide adequate FA at specific sites.
EPA fails to recognize that establishment of appropriate FA requirements for a modem mining operation is a thorough, exhaustive, and facility- and site-specific process. Before even considering whether State FA requirements are adequate, EPA must first define the potential for uncontrolled releases that could trigger the need to access FA.
As a basic fact, mining companies generally work to design projects that minimize the potential for hazardous substance releases during operations and after closure. Mining companies rely on extensive in-house technical experts as well as outside consultants to select state-of-the-art practices to minimize risk, including in the fields of geotechnical and civil engineering, processing, hydrology and hydrogeology, and geochemistry among others. Moreover, such expertise is often specific to a particular region and certain climactic conditions. For example, tailings, waste rock, and leach facility design in remote areas of western Alaska is not comparable to design in the arid Southwest.
As indicated above, facility design is focused on not only operations, but also long-term closure and post-closure conditions. Overseeing the industry's work are experienced Federal and State agency mining program staff that review and permit projects. These agency staff, supplemented by expert consultants, bring similar expertise in ensuring that mines prevent hazardous substance releases during operations and after closure. The application of such specific industry and agency
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00008
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 9 of 35
expertise and technical knowledge has been directly responsible for the total lack of any releases at modern mining operations that have led to Superfund liability in the past decade. In the Proposed Rule, EPA has established uniform national FA requirements and performance standards that run contrary to the currently successful site-specific approach. With all due respect to EPA, its Headquarters' staff and consultants do not have anywhere comparable technical or practicable experience in establishing or applying such standards. This point was emphasized in the Western Governors' Association Policy Resolution 2014-07, Bondingfor Mine Reclamation'.
2. Western states have a proven track record in regulating mine reclamation in the modem era - including for hard rock mines --having developed appropriate statutory and regulatory controls, and are dedicating resources and staff to ensure responsible industry oversight.
3. In contrast, EPA currently has no staff dedicated to oversight of mine reclamation, or to the approval of bonding associated with mine reclamation. As a consequence, if EPA proceeds to promulgate bonding requirements for the hardrock mining industry under CERCLA Sec. 108, it will have to create a new federal regulatory program --an unnecessary investment of federal funds - at a time when the federal government is trying to get its fiscal house in order.
In addition, EPA Headquarters intentionally chose not to consult with FLMAs, other Federal Agencies, State, and industry experts in determining performance standards. During the SBAR process, the SERs repeatedly requested that EPA staff visit mine sites throughout the U.S. to understand how existing programs work. EPA refused these invitations citing lack of time despite the fact work on the Proposed Rule had been ongoing for more than five years. As a direct result of EPA's decision to develop the Proposed Rule in a vacuum, EPA fails to provide any examples of where the uniform national performance standards minimize future liability risk. Additional comments on EPA's performance standards are provided later in this letter.
Existing FLMA and State FA programs are constantly being improved as the regulatory agencies and industry gain experience. This continuous improvement approach is a key element in these programs and is responsible for the significant increases in the FA amounts required by State and FLMAs over the last 25 years. The FLMA and State programs typically require updates to plans of operation and FA calculations on a periodic basis or more frequently when facility modifications are proposed. For example, the BLM reviews the "amount and terms o f the financial guarantee for each increment o fyour operations at least annually'n or sooner if there is a modification to the plan of operation or the agency determines a need. The USFS Training Guide for Reclamation Bond Estimation and Administration states "[Tjo ensure the bond can be adjusted as needed to reflect the actual cost o f reclamation, the FS should include provisions allowingfor the periodic adjustment o f bonds in the Plan o f Operation prior to approval. "
In Nevada, each FA cost estimate must be updated at least every three years or any time a change is proposed. The fluid management permit program administered by Nevada requires permit1
1143 CFR 3809.553(b)
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00009
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 10 o f 35
renewals every five years, which also triggers an update to the FA. As a specific permit condition for all large, hardrock operations in Alaska, mines must undergo a comprehensive third-party environmental audit, under State direction, every five years. These audits specifically include detailed review, and as needed, update of the mines' FA requirements. The review reports are posted on the Alaska Department of Natural Resources (ADNR) website, see http://dnr.alaska.gov/mlw/mining/largemine. Although specific timeframes for permit or FA updates are not included in all of FLMA and State programs, it is common practice that mine plans will change on a regular basis and each of these changes triggers a review and update of all permit conditions, including the FA calculations.
As noted above and in the attached White Paper, as well as in Appendix E attached to NMA's comments, EPA erroneously assumes that currently permitted and authorized to operate mines are operated in a manner similar to those that have become CERCLA sites. This assumption ignores the scope of the state and FLMA programs under which today's mines are required to operate. The FLMA and state mine regulatory and FA programs are specifically designed to ensure that mines are designed, constructed, operated and closed in a manner that avoids the types of problems that were caused by practices implemented by unregulated or under-regulated mines of the past.
EPA's CERCLA 108(b) rulemaking for hardrock mining and beneficiation is a classic "solution in search o f a problem" a problem that clearly does not exist. The hardrock mining States and FLMAs have comprehensive, robust regulatory programs in place that address FA requirements associated with mining and beneficiation, reclamation, closure and post-closure. The entire mining life-cycle is covered. Monitoring and regular inspections are part of these regulatory programs to ensure that FA is always kept current. These programs substantially reduce the risk of a release, and the current regulatory framework, including permits, monitoring, reporting and corrective action, assure that when releases do occur, they are promptly identified, reported and addressed under the supervision of regulatory authorities. EPA has placed several documents in the rulemaking record that reflect releases, but these reports are misleading because they overlook or fail to report the responses to the releases (See discussion on page 20.
The States and FLMAs have the expertise and staff to calculate the appropriate amount of FA based on unique site-specific circumstances and features (e.g., geochemistry), for each mining operation and to adjust FA as required over the life of the operation, including post-closure. These programs are designed to prevent the release of hazardous substances and ensure that sufficient FA is in place to ensure that the costs of taking remedial action do not fall to the federal Superfund program or the American taxpayers in the event of bankruptcy or an event that requires corrective action.
The fact no hardrock mining or beneficiation plan of operation approved by BLM or USFS since 1990 has been added to the CERCLA NPL demonstrates that the "degree and duration o f risk" for hardrock mining is too small to regulate, thereby satisfying CERCLA 108(b)'s statutory mandate and EPA does not need to propose a national program. Because the existing FLMA and State programs cover CERCLA 107 liabilities, there is minimal to no benefit to the public or
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00010
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 11 o f 35
the environment from a CERCLA 108(b) rule and significant regulatory burdens and costs on the industry, especially small entities. EPA has failed to demonstrate otherwise.
The Proposed Rule is an ill-advised proposal that imposes an enormous and unjustifiable burden on the U.S. hardrock mining industry because it duplicates existing state and federal FA requirements12for mine operators and provides little to no environmental benefit. Because existing State and federal FA programs13 already require mine operators to provide substantial FA for their operations to ensure that mines are reclaimed and closed in a manner that protects the environment and shields taxpayers from exposure to future cleanup costs at today's mines, adding a superfluous layer of EPA FR is unwarranted. EPA should withdraw the regulations in the Proposed Rule and develop a Final Rule that establishes there is no need for another federal FR program for the hardrock mining industry.
Because EPA must provide "notice of its final action" by December 1, 2017 to satisfy a courtordered deadline,14there is urgency for EPA to withdraw the regulations in the Proposed Rule and focus its attention upon developing a Final Rule that concludes that no additional FR is required for the hardrock mining industry and CERCLA 108(b)'s mandate has been satisfied.
The potential negative economic impacts of the Proposed Rule are a stark contrast to EPA's own estimate of the benefits to the American taxpayer - a meager $15.5 million each year. AEMA further contends that this estimate is actually an overestimate of the benefits since EPA has failed to provide a single example of currently operating mines where there is a risk of a hazardous substance release that could create substantive Federal Superfund liability. It is completely unclear how establishing extremely burdensome and highly duplicative program is justified given the very small proj ected benefits.
The Small Business Administration's Office of Advocacy's (Advocacy), comment letter (attached to these comments and incorporated by reference), provides further support for AEMA's position that the Proposed Rule is highly flawed, duplicative and burdensome. See, section 1 beginning on page 4 and section 3 beginning on page 8.
In summary, EPA will create at least an estimated $7.1 billion FA obligation for hardrock mining companies with no guarantee of instrument availability (see discussion in Section VII, supra on market capacity) - on top of them more than $3.5 billion of FA the industry already provides to the FLMAs and billions of dollars of additional FA provided to States.15
Finally, it is noteworthy that EPA indicated they did not adopt a site-specific approach to determining hazardous substance risk because it does not have the resources or capability to do
12 Also known as "bonding requirements." 13 Two federal land management agencies ("FLMA"), the U.S. Bureau o f Land Management ("BLM") and the U.S. Forest Service ("USFS") already have substantial FA requirements for hardrock mines. 14 EPA must comply with the January' 29, 2016 Order o f the U.S. Court o f Appeals for the District o f Columbia in re: Idaho Conservation League et al No. 14-1149 ("Court Order"). The Order states, in part, "Although more is required with respect to hardrock mining than the other identified industries, where EPA retains discretion not to conduct a rulemaking at all, EPA retains "discretion to promulgate a rule or decline to do so " even fo r the hardrock mining industry. " Order at p. 3 (emphasis added). 15 As examples, Nevada regulators alone have $2.66 billion in FA; while Alaska's program currently maintains $844 million.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00011
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 12 o f 35
so. This is despite the fact the FLMAs and States are already doing so effectively. However, EPA contradicts its own approach in its proposed method for reducing or releasing FR. The Proposed rule provides that EPA Regional Administrators would determine, on a site-specific basis, when the reductions in risk merit partial or full release. Since there is no uniform methodology proposed for such releases or reductions, relying instead on each Region to determine the methodologies, and, as EPA acknowledges, because it does not have the resources to make such determinations, mining companies will not be able to assume any reasonable timeframe for releases or reductions and they will have to account for the FA requirements for an indefinite period. There is no reasonable basis for this requirement since the FLMAs and States are far more qualified, and they already do, make such determinations.
II. The Proposed Rule Qualifies for Elimination Pursuant to EO 13777 because CERCLA 108(b) FA is Duplicative, Burdensome, and EPA's Involvement is Unwarranted
A. EPA's Faulty Premise that CERCLA $108(b) Covers Something Different than Existing State and Federal FA Requirements Undermines the Need for the Rule
EPA's Proposed Rule to require FR for the hardrock mining industry is based on the faulty premise that CERCLA 108(b) FR would address environmental risks that differ from the environmental risks that existing State and FLMA FA programs already cover. The rulemaking record for the Proposed Rule clearly demonstrates the specious nature of EPA's position, which is internally inconsistent and based on faulty logic.
This record shows that today's hardrock mines are highly regulated and have robust FA as required under state and/or FLMA programs, and state and federal regulators have sufficient FA resources to respond to unpermitted future releases of hazardous substances from a hardrock mine in the event the owner fails to do so. EPA's Proposed Rule would create a superfluous FR program and cause unwarranted and unsupportable financial hardship for the hardrock mining industry and should thus be withdrawn in accordance with EO 13777.
EPA's assertion that CERCLA 108(b) covers something different than existing State and FLMA FA is based on a distinction without a difference. The State and FLMA FA programs fully address the exact same types of environmental risks and cover the identical mine features and on-site activities as the following thirteen Response Cost Categories that EPA developed in 320.63 of the Proposed Rule:
CERCLA 108(b) Proposed Rule Response Cost Categories:
Solid/hazardous waste disposal Open pit Waste rock Heap/dump leach Tailings facility Process pond/reservoir
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00012
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 13 o f 35
Underground mine Slag pile Drainage Interim O & M Water Treatment Short-term O & M/Monitoring Long-term O & M/Monitoring
EPA's incorrect assertion that CERCLA 108(b) covers something different than existing State and FLMA FA programs blatantly contradicts EPA's simultaneous use of these supposedly different State and federal programs in two fundamental ways to determine program requirements. First, EPA uses existing FA requirements as the basis for calculating how much FR should be required for each category. Second, EPA proposes to allow coverage under these FLMA and State programs to reduce or eliminate CERCLA 108(b) FR obligations. See, for example, 320.63(c) of the Proposed Rule, which states:
Owners and operators may satisfy reqidrements o f [the response components in] paragraph (h)(i) through (xiii), in whole or in part, by demonstrating that they are subject to, and in compliance with, requirements that will result in a minimum degree and duration o f risk associated with the production, transportation, treatment, storage, or disposal, as applicable, o f all hazardous substances present at that sitefeature. A demonstration under this paragraph will reduce the amount o ffinancial responsibility that an owner and operator must demonstrate under this part.
EPA's wholesale reliance on the environmental protection regulatory requirements and best management practices used at today's mines to determine and reduce or eliminate CERCLA 108(b) FR requirements renders the Proposed Rule internally inconsistent. EPA cannot have it both ways. The Agency cannot claim that existing state and federal reclamation and closure bonding programs cover something different than CERCLA 108(b) and simultaneously reverse this position by relying on these so-called "different programs" to satisfy FR requirements in the Proposed Rule.
EPA's contradictory position completely undermines EPA's premise for the Proposed Rule and proves that imposition of CERCLA 108(b) FR would duplicate the States' and FLMA's existing FA programs. The proposed duplication directly conflicts with EO 13777 as well as President Clinton's EO 12866 and President Obama's EO 13563. The proposed duplicative FR requirement places an enormous and unnecessary regulatory burden upon the hardrock mining industry, which also violates key objectives in EO 13777.
Advocacy's comment letter urges EPA to withdraw the Proposed Rule because EPA has not demonstrated any necessity for the Proposed Rule or justification for the economic hardships it would create:
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00013
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 14 o f 35
The agency [EPA] has conspicuouslyfailed to articulate a cohesive response to the argument that state and Federal rides address the same risks comprehensively. (Advocacy letter at 3).
Although EPA states that these mining regulations are "distinct"from the CERCLA 108(h) requirements, this does not mean that the Federal and state mining requirements do not address the same response categories using other legal authorities and different language. An entirely duplicative CERCLA 108(h) financial responsibility program would be inconsistent with the "degree and duration "o f risk associated with potential releasesfrom current highly regulated andfidly bonded hardrock mines. EPA is proposing an additive regulatory scheme in the absence o f a clearly articulated need as to why these existing programs are deficient or require additional FA. (Advocacy Letter at 5).
Advocacy strongly recommends that EPA withdraw this ill-advisedproposal, [which is] without evidence that a problem exists warranting intervention... There is no statutory need for this regulation, nor are there any significant environmental benefits demonstrated by EPA... EPA is proposing a rule that would cost the industry $171 million annuallyfor an annual savings to the government o f $15.5 million by its own estimate, to address risks that are already addressed by state and Federal agencies. (Advocacy Letter at 1 and 3).
Advocacy's January 2017 letter provides compelling reasons to withdraw the regulations in the Proposed Rule that also are consistent with the objectives in EO 13777. In compliance with the EO 13777 policy to eliminate unduly burdensome regulations, EPA must heed Advocacy's advice and withdraw this fatally flawed Proposed Rule, which is built on a defective and illogical foundation.
In light of the rulemaking record including comments filed on or before July 11, 2017 and EO 13777, EPA must write a Final Rule that reflects "adequate evidence has been demonstrated," and that there is no need for additional CERCLA 108(b) FR. The Final Rule should establish that there is no difference in the coverage provided by the existing States' and FLMAs' FA programs and the coverage in the Proposed Rule. Consequently, there is no demonstrated need for the regulations in EPA's Proposed Rule. Because EPA's rulemaking process has gathered substantial evidence of adequate FA to address potential future unpermitted releases of hazardous substances from hardrock mines, EPA has fulfilled the CERCLA 108(b)(1) statutory mandate to "establish and maintain evidence of financial responsibility." EPA should withdraw the regulations in the Proposed Rule and issue a Final rule that no additional FR pursuant to CERCLA 108(b) is required.
B. The Proposed Rule Should be Withdrawn Because There is No Degree or Duration of Risk that Warrants the Rule's Regulatory Burden
The Congressional directive in CERCLA 108(b) requires EPA to develop requirements for classes of facilities "to establish and maintain evidence of financial responsibility consistent with
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00014
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 15 o f 35
the degree and duration o f risk associated with the production, transportation, treatment, storage, or disposal of hazardous substances." (emphasis added). Consequently, the threshold question in evaluating the need for the Proposed Rule should focus on whether there is a substantial degree of unfunded risk associated with the hardrock mining industry and if so, what is the duration of that risk.
The rulemaking record for the Proposed Rule provides overwhelming evidence that the existing State and FLMA environmental protection rules and FA requirements for hardrock mining reduce risks to a very low level. Because there is minimal risk, the issue of the duration of the risk is nullified. As a result of the States' and FLMAs' regulations and FA requirements already governing hardrock mines and the resulting elimination of substantial or long-term risks associated with today's mines, there is no need for a CERCLA 108(b) FR Rule that applies to hardrock mines. The Final Rule must reflect this finding and establish that CERCLA 108(b) FR is not warranted. The rulemaking record, mining industry comments and the prohibition in EO 13777 against costly, outdated and unnecessary regulations that cost jobs and interfere with regulatory reform objectives mandate this outcome.
Because the States and FLMAs generally require FA for each of the thirteen CERCLA response categories for mine site features and mine site activities listed in Section II A, there are no un bonded risks associated with today's mines. Consequently, there is minimal risk that operating hardrock mines will cause natural resource damage or adversely impact human health. Thus, there is no need for the Natural Resource Damages or Health Assessment cost categories included in the Proposed Rule.
Advocacy's January 2017 letter tells EPA there is no need for the regulations in the Proposed Rule because of the minimal level of risk associated with modern mines:
In sum, there is little evidence o f a needfor the proposed CERCLA 108(h) bondingprogram which EPA estimates to involve tens o f billions o f dollars. EPA's scheme would onlypotentially bejustified if modern mines were facing the same type o f remedial costs as previous legacy sites that did generate billions o f dollars o f costs. This rulemaking is not required by statute because the risk is minimal. (Advocacy letter at 4).
The historical record does not support a determination o f risk levels requiring new Federal involvement, especially when EPA has not refuted the assertion that certain regidatory programs provide coverage o f the same response actions that EPA plans to cover (e.g., state and Federal mining regulations). (Advocacy letter at 17)
EPA simply describes evidence o f recent releases, while not addressing the fact that the responses to these releases are potentially being handled effectively under the existing regulations. I f other Federal and state programs adequately handle these releases, this would undermine, rather than support thefoundation for this proposal. (Advocacy letter at 7).
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00015
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 16 o f 35
The evidence presented to the SBAR Panel, these and other mining industry comments, and compliance with EO 13777 require EPA to withdraw the unnecessary regulations in the Proposed Rule. Proceeding with the Proposed Rule would be arbitrary and capricious and violate each of the regulatory directives in EO 13777.
C. There is No Gap - CERCLA 108(b) FR Duplicates Existing FLMA and state FA Requirements and is thus Inconsistent with Congressional Intent and EO 13777
During the SBAR Panel convened in conjunction with the CERCLA 108(b) rulemaking, numerous SERs, state regulators, and the FLMAs provided substantial evidence that state and federal FA programs include comprehensive FA that covers reclamation, closure, and releases of hazardous substances. Advocacy's January 2017 letter to EPA cites input from the SERs that emphasizes this point:
The hardrock mining states and the federal land management agencies have comprehensive, robust regulatory programs in place that address FA requirements associated with mining and beneficiation, reclamation closure and post-closure issues. These programs substantially reduce, if not eliminate, the risk that a mine will have a release o f hazardous substances... The FLMA's and state's comprehensive, robust regulatory programs are designed toprevent the release of hazardous substances and assure sufficient FA is in place to protect the taxpayer in the event o f bankruptcy or an event that requires corrective action.
EPA appears to hold the position that somehow the existingfederal and state FA programs deal solely with traditional reclamation and mine closure activities (e.g., recontouring and revegetating disturbed areas). Thisposition is incorrect. The existing regulatory requirementsfor hardrock mining gofar beyond reclamation and closure and include many provisions designed toprotect the environment. Consequently, they include measures toprevent releases o f contaminantsfrom operating and closed mines that would come under the CERCLA 107 hazardous substances definition. (Advocacy letter at 5 - 6).
Throughout the CERCLA 108(b) rulemaking, EPA has not pointed to any shortcomings or gaps in any of the State or FLMA FA programs. To the contrary, EPA's reliance on existing State and FLMA FA to form the basis for FA amounts for each response category, and reduce or eliminate the need for CERCLA 108(b) FA, indicates EPA places sufficient confidence in these existing FA programs to determine that they supplant the need for CERCLA 108(b) FR.
The December 2016 SBAR Panel Report published by EPA, Advocacy, and the Office of Management and Budget/Office of Information and Regulatory Affairs ("OMB") states that the CERCLA 108(b) FR program is designed to: "...fill the gap where other regulations fail to prevent releases or threatened releases of hazardous substances"16(SBAR Panel Report at 9) but
16 Final Report of the Small Business Advocacy Review Panel on EPA's Planned Proposed Rule, Financial Responsibility Requirements for the Flardrock Mining Industry' Under CERCLA 108(b), December 1, 2016.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00016
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 17 o f 35
EPA has not pinpointed any gaps that need to be filled. EPA is thus making an unsubstantiated claim that the States' and FLMAs' FA programs are different, inadequate, or both without providing any explanation whatsoever of why the States' and FLMAs' FA programs do not address the same types of releases of hazardous substances as those the Proposed Rule purports to cover.
Appendix A17of the SBAR Panel Report is a lengthy table prepared by one of the SERs that lists the CERCLA Response Categories in the Proposed Rule and shows that the FA requirements for mines in Nevada and on BLM-administered federal lands provide complete FA for the mine features and activities that are identical to EPA's Response Cost Categories18. Advocacy's January 2017 letter states that an analogous table can be produced documenting FA covering the CERCLA Response Cost Categories for mines on National Forest System lands administered by the USFS. (Advocacy letter at 6). The obvious redundancy of the Proposed Rule, which is shown so clearly in this table, proves this rule is unnecessary.
In its January 2017 letter to EPA, Advocacy found that the Proposed Rule would duplicate the existing states' and FLMA's regulatory and FA requirements:
Both BLKi and USFS have effective and comprehensive FA requirements that extendfar beyond reclamation (i.e., earthworks and revegetation) and can include long-term FAfor sites where warranted... The Federal LandManagement Agencies (FLMA) and state agencies have existing comprehensive bonding and regulatory requirements that would be duplicated by every response requirement that EPA intends to address under CERCLA 108(b). (Advocacy letter at 5).
EPA's failure to demonstrate any gaps or problems with the existing States' and FLMA's FA programs means EPA has not shown there is a need for the Proposed Rule and cannot justify the enormous costs associated with the Proposed Rule. Consequently, EPA must withdraw the regulations in the Proposed Rule, and develop a Final Rule that establishes that there is no requirement for additional FR pursuant to CERCLA 108(b) for the hardrock mining industry.
As a result of the rulemaking for the Proposed Rule and the SBAR Panel process, EPA has conclusive "evidence offinancial responsibility consistent with the degree and duration o f risk associated with the production, transportation, treatment, storage or disposal o f hazardous substances" as mandated by CERCLA 108(b)(1). Because there is overwhelming evidence that the States and FLMAs already have FA for hardrock mines that is sufficient to address future releases of hazardous substances, promulgation of a Final Rule requiring additional FR pursuant to CERCLA 108(b) would be arbitrary and capricious, and conflict with EO 13777.
17Appendix A from the SBAR Panel Report is included herein as Appendix B. 18Nevada, BLM, U.S. Forest Service, and other states use the Standardized Reclamation Cost Estimator ("SRCE") software to calculate reclamation costs that uses detailed site-specific factors and engineering cost estimates.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00017
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 18 o f 35
III. The Costs of the Proposed Rule Far Outweigh the Benefits
As clearly articulated in Advocacy's January 2017 letter, there is essentially no financial benefit associated with the Proposed Rule, which EPA projects will cost the hardrock mining industry between $111 to 171 million each year - and save the federal government $527 million over 34 years - only $15.5 million per year. As indicated above, and in Section YII below regarding market capacity, the cost is likely underestimated while the benefit is likely overestimated. Obviously, there is no meaningful public or environmental benefit associated with the Proposed Rule - which costs so much and accomplishes so little.
In addition to the economic hardships the Proposed Rule would impose on the mining industry, it would also create adverse socioeconomic impacts in mining states where mining jobs will be lost due to the premature closure of mines that cannot withstand the added FA burden. Our Nation's reliance on foreign sources of strategic and critical minerals necessary for national defense, manufacturing, infrastructure, and the everyday products of modern society will increase dramatically, putting America at risk.
Advocacy's letter critiques EPA's cost benefit analysis saying that EPA has grossly overestimated the rule's benefits. Advocacy found that EPA has overestimated the number of bankrupt companies that will incur a CERCLA response cost, has inflated EPA's response costs, and has assumed that CERCLA 108(b) FR will be used to fund a response at too many sites:
Based on [Advocacy's] conservative estimates, the estimated benefits o f Option 1 o fEPA's proposed rule in terms o f reduced Government Costs would dropfrom EPA's $527 million estimate to $13.2 million [over a 34-year period]. When compared to 34 years o fEPA \s estimate o f Option 1 annual FA responsibility expenditures ($171 million/year), the cost/benefit ratio demonstrates the huge inefficiency o fEPA's regulatory approach... This comparison isjust another way to appreciate the inappropriateness o f this proposal, even if one ignores theflaws in the formula methodology. The EPA scheme, in effect, is a huge transfer between miningfirms and the FA industry with comparatively small benefits to the public. (Advocacy letter at 16).
EPA is proposing a rule that would cost $171 million annually by its own estimate, to address risks that are already addressed by state and Federal agencies. Given the minimal remaining risks, the statute does not require any regulation under CERCIA 108(b) to address the hardrock mining industry. EPA also greatly overstates the benefits of this rulemaking byfailing to incorporate valid estimates of the incremental impact of the proposed rule. When properly evaluated, the costs of the proposed actionfar outweigh the benefits. (Advocacy letter at 17).
In the preamble to the Proposed Rule, EPA admits that CERCLA 108(b) FR may not be necessary: "... there could be an associated risk that the rule willpotentially requirefinancial
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00018
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 19 o f 35
responsibility that may never be required.19" This stunning admission demonstrates the Proposed Rule is arbitrary and capricious; there can be no justification for proposing such a costly rule that may never be needed. EPA's proposal to impose, at a minimum20, a $7.1 billion superfluous CERCLA 108(b) FR program on the hardrock mining industry is completely untenable. The arbitrary and capricious nature of this unnecessary rule are compelling reasons why EPA must withdraw the regulations in the Proposed Rule and issue a Final Rule that finds there is no justification for proceeding with the Proposed Rule. The Final Rule should establish that there are no meaningful public or environmental benefits associated with the Proposed Rule, the estimated costs to the mining industry are not justifiable, and the loss of mining jobs and adverse socioeconomic impacts are unacceptable.
IV. The Proposed Rule is EPA's Attempt to Become the "Super Regulator" of Hardrock Mining
To address largely hypothetical risks, the Proposed Rule would impose extraordinary financial burdens that almost entirely duplicate similar measures already in place. Worse still, because of EPA's own lack of capacity, the best EPA could do in the Proposed Rule was to adopt a crude, one-size-fits-all formula that wholly ignores dramatically different site-specific circumstances among mining operations, yielding truly extraordinary (and unnecessary) sums of FR to be required. Indeed, EPA did not merely ignore site-specific conditions in determining its preferred methods of reclamation/remediation and control of hazardous substances at particular sites, it explicitly disavowed any intention, or even the capacity, to conduct any site-specific analysis.
Rather than consider whether, in light of this admitted lack of capacity, it might be prudent not to act, EPA instead developed its own generic formula for calculating mine FR requirements from whole cloth. This superficial approach uses a very small number of parameters, ignores many highly relevant site-specific conditions, and then assigns an estimated cost for each mine by scaling EPA's estimates for those individual features (such as tailings facilities, open pits, waste rock facilities and process ponds) to the sizes of currently operating facilities.
It is illustrative to evaluate this approach compared to the methodologies used by the FLMAs and States that have been developed over time. These government agencies consistently have shown that FA should be calculated on a region-by-region, site-by-site basis. They base their approaches on many years of regulating the mining industry and ensuring that adequate FA is available to prevent and address releases. It is clear that EPA staff brought no such experience to determine the methods for FR determinations in the Proposed Rule. In setting these FR amounts, EPA also made the astonishing and unjustifiable assumption that every one o f those features'categories will require a CERCLA response at every mine site as the basis for establishing an extraordinarily large pool of contingency funds. No qualified mining expert would find EPA's conclusion justified from a technical perspective, and the administrative
19FR at 3463 20 See Freeport-McMoRan comment letter dated May 5, 2017, at page 3, "a more representative value from EPA's regulatory1 impact analysis yields a figure of $15.7 billion.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00019
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 20 of 35
record developed in support of the Proposed Rule contains nothing to justify such unreasonable assumptions.
Faced with the excessive financial responsibility requirements of the Proposed Rule, many mines, and perhaps most, will be forced to qualify for EPA's crediting program or face going out of business. This will involve compliance with the technical performance standards provided for each response category. Again, mining companies generally design their operations to minimize the potential for releases and risks to the environment. The FLMAs and States then utilize their expertise to determine the adequacy and potential risks of specific designs. In many cases, technical requirements are established in FLMA and State regulatory programs. However, based on experience, there is a general recognition that a "one size fits all" approach does not work. Specific examples of the inappropriate elements of EPA's proposed performance standards include:
For open pit categories, EPA proposes that structures that are considered to be critical structures to be designedfor a long-term staticfactor ofsafety of 1.5 or greater, structures that are considered to be non-critical structures to be designedfor a long-term staticfactor ofsafety of 1.3 or greater, units being closed be designedfor afactor ofsafety of 1.1 or greater under pseudostatic analysis.
Many government agencies have chosen not to define specific safety-factors allowing such determinations to be made a on site-specific basis. Moreover, in a large pit, it is highly relevant whether such a requirement would apply across the entire pit or in small, localized areas. Exact determinations of appropriate post-closure stability requirements are often made as data are collected when pits are operational - balancing the need for stability with mining economics. For EPA to usurp the authority of existing programs without any practicable knowledge or experience in open pit design or any clear evidence that this requirement is needed beyond existing programs to minimize risk, is arbitrary, capricious, and without merit. Moreover, it interferes with mining companies' abilities to determine how best to economically mine a deposit. Note this comment also applies to the stability requirements for the waste rock and heap leach response categories.
For waste rock category, for existing units, the plan mustprovidefor permanent stormwater conveyances, ditches, channels and diversions designed to convey thepeakflow andponds and other collection devices designed to store the volume generated during a 24-hourperiod by a 100-year return interval storm event. For units that become authorized to operate after [insert the effective date of the Final Ride], the plan mustprovidefor controls designed to store the volume generated during a 24-hour period by a 200-year return interval storm event... In addition, aplanfor the minimization, prevention, or collection and treatment ofdischarges and/or seepage, based on site hydrology and water quality characterization information, that providesfor a cover system of, at a minimum, a store and release earthen cover system with a thickness ofat least twelve inches and, ifnecessary, additional source controls or capture and treatment at closure, all ofwhich meet a minimum 200-year life design criteria.
Here again, EPA has proclaimed its view of appropriate cover and water management system designs without indicating why existing programs are inadequate to address risk.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00020
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 21 of 35
Mining companies, under the oversight of FLMAs and States establish site-specific closure designs for waste rock facilities based on local geochemistry, hydrology, hydrogeology, and geotechnical conditions and the surrounding environmental that could be impacted. There is absolutely no basis for setting rigid national standards or design criteria for water management and cover systems where facilities have site-specific water management plans and associated FA that are protective. EPA has not made any compelling argument why such local, site-specific closure requirement determinations are not working to justify why mines should be forced to implement unproven, rigid national standards.
For the tailings category, EPA requires a plan to regrade surface during closure to a stable configuration thatprevents ponding andpromotes the conveyance of surface water off the unit, and that requires closure ofall tailings impoundments and stacks considered to be critical structures to be designedfor a long-term staticfactor of safety of 1.5 or greater and all non-critical structures to be designedfor a long-term staticfactor of safety of 1.3 or greater; and requires that the units being closed be designedfor afactor of safety of 1.1 or greater underpseudostatic analysis.
The Proposed Rule also appears to require that tailings facilities be covered to avoid the need for FR for this category. Tailings dams are typically regulated by FLMA geotechnical experts and State dam safety engineers. These individuals understand the specific requirements needed to ensure long-term dam stability. They generally allow site-specific demonstrations of the appropriate levels of stability to prevent dam failure. Similarly, mines must propose water management systems to ensure that water is not released that does not meet applicable standards. For this category, EPA has defied the proven approaches followed by existing programs with highly prescriptive requirements that are not based on any proven example of reducing environmental risk. AEMA specifically challenges EPA to provide a single example of substantive dam failure risk at a currently operating or proposed hardrock mining operation.
Similar arguments can be made about all of the proposed performance standards. Existing FLMA and State programs address each of the categories in a manner that ensures proper site-specific designs to minimize risk with appropriate FA to guarantee implementation. EPA does not (and cannot) cite a single operating mine where its requirements would address a Superfund liability risk not covered by existing programs.
As discussed above, EPA fails to justify the need for the regulations in the Proposed Rule by demonstrating any actual cases where currently operating or proposed mines are posing unacceptable risk of hazardous substance releases and potential creation of Superfund liability. Recognizing this weakness, EPA tries to make broad generalizations about supposed other environmental benefits of the rule without any supporting evidence. At a broad level, throughout the Proposed Rule and supporting documents, EPA again and again equates "risk" with the occurrence of a "release" [and other inappropriate risk surrogates]. This misleadingly fails to acknowledge that that the mere existence of releases is inadequate to demonstrate that any meaningful risk exists.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00021
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 22 of 35
One clear example of EPA's misstatements of the supposed benefits of Proposed Rule is the following reference:
Waterways identified as impaired waters by section 303(d) of the Clean WaterAct (CWA) and waters identified as wild and scenic rivers under the 1968 Wild and Scenic Rivers Act may benefit the mostfrom improved environmental performance. Adverse impacts to waterbodies may be reduced or avoided in accordance with improvements in the environmentalperformance of mines.
While some historic mining clearly contributed to water quality impairment, modem mining operations are required to comply with Clean Water Act provisions. The suggestion that modem mines will not comply and the Proposed Rule will lead to a better level of compliance is completely unsubstantiated. There is no evidence of any requirement in the Proposed Rule improving water quality at mines or surrounding watersheds.21
Next, EPA tries to use its findings from the Agency's National Enforcement Initiative (NEI): Reducing Pollutionfrom Mineral Processing Operations to justify the benefits of the Proposed Rule. Like the CWA reference, EPA broadly states that its inspections have found significant noncompliance with hazardous waste and other environmental laws. It goes on to further indicate that the mineral processing and mining sectors generate more wastes that are corrosive or contain toxic metals than any other industrial sector. It is reasonable to debate EPA's findings on hazardous waste statute and regulatory compliance but EPA does not demonstrate that such non-compliance is not being addressed by existing regulatory and FA programs and these sites pose a risk of Superfund liability at modem mining operations. EPA's failure to establish a link between alleged noncompliance and the Proposed Rule requirements further demonstrates the fundamental weakness in its justification for the Proposed Rule.
EPA also misleadingly cites Toxic Release Inventory (TRI) data as justification for the Proposed Rule. EPA cites 2013 TRI data that indicates that the metal mining industry (e.g., gold ore mining, lead ore and zinc ore mining, and copper ore and nickel ore mining), reported quantities of onsite releases of hazardous substances, averaging nearly 1.7 billion pounds per year. EPA acknowledges that these numbers in no way represent actual risk of release to the environment. In fact, much of this volume relates to waste rock managed on-site that has little or no potential to cause a hazardous release or risk. Moreover, EPA recognizes that the TRI data is generally related to releases that are permitted under existing State and Federal law. However, EPA suggests that the mere presences of these materials in the mining industry somehow equates to environmental risk and potential Superfund liability. This is like saying because a rock in your backyard has some copper in it, it could cause a hazardous substance release for which you
21 AEMA anticipates that the anti-mining organization Earthworks (or another environmental NGO) may place into the rulemaking record a 2006 report prepared by Ann Maest and Jim Kuipers, Comparison o fPredicted and Actual Water Quality at Hardrock Mines - the Reliability o fpredictions in Environmental Impact Statements. This report and its conclusions were debunked by Schlumberger Water Services in 2013, Technical Review o fKuipers M aest 2006, Comparison ofpredicted and actual water quality at hardrock mines: The reliability o fpredictions in Environmental Impact Statements. Among the findings o f the Schlumberger review are that the conclusions in Maest Kuipers are not relevant to any current mines being permitted today; the conclusions regarding water quality exceedences could not be validated; and that the data set primarily focused on historical sites and sites permitted during the transition from an unregulated activity to modem regulations. This report is included with these comments and incorporated by reference.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00022
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 23 of 35
should provide FR. Most strikingly, EPA provides no examples correlating TRI data to actual releases that triggered Superfund liability at modern mines. That is because it cannot do so.
Finally, having failed to demonstrate any financial justification for the Proposed rule or any evidence that environmental risks are not addressed adequately by existing programs, EPA states that the Proposed Rule will yield vague benefits in terms of changes in behavior among mining operations. Again, the theory is that because the mining industry caused issues in the past (pre-environmental statutes), it must not be environmentally responsible today, and, therefore, a burdensome, unsupported FR program is necessary. The mining industry is one of the most regulated and scrutinized industries in the U.S. To suggest that it behaves poorly compared to other industries is unsupported and offensive to AEMA's members that are committed to protecting the environment. This is clearly evidenced over the past decade by the lack of any tangible impacts from modem mining operations on human health or ecological systems. Overall, EPA has not demonstrated any linkage between the Proposed Rule and changes in behavior that would reduce risk.
In establishing the performance standards and the fiscal necessity to comply with them, EPA is effectively using the "financial responsibility" provisions of CERCLA 108(b)--a statute that says nothing about mines or mining--as statutory authority to establish itself as the super regulator of hardrock mining in the United States, thereby usurping the authority of FLMA and State regulators that EPA itself concedes to have greater capability to evaluate such issues. Neither section 108(b) nor any other act of Congress has delegated that authority to EPA. In setting national criteria without regard to site-specific differences in such critical areas as geology, climate, hydrology, seismology, and ecology, EPA will be requiring mines to incorporate inflexible measures that a number of States have rejected for sound technical reasons, either as not needed or as affirmatively inferior to other options. EPA's approach will increase the costs to build and operate mines without providing an environmental benefit. As a result, a number of mines will be forced to prematurely close and new mines won't be built.
V. EPA's Flawed Formula
As more fully explained in the document prepared by SRK Consulting entitled Review o f Cost Estimate Formulafor EPA's CERCLA 108(b) Proposed Rule (marked as Appendix B to NMA's Comments and incorporated herein by reference), EPA's approach to estimating FR is fundamentally flawed. From a conceptual standpoint, EPA's reliance upon a generic, one-sizefits-all formulaic approach based on limited input variables and using statistical manipulation to estimate FR costs is a highly inaccurate, outdated and overall erroneous approach. The assumption that one formula can produce valid estimates of the cost of response actions for any facility type on any hardrock mine site is unreasonable. This generic approach does not consider critical, site-specific conditions that can profoundly affect the cost of such actions. For example, sites located in semi-arid environments will have a number of lower cost options available for management of solutions at the site. Likewise, the presence or absence of acid generating rock at a site can have a significant impact on site objectives, and therefore, the actions taken to achieve those objectives.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00023
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 24 of 35
In contrast, the federal and state regulatory agencies began requiring site-specific closure and reclamation cost estimates to calculate FA obligations nearly 30 years ago, after abandoning the overly simplistic formulaic approach previously used. The change was based upon actual experience with mine design, operations and closure, which showed that simplistic approaches would not provide accurate cost estimates, sometimes seriously underestimating closure and reclamation costs. For example, prior to 1989, mine sites in Nevada were only required to post FA of $2,500 per acre, an arbitrary amount that subsequent experience by the agencies and the mining industry was shown to be wholly inadequate2223.
Although some international jurisdictions still use this type of overly simplistic method for FA estimates, jurisdictions with mature mining industries and advanced regulatory programs have abandoned, or are abandoning this approach in favor of requiring site-specific closure cost estimates.
VI. The Proposed Rule Must be Rejected because it Violates Numerous Executive Orders
As described below, EPA's Proposed Rule violates specific directives in Executive Orders (EOs) issued by Presidents Clinton, Obama, and Trump. Proceeding with the Proposed Rule is unjustifiable because of these violations.
A. President Clinton's Executive Order 12866
In September 1993, President Bill Clinton issued Executive Order ("EO") 12866 - Regulatory Planning and Review stating:
The American people deserve a regulatory system that worksfor them, not against them: a regulatory system thatprotects and improves their health, safety, environment, and well-being and improves the performance o f the economy without imposing unacceptable or unreasonable costs on society; regulatory policies that recognize that the private sector andprivate markets are the best enginefor economic growth; regulatory approaches that respect the role o f State, local, and tribal governments; and regidations that are effective, consistent, sensible, and understandable. We do not have such a regulatory system today11,
EPA's Proposed Rule does not comply with numerous aspects of EO 12866 including the requirement that rules use the most cost-effective option to achieve regulatory benefits, impose the least regulatory burden, avoid duplicating existing rules, harmonize federal regulations with State, local, and tribal regulations, and consider alternatives.
22Although some states still use cost/acre as a regulatory guideline, those regulations require consideration of other site-specific factors and regulators have the discretion to consider other factors, and may increase the total bond above the guideline, if needed. 23 http://www.presidency ,ucsb.edu/ws/?pid=61560
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00024
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 25 of 35
In violation of EO 12866, EPA's Proposed Rule works against the interests of the U.S. mining industry and the broader best interests of our Nation that require mined materials for our infrastructure, our technology, our transportation, our defense, our security, and for all other aspects of modem life. The Nation's interests would be best served by developing domestic sources of such minerals.
The Proposed Rule violates EO 12866 because it places an enormous financial burden on the hardrock mining industry that will diminish the domestic production of minerals, cost U.S. mining jobs, and impose "unacceptable or unreasonable costs on society." The Proposed Rule also violates EO 12866 by failing to "respect the role of State, local, and tribal governments." Moreover, the Proposed Rule violates the 12 Principles of Regulation specified in EO 12866 as shown in Table 2.
Table 2
The Proposed Rule Contravenes Executive Order 12866 Regulatory Principles
EO 12866 Regulatory Principles
Proposed Rule Contraventions
Identify the problem to be solved
There is no problem. Adequate FA already
provided by States' and FLMAs' FA programs,
eliminating the need for the Proposed Rule.
Examine existing regulations
Existing States' and FLMA's regulations and FA
programs eliminate the need for the Proposed Rule
Identify and assess alternatives to
Relying on existing States' and FLMAs' FA
regulations
programs is an obvious and viable alternative.
Consider the degree and duration of There is minimal risk because the States' and
risks
FLMAs' regulatory and FA programs largely
eliminate risks.
Use most cost-effective options to
States' and FLMAs' programs provide cost-
achieve the regulatory objective
effective FA for each CERCLA response category
Determine if benefits justify the costs The Proposed Rule estimates minimal public
benefits (no more than $15.5 million per year of
savings to the government) at an enormous and
unjustifiable cost to industry of at least $171
million per year.
Use best available information to
The numerous documents in the docket pertaining
determine the need for and
to legacy sites are irrelevant to the Proposed Rule,
consequences of proposed regulations which governs current mining operations - not
legacy sites. Similarly, CWA, TRI, and
enforcement statistic data have no direct
applicability to the Proposed Rule. The Proposed
Rule should be based on information provided by
the SERs, States, and FLMAs during and after the
SBAR Panel process.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00025
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 26 of 35
Table 2
The Proposed Rule Contravenes Executive Order 12866 Regulatory Principles
EO 12866 Regulatory Principles
Proposed Rule Contraventions
Identify and assess alternative forms of Existing States' and FLMAs' FA programs reduce
regulation
or eliminate the need for the Proposed Rule24
Harmonize federal regulations with
Proposed Rule is dismissive of and incongruent
State, local, and tribal regulations and with State, local, and tribal regulations and
functions
functions
Avoid regulations that are duplicative, Proposed Rule duplicates and is incompatible with
inconsistent, and incompatible with
existing States' and FLMAs' regulations and FA
other federal regulations
programs
Impose the least burdensome
EPA estimates the Proposed Rule would create a
regulations including cumulative
$7.1 billion FA requirement and burden the mining
regulations
industry with $171 million annual costs on top of
existing FA requirements. It further assumes the
availability of FA instruments to satisfy the
requirements. Given EPA's own documented
uncertainties in this assumption, the actual costs
could be much higher and potentially devastating
to the industry. As indicated by Advocacy's letter,
the benefits are likely significantly overestimated
and could be less than $1 million per year.
Minimize the potential for litigation
Per CERCLA 114(d), the Proposed Rule would
preempt existing States' FA and result in litigation.
In compliance with EO 13777, EPA must write a Final Rule that is consistent with the Regulatory Principles in EO 12866. The Final Rule must recognize that a strong domestic hardrock mining industry is essential to the economic, defense, and security interests of the Nation. The Final Rule must rej ect the regulations in the Proposed Rule as being duplicative and unwarranted and find that the existing States' and FLMAs' regulatory requirements and FA programs eliminate risks, thereby rendering CERCLA 108(b) FR unnecessary.
B. President Obama's Executive Order 13563
It is ironic that the Obama administration's Proposed Rule violates President Obama's January 2011 EO 13563, "Improving Regulation and Regulatory Review." EO 13563 supplements and reaffirms the principles in President Clinton's EO 12866 and requires federal regulations to comply with EO 12866. EO 13563 recognizes that some industry sectors are subject to numerous regulations that may be redundant, and requires elimination of regulatory redundancies to reduce regulatory burdens.
24As discussed in Section II A, EPA's reliance on existing States' and/or FLMAs' FA to reduce or eliminate the need for CERCLA 108(b) FA clearly demonstrates the Proposed Rule is unnecessary.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00026
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 27 of 35
EO 13563 directs federal agencies to " ...identify and use the best, most innovative, and least burdensome tools for achieving regulatory ends [and] take into account benefits and costs. This EO acknowledges, "Some sectors and industries face a significant number of regulatory requirements, some of which may be redundant, inconsistent or o v e r l a ppi ng. a nd requires federal agencies to "identify and consider approaches that reduce burdens."
In compliance with President Trump's EO 13777, EPA must withdraw the regulations in the Proposed Rule as currently drafted and develop a Final Rule that complies with President Obama's EO 13563 and President Clinton's EO 12866. As mandated by the Clinton, Obama, and Trump EOs, EPA's Final Rule must not unduly burden the hardrock mining industry, must appropriately weigh costs and benefits, and eliminate redundancy by recognizing that the States and FLMAs already have substantial FA programs that make an EPA program unnecessary.
C. President Trump's Executive Orders
In addition to EO 13777, President Trump has issued other EOs that are directly relevant to the Proposed Rule. The directives in these EOs require EPA to withdraw the regulations in the Proposed Rule. Two such EOs, EO 13771 and 13783, are discussed below.
President Trump's January 30, 2017 EO 13771, "ReducingRegulation and Controlling Regulatory Costs," establishes that it is the policy of the executive branch to be prudent and financially responsible in the expenditure of both public and private sector funds. In addition to managing the direct expenditure of taxpayer dollars, this EO requires federal agencies to control the financial burdens that compliance with federal regulations imposes upon the private sector.
To accomplish this objective, EO 13771 requires federal agencies to eliminate at least two existing regulations prior to promulgating any new regulations. It also mandates a net-zero cost to the regulated community in which the cost of new regulations must be offset by eliminating existing regulations that create equivalent cost burdens.
This EO has important fiscal implications for a future CERCLA 108(b) rule because before EPA can promulgate regulations under a Final Rule or determine that no such regulations are necessary (as it must to comply with the Court Order), the Agency would have to repeal two or more existing regulations to meet the net-zero cost savings mandate. If EPA were to proceed with the Proposed Rule as written, the Agency would have to repeal two or more regulations that cumulatively impose $171 million in annual private-sector costs to offset EPA's projected costs of the Proposed Rule.
EO 13771 also requires agencies to submit Regulatory Plans pursuant to EO 12866 and include any new rule approved during the Presidential budget process in the Unified Regulatory Agenda. Notably in the case of the Proposed Rule, EPA's internal memorandum regarding the President's FY 2018 budget specifically prohibits EPA from using any funds to finalize the regulations in the Proposed Rule: "None of the funds made available are to be used to finalize or enforce the proposed CERCLA 108(b) rulemaking on the hardrock mining industry, as the rule is currently written." This prohibition does not prevent EPA from issuing a No Rule Final Rule. EO 13771
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00027
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 28 of 35
and EO 13777 work hand-in-hand to reduce regulatory burdens. Considering the requirements in both of these EOs, it is clear that EPA must withdraw the regulations in the Proposed Rule.
A third EO, President Trump's March 28, 2017 EO, "Promoting Energy Independence and Economic Growth" (EO 13783), similarly requires EPA to reject the regulations in the Proposed Rule. This EO states that it is in the Nation's interest to develop a broad array of domestic energy resources including coal, natural gas, nuclear, hydropower, and renewable energy sources. This EO also establishes that the Nation's electricity must be affordable, reliable, safe, and secure and that it be produced from domestic sources.
EO 13783 requires agencies to avoid creating regulatory burdens that unnecessarily encumber energy production, constrain economic growth, and prevent job creation. The Proposed Rule directly thwarts these objectives because it substantially burdens - and may even curtail altogether - the future production of energy from hardrock minerals like lithium and uranium; the distribution of energy which requires copper, gold, silver, zinc and other hardrock minerals; and the development of solar and wind renewable energy sources, which require rare earths, copper, gold, silver, and other hardrock minerals.
EO 13783 directs all executive branch departments and federal agencies to conduct an immediate review of regulations that potentially burden the development of domestic energy resources and suspend, revise, or rescind those that unduly burden the development of domestic energy sources. As shown in Table 3, the Proposed Rule violates several aspects of EO 13783. EPA must withdraw the regulations in the Proposed Rule in order to comply with EO 13783.
Table 3
Proposed Rule Contravenes Energy Independence Executive Order 13783
EO 13783 Energy Independence Directives
Proposed Rule Contraventions
Avoid regulatory burdens that unnecessarily The onerous and duplicative FA requirements
encumber energy production
will interfere with and potentially eliminate the
development of domestic deposits of lithium
and uranium, two important energy resources
Ensure the affordability, reliability and safety The Proposed Rule directly threatens the
of the Nation's electricity, by developing
affordability and reliability of the Nation's
domestic coal, natural gas, nuclear,
electricity by imposing a substantial financial
hydropower, and renewable energy resources burden on the domestic producers of energy
minerals used to produce and distribute
conventional and renewable sources of
electricity.
Require environmental regulations to have a EPA projects the Proposed Rule will cost
greater benefit than cost
mining companies a minimum of $171 million
per year while providing no more than a
meager $15.5 million in annual taxpayer
savings, which clearly violates this cost benefit
mandate.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00028
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 29 of 35
EPA must withdraw the regulations in the Proposed Rule because they violate EOs from three administrations: 12866, 13563, 13771, 13777, and 13783, and write a Final Rule by December 1, 2017 in order to comply with the Court Order. The Final Rule also must comply with the directives to avoid duplicative regulations, alleviate regulatory burdens, achieve a cost benefit, and not impede domestic energy production in the EOs listed above. The only Final Rule that will comply with these EOs is a Final Rule concluding that no additional FR pursuant to CERCLA 108(b) is required for hardrock mining.
The Court's January 29, 2016 opinion in Idaho Conservation League et al ("Opinion") provides EPA with broad discretionary authority regarding the scope and content of the rule - or even whether to issue a rule at all. EPA can thus satisfy the Court Order by developing a Final Rule that also complies with the EO regulatory directives.
...the proposedjoint order23 "does not require EPA topromulgate a new, stricter rule... At most, it merely requires that LLPA conduct a rulemaking and then decide whether topromulgate a new rule -- the content o fwhich is not in any way dictated by the proposed order on consent-- using a specific timeline ...EPA retains discretion to promulgate a rule or decline to do so... Thejoint motion on consent states that "[n]othing in this Joint Motion shoidd be construed to limit or modify the discretion accorded EPA by CERCLA or the generalprinciples o f administrative law. (Opinion at 17, internal citations omitted.)
...the joint motion does not preordain the content o f a rulemaking much less indicate that in committing itself to conducting a ridemaking EPA has prejudged the outcomefor the hardrock mining industry. (Opinion at 20)
Thus, pursuant to the Opinion, EPA has full authority to determine that CERCLA 108(b) FR is not necessary and therefore to issue a Final Rule that states no rule is warranted. EPA can readily justify this "No Rule" Final Rule based solely on the overwhelming data that the SERs, States, and FLMAs provided during the SBAR Panel process that document there are no un-bonded risks associated with the hardrock mining industry that justify a CERCLA 108(b) FR requirements. The comments filed during this comment period provide overwhelming additional support for that premise. A No Rule Final Rule would be the best way to conform to congressional intent and satisfy all of the regulatory directives in the Clinton, Obama, and Trump EOs.
VII.
The Proposed Rule's Regulatory Burden Violates EO 13777 because there is
Insufficient Market Capacity to Respond to the Proposed Rule's FA Demand
In response to a Congressional directive in the FY 2016 Conference Committee Report, EPA performed an analysis of the availability of FA instruments to satisfy the demand that a25
25 In re: Idaho Conservation League et al, Petitioners and EPA filed a joint motion for an order on consent ("joint motion") specifying an agreed upon schedule for the CERCLA 108(b) rulemaking for the hardrock mining industry.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00029
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 30 of 35
CERCLA 108(b) FR program26 would create. EPA's highly flawed FA Market Study performed in conjunction with the rulemaking for the Proposed Rule reveals there could be insufficient marketplace capacity to satisfy EPA's projected FR requirement under the Proposed Rule. This finding underscores and quantifies the magnitude of the regulatory burden associated with the Proposed Rule, which would require the hardrock mining industry to obtain third-party FR instruments that would not be commercially available to many hardrock mining companies. EPA's Market Study confused "capacity" with "availability." Capacity does not equal availability. EPA failed to determine if FR instruments would be available regardless of capacity.
EPA's FA Market Study estimates there may be as much as $600 million of market capacity for environmental insurance and $5 billion for surety coverage, resulting in an aggregate market capacity of $5.6 billion potentially available to respond to a future CERCLA 108(b) FR requirement. (FA Market Study at 2). EPA's $7.1 billion estimate of the price tag for the CERCLA 108(b) FA program significantly exceeds the estimated FA market capacity. As indicated in comments by NMA and others such, we believe EPA's cost estimate of $7.1 billion is inaccurate and the costs are likely to be far higher.27With only $5.6 billion in market capacity, it is easy to see that many operations will not be able to find coverage in the market.
EPA's FA Market Study reveals a great deal of uncertainty regarding the market's ability to satisfy the demand for CERCLA 108(b) FA:
At this time it is not possible to predict the exact market for these instruments in response to E PA 's CERCLA 108(b) regulations. (FA Market Study at 5).
[T]here may be softening o f the underwriting o f traditionally volatile lines of business, including environmental liability and mining... Such uncertainty makes it exceedingly difficult to make inferences or predictionsfrom the data as tofuture market trends and capacity. (FA Market Study at 8).
[I]t is important to keep in mind that insurers and sureties will continue to be wary o f business lines that are recognized as volatile (as the hardrock mining industry could be characterized). (FA Market Study at 16).
Moreover, EPA's FA Market Study acknowledges that the universe of willing FA providers has recently shrunk noting that in January 2016, AIG, one of the largest underwriters of environmental liability insurance to cover large-scale and long-term environmental risks, announced it would no longer offer environmental impairment liability coverage. In evaluating AIG's announcement, EPA's research found that "the marketplace is continuing to evaluate the impact of this decision." (FA Market Study at 15).
26 CERCLA 108(b) Hardrock Mining and Mineral Processing Evaluation of Markets for Financial Responsibility Instruments and the Relationship of CERCLA 108(b) to Financial Responsibility Programs of Other Federal Agencies, August 25,2016. ("FA Market Study") 27 In its May 5, 2017 comment letter to EPA, Freeport McMoran indicated that it alone will have to add as much FR ($4-7 billion) as EPA projected for the entire mining industry ($4-7 billion).
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00030
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 31 of 35
Similarly, Wells Fargo informed EPA of the limited market capacity for covering mining risks, cautioning that "Energy risks, power and utility risks, and mining risks: these industries have significantly less capacity available to them, with carriers generally not willing to write more than a one- or two-year term." (FA Market Study at 18).
The Proposed Rule acknowledges that a FR program pursuant to CERCLA 108(b) would create a demand for FR instruments that the market may not be able to satisfy:
Given the number o f unknownfactors, the ultimate availability o f CERCLA 108(b)financial responsibility instruments cannot be predicted with certainty until thefinal rule has been promulgated. At that time, the available instruments will be determined, and the market will have an opportunity to respond. (FR at 3399)
EPA's "Build it and They Will Come" theory about the future availability of FR instruments to satisfy the demand created by a CERCLA 108(b) rule is dangerously speculative, could result in serious regulatory compliance problems for the industry, and creates an extraordinary regulatory burden in violation of numerous EOs, including EO 13777, not to mention jeopardizing our national security by removing critical minerals for national security from domestic production.
The materials EPA provided to the SERs during the SBAR Panel process28 showed projected FA costs for hypothetical companies with credit ratings ranging from CCC+ to B+. This analysis is inapplicable for some companies in the hardrock mining industry (especially small, startup companies like many of the SERs) that do not have a revenue stream and therefore do not have a credit rating.
For those companies that could qualify for third-party, commercial FR instruments, there is widespread concern over the cost of securing and maintaining these instruments. So, in addition to the problems associated with the projected limited market capacity to respond to a future demand for CERCLA 108(b) FR, the significant cash collateral required to obtain a CERCLA 108(b) FR instrument would be very problematic. This cash collateral requirement, which could be as much as 100% plus fees, would reduce the capital that companies have available to conduct reclamation activities, advance environmental improvement initiatives, and pursue business development opportunities. Ultimately the drain on corporate capital that would result from the CERCLA 108(b) FR program would reduce the domestic production of minerals, cost hardrock mining jobs, and economically devastate mining dependent rural communities.
As noted in EPA's Market Study, aspects of the CERCLA 108(b) FR program - especially the payout to multiple claimants (i.e., third parties seeking monies from the CERCLA 108(b) FR instruments for natural resource damages and other claims) - "presents a different regulatory framework [that was] not universally familiar to the providers." (FR Market Study at 5). The
28 See August 23,2016 EPA PowerPoint Presentation entitled "CERCLA 108(b) Financial Responsibility, Small Business Advocacy Review Panel Outreach for August 2016 Meeting"
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00031
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 32 of 35
issue of third-party claimants who have standing under CERCLA to seek money from the CERCLA 108(b) program could be a serious market constraint if FA providers are not willing to provide FR instruments under these circumstances. Secondly, the opportunity for third-party claims against a CERCLA 108(b) FR instrument is likely to increase the potential for frivolous damage claims and lawsuits.
Under EPA's own evaluation, the Proposed Rule carries an enormous annual industry price tag of $171 million. Based on EPA's Market Study, however, there is significant potential this is an underestimate of the actual costs to the mining industry. The central theme of EPA's Market Study is the suggestion that capacity will exist to provide the necessary financial instruments. Flowever, as indicated above, there is great uncertainty in these predictions especially since the study provides no definitive indications of commitments to provide such instruments and the expected costs. If in fact, some or all hardrock mining companies cannot obtain such instruments, they would have to self-fund some or all of the required FA. Because they lack cash flow, most junior mining companies and mine developers will be unable to meet the financial test to self-insure or self-fund.
If facilities do have to self-fund the FA, the impacts on the US mining industry could be devastating. In highly competitive world markets, U S. producers cannot afford to hold tens or hundreds of millions of dollars in escrow for potential future releases that EPA has not demonstrated could occur. Given the uncertainties expressed in the market study, it is highly negligent of EPA not to at least analyze implementation scenarios, including determining the socioeconomic impacts, where FA instruments are not available.
Because the Proposed Rule creates a FR requirement for which there is a reasonable expectation of inadequate commercial capacity, it places an unacceptable regulatory burden on the hardrock mining industry that violates the directives in EOs 12866, 13563, and 13771. This regulatory burden also is inconsistent with President Trump's EO 13777, and is therefore an excellent example of a proposed regulation that should be withdrawn pursuant to EO 13777.
VIII.
The SBREFA SBAR Process Was Flawed
As indicated above, AEMA participated as a SER in the SBREFA required SBAR Panel process. AEMA submits that EPA failed to comply with the letter and spirit of SBREFA and violated its own Regulatory Flexibility Act (RFA) Guidance,
You shouldprovide the SERs with enough information about the rulefor them to be able tojudge the likely impacts o f the rulemaking on small entities. Outreach materials could include any draft o f the rule or preamble text, if such materials are available. Section 5.7.5.
Despite repeated requests for the model and formulae, EPA failed to provide this basic information necessary to determine the impact of a CERCLA 108(b) rule on small entities.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00032
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 33 of 35
EPA failed to provide the SERs the formula for calculating FR requirements which prevented the SERs from determining the impact of the Proposed Rule on their operations. Throughout the SBAR process, the SERs expressed concern with the transparency of the process, the lack of relevant information about the model and formula and EPA's rush to get a Proposed Rule published by December 1, 2016 in order to comply with an arbitrary date in a Court Order. The result, in our view, is a flawed SBREFA process. Had EPA shared the formula and model with the SERs, we could have engaged experts to review the model and formula and helped EPA develop a rule with minimal adverse financial impacts on SERs and the hardrock mining industry while complying with CERCLA 108(b)'s mandate.
Throughout the SBAR process, AEMA and other SERs have repeatedly requested information concerning the model and formulae, including:
the selection criteria used to identify the 63 mines used to inform the model/formula; the complete list of engineering controls and best management practices the agency is
currently considering for reductions in the total financial responsibility obligation, including those controls and practices EPA intends to include that are currently required under state and federal regulatory programs; the criteria for identifying engineering controls and best management practices that will be assigned reduction values in the model/formula; the corresponding reduction percentages/values for each engineering control and best management practice and the criteria, formula, and assumptions used to determine these numbers; and the formula, calculations, and assumptions, including spreadsheets, used to determine the annualized instrument costs to obtain the hypothetical financial responsibility amounts in the SBREFA slides, including the costs for insurance policies, trust funds, and letters of credit, as well as information on costs for surety bonds (not provided in the slides, at the June 9 or August 31, 2016 meetings).
Without this information, it was impossible for the SERs to determine the financial impact of a CERCLA 108(b) rule on their businesses. By email dated September 6, 2016, AEMA requested additional information necessary to properly comment on EPA's proposal and fulfill our responsibility as a SER. By email dated September 14, EPA stated it was able to clarify some points, but would provide no new or additional information. EPA stated that it believes the information provided "provides sufficient basisfor meaningful comments from the SERs" AEMA disagreed. Without knowing how the financial responsibility for each of the 13 response categories was calculated and without knowing the criteria used to qualify for a reduction, our members could not determine the impact of a CERCLA 108(b) rule on their operations. It was impossible to evaluate the validity of the formula EPA intended to use. EPA failed to meet SBREFA's statutory requirements.
Advocacy's comment letter also discusses EPA's failure to comply with the RFA's requirement to consider significant small business alternatives (Advocacy letter, Section 5 at p. 14). The SBREFA amendments to the RFA provide that an agency's compliance with the RFA is judicially reviewable and that a court may remand a rule to the agency and defer enforcement.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00033
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 34 of 35
See, Northwest Mining Association v Babbitt, 5 F.Supp.2d 9 (DDC 1998). EPA can avoid a remand of the Proposed Rule for failing to comply with the RFA by issuing a No Rule Final Rule.
IX. Conclusions
Based on information EPA did provide the SERs, information provided by FLMA and State regulators, and this rulemaking record, it is clear EPA has not done the diligence required to support the need for the regulations in the Proposed Rule. EPA acknowledges that the Proposed Rule is not appropriate for legacy sites, yet uses irrelevant, outdated legacy and pre-regulation site information to inform the formula and in an attempt to justify the Proposed Rule. At the same time, EPA has failed to provide any evidence to suggest existing FLMA and State FR programs are insufficient. This shifting of the burden of proving a negative is entirely inappropriate and illegal.
Furthermore, with EPA concluding that a CERCLA 108(b) rule will be applied only to mines operating on or after the effective date, or idle but authorized to operate on or after the effective date, it is unreasonable, arbitrary and capricious for EPA to assume that all currently operating mines and mines which will be authorized in the future pose a risk of releasing hazardous substances to the environment and that all 13 response costs will be incurred. The rulemaking record, including these comments and comments filed by industry, affected States, FLMAs, and Advocacy clearly demonstrates: 1) that modern mine regulatory and FA programs, together with modem mining practices and engineering controls are working; and 2) that a CERCLA 108(b) rule is unnecessary.
Therefore, EPA should conclude, based on the rulemaking record that the CERCLA 108(b)'s statutory mandate has been met and additional financial responsibility requirements are not necessary to protect the federal Superfund program and the American Taxpayer. The DC Circuit Court of Appeals empowered EPA to reach this conclusion in its Mandamus Order,
But the proposedjoint order "does not require EPA to promulgate a new, stricter rule. "Id. at 1324. At most, it "merely requires that EPA conduct a rulemaking and then decide whether topromulgate a new rule -- the content o f which is not in any way dictated by the [proposed order on consent] -- using a specific timeline." Id. The timeline in the joint motion requires that EPA commence a rulemaking with respect to hardrock mining by December 1, 2016, and provide "notice of its final action" by December 1, 2017. Joint Mot. 3. Although more is required with respect to hardrock mining than the other identified industries, where EPA retains discretion not to conduct a rulemaking at all, EPA retains "discretion topromulgate a rule or decline to do so "evenfor the hardrock mining industry29 (Emphasis added)
29In re Idaho Conservation League, et al, No. 14-1149 (DC Cir. January 29, 2016) at 17.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00034
AEMA Comments on Financial Responsibility Requirements under CERCLA 108(b) for Classes o f Facilities in the Hardrock Mining Industry Docket ID No.: EPA-HQ-SFUND-2015-0781 Page 35 of 35
As discussed above, the costly and highly flawed Proposed Rule creates a regulatory burden on the hardrock mining industry that is duplicative, unnecessary, and inconsistent with numerous regulatory directives in President Clinton's EO 12866 and President Obama's EO 13563. Pursuant to President Trump's EO 13771, EPA would have to repeal two regulations that impose comparable costs (at least $171 million/year) on the private sector if the Agency elects to proceed with the Proposed Rule. EPA could avoid this impact altogether by withdrawing the regulations in the Proposed Rule and issuing a "No Rule" Final Rule.
The Proposed Rule would place an enormous and unjustifiable financial burden on the entire U.S. hardrock mining industry. The onerous and duplicative FR requirements in the Proposed Rule would substantially reduce domestic production of critically important minerals, put thousands of U.S. mining jobs at risk, and dramatically increase the Nation's reliance on foreign minerals. Clearly, these outcomes are not in the Nation's best interests and do not comply with the EOs discussed above.
For these reasons, AEMA strongly urges EPA to withdraw the regulations in the Proposed Rule and issue a Final Rule establishing that no additional FR is required for the hardrock mining industry. Withdrawing the Proposed Rule and replacing it with a Final Rule documenting that no additional FA is needed for modern hardrock mining operations would alleviate a substantial and unwarranted regulatory burden and help to lift the enormous cloud of uncertainty that is currently costing mining jobs and chilling investment in the U.S. hardrock mining industry. AEMA believes the record in the rulemaking for the Proposed Rule provides overwhelming support for this Administration to withdraw the regulations in the Proposed Rule and issue a Final Rule that no additional FR pursuant to CERCLA 108(b) is required for hardrock mining.
AEMA incorporates by reference as though fully set forth herein the comments of the NMA, Rio Tinto/Kennecott, Newmont Mining Corp., Barrick Gold N.A., Hecla Mining Company, Coeur Mining, Kinross Gold USA, and NOVAGOLD Resources.
Respectfully Submitted,
Laura Skaer Executive Director
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00035
HARDROCK MINE RECLAMATION AND REGULATION
HOW CHANGING VALUES and CHANGING LAW CAUSED HARDROCK MINES to DESIGN, BUILD, and OPERATE for
LONG-TERM CLOSURE and RECLAMATION: A FEDERAL and STATE REGULATORY SUCCESS STORY
preparedfor the AMERICAN EXPLORATION & MINING ASSOCIATION
(Formerly Northwest Mining Association) 10 Post Street, Suite 305 Spokane, WA 99201
(509) 624-1158 by
Joseph H. Baird Baird Hanson LLP
Boise, Idaho 208-388-0110
and Richard DeLong Enviroscientists, Inc.
Reno, Nevada 775-826-8822
July 2017
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00036
TABLE OF CONTENTS
1.0 Executive Summary.............................................................................................. 1
2.0 Hardrock Mine Regulation Effectiveness - EPA has never determined that any hardrock mine approved by a federal or a Western State agency after 1990 to be among the "top priority among known response targets"..............3
2.1 EPA's National Priorities List for CERCLA Cleanup............................................3
2.2 A specific hardrock mine clean-up case study cannot be used to evaluate the effectiveness of current hardrock mine regulation if that specific hardrock mine had not been subjected to regulation prior to its design and construction..............4
2.3 Hardrock mines on the National Priorities List must be rationally classified into three (3) major eras based upon applicable regulation or the lack thereof: (1) PreRegulatory Era (prior to 1970); (2) Transition Regulatory Era (1970 through 1990); and, (3) the Regulated Hardrock Mine Era (post-1990)...............................5
2.4 Northwest Mining Association June 30, 2013 Comments on EPA's Bristol Bay Watershed Assessment determined that current hardrock mining regulations were protective of the environment, citing to specific federal and state government studies that explicitly support this conclusion..........................................................7
2.5 The 2015 Enviroscientists Report confirms the NWMA/(AEMA) Comments on EPA's Bristol Bay Watershed Assessment in June 2013 that determined that no Western hardrock mine has been placed on the CERCLA NPL since 1990...........8
3.0 Current hardrock mine regulation is protective of the environment, as determined by: (1) the United States National Academy of Sciences; (2) the Western Governors Association; and, (3) Senator Murkowski's 2011 Investigation......................................................................................................... 10
3.1 The National Academy of Sciences/National Research Council has determined that existing hardrock mine regulation on federal land is "complicated but generally effective" in protecting the environment........10
3.1.1 The NAS/NRC Report determined that "[sjimple `one-size-fits-all' solutions are impractical because mining confronts too great an assortment of site-specific technical, environmental, and social conditions.".............10
3.1.2 The NAC/NRC Report correctly characterizes the current hardrock mining industry as having minimal impact on public lands and the NAC/NRC Report also correctly characterizes the importance of the hardrock mining to the US economy and to US manufacturing................11
Sierra Club v. EPA 18cv3472 NDCA
i
Tier 5
ED 002061 00090629-00037
3.2 Current hardrock mine regulation continues to be protective of the environment on federal lands as further evidenced by the United States Forest Service and United States Bureau of Land Management Responses to Senator Murkowski's 2011 Investigation..............................................11
3.3 The Bi-Partisan Western Governors' Association confirms that the Western States "have a proven track record in regulating mine reclamation in the modern era, having developed appropriate statutory and regulatory controls" that are "protective of human health and the environment" as well as being protective of public treasuries............................................ 11
3.4 Current hardrock mine regulation is protective of the environment on all federal and state Western lands - A Summary.........................................14
4.0 Changing Societal Values - The Great Depression, World War II, the Cold War, and the Modern Environmental Movement.......................................... 125
4.1 Prior to 1970, there was virtually no direct regulation of municipal sewage, industrial wastes or hardrock mines...................................................................... 15
4.2 Societal Values of "The Greatest Generation" ........................................................15
4.3 Cultural Balance......................................................................................................18
4.4 The Modem Environmental Movement..................................................................18
4.5 Cultural and Legal Changes Incorporating Environmental Values........................ 18
5.0 Development of Legally-Applicable Hardrock Mine Regulation.....................19
5.1 Regulation of the Natural Media Receptors - An Overview..................................19
5.2 Surface Water......................................................................................................... 20
5.3 Groundwater Protection at Hardrock Mines.......................................................... 21
5.3.1 State Protection of Groundwater at Hardrock Mines................................. 21
5.3.2 Federal Protection of Groundwater at Hardrock Mines.............................21
5.4 Hardrock Mine Reclamation, Fincial Assurances and Water Quality Protection.. 22
5.5 The National Environmental Policy Act of 1970.................................................. 24
5.6 Evaluation of the Effectiveness of Hardrock Mine Regulation based upon the Timing of Regulatory Developments...........................................................................25
n
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00038
6.0 Conclusion
27
Sierra Club v. EPA 18cv3472 NDCA
iii
Tier 5
ED 002061 00090629-00039
1.0 Executive Summary
The federal and state regulation of hardrock mining and milling facilities (collectively, "hardrock mines")1 is a success story of environmental protection that is well-illustrated by the fact that of the none of the Western hardrock mines that were designed, built and/or approved in the last 26 years are on the United States Environmental Protection Agency ("EPA") National Priorities List of environmental cleanup sites. To characterize this another way, there has never been an environmental problem at a hardrock mine approved by a federal or state agency in the West after 1990 that required EPA to make any such hardrock mine a Superfund "top priority among known response targets." Finally, and most succinctly, no hardrock mine permitted/approved in the West after 1990 has ever been placed on EPA's Superfund National Priorities List. This is in stark contrast to Western hardrock mines designed and built prior to 1970 when there were no regulatory approvals for such facilities and no cultural guidelines.
The reasons for this are straightforward and summarized below.
Current hardrock federal and state mine regulation is protecting the environment. This is not just the opinion of the relevant agencies or the hardrock mining industry. It is also the opinion of the federal government's National Academy of Sciences/National Research Council and the bi-partisan Western Governors' Association.
In 1999, the federal government's independent National Academy of Sciences/National Research Council produced a comprehensive report entitled "Hardrock Mining on Federal Lands" regarding then-current hardrock mine regulation on lands managed by the federal government and states agencies and determined:
The overall structure of the federal and state laws and regulations that provide mining-related environmental protection is complicated but generally effective.
Simple "one-size-fits-all" solutions are impractical because mining confronts too great an assortment of site-specific technical, environmental, and social conditions. Each proposed mining operation should be examined on its own merits. ... Recommendation: BLM and the Forest Service should continue to base their permitting decisions on the sitespecific evaluation process provided by NEPA [National Environmental Policy Act]. ...
1 For the purposes o f this study, "hardrock mine" includes any facilities deemed to be a "mining" or "beneficiation" facility by the EPA. EPA has defined "mining and beneficiation" to include, generally, all metal mines, but EPA's use o f the term "hardrock mine" also includes many non-metallic industrial mineral mines, such as phosphate rock, trona, fluorospar, and mica, as well as the mills required to concentrate the target minerals o f these ores. See generally 40 C.F.R. 261.4(b)(7)(JuIy 15, 2016). In common usage, EPA's "mining and beneficiation" is more typically referred to as "hardrock mining and milling" or just for the purposes o f this Report sometimes "hardrock mine."
1
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED_002061 00090629-00040
"Hardrock Mining on Federal Lands," National Academy of Sciences/National Research Council, Executive Summary, p. 5. Importantly, the bi-partisan Western Governors Association has determined that the Western States, which regulate hardrock mining on state and private lands within their borders, impose permit conditions and stringent design and operating standards, to ensure that hardrock mining operations are conducted in a manner that is protective of human health and the environment." WGA, Policy Resolution 10-16, Background (A)(8) ("National Minerals Policy"). Moreover, the states and federal agencies have continued to strengthen their reclamation and financial assurances requirements on an ongoing basis.
The correctness of the 1999 National Academy of Sciences determinations were revalidated and confirmed by Senator Murkowski's 2011 Investigation, when the United States Forest Service ("Forest Service") and the United States Bureau of Land Management ("BLM") reported to the Senator that out of 3,344 mining plans of operations approved by these two agencies since 1990, none of these 3,344 federal mine plan approvals created an environmental problem that caused EPA to place any of these hardrock mines on EPA's highest priority environmental clean-up sites. Therefore, Senator Murkowski's study objectively demonstrates the continued correctness of the National Academy/National Resources Council's 1999 determinations.
The development of the effective hardrock mine regulation and reclamation of the Forest Service, the BLM and Western States did not occur overnight. There was a "learning curve" that took a couple of decades. But the single most important factor creating effective hardrock mine regulation has been an American cultural shift since about 1970 with the advent of the modem environmental movement. Prior to 1970, municipal waste, industrial waste and hardrock mines were not regulated to protect the environment. Protecting the environment was not a major societal priority. The US hardrock has incorporated these environmental values into the cultural fabric of the industry.
The absence of environmental protections prior to 1970 was, in significant part, a legacy of the then-dominant American cultural focus from the Great Depression on jobs and the economy, followed immediately by World War II, the Cold War and the Korean War. All of these nation-threatening events caused the federal government to force dramatic and environmentally-harmful national efforts to quickly and heroically increase the chain of industrial and manufacturing production to historic heights. Hardrock mining was (and remains) the first and primary link in much of the manufacturing chain. Much of the CERCLA hardrock mine negative environmental legacy arose during this period or long before. Even in the late 1950s, President Eisenhower's forward-looking "Blueprint for America" did not even mention the environment.
The modem environmental movement, symbolized by the first Earth Day and by the enactment of the National Environmental Policy Act in 1970, evidenced a shift of our society from one that had been almost wholly-focused on industrial and manufacturing production values to a society where environmental values had a role, too. This shift in values was implemented by changes in law and regulation over the next twenty years as the United States adjusted to this more balanced approach to hardrock mining. As
2
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00041
discussed below, these laws, regulations and the collective experience of federal and states agencies, as well as the hardrock mine industry (learning from regulatory omissions along the way) have created a regulatory climate and an operating culture in which current hardrock mine regulation is an effective protector of the environment.
Hardrock mines designed and built prior to 1970 were developed to maximize production and minimize cost with little or no regard for environmental values. Importantly, however, after 1990, all new hardrock mines have been designed, built and operated to integrate long-term environmental closure and reclamation as a primary design standard. This is required by current law, but it is also required by the U.S. culture, generally, and by the U.S. hardrock mining industry, specifically.
Therefore, the EPA cannot rationally use information about environmental closure and reclamation costs from hardrock mines designed and approved prior to 1970 to assess the degree and duration of environmental risk associated with hardrock mines in 2017. Doing so would be as absurd as assuming that the design flaws of the 1964 Chevrolet Corvair, made infamous by Ralph Nader's 1966 book "Unsafe at Any Speed," should be used to assess whether any new National Highway Traffic Safety rules are needed in 2017. In both the hardrock mine and the NHTSA examples, the result of such assessments would be equally hopeless and comically out of date.
The Forest Service, the BLM, and the Western States reclamation agencies, in concert with the hardrock mining industry environmental management, have prevented any hardrock mine, designed and approved after 1990, from being deemed by EPA to be a "top priority" cleanup site.
This achievement is a genuine "success story."
2.0 Hardrock Mining Regulation Effectiveness - EPA has never determined that any hardrock mine approved by a federal or a Western State agency after 1990 to be among the "top priority among known response targets"
2.1 EPA's National Priorities List for CERCLA Cleanup
The federal "Comprehensive Environmental Response Compensation and Liability Act of 1980, as amended (commonly referred to as "CERCLA" or "Superfund"), requires EPA to publish the National Priorities List annually to identify the "national priorities among known releases or threatened releases [of hazardous substances] throughout the United States ...."2 The National Priorities List identifies "[t]o the extent practicable, ... [EPA's] `top priority among known response targets'...."3 The National Priorities List ("NPL") includes over 1100 sites, which includes only about 50 hardrock mining sites, which, in turn are almost all pre-1970 facilities.4
242 U.S.C. Section 9605(a)(8)(B). 3 Id. 4 http://www.epa.gov/superfund/sites/npl (March 30, 2012). Unfortunately, EPA had prepared and electronically-published a Table designated "Summary - Mining Sites on the National Priorities List"
3
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00042
EPA has specifically determined that hardrock mining wastes pose significantly lower environmental risk than "mineral processing" wastes, and so EPA has determined that "high volume" "low hazard" wastes should not be regulated as if they were "hazardous wastes."5 Therefore, information about environmental problems with inorganic chemical plants and mineral processing facilities that generate actual "hazardous waste" does not provide any useful information to assess the environmental issues associated with hardrock mines. Accordingly, even more importantly, environmental regulatory issues associated with mineral processing facilities and inorganic chemical plants provide no information about the current regulation of hardrock mining. Mineral processing and inorganic chemical plants are subject to substantially different regulatory programs, standards and procedures than hardrock mines, in short, to have an intelligent discussion about the effectiveness of hardrock mine regulation one must evaluate hardrock mining and milling facilities that were actually subject to regulation since 1990. EPA's nowdefunct NPL Mining Sites List failed to do this, since almost one-half of the EPA's socalled "Mining Sites" were in fact mineral processing or inorganic chemical plants.
2.2 A specific hardrock mine clean-up case study cannot be used to evaluate the effectiveness of current hardrock mine regulation if that specific hardrock mine had not been subjected to regulation prior to its design and construction
One cannot evaluate the effectiveness of hardrock mine regulation if one does not first consider whether or not a case study hardrock mine had been subject to regulation, and then second, if applicable, one must consider the nature of the specific regulation to which a hardrock mine had been subject to regulation prior to its design and construction. Obviously, it is utterly pointless, absurd, and deliberately misleading, to pretend to "evaluate" the effectiveness of hardrock mine regulation with reference to any hardrock mine that has never been subject to regulation! Nevertheless, nongovernmental organizations (NGO's) that seek their funding by opposing hardrock mines inevitably use
("EPA's Mining Site List," May 2013, www.epa.gov/aml), but EPA's Mining Site List was highly misleading because it did not include only hardrock mines, nor even just "hardrock mining and milling sites" Unfortunately, EPA's "Mining Sites List" included large numbers o f downstream inorganic chemical plants and "mineral processing" sites that are not hardrock mines. This critical substantive distinction seems to have given rise to multiple legal actions filed by non-governmental organizations ("NGO") against the hardrock mining industry and against EPA speciously seeking regulation o f hardrock pursuant CERCLA 108(b). Fortunately, after the NWMA/AEMA provided its public comments regarding EPA's fatally-flawed "Summary - Mining Sites on the National Priorities List" and other closely-related issues in EPA's "Bristol Bay" public docket (see discussion in Section 2.4 below), EPA terminated its dissemination o f this particular grossly misleading information by removing it from EPA's website. Nonetheless, the NGO legal challenges against the mining industry that were apparently supported, in part, by EPA's years o f misinformation regarding the hardrock mining industry, continue to this day.
5 See 50 Fed. Reg. 40,292 (Oct. 2, 1985); EPA, "Report to Congress, Wastes from the Extraction and Beneficiation o f Metallic Ores, Phosphate Rock, Asbestos, Overburden from Uranium Mining, and Oil Shale," (Dec. 31, 1985); 55 Fed. Reg. 32,135 (Aug. 7, 1990); and EPA, "Report to Congress on Special Wastes from Mineral Processing" (July 1990).
4
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00043
historical and factually irrelevant examples to suggest there are current problems with hardrock mines in both regulatory and litigation settings.6
Hardrock mines designed and built prior to 1970 were developed to maximize production and minimize cost, but after 1990, all new hardrock mines have been designed, built and operated to integrate long-term environmental closure and reclamation as a primary design standard, as required by current law and culture. Therefore, the success of hardrock mining regulation must be evaluated by using reasonably current applicable rules.
No one would suggest that General Motors (GM) should be prohibited from producing cars in 2017 or subject to new regulation because, in 1965, GM produced the Corvair (deemed "unsafe at any speed" by Ralph Nader7) which does not meet 2017 standards. Yet, critics of the hardrock mining industry repeatedly and constantly describe environmental problems at hardrock mines that were designed and operated prior to 1970 as illustrative of current hardrock mine.8 This is absurd.
Hardrock mines designed and operated prior to 1970 were in place long before hardrock mines were subject to any regulation whatsoever. Thus, it is critical to determine, even if only generally, the extent to which any hardrock mine used as an example or case study to evaluate the effectiveness of hardrock mine regulatory programs has actually been subject to relevant regulatory programs.
2.3 Hardrock mines on the National Priorities List must be rationally classified into three (3) major eras based upon applicable regulation or the lack thereof: (1) Pre-Regulatory Era (prior to 1970); (2) Transition Regulatory Era (1970 through 1990); and, (3) the Regulated Hardrock Mine Era (post-1990).
Hardrock mine regulation must be classified into 3 major eras based upon the extent of applicable regulation or the lack thereof: (1) Pre-Regulatory Era (prior to 1970); (2) Transition Regulatory Era (1970 through 1990); and, (3) Regulated Hardrock Mine Era (Post-1990). Below, Section 4.0 ("Changing Societal Values - The Great Depression, World War II, the Cold War, and the Advent of the Modern Environmental Movement") provides some of the policy history supporting use of these three temporal classifications. Further below, Section 5,0 ("Development of Legally-Applicable Hardrock Mine
6 Maest, A.S., Kuipers, J.R., Travers, C.L. and Atkins, D.A., 2005, "Predicting Water Quality at Hardrock Mines: Methods and Models, Uncertainties, and State-of-the Art." But importantly also see. Schlumbereer Water Services. 2013. "Technical Review o f the Kuipers Maest, 2006, `Comparison o f predicted and actual water quality at hardrock mines: The reliability o f predictions in Environmental Impact Statements,'" p. I, that determined in te r a lia that "The conclusions contained in the fMaest Kuipers. 20061 report are not relevant to any current mines that are being permitted, or to anv future mines ...Ibecausel Imlodem-dav characterization and analysis techniques have changed so radically from virtually all o f the studies cited by the report that it is meaningless to draw anv comparison to modern-day conditions." Emphasis added. 7 Nader, Ralph, Unsafe at anv speed: The Designed in Dangers o f the American Automobile. Grossman Publishers, 1965. 8 See footnote 6, supra.
5
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED_002061 00090629-00044
Regulation") provides a summary of the primary legal support for using these three (3) temporal classifications.
Facilities designed and constructed in the Pre-Regulatory Era (prior to 1970) provide no useful information about the effectiveness of current hardrock mine regulation "predictions" since Pre-Regulatory Era Hardrock Mines were designed, constructed and operated to maximize production and minimize cost. Pre-Regulatory Era Hardrock mines did not even consider long-term environmental closure and reclamation. In stark contrast, long-term environmental closure and reclamation are required by current federal and state law, while Pre-1970 hardrock mines were never subject to any regulation whatsoever. Even worse, Pre-Regulatory Era facilities were conceived, designed and operated even before environmental values were imbedded in the American culture. Thus, when subsequently enacted laws and regulations were applied to these facilities after-the-fact, such regulatory efforts could not influence the facility design and construction. Thus, such regulation could never hope to prevent all releases to the environment from facilities. For example, tailings facilities from the Pre-Regulatory Era were often designed to release to the ground water for reasons of structural safety, while even simple release-reporting to ground water was only required starting in the 1980s, and even then, only under certain limited circumstances. In short, pre-1970 PreRegulatory Era facilities were not conceived, designed or operated with significant concern for the environment.
Importantly, even hardrock mines designed and constructed during the Transition Regulatory Era were often not subject to direct regulatory approvals. But at least there was an increasing cultural awareness of the regulated community and the government that environmental values needed to be considered, even if imperfectly. However, those Transition Regulatory Era Mines that were actually subject to regulation were never subject to full control of surface and ground water regulation and geochemical predictive modeling that characterizes current hardrock mine permitting.
For example, in 1985, it was EPA's assessment was that "EPA data on management methods at mining facilities indicate that only a small percentage of mines currently [i.e., 1985] monitor their ground water, use run-on/run-off controls or liner, or employ leachate collection, detection, and removal systems." 50 Fed. Reg. 40,292 (Oct. 2, 1985); EPA, "Report to Congress, Wastes from the Extraction and Beneficiation of Metallic Ores, Phosphate Rock, Asbestos, Overburden from Uranium Mining, and Oil Shale," (Dec. 31, 1985) ("RTC I," p. ES-10.) Therefore, as a practical matter, according to EPA, any discussion of the effectiveness of "environmental predictions" at facilities designed and approved prior to 1985 is utterly meaningless. To restate this point, hardrock mining facilities designed and approved prior to 1985 do not provide any useful information about current regulation of hardrock mines because pre-1985 hardrock mines were not designed, built and operated to integrate long-term environmental closure and reclamation. This is in sharp contrast to current law and regulation.
Therefore, per EPA, there was almost no comprehensive regulation of ground water discharges prior to 1985. Of course, such programs were not created overnight. Even in
6
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00045
1990, programs specifically designed to preclude groundwater releases from mining facilities were in their infancy and geochemical "predictive" modeling was largely conceptual at that time. Modern geochemical predictive modeling really did not begin practical application as a regulatory tool in the mid-1990s. For example, Earthworks, a group that opposes the hardrock mining industry, contracted for a report "Predicting Water Quality at Hardrock Mines: Methods and Models, Uncertainties, and State-of-the Art" in which of 202 references cited to, only 28 dated from before 1990, and most of the directly pertinent geochemical references have been published since 2000.9 Nevertheless, if one evaluates and then assigns each hardrock mine that EPA has deemed to be among its "top priority among known response targets" (i.e., the NPL) to the major regulatory era when it was designed, constructed and approved, then a very clear and incontestable picture develops, as discussed immediately below.
2.4 Northwest Mining Association June 30, 2013 Comments on EPA's Bristol Bay Watershed Assessment determined that current hardrock mining regulations were protective of the environment, citing to specific federal and state government studies that explicitly support this conclusion.
The American Exploration & Mining Association (AEMA) (formerly Northwest Mining Association or "NWMA'j provided comments to EPA's Bristol Bay Watershed Assessment concerning the Alaskan Pebble Project on June 30, 2013 regarding the effectiveness of existing hardrock mine regulation. Baird, 2013, "Hardrock Mining Reclamation and Reclamation - Developing Sustainable Environmental Protection through Changing Values, Changing Laws and Experience: A Federal State Success Story" (the "NWMA 2013 Study"). The NWMA 2013 Study provides detailed support to arrive at its conclusions that:
Current Hardrock Mining regulation is protecting the environment. However, this is not just the opinion of the relevant agencies or the Hardrock Mining industry; it is the opinion of the National Academy of Sciences and the bi-partisan Western Governors' Association.
Unfortunately, EPA apparently wholly-ignored the NWMA 2013 Study with regard to the "Bristol Bay Watershed Assessment," except that the NWMA 2013 Study may have caused EPA's to terminate use of its so-called "NPL Mining Site List." Nevertheless, to date, EPA has never referenced the NWMA/AEMA's 2013 Study.
AEMA must assume EPA's failure to acknowledge the relevant indisputable facts described in NWMA's 2013 Report has something to do with the bias that occurred within EPA regarding the "Bristol Bay Watershed Assessment." More specifically, the respected Cato Institute "think tank" has stated:
Because there was never a mining permit application [submitted for the Pebble Project], EPA charged a senior biologist (not a mining engineer)
9 See footnote 6, supra.
7
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00046
named Phillip North to design a worst case scenario open-pit `hypothetical mine' that could never be approved. ... North then proceeded to `model' the maximum deleterious impact of the nonexistent, unplanned, and imaginary mine ...
EPA and North simply ignored ... [a $150,000,000 in scientific study of the] biology, ecology, and dynamics of the Bristol Bay watershed. EPA and North simply ignored this remarkable repository of information before admitting, during the entire time that the Bristol Bay Watershed Assessment was written (2011-2014), that it was never really intended to provide a scientific foundation for regulatory decision-making, after all.
While he was creating his hypothetical mine, Mr. North also coached antiPebble activists on how to petition his own Agency to stop the real permit application. It appears he even wrote petitions. ...
Mamula, Ned and Michaels, Patrick J., 2016, "A Green Mess: Is EPA in Hot Water over Alaska's Bristol Bay?" http://www.cato.org/publications/commentary/green-mess-epahot-water. Importantly, when the House Oversight Committee sought to bring Mr. North before a Committee Hearing in 2013:
...he delayed, bobbed and weave, and suddenly pulled his children out of school and fled the country.
Id. Therefore, the AEMA/NWMA must assume that the important information that it has previously presented to EPA regarding the adequacy of existing hardrock mine reclamation has been lost to EPA's unethical Bristol Bay Watershed Assessment sideshow.
Accordingly, the AEMA has developed this document in 2017 to further support its and refine the NWMA's original demonstration that currently, federal and state hardrock mine reclamation programs and financial assurance mechanism are protective of the environment. Therefore, the AEMA commissioned the independent expertise of Enviroscientists, Inc. to review and assess NWMA's 2013 Report to be sure that its information is fully considered by future EPA actions.
2,5 The 2015 Enviroscientists Report confirms the AEMA/NWMA Comments on the Bristol Bay Watershed Assessment in June 2013 that determined that no Western hardrock mine has been placed on the CERCLA NPL since 1990
Dr. Richard DeLong of Enviroscientists, Reno, Nevada, has completed an assessment of U.S. Environmental Protection Agency's National Priorities List ("NPL") for Mining and Milling Sites. Please see attached "Memorandum" from Richard DeLong to Joe Baird,
8
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00047
Baird Hanson LLP, dated, May 15, 2015, "Assessment of Mining and Milling Sites on the National Priorities List" ("Enviroscientists Memo"). Dr. DeLong's analysis states:
There are over 1,100 sites on the NPL. Of those, there are 100 that the EPA has classified as MMS [i.e., "Mining and Milling Sites"]. However, only 55 of those sites are actual mining operations where mineral resources were extracted from the earth. The other 45 are mineral processing facilities where a mineral product is delivered to the operation for further processing. The 55 "hardrock" MMS on the NPL fall into the following temporal classifications: 49 are prior to 1970; five are from 1970 through 1990; and one is post-1990 and it is the Barite Hill property in South Carolina.
Therefore, per the Enviroscientists' Memorandum, the 55 Mining and Milling sites on the NPL fall into the following temporal classifications:
Pre-Regulatory Era (prior to 1970)
49
Transition Regulatory Era (1970 through 1990)
5
Regulated Hardrock Mine Era (post-1990)
1!0
By eliminating the "red herring" mineral processing and inorganic chemical plants from the EPA's so-called "Mining" Sites List of 100 sites, the EPA List can be corrected to include about 55 sites that are hardrock mining sites, but only if one includes hardrock mining sites from all eras, including many historic facilities dating back to the 1800s, which obviously provided no information about 20th century mine design, construction, operation and reclamation/closure practices, let alone 21st century practices.
Obviously, and most importantly from the perspective of evaluating the success of current hardrock mine regulation, none of the hardrock mines on the National Priorities List were approved after 1990 in the West.11 Moreover, this is validated and updated regarding federal lands by the Forest Service and the BLM, as discussed immediately below.01
10 Barite Hill, McCormick County, South Carolina, EPA Facility ID SCN000407714. According to EPA, from 1991 to 1995, gold and silver mining was conducted at the site. 11 It is important to note that eliminating mineral processing and inorganic chemical plant sites almost certainly does not affect the number o f regulated facilities from EPA's so-called Mining Site List that would be deemed to be located on the NPL since 1990. In fact, there have been very few new mineral processing facilities constructed since 1990, other than updating o f existing facilities (e.g., Rio Tinto's Utah Copper Division) or use o f small "mineral processing" facilities such as the dor furnaces commonly located at gold mines. Very few, if any, new large regional mineral processing facilities have been constructed since 1990. Nevertheless, one cannot have an intelligent discussion about the efficacy o f or even enumerate the issues related to regulating hardrock mines and mills if the data includes information about mineral processing and inorganic chemical plants.
9
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00048
3.0 Current hardrock mine regulation is protective of the environment, as determined by: (1) the United States National Academy of Sciences; (2) the Western Governors Association; and, (3) Senator Murkowski's 2011 Investigation.
3.1 The National Academy of Sciences/National Research Council has determined that existing hardrock mine regulation on federal land is "complicated but generally effective" in protecting the environment.
In 1999, the federal government's independent National Academy of Sciences/National Research Council ("NAS/NRC"), including several-related organizations,12 produced a comprehensive report entitled "Hardrock Mining on Federal Lands" regarding thencurrent hardrock mine regulation on lands managed by the Forest Service and the Bureau of Land Management and determined:
The overall structure of the federal and state laws and regulations that provide mining-related environmental protection is complicated but generally effective.
NAS/NRC, 1999, "Hardrock Mining on Federal Lands," p.5. Importantly, the NAS/NRC also identified a number of areas where implementation of existing laws could be improved, hi, pp. 6 - 9 , and all of the NAS/NRC recommendations that increased the protection of the environment have since been adopted into current federal law.
Importantly, the Forest Service and the BLM continue to improve their programs. Since the 1999 NAS/NRS determination, for example, the Forest Service developed a new "Training Guide for Reclamation Bond Estimation and Administration - For Mineral Plans of Operation authorized and administered under 36 CFR 228A" in 2004, which considered the decades of experience that had developed concerning creating financial assurances and distilled much of this practical knowledge into the Forest Service manual. Additionally, in 2001, the BLM expanded its program to provide for financial assurances on all surface disturbing activities, including notice-level exploration projects affecting fewer than five acres. Thus, the hardrock mining regulation protecting federal land is continually improving and adjusting to take into account the lessons learned from experience, as is required pursuant to NEPA "adaptive management" strictures. These existing regulatory programs already substantially limit or eliminate the degree and duration of environmental risk associated with the current hardrock mining industry.
3.1.1 The NAS/NRC Report determined that "[s]imple `one-size-fitsall' solutions are impractical because mining confronts too great an assortment of site-specific technical, environmental, and social conditions."*10
12 "Committee on Hardrock Mining on Federal Lands," "Committee on Earth Resources," "Board on Earth Sciences and Resources," "Commission on Geosciences, Environment, and Resources."
10
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00049
Over the last 40 years, the Forest Service and the BLM have developed complicated, but nonetheless workable and environmentally protective programs under the auspices of their own authorities comprehensively coordinated by the National Environmental Policy Act ("NEPA") to properly evaluate and take into account site-specific conditions. The NAS/NRC properly characterizes the situation.
Conclusion: Federal land management agencies' regulatory standards for mining should continue to focus on the clear statement of management goals rather than on defining inflexible, technically prescriptive standards. Simple `one-size-fits-alf solutions are impractical because mining confronts too great an assortment of site-specific technical, environmental, and social conditions. Each proposed mining operation should be examined on its own merits. ... Recommendation: BLM and the Forest Service should continue to base their permitting decisions on the sitespecific evaluation [emphasis added] process provided by NEPA. The two land management agencies should continue to use comprehensive performance-based standards rather than rigid, technically prescriptive standards. ...
"Hardrock Mining on Federal Lands," Executive Summary, p.5. The NAC/NRC emphasis on the criticality of site-specific evaluation is emphasized by NEPA, CERCLA's ARARs process and state permitting for determining rational standards that are protective of the environment and create realistic mechanism for reclamation guarantees.
3.1.2 The NAC/NRC Report correctly characterizes current hardrock mining industry as having minimal impact on public lands and NAC/NRC Report also correctly characterizes the importance of hardrock mining to the US economy and to US manufacturing
The NAC/NRC Report "... respond[ed] to a request by Congress that the National Research Council assess the adequacy of the regulatory framework for hardrock mining on federal lands." "Elardrock Mining on Federal Lands," Executive Summary, p. 1. Importantly, the Report states that "[t]he area of federal land available to hardrock mining in the Western states is enormous, but the surface area actually physically disturbed by active mining is small in comparison ... [approximately 0.06% of BLM lands are affected by active mining and mineral exploration operations." Id. And, "while society requires a healthy environment, it also requires sources of materials, many of which can be supplied only by mining." Id. Importantly:
Regulations intended to control and manage the alteration of the landscape and the environment in an acceptable way are generally in place and are updated as new technologies are developed to improve mineral extraction, to reclaim mined lands, and to limit environmental impacts.
Sierra Club v. EPA 18cv3472 NDCA
11 Tier 5
ED 002061 00090629-00050
Thus, the NAC/NRC Hardrock Mining Report correctly notes that hardrock mining has a minor surface area "footprint" relative to total federal lands, and that society requires mining for survival.
3.2 Current hardrock mine regulation continues to be protective of the environment on federal lands as further evidenced by the United States Forest Service and the United States Bureau of Land Management Responses to Senator Murkowski's 2011 Investigation
By letter dated, March 8, 2011, Senator Murkowski's (R-AK) asked the Forest Service and the BLM how many mine plans of operations ("MPOs") the agencies had approved since 1990 and asked how many of those approved MPO facilities subsequently were listed by EPA on the NPL? The Forest Service responded to Senator Murkowski by stating that they had approved 2,685 MPOs since 1990 and stated that none of these required EPA to place them on the NPL. The BLM responded to Senator Murkowski by stating that they had approved 659 MPOs after 1990 and stated that none of these required EPA to place them on the NPL.
Thus, the 1999 NAS/NRC determination that current hardrock mine regulation was protective of federal lands was additionally confirmed and updated by Senator Murkowski's 2011 Investigation.
3.3 The Bi-Partisan Western Governors' Association confirms that the Western States "have a proven track record in regulating mine reclamation in the modern era, having developed appropriate statutory and regulatory controls" that are "protective of human health and the environment" as well as being protective of public treasuries
The Western Governors' Association has repeatedly determined that current Western States' hardrock mine regulation is protective of human health and the environment. The Western States have agencies and staffs that have been exclusively dedicated to prospective mine regulation and to prospectively requiring mine operating and mine reclamation plans. Additionally, good regulatory work and correct mine financial assurances have not only protected public health and the environment, but these regulatory programs have also protected state and federal public treasuries. Importantly, these WGA determinations have been Bi-Partisan. Even more importantly, these determinations regarding the quality of Western states mine regulation and reclamation have been on-going, made year-after-year, by an ever-changing group of Bi-Partisan Western Governors. Please note that WGA policy statements are either, renewed, updated or "sun-setted" every three (3) years, but it is also important to see the evolution of these policy statements.
In 2010, the Western Governors' Association ("WGA") stated:
The Western States ... extensively regulate hardrock mining operations on both public and private lands, and uniformly impose permit conditions and
12
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00051
stringent design and operating standards, to ensure that hardrock mining operations are conducted in a manner that is protective of human health and the environment, and that, at closure, the mined lands are returned to a safe, stable condition for productive post-mining use.
WGA, Policy Resolution 2010-16, Background (A)(8) ("National Minerals Policy''). More recently, in 2011, the Western Governors Association "Policy Statement" further emphasized the above points stating simply:
The member states have a proven track record in regulating mine reclamation in the modern era, having developed appropriate statutory and regulatory controls, and are dedicating resources and staff to ensure responsible industry oversight.
WGA, Policy Resolution 2011-4 ("Bonding for Mine Reclamation"). Previous WGA policy determinations provided foundation for the correctness of the above determinations, stating that:
All Western states ... have staff dedicated to ensuring that ongoing mine operations develop and follow appropriate reclamation plans.
Western states have a proven track record in regulating mine reclamation in the modem era - including for hard rock mines - having developed appropriate statutory and regulatory controls, and are dedicating resources and staff to ensure responsible industry oversight.
WGA, Policy Resolution 2014-07 ("Bonding for Mine Reclamation"). Thus, while the National Academy of Science/NRC confirms that hardrock mine regulation on federal lands is "generally effective," the Western Governors' Association confirms that the Western States' hardrock mine regulation is also "protective of human health and the environment." Collectively, this means that all Western lands, federal and state (including private) lands are covered by adequate regulations regarding hard rock mining.
Thus, since it has been well-established that state regulatory and policy regulation of hardrock mining protects human health and the environment, it is important to also ensure that such regulation is protective of the state public finances, as well.
In 2014, the WGA correctly determined regarding the Western mining states that:
An important component of a state's oversight of mine reclamation is the requirement that mining companies provide financial assurances in a form and sufficient to fund required reclamation if, for some reason, the company itself fails to do so [often referred to generically as "Bonding"].
Sierra Club v. EPA 18cv3472 NDCA
13
Tier 5
ED 002061 00090629-00052
All Western states have developed regulatory bonding programs to evaluate and approve the financial assurances required of mining companies. The states have developed the staff and expertise necessary to calculate the appropriate amount of the bonds, based upon the unique circumstances of each mining operation, as well as to make informed predictions of how the real value of current financial assurance may change over the life of mine, even post-closure.
WGA, Policy Resolution 2014-07 ("Bonding for Mine Reclamation"). These are powerful Bi-Partisan collective gubernatorial determinations made over a period of recent years. Importantly, these statements by Western State political leaders are wellsupported by the independent factual record.
3.4 Current hardrock mine regulation is protective of the environment on all federal and state Western lands - A Summary
In 1999, federal hardrock mine regulation programs of the USFS and the BLM were deemed to be "generally effective" in protecting the environment by the National Academy of Science/National Research Council. In 2011, Senator Murkowski's investigation of the BLM and Forest Service mine regulation experience verified and updated the 1999 NAS/NRC determination. And the Bipartisan Western Governors' Association has determined that the state hardrock mine regulatory programs were both "protective of human health and the environment" and protective of public treasuries.
Importantly, such regulatory "treasury protection" does not even consider the major additional public benefit of mining revenue from state revenue from taxes, severances taxes, and employee income taxes, among other sources, which are substantial since mining jobs (i) are traditionally some of the highest paving hourly wages in any state (ii) like any industrial enterprise, have substantial job multiplier effects on supporting business and employment and (iii) typically produce products that are the necessary in puts for US manufacturing.
Nevertheless, it is reasonable to ask, "Why is hardrock mine regulation so effective now, when historic operations created significant problems?" Obviously, as discussed above, part of the answer is simply that prior to 1970 (i.e., the Pre-Regulatory Era) there was no significant environmental regulation of hardrock mines. However, it is also important to recognize that prior to 1970 there was also no significant environmental regulation of municipal waste or municipal sewage, nor was there any significant regulation of manufacturing environmental impacts. The "bottom line" is that the American culture has now made environmental protection a priority value - not only for the hardrock mining industry, but also for local communities, industry, the regulatory community, and the public. Therefore, unlike in decades gone-by, public, private and NGO managers are now paying close attention to hardrock mining environmental issues that did not even show up on the policy "radar screen" prior to 1970.
Sierra Club v. EPA 18cv3472 NDCA
14
Tier 5
ED 002061 00090629-00053
4.0 Changing Societal Values - The Great Depression, World War II, the Cold War, and the the Modern Environmental Movement
4.1 Prior to 1970, there was virtually no direct regulation of municipal sewage, industrial wastes or hardrock mines.
Prior to 1970, there was no significant regulation of hardrock mines at either the federal or state level. Mining was not an exceptional activity in this regard. Prior to 1970 there was very little direct regulation of municipal sewage or industrial waste discharges. The early federal water pollution control laws were primarily construction grants programs that were public works projects subsidizing certain activities, but these were not regulatory prohibitions. Rivers, lakes and other water bodies were deliberately used to dispose of all types of septic, chemical and industrial wastes.
Prior to 1970, government and industrial managers did not "see" environmental pollution as a problem or they simply did not know what to do about it. In 2017, this may seem incomprehensible. However, if one briefly reviews our history leading up to this point, one can quickly understand how the culture reached this point. More importantly, for the purpose of this report, in part, it explains why the regulatory omissions of the past will not be repeated, even without specific regulatory prohibitions.
4.2 Societal Values of "The Greatest Generation"
Tom Brokaw's iconic 1998 book The Greatest Generation13 describes the generation of American who came of age in the poverty of the Great Depression and went on to fight World War II, the Korean War, the Cold War, and then participated in generating an era of comparative affluence in the 1950s and 1960s. The deprivation of the Great Depression created a culture in which jobs and manufacturing production were the primary concerns. Belching industrial smokestacks symbolized prosperity in one town, while clean air in the next town symbolized factory closure and unemployment. For example, in 2016, it is now ironic to note with regard to a historic smokestack at a Hoover vacuum manufacturing facility that:
... the Hoover Co. understood the value of the tall chimney promoting the burgeoning company at a time when companies took pride in the height of their smokestacks. While today they may represent industrial pollution, in that era, the image of the black billowing smoke from a tall chimney stack represented prosperity. `They wanted it to be a symbol of their company by putting their name on it,' Fernandez said. `Every time somebody would take a picture of North Canton [Ohio], that chimney is in the picture.' `It's certainly symbolic.'
"Iconic Hoover Smoke Stack to be Restacked," Robert, Wang, The Canton Repository. December 4, 2014. Obviously, this describes a very different set of values from the environmental values that are foundational to the US in 2017.*15
13 Brokaw, Thomas, The Greatest Generation. Random House, New York, 1998.
15
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00054
The economic desperation of the Great Depression focused both public and private values upon the primary mission of finding ways to generate employment, manufacturing production and material prosperity to the exclusion of almost all other societal values. Thus, for example, when President Roosevelt's New Deal promoted multiple massive government dams on the Columbia River and Tennessee River systems progressive folk hero Woody Guthrie celebrated these achievements with songs like "Roll On, Columbia, Roll On" and "Grand Coulee Dam" unabashedly supporting such projects without any apparent concern about the associated major environmental, social or First Nation impacts. "Environmental concerns," as we now understand them were not part of the mainstream culture. The American culture of the Great Depression was one that necessarily worshiped jobs, production and material prosperity above all other values. These traits became even more deeply embedded into the American cultural fabric by the advent of World War II ("WWII") and its precursor events.
Strategically, WWII was to be won or lost based not just upon the bravery and sacrifice of soldiers, sailors and airmen, but also by delivering a crushing weight of one nation's gross national product ("GNP") onto the enemy nation. At the time, the United States excelled at this form of industrial warfare. At the time, the US could generate GNP quickly and in vast quantities of material, and the US did exactly that. Idled factories were brought back to smoking productively, while liquid (and solid) industrial wastes were conveniently disposed in the waterways behind these same plants.14 Massive new industrial production facilities were conceived of and brought into production within months, not years. Enormous new manufacturing plants were constructed to build aircraft, ships, tanks, trucks, weapons and munitions, to name just a very few of the critical implements of war. Whole new cities were constructed, seemingly overnight, to meet various production goals, and indeed, the "Manhattan Project" developing atomic weapons built new towns and industrial facilities like Oak Ridge, Tennessee and Los Alamos, New Mexico in secret, without any oversight other than that that ensured production was achieve ASAP. There was no "permitting" of any of these great public works, and little or no consideration of environmental values.
Critically, all manufacturing requires mineral inputs as primary material ingredients and the wartime plants consumed the products o f hardrock mines voraciously, demanding immediate expansion of the hardrock mining industry during WWII without regard to environmental impacts.
The federal government's direct orders and subsidies spurred the hardrock mining industry into what was the greatest periods of the industry's expansion in the shortest possible time. Providing immediate production, and lots of it, was the driving societal value. Generating GNP to deliver its brutal impact upon enemy nations was imperative. Indeed, everyone knew that American lives depended upon this industrial production, including the primary contribution of the hardrock mining industry. (Mining is referred to as being a "primary industry" for good reason!) Environmental values, as we now
14 Obviously, the US could not duplicate these same achievements at this time.
16
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00055
understand them, were pushed to an obscure corner, or more typically, such values simply did not influence federal decision-making whatsoever.
Perhaps, no single visual image captures the difference in attitudes between this period and the present than the 1943 Pennsylvania Railroad calendar art by Dean Cornwell showing a PRR steam locomotive highballing past a massive steel mill belching fire and smoke, a munitions train on the foreground track, full coal hopper cars in the background and a pile of iron ore set to be charged into the steel production furnaces. Uncle Sam looms huge in the background, rolling up his sleeve to get down to work. There is no mistaking the message, even in 2017. In 1943, the Pennsylvania Railroad was proudly displaying the pollution it generated to help win World War II.
Nor did the post-WWII culture quickly change from its intense wartime focus on material production to the exclusion of other values. The Union of Soviet Socialist Republics (USSR), a World War II ally, immediately became the new "Cold War" enemy. Additionally, Communist China, also a then-recent WW II ally became a frightening new enemy in very real "hot" war in Korea in 1950. The Soviet Union's surprisingly swift development of nuclear weapons only exacerbated US concerns. Not only were many WWII attitudes of the USA about the production ethos maintained, but indeed many of the WWII industrial and mineral production subsidies were maintained through the Korean War, and for some time thereafter. Indeed, the most far-reaching federal statute explicitly supporting U.S. mineral production was passed during this period, i.e., the U.S. Defense Production Act of 1950.
If a town was in the way of the growth of mine production, then the town had to move, in whole or in part, as witnessed, e.g., at Butte, Montana or at Bingham Canyon Utah. Other values, be they cultural or environmental, were secondary to overall societal production needs. And, indeed, the core values of production, employment and prosperity continued well into the 1960s.
In the 1960s, before the crises of energy shortages, sprawl, air and water pollution, and post-industrial economic restructuring gripped urban and rural places across America, unlimited growth was a primary goal of many communities. Growth, both economic and demographic, was a mark of progress, a source of pride, and a centerpiece of many communities' identifies.
Greenow, Linda, 2004, "When Growth was Good: Images of Prosperity in MidTwentieth Century America, Middle States Geographer, 2004, 37:pp. 53-61, p. 53.
In short, the current culture of the USA has embedded environmental values into all aspects of policy-making. In contrast, "The Greatest Generation" had no such luxury in the 1930s, 1940s or 1950s. The 1960s reaction to such attitudes is understandable. However, it is not only the hardrock mining industry that had to change and incorporate such values, it was society as a whole that had to make these changes. And, such
Sierra Club v. EPA 18cv3472 NDCA
17
Tier 5
ED 002061 00090629-00056
changes, did in fact occur, in the public, the government, and the hardrock mining industry.
4.3 Cultural Balance
Fear of unemployment, fear of war, and fear of losing wars were all factors that pushed the United States far into the public policy mode of production-at-all-costs during most of the Twentieth Century. Environmental values were almost entirely ignored regarding industrial production until 1970. Indeed, such values were rarely even articulated. At the time, the pendulum had swung too far in the direction of industrial production at all cost, which led to unnecessarily high costs to natural and environmental values. However, times were changing in the 1960s and 1970s. With the prosperity of the 1950's and 1960's, other values could and did enter or re-enter the American culture ... including environmental values.
4.4 The Modern Environmental Movement
There is no single event that marks the beginning of the environmental movement, but there are a series of events that collectively altered the mix of cultural norms regarding jobs, production, pollution, and the environment. Concerns about nuclear arms and the effects from nuclear fallout (e.g., strontium 90) from bomb testing raised consciousness about the "environment" in the 1950s. The controversy surrounding the proposal of several major dams on the Colorado River system provided a focus for environmental values in the late 1950s, perhaps most notably the work of the Sierra Club and David Brower to help thwart the building of the Echo Park Dam in Dinosaur National Monument. The 1962 publication of Rachel Carson's controversial book Silent Spring provided a counterpoint to the widespread use of chemicals in the U.S. and Dupont's "better living through chemistry" message. Shortly thereafter, changing values and changing politics allowed the passage of the landmark Wilderness Act of 1964. All of these and many other factors brought changes to America's culture and values.
America reached a symbolic turning-point on April 22, 1970, celebrated by the first Earth Day. The advent of the modem environmental movement was to generate major changes for the U.S. hardrock mining industry, and indeed, all of US industry, manufacturing, state and municipal government pollution. However, these changes were certainly not immediate, and many of the changes most applicable to hardrock mining, reclamation, environmental protection and financial assurances would take decades to develop and implement.
4.5 Cultural and Legal Changes Incorporating Environmental Values
The above discussion is provided to emphasize the extent and rapidity of the change in societal values that caught both government and industry off-guard in the 1970s. Prior to 1970, there was very little regulation of government or industrial pollution. Often, there was no regulation of pollution whatsoever. Even worse, the USA's pre-1970 values and norms were such that environmental values were not significantly impacting societal
18
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00057
decision-making in any way, because much of society did not even understand there was another way of conceiving of the world. In fact, it was only late in 1969 that the US enacted the National Environmental Policy Act of 1969 (NEPA), which was the forerunner of most modem federal environmental statutes.
Accordingly, there is nothing that can be learned about the effectiveness o f current hardrock mine regulation by studyingfacilities that were designed or constructed prior to 1970. These facilities were designed, built and operated to maximize production and minimize cost, but hardrock mines permitted/approved after 1990 have been designed, built and operated to integrate long-term environmental closure and reclamation as a primary design standard, as required by current law and mining industry attitudes.
Importantly, as discussed immediately below, even though laws and attitudes were changing rapidly starting in the 1970s, there was certainly a very steep "learning curve'" as both government and industry tried to cope with challenges of a sort that never had had to be addressed previously. This transition was hard for all concerned, and mistakes were made. For example, the infamous "Syringe Tide" of raw garbage and medical waste washed up onto New Jersey and Long Island beaches as late as 1988-1989 highlighted on-going municipal waste disposal practices, and indeed, well into the 1990s, New York City and various New Jersey communities were still ocean-dumping sewage sludge in the New York Bight and raw sewage via storm water overflow.
Fortunately, the Hardrock Mining Industry's transition problems was largely complete by 1990, and since 1990 environmental problems associated Hardrock Mining have been generally modest and manageable, as benchmarked, in part, by the lack of any new Western hardrock mines appearing on the CERCLA National Priorities List in the last 26 years.
Section 5.0, immediately below, provides a summary of the major environmental regulatory programs that have created the regulated hardrock mine era.
5.0 Development of Legally-Applicable Hardrock Mine Regulation
5.1 Regulation of the Natural Media Receptors - An Overview
Fundamentally, there are four major categories natural media that the environmental laws protect: (1) air; (2) surface water; (3) groundwater, and (4) land. As a practical matter, hardrock mining has not typically triggered significant scientific, policy or regulatory questions regarding air quality; therefore, this study does not evaluate hardrock mine regulation regarding protection of air quality.16*19Surface water quality protection has been
16 For example, the only significant air quality policy issue that has arisen from hardrock mining concerns the emissions o f mercury from gold mining operations in Nevada impacting Idaho dam-impounded reservoirs. However, these allegations were effectively discredited by the White Paper developed by the Idaho Association o f Commerce and Industry/Idaho Council for Industry and the Environment Report "Sources and Receptors o f Mercury in Idaho," January 28, 2009 ("Idaho Mercury Report"). Mercury in Idaho's waterways is primarily a result o f geologic source mercury or legacy mining (i.e., historic mining
19
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00058
dominated by promulgation of federal statutory and regulatory programs, which then have typically been implemented by state agencies. On the other hand, ground water quality protection has been the province of State government with some specific notable exceptions.
Regulation of direct impacts to land (i.e., "reclamation") has been almost exclusively the province of the relevant land management authorities. The regulation of hardrock mine reclamation on National Forest System lands has been administered by the USFS since 1974, the regulation of hardrock mining on Department of Interior managed public domain lands has been administered by the BLM since 1981, and the regulation of state and private lands within a state are administered by the relevant state agency. Additionally, the integration of post-mining land use, continued protection of water quality and post-mining land uses following hardrock mine closure and reclamation, as well as bonding for these purposes, has been the unique province and expertise of the State and Federal Land management agencies. A brief history of these programs is provided below.
5.2 Surface Water
The Clean Water Act17 was passed in 1972 and, among other things, created a requirement for a discharger of a "pollutant" to "navigable waters" (which later came to be more broadly defined as "waters of the United States") from a "point source" to obtain an NPDES permit.'8 In theory, the Clean Water Act, most particularly the NPDES permit system was one of the first federal laws potentially directly implementing regulation of hardrock mines. However, implementation was slow as EPA and the mining industry grappled with new concepts, new operational issues, and new regulatory concepts, including but not limited to programmatic litigation (see e.g., U.S. Steel Corp. v. Train, 556 F. 2d. 822 (7th Cir. 1977), and major statutory amendments19 to address these issues. Thus, EPA did not promulgate 40 C.F.R. 440, Subpart J, concerning "Copper, Lead, Zinc, Gold, Silver, and Molybdenum Ores Subcategory," some of the most common Hardrock Mines, until December 1982. 47 FR 54609, Dec. 3, 1982.
Therefore, prior to 1982, EPA and delegated State programs had attempted to enforce on a case-by-case basis an inflexible and absolute "no discharge" requirement that did not take into account net contributions of rain and snow which contributed to unrealistic environmental evaluations that significantly contributed to environmental problems at early Transition Era hardrock mines, thus, the very first practical federal regulatory scheme specifically regulating hardrock mine surface discharges did not even exist until the very end of 1982. Not surprisingly, sorting out the implementation of the NPDES program did not occur overnight.*178920
using historic mineral extraction technologies and practices long abandoned). Neither the EPA, nor the NGO's, have ever responded to the Idaho Mercury Report in writing. 17 Technically, the Clean Water Act is the Federal Water Pollution Control Act Amendments o f 1972, Pub. L. No. 92-500 (codified as amended at 33 U.S.C. Section 1251-1387. 18 33 U.S.C. Sections 1311(a), 1362(6), (7), (12), (14). 19 1977 Clean Water Act Amendments, Pub. L. No. 95-217, 91 Stat. 1581 (codified as amended in scattered sections o f 33 U.S.C.)
20
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00059
5.3 Groundwater Protection at Hardrock Mines
5.3.1 State Protection of Groundwater at Hardrock Mines
Groundwater regulation is generally held to be the unique province of state government. Groundwater, unlike surface water, does not readily migrate across State borders. Thus, while the federal definition of "waters of the United States" has been construed broadly, it has not generally been construed to regulate groundwater. As the American Law of Mining states, "[t]he Clean Water Act makes a clear distinction between navigable waters on the one hand and groundwater on the other."25
Therefore, state hardrock mine regulation has emerged as the primary regulatory tool for preventing or otherwise regulating potential hardrock mining impacts to groundwater. However, these programs have been relatively recent developments (i.e., since 1990). For example, the Nevada "Mining Facilities" regulation explicitly protects against and regulates discharges to groundwater from mining facilities were promulgated on September 1, 1990.26 And although Idaho's Ground Water Quality Plan became law in 1992,27 it was not until 1997 that a detailed and comprehensive enforcement mechanism was promulgated. See IDAPA 58.01.11, 3-20-1997 ("Ground Water Quality Rule"). Alaska's Hardrock mine reclamation was codified and promulgated in 1991. Washington's Metal Mining and Milling Act protects against potential discharges to groundwater and was passed in 1994.28
Thus, comprehensive direct preventative regulation of potential groundwater impacts of hardrock mine regulation was only initiated in the 1990s.
5.3.2 Federal Protection of Groundwater at Hardrock Mines
The Clean Water Act regulates discharges from hardrock mines, to "waters of the United States," and as discussed above, this is generally limited exclusively to surface water discharges. Certain Federal programs, including the Safe Drinking Water Act,29 the federal Resource Conservation and Recovery Act30 and Uranium Mill Tailings Radiation Control Act of 197831 regulate specific, narrowly defined activities potentially relevant to hardrock mines. The federal public lands agencies (i.e., the Forest Service and the BLM) incorporate state groundwater standards into NEPA compliance and mitigation. Nevertheless, as discussed below, since these state programs were devised in the 1990s, even explicit federal incorporation of state groundwater standards did not provide significant preventative groundwater regulation until, at least 1990. EPA has confirmed this to be true.
25 5 Am. L. o f Mining Section 169.02[2][c] (2d ed.) 26 NAC 445A.350 et seq. 27 See Idaho Groundwater Plan, Section II-C, Senate Bill 1321 (1992). 28 Wash.Rev.Code 43.21. 29 Safe Drinking Water Act, 42 U.S.C Sections 300 et seq. 30 Resource Conservation and Recovery Act, 42 U.S.C. Sections 6901 et seq. 31 Uranium Mill Tailings Radiation Control Act o f 1978, 42 U.S.C. Section 7901 et seq.
21
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00060
EPA's assessment of groundwater protection at hardrock mine in 1985 was as follows:
Ground-water monitoring is difficult, expensive, and has seldom been conducted at mine sites on a comprehensive basis. Because of complex geologic strata (presence of an ore body) and the extensive size of many mine properties, proper ground-water monitoring is technically difficult and costly. Historical practice in the mining industry has not required such monitoring. As a result, there is very little available information in the literature, and almost none on a complete or comprehensive basis. Most mines have no historical or contemporary ground-water monitoring information.
RTC I, p. 6-7 (emphasis in original). In short, as late as 1985 EPA asserts that groundwater protection at hardrock mine sites was virtually nonexistent. Thus, per EPA's own study of the hardrock mining industry, one cannot rationally gauge the current effectiveness of hardrock mine regulation regarding groundwater protection with reference to sites designed and approved before 1985.
Accordingly, in the 1980s, federal regulation hardrock mining for protection of groundwater was limited, and virtually non-existent. This left the subject of groundwater regulation at hardrock mines to the state governments. The Western States stepped-up to manage this area in the 1990s, generally as part of mining specific statutes or regulations, and eventually tied directly to hardrock mine reclamation programs and financial assurance requirements.
5.4 Hardrock Mine Reclamation, Financial Assurances and Water Quality Protection
In 1974, the Forest Service promulgated regulations governing reclamation and performance bonding of hardrock mines on National Forest System Lands.32 These were some of the first regulations governing Hardrock Mine reclamation promulgated by any agency, federal or state. In 1981, the BLM promulgated the surface management regulations applicable to Mine Plans of Operations ("MPOs") similar in concept to those of the Forest Service. The history of the impact and evolution of these programs is described in greater detail by Northwest Mining Association's "The Evolution of Federal and Nevada State Reclamation Bonding Requirements from Hardrock Exploration and Mining Projects: A Case History Documenting How Federal and State Regulators Used Existing Regulatory Authorities to Respond to Shortcomings in the Reclamation Bonding Program," prepared by Jeffrey V. Parshley and Debra W. Struhsacker, January 2008. That study documents federal and state interagency and industry cooperation by which hardrock mine regulation worked to create the currently effective hardrock mine regulation in Nevada; however, a similar history is reflected in most of the western mining states, as discussed above.
32 36 CFR Part 228 (2016).
22
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00061
However, hardrock mine regulation is certainly not only about the Forest Service and the BLM. The Western States have regulated hardrock mining for decades. For example, both Idaho and Colorado had mined land reclamation programs that dated back to the 1970s. Initially these programs, like those of the Forest Service and the BLM focused on regrading and revegetation of mined lands, and not on surface water quality and certainly not ground water protection. Indeed, initially, the Forest Service deferred protection of surface water to EPA enforcement of the Clean Water Act and EPA oversight of delegated state Clean Water Act programs, which gave rise to two of the most notorious hardrock mine regulatory failures during the Transition Era (1970-1990), specifically Summitville, Colorado and Zortman, Montana. Thus, it became clear to the BLM, the Forest Service and the Western States that closure, reclamation, post-mining land uses and water quality had to be integrally-related and "bonds" posted.
Accordingly, the current reclamation bonding programs are working very well. Not only are Regulated Hardrock Mines (i.e., post-1990) avoiding EPA CERCLA National Priorities List, but even more importantly, existing financial assurances (federal and state) are avoiding public liability, even when defaults have occurred. For example, in the co-authors' home states of Idaho and Nevada, there has never been a Hardrock Mine that was approved and for which financial assurances were posted that defaulted on the financial assurances such that the Mine was not closed and reclaimed in accordance with: (1) the reclamation/closure plan approved by the relevant federal and/or state agencies; and (2) the financial assurances retained by the agencies. This is discussed in greater detail below.
In Idaho, two relatively large hardrock mines in Idaho defaulted on their bonds in the 1990s such that the public agencies had to rely on financial assurance monies to close and reclaim the properties. Even though both mines dated from the Transition Era (i.e., pre1990), in both situations (specifically, Dakota Mines-Stibnite and Black Pine), the bond amounts proved to be adequate. Interestingly, these two mines had been identified by Earthworks' (one of the CERCLA 108(b) plaintiffs) as being insufficiently bonded.33 Earthworks was wrong, by a factor of ten. More specifically, Earthworks' stated that adequate bonding for each of these mines would be about $50,000 per acre; in fact, Dakota Stibnite and Black Pine were closed and reclaimed for $2,710 per acre and $7,383 per acre respectively.34 In short, it is objectively demonstrable that any factual assertions by Earthworks are insufficiently grounded to be given serious consideration in any EPA rulemaking.
Nevada has the nation's largest and arguably the most successful state hardrock mine environmental closure and reclamation program. In part because it started later, Nevada developed water quality protection and land reclamation into an integrated and "bonded" hardrock mine program, essentially from the beginning. Nevada's "Mining Facilities" regulations protecting waters of the state (surface and groundwater) were promulgated in 1989, and then in 1990 the Nevada legislature passed the Nevada Reclamation Act. In
33 Letter, Baird Hanson William LLP to USFS Salmon-Challis Nation Forest, May 24, 2007 34 Thus, Earthworks and their NGO colleagues have been are fully informed o f the adequacy of existing hardrock mine financial assurances for 20 years.
23
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00062
the mid-to-late 1990s, two permitted mines (Goldfields and Mt. Hamilton) defaulted on their ``bonds." which were adequate but not immediately available for necessary water system management. This prompted voluntary efforts on the part of the Nevada mining industry to act to prevent any interim spills and this caused the Nevada Mining Association to seek a change in Nevada law to allow for immediate NDEP access to "fluid management bonding." This problem has never recurred.
Thus, every Idaho and Nevada hardrock mine (including those that have been in default) that was approved and subject to financial assurances has been closed and reclaimed in accordance with: (1) the reclamation/closure plan approved by the relevant federal and/or state agencies; and (2) the financial assurances retained by the federal and/or state agencies.
Once states and/or federal land management agencies (i.e., the Forest Service and the BLM) integrated mine reclamation with surface water and ground water protection, geochemical prediction and financial assurance for such activities and related predictions, the chances of such facilities replicating the problems that arose in the Pre-Regulatory Era (Per-1970) became essentially impossible to duplicate ... and, indeed, such problems have not been recreated to date.
Thus, certain Transition Era (1970 through about 1990) hardrock mines created problems. There is no question there has been a "learning curve." State agencies began to create active groundwater management programs regulating hardrock mines that might impact ground water. And, the Forest Service and the BLM began to work in concert with the relevant states, as all parties sought to incorporate comprehensive surface and groundwater protection into NEPA planning, Mine Plan of Operation approvals and reclamation bonding programs to create regulatory programs that prevented the creation of water pollution in the first place and bonded for such protection from the outset of mining operations. This took time, but it was achieved. And, the most important single element is that since 1990, design, permitting, construction, operation, closure and reclamation of hardrock mines are integrated.
Initially, Western States hardrock mine regulation was limited to regrading and re vegetation, similar to the early Forest Service and BLM programs. Flowever, after water quality impacts were identified famously at hardrock mines at Zortman and Summitville, then the primary federal land management agencies (i.e., the Forest Service and BLM) shifted from reclamation as a merely regrading and revegetation exercise to comprehensive sustainable surface and ground water quality protection.
5.5 The National Environmental Policy Act of 1970
Nominally, the passage of the National Environmental Policy Act of 1969 (NEPA) was potentially applicable to hardrock mines and therefore could have heralded an immediate major shift in hardrock mine regulatory policy. In fact, initially, it did not. NEPA requires a "proposal" of a "major federal action" (including potentially approval of a
Sierra Club v. EPA 18cv3472 NDCA
24
Tier 5
ED 002061 00090629-00063
Mine Plan of Operation) "significantly affecting the environment."35 Thus, NEPA regulation of hardrock mining typically is triggered by the filing of a request for an MPO with the Forest Service, the BLM or the EPA (for an NPDES permit). In fact, in the 1970's and 1980's there was significant state-by-state debate regarding whether the approval of a single hardrock mine constituted a "major" Federal action that was subject to NEPA, but it was not until 1995 that the first hardrock mine Environmental Impact Statement was issued in Nevada. Nevertheless, when it became clear that EPA and state NPDES jurisdiction could not adequately manage surface discharges as stand-alone issues at Zortman and Summitville, the Forest Service and the BLM used their Mine Plan of Operation approval processes to create comprehensive and integrated water qualityprotection for hardrock mines. Clearly, there were regulatory gaps that had to be addressed. This was part of the learning curve that delayed effective hardrock mine regulation until the 1990s. In fact, regarding current hardrock mine regulation, NEPA EIS evaluation of the environmental impacts and mitigation measures has become a major aspect of any hardrock mine approval with a federal nexus.
Nevertheless, prior to 1990, NEPA had little relevance to hardrock mine regulation.
5.6 Evaluation of the Effectiveness of Hardrock Mine Regulation based upon the Timing of Regulatory Developments
The above discussion provides a short jurisdictional history of the regulation of hardrock mining. To briefly summarize, there was literally no regulation and therefore no regulatory consideration of the environmental impacts of hardrock mining prior to 1970, so any site designed and constructed prior to this date provides no information about the effectiveness of hardrock mine regulation. NEPA was signed into law in 1970, but NEPA required other federal authorities and case law to be interpreted before NEPA could be implemented at hardrock mines. Accordingly, it is misleading, disingenuous, and certainly "arbitrary and capricious" to evaluate environmental issues associated with hardrock mines designed and operated prior to 1970 as examples of current hardrock mine regulation.
EPA's hardrock mine NPDES program was not published until 1982, and took years after that to properly implement the program. As discussed above, federal agencies were generally precluded from infringing upon state control of groundwater, and groundwater programs regulating hardrock mines were largely the product of the 1990s. Thus, it was not until the 1990s that federal and state agencies began to comprehensively address the water quality issues associated with hardrock mining.
EPA confirms this state of affairs when it stated in 1985 that:
During active site life, during closure, and in the post-closure period, facilities could employ engineering controls to prevent erosion, to keep leachate out of the ground water, or to remove contaminants introduced into ground water. However, EPA data on management methods at mining
35 American Law o f Mining, Section 167.02.
25
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00064
facilities indicate that only a small percentage of mines currently monitor their ground water, use run-on/runoff controls or liners, or employ leachate collection, detection, and removal systems. EPA has not determined the circumstances under which these waste measures would be appropriate at mine waste and mill tailing disposal sites.
RTC I, p. ES-10. It is only after 1990 that the lessons learned from the 1970 to 1990 Transition Era began to be more fully incorporated in the mine regulatory processes. Thus, it has only been in the last 20 years that hardrock mine permitting has first begun to more fully evaluate, predict and regulate long term water quality impacts.
The bi-partisan Western Governors' Association has characterized the situation as follows:
3. While older mines in western states have sometimes had harmful impacts on adjacent waters, the mining industry has improved its operation and reclamation track record in recent decades, to avoid or minimize such impacts.
4. Recent decades have also brought heightened attention to the importance of mine reclamation from state regulators across the west. All western states that host hardrock mining industries now have staff dedicated to ensuring that on going mine operations develop and follow appropriate reclamation plans.
WGA, Policy Resolution 2011-4 (A)(3) and (4).
All Western states have developed regulatory bonding programs to evaluate and approve the financial assurances required of mining companies. The states have developed the staff and expertise necessary to calculate the appropriate amount of the bonds, based upon the unique circumstances of each mining operation, as well as to make informed predictions of how the real value of current financial assurance may change over the life of mine, even post-closure.
WGA, Policy Resolution 2014-07 ("Bonding for Mine Reclamation"). In fact, the "bottom line" on the adequacy of hardrock mine regulation is fairly simple. Until changing societal cultural norms regarding environmental protection and Hardrock Mine regulation began to be implemented by federal and state regulatory agencies environmental problems arose. Since 1990 after federal and state agencies began paying attention with a degree of technical experience, the EPA has yet to designate even a single Western hardrock mine site to the National Priorities List.
The key to effective hardrock mine regulation is that there is some form of evaluation and planning. Neither the goals, nor the science, are that difficult to implement. It takes planning and application of existing knowledge. Almost all of the hardrock mines giving rise environmental problems on the CERCLA NPL arose when environmental goals and planning were nonexistent in the Pre-Regulatory Era (Pre-1970). And, while a few CERCLA NPL problems arose in the Transition Era (1970 through 1990) when practical experience was wholly-lacking, in the Regulatory Era (Post-1990) there have been no
26
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00065
Western hardrock mine sites that EPA has deemed to be a sufficient problem to require nomination to the National Priorities List.
6.0 Conclusion
The federal and state regulation of hardrock mining and milling facilities is a remarkable success story of changing law and policy environmental protection that is well-illustrated by the vintage of hardrock mines on the United States Environmental Protection Agency ("EPA") National Priorities List of environmental cleanup sites. To briefly summarize, there has never been an environmental problem at a Western hardrock mine that was approved by a federal or state agency in the West after 1990 that has required EPA to make such hardrock mine a Superfund "top priority among known response targets." To reiterate, no hardrock mine permitted in the West after 1990 has ever been placed on EPA's Superfund National Priorities List.
Current hardrock mine regulation on federal lands managed by the United States Forest Service and the Bureau of Land Management has been determined to be "complicated, but generally effective" by the federal government's independent National Academy of Sciences National Research Council in 1999. In 2011, Senator Murkoswki's investigation of the BLM and Forest Service mine regulation experience verified and updated the 1999 NAS/NRC determination. And, the Bi-partisan Western Governors' Association has stated that the Western states, which regulate Hardrock Mining on state and private lands within their borders "... impose permit conditions and stringent design and operating standards, to ensure that hardrock mining operations are conducted in a manner that is protective of human health and the environment" and that Western "... states have developed the staff and expertise necessary to calculate the appropriate amount of the bonds, based upon the unique circumstances of each mining operation, as well as to make informed predictions of how the real value of current financial assurance may change over the life of mine, even post-closure." WGA, Policy Resolution 10-16, Background (A)(8) ("National Minerals Policy"). Moreover, all programs of the federal and state agencies have continued to strengthen their reclamation and bonding programs on an ongoing basis,
the above-described regulatory success story is a direct result of society's change in values both outside of, and within, the hardrock mining industry to seek protection o f the environment, not just to creates jobs, industrial production and tax revenue. Hardrock mines designed and built prior to 1970 were developed to maximize production and minimize cost with little or no regard for environmental values. After 1990, new hardrock mines have been designed, built and operated to integrate long-term environmental closure and reclamation as a primary design standard, as required by current law.
The above-described changes in values, law, design, permitting, operation closure and reclamation have had a major impact on the adequacy of financial assurances posted pursuant to routine individual financial assurances on a mine by mine basis. Using the co-authors' home states as examples, there has never been an Idaho or Nevada hardrock
27
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00066
mine for which financial assurances were posted that defaulted on the bonding such that the hardrock mine was not closed and reclaimed in accordance with: (1) the reclamation/closure plan approved by the relevant federal and/or state agencies; and (2) the financial assurances retained by the agencies. Thus, objectively, the existing regulation of hardrock mines is protecting the environment from releases and protecting public treasuries through posting of adequate financial assurances.
Sierra Club v. EPA 18cv3472 NDCA
28
Tier 5
ED 002061 00090629-00067
BIBLIOGRAPHY
Baird, 2013, "Hardrock Mining Reclamation and Reclamation - Developing Sustainable Environmental Protection through Changing Values, Changing Laws and Experience: A Federal State Success Story," the "NWMA 2013 Study."
Brokaw, Thomas, The Greatest Generation. Random House, New York, 1998.
Carson, Rachel, Silent Spring, Houghton Mifflin, 1962.
EPA, 2013, "Summary - Mining Sites on the National Priorities List," http://www.epa.gov/superfund/sites/npl (March 30, 2013).
EPA, "Report to Congress, Wastes from the Extraction and Beneficiation of Metallic Ores, Phosphate Rock, Asbestos, Overburden from Uranium Mining, and Oil Shale," (Dec. 31, 1985), "RTC I"; see also, 50 Fed. Reg. 40,292 (Oct. 2, 1985).
EPA, National Priorities List, April 21, 2015.
EPA, "Report to Congress on Special Wastes from Mineral Processing" (July 1990 Fed. Reg. 32,135); see also (Aug. 7, 1990).
EPA, "EPA's Mining Site List," May 2013, www.epa.gov/aml.
DeLong, Richard, May 15, 2015, "Assessment of Mining and Milling Sites on the National Priorities List," Memorandum from Enviroscientists to Baird Hanson LLP.
Forest Service, 2004, "Training Guide for Reclamation Bond Estimation and Administration --For Mineral Plans of Operation authorized and administered under 36 CFR 228A."
Greenow, Linda, 2004, "When Growth was Good: Images of Prosperity in MidTwentieth Century America," Middle States Geographer, 2004, 37: pp. 53-61, p. 53.
Maest, Kuipers, J.R., Travers. C.L. and Atkins, D.A., 2006, "Predicting Water Quality at Hardrock Mines: Methods and Models, Uncertainties, and State-of-the Art," Earthworks
Mamula and Michaels, 2016, "A Green Mess: Is EPA in Hot Water over Alaska's Bristol Bay?" http://www.cato.org/publications/commentary/green-mess-epa-hot-water.
Murkowski, March 8, 2011, Letter to Forest Service and BLM, regarding Mine Plans of Operation.
Sierra Club v. EPA 18cv3472 NDCA
29
Tier 5
ED 002061 00090629-00068
"Mercury - Sources and Receptors of Mercury in Idaho," January 28, 2009, (the "Idaho Mercury Report"), Idaho Association of Commerce and Industry and the Idaho Council for Industry and the Environment Report.
Nader, Ralph, 1965, Unsafe at any speed: The Designed in Dangers of the American Automobile, Grossman Publishers, 1965.
National Academy of Sciences/National Research Council ("NAS/NRC"), 1999, "Hardrock Mining on the Federal Lands," The National Academies Press,
https://doi.Org/10.l 7226/9682.
Parshley and Struhsacker, 2008, "The Evolution of Federal and Nevada State Reclamation Bonding Requirements from Hardrock Exploration and Mining Projects: A Case History Documenting How Federal and State Regulators Used Existing Regulatory Authorities to Respond to Shortcomings in the Reclamation Bonding Program."
Rocky Mountain Mineral Law Foundation, 5 American Law of Mining (2d ed.), 2013.
Schlumberger Water Services, 2013, "Technical Review of the Kuipers Maest, 2006, `Comparison of predicted and actual water quality at hardrock mines: The reliability of predictions in Environmental Impact Statements,"' prepared for the Northwest Mining Association and submitted into EPA administrative record for Pebble Project on June 30, 2013.
Wang, Robert, 2014, "Iconic Hoover Smoke Stack to be Restacked," The Canton Repository, December 4, 2014.
Western Governors Association, Policy Resolution 2011-4 ("Bonding for Mine Reclamation").
Western Governors Association WGA, Policy Resolution 2014-07 ("Bonding for Mine Reclamation").
Western Governors Association, Policy Resolution 2010-16, Background (A)(8) ("National Minerals Policy").
Sierra Club v. EPA 18cv3472 NDCA
30
Tier 5
ED 002061 00090629-00069
1 w 6 j O M e a d o w o o d i a n e
U e n o , |\Jevada 8j>j0 2 (77 j) 8 1 6 -8 8 1 1 fax: (7 7 ^) 816-88 j 7 ww w .envirom cu5.com
Office L o c a tio n s :
R eno, N evada L I O N evada
MEMORANDUM
TO:
Mr. Joe Baird - Baird Hanson LLP
FROM:
Mr. Richard DeLong K
DATE:
May 15,2015
SUBJECT: Assessment of Mining and Milling Site on the National Priorities List
At your request, Enviroscientists, Inc. (Enviroscientists) completed an assessment of the United States Environmental Protection Agency's (EPA's) National Priorities List (NPL) for Mining and Milling Sites (MMS). A search of the NPL was completed on April 21, 2015. See Attachment A for a printout of the list. In addition, a compact disk (CD) with the searchable excel version of the printout is included with is memorandum.
There are over 1,100 sites on the NPL. Of those, there are 100 that the EPA has classified as MMS. However, only 55 of those sites are actual mining operations where mineral resources were extracted from the earth. The other 45 are mineral processing facilities where a mineral product is delivered to the operation for further processing. The 55 "Hardrock Rock" MMS on the NPL fall into the following temporal classifications: 49 are prior to 1970; five are from 1970 through 1990; and one is post-1990. The one operation that was permitted and began operations post-1990 is the Barite Hill property in South Carolina. The operation was an open pit heap leach mine that ceased operation in 1995 and reclamation was completed in 1995 to 1999.
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00070
ATTACHMENT A
MAY 2013 VERSION OF THE MINING AND MILLING SITES ON THE NATIONAL PRIORITY LIST
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00071
The EPA AVIL program defines AMLs as:
Summary - Mining and MillingTabSleit1es on the National Priorities L Source: EPA AML - Status = "Final" as of May 2013 Update (list check April 21,2
"Those lands, waters, and surrounding watersheds contaminated or scarred by extraction, beneficiation or processing o f ores and minerals, including phosphate but not coal*. Abandoned mine lands include areas where mining or processing activity is tem porarily inactive."
Site Name
EPA Region
State
Year Start
Year End
Year End
Design/Ap provai 1917-0p-r1e9a18n9d97l0ater 3 -129
Mining/Milling or ther Processing
Type of Activity
Minerals
NPL Status
Site/CERCLISID Number
-1
1 ME
1880's
1972
1972
1
M
Minlng/milling (Open pit mine)
Zinc/copper
Final
MED980524128
ELIZABETH MINE ELY COPPER MINE
l VT
early 1800s
1958
1 VT
1821
1920
1958
1
M/O
1920
1
M/O
Minina: copper smeltina
Copper
Mining/cobbing/roasting/smelting; (removal
of ore)
Copper
Final
VTD988366621
Final
VTD988366571
PIKE HILL COPPER MINE F 1! TIJNGSTFN OORP
1 Vi
1847
1919
1919
1
M
Mining
Copoer
Final
VTD988366720
Processing (Received tungsten ore's for
2 NY
1940's
1984
1984
1
O
nroeessinn)
Tunosten
Final
NYD986882660
MAYWOOD CHFMICA! CO 7 SHI FI DAI IO Y O O R P
? N.l
1916
1955
1955
1
O
Processinn (radioactive thorium ore) Thorium
Final
NJD980529767
Processing (discharge to uniined pits
2 NJ
1955
2006
2006
1
O
orior to 1970 enforcment actions).
Chromium allov
Final
N.ID002365930
ft U.S. RADIUM CORP
2 NJ
1915
1926
1926
1
0
NJD980654172
W.R. GRACE S CO.. INC./WAYNE INTERIM STORAGE SITE (USDO
2 NJ
1948
1971
1971
1
O
Monazite ore
NJ1891837980
Processing/Manufacture of metal 10 FOOTE MINERAL CO_____________________________________________ _________ 1 ________ ________ M 2 . ______________m l ______________1221. _________1_________ _________________ products________________________________ Lithium_________________ final_________ PAD077Q87989_____
Sierra Club v. EPA 18cv3472 NDCA
Page 1 of 10
Tier 5
ED 002061 00090629-00072
The EPA AVIL program defines AMLs as:
Summary - Mining and MillingTabSleit1es on the National Priorities L Source: EPA AML - Status = "Final" as of May 2013 Update (list check April 21,2
"Those lands, waters, and surrounding watersheds contaminated or scarred by extraction, beneficiation or processing o f ores and minerals, including phosphate but not coal*. Abandoned mine lands include areas where mining or processing activity is tem porarily inactive."
Site Name FRANKLIN SI AG Pll F: (MDC)
EPA Region
State
Year Start
Year End
Year End
Design/Ap provai 1917-0p-r1e9a18n9d97l0ater 3 -129
Mining/Milling or ther Processing
Type of Activity
M ine rals
MDC Industries sold the processing slag
as sand blasting grit for 40 years. MDL
Abandoned site 12/30/1999. Franklin
Smelting and Refining Co smelting the ore.
3 PA
1950's
1999
1999
1
o
(lead contamination)
Coooer
NPL Status
Site/CERCLISID Number
Final
PASFND3D5549
p JACKS ORFFK/SITKIN SMFI TING R RFFINING IN
Sm eltingprocessing and precious metals
3 PA
195ft
1977
1977
1
o
reclamation
Precious metals
Final
PAD98D879493
13 PA! MFRTON 7INO PI! F
3 PA
-1912
19ft2
1982
1
o
Sm eltinnnrooessinn /NJ 7ino Co )
7inc
Final
PAn007395ft87
U.S. TITANIUM
3 VA
1931
1971
1971
1
0
Refining p rocessin g titanium ore/Titanium
dioxide manufacturing
Titanium
Final
VAD980705404
B A fiiI ;.h iL L L ^ V A D A .S .Q m Q E LD S
4 SC
1S91
1S95
1995
3
V!
Mining (gold plant, heap leach)
Gold, Silver
Final
SCN000407714
I6 BREWER GOLDMINE
4 SC
1828
1995
1995
1,2
M
Minina - CN heao leach pad 1987 -1995. Gold
Final
SCD987577913
MAOAI I OY CORPORATION
4 SC
1941
1998
1998
1
O
Ferrochromium alloy processing plant Ferrochromium
Final
SCD003360476
18 NATIONAl SOUTHWIRF ALUMINUM CO
4 KY
19 ORF KNOR MINF
4 NC
on STAUFFER CHEMICAL CO. (TARPON SPRINGS)_________________
4 FL
1969 active
active
1
O
1850s
1962
1962
1M
1950
1981
1981
1
O
Aluminum processing (north pond)
Aluminum
Final
KYD049062375
Mining, roasting, smelting
Copoer
Processed elemental phosphorous from
phosphate ore.
Phosphate
Final
NCN0004Q9895
Final
FLD010596013
Sierra Club v. EPA 18cv3472 NDCA
Page 2 of 10
Tier 5
ED 002061 00090629-00073
The EPA AVIL program defines AMLs as:
Summary - Mining and MillingTabSleit1es on the National Priorities L Source: EPA AML - Status = "Final" as of May 2013 Update (list check April 21,2
"Those lands, waters, and surrounding watersheds contaminated or scarred by extraction, beneficiation or processing o f ores and minerals, including phosphate but not coal*. Abandoned mine lands include areas where mining or processing activity is tem porarily inactive."
Site Name
EPA Region
State
Year Start
Year End
Year End
Design/Ap provai 1917-0p-r1e9a18n9d97l0ater 3 -129
Mining/Milling or ther Processing
Type of Activity
M ine rals
NPL Status
Site/CERCLISID Number
ASAROO TAYI OR SPRING?
5 II
DFPUF/NFW JFRSFY 7INO/MORI! OHFMIOA! CORF
5 IL
EAGLE ZNC CO D!V T L DIAMOND
5 IL
24
5 IL
MATTHIESSEN AND HEGELER ZINC COMPAN'
5 IL
ORMFT CORP
5 OH
27 TORCH IAKF
5 MI
U S SMFI.TFR AND I.FAD R FFINFRY INC CHEVRON QUESTA MINE MOL.YCORP1 & l CIMARRON MINING CORP.
5 IN NM NM
4 HOMESTAKE MINING CO.________________________________________
6 NM
Sierra Club v. EPA 18cv3472 NDCA
1911 active
active
1
o
1903
1990
1990
1
o
1923
2003
2003
1
0
1906
1954
1954
1
0
1858
1978
1978
1
0
1956
2005
2005
1
o
1890
1969
1969
1
M
1920
1985
1985
1
o
Active
(underground
biockcave 1983 to
1920 present)
active
1,2
M/O
1960
1982
1982
1,2
O
1958
1990
1990
1
O
Page 3 of 10
Tier 5
7inc sm eltinn/Pronessinnzinc oxide
7inc
Zinc smelting/Processing/Phosphate
fertilizer
7inn
Final
Il N000508170
Final
I! D062340641
Processina/zinc smeltina
Zinc/Cadmium
Final
ILD980606941
Zinc smelter/Processina
Zinc
Zinc Smelter (smelter dosed
Aluminum reduction (unlined pits closed
1981VProcessina
Aluminum
Mining (copper mines dumped tailings into
lake).
Copper
Final
ILN000508134
IL0000064782
Final
OHD004379970
Final
MID98Q901946
%SmeltenP rocessinn
I earl
Final
ND047030776
Minins/Millins Milling
Molybdenum
Final
Iron; Precious metals
Final
NMD002899094 NMD98749378
Milling
Uranium
Final
NMD007860935
ED 002061 00090629-00074
The EPA AVIL program defines AMLs as:
Summary - Mining and MillingTabSleit1es on the National Priorities L Source: EPA AML - Status = "Final" as of May 2013 Update (list check April 21,2
"Those lands, waters, and surrounding watersheds contaminated or scarred by extraction, beneficiation or processing o f ores and minerals, including phosphate but not coal*. Abandoned mine lands include areas where mining or processing activity is tem porarily inactive."
Site Name
EPA Region
State
Year Start
Year End
Year End
Design/Ap provai 1917-0p-r1e9a18n9d97l0ater 3 -129
Mining/Milling or ther Processing
Type of Activity
Minerals
NPL Status
Site/CERCLISID Number
TAR CREEK fOTTAWA COUNTY)
6 OK
33 IEX_lbLC_QRE TULSA FUEL AND MANUFACTURING UNITED NUCLEAR CORP.
36 ANNAPOLIS I FAD MINE
6 TX 6 OK 6 NM
MO
BIG RIVER MINE TAILINGS/ST. JOE MINERALS CORP. OHFROKFF COUNTY
MADISON COUNTY MINF5
7 MO 7 KS 7 MO
40 NEWTON COUNTY MINE TAILINGS
MO
OMAHA LEAD___________________________________________________
7 NE
Sierra Club v. EPA 18cv3472 NDCA
1850 1970s
1970
1
M
1941
1989
1989
1
O
1914
1925
1925
1
0
1967
1986
1986
1.2
M/O
1S20
1540
1940
1
M
1700's
1972
-1870
1970
1700's 1970s
1972
1
O
1970
1
M
1970
1
M
-1850s
1950
1950
1
M
1870s
1996
1996
1
O
Page 4 of 10
Tier 5
Mining district
Iron, Zinc
Final
OKD980629844
Sm elter/Processinq
Tin. Copper
Final
TXD062113329
OKD987096195
NMD030443303
Mining
Lead
Final
M00000958611
Tailings disposal for lead mining
Lead
Mininn (a/k/a Tri-State mininn district)
Lead, zinc
Mininn (mininn district)
! ead
Final
MODS8112689S
Final
KSD980741862
Final
MOD098633415
Mining (Tri-State Mining Districtl
Lead, cadmium, zinc
Final
MODS81507585
SmeltinaProcessina
Lead
Final
NESFN0703481
ED 002061 00090629-00075
The EPA AVIL program defines AMLs as:
Summary - Mining and MillingTabSleit1es on the National Priorities L Source: EPA AML - Status = "Final" as of May 2013 Update (list check April 21,2
"Those lands, waters, and surrounding watersheds contaminated or scarred by extraction, beneficiation or processing o f ores and minerals, including phosphate but not coal*. Abandoned mine lands include areas where mining or processing activity is tem porarily inactive."
Site Name
EPA Region
State
Year Start
Year End
Year End
Design/Ap provai 1917-0p-r1e9a18n9d97l0ater 3 -129
Mining/Milling or ther Processing
Type of Activity
Minerals
NPL Status
Site/CERCLISID Number
42 ORONOGO-DUENWEG MINING BELT
7 MO
1848 late 1960s
1967
1
M
43
MO
early 1800s
1975
1
M/O
y^ShiiM G IQ ^.C .Q l^IJ!i'..L& D .D JSI.B JC I..-.R JfiN A C .C iSEEK
7 MO
1799 1980s (historic)
1980
1
M/O
46
MO
1700s
1980
1
M/O
46 WASHINGTON COUNTY LEAD DISTRICT - POTOS 42 WASHINGTON COUNTY I FAD DISTRICT - RICHWOODS
ACM SMFI.TFR AND RFFINFR'i
7 MO MO
fi MT
1700s
1980
1
M/O
1700s
1980
1
M/O
1fi9?
197?
197?
1
O
4d ANACQUQQ^5M ELLEB
8 MT
5 BARKER HUGHESVILLE MINING DISTRICT
8 MT
44 f i m m u s _______________________________________________
8 MT
late 1800s
1980
1879 1970s
late 1800s 1960s
1980
1
O
1970
1
M
1960
1
M
Sierra Club v. EPA 18cv3472 NDCA
Page 5 of 10
Tier 5
Mining (Tri-State Mining District)
Lead, cadmium, zinc
Final
MOD980686281
Historic mining district, smelting Mining, milling, smelting
Lead, zinc, barium
Final
MON000705443
Lead, barite (barite 1926 -
1980s)
Final
MON000705842
Mining, milling, smelting
MON000705027
Mining, milling, smelting Mining, milling, smelting s S m e ltin n retminruProcessinn
Conner ?inn
MON00705023
MON000705032
Final
M T r)093?91599
Smeltinq/Processinq
Copper
Mining (only brief activity in l40s, 1920s,
and 1960s)
Silver, lead
Final
MTD093291656
Final
MT6122307485
Mining (intermitent into 1960s)
Precious metals
Final
MTD982572562
ED 002061 00090629-00076
The EPA AVIL program defines AMLs as:
Summary - Mining and MillingTabSleit1es on the National Priorities L Source: EPA AML - Status = "Final" as of May 2013 Update (list check April 21,2
"Those lands, waters, and surrounding watersheds contaminated or scarred by extraction, beneficiation or processing o f ores and minerals, including phosphate but not coal*. Abandoned mine lands include areas where mining or processing activity is tem porarily inactive."
Site Name
EPA Region
State
Year Start
Year End
Year End
Design/Ap provai 1917-0p-r1e9a18n9d97l0ater 3 -129
Mining/Milling or ther Processing
Type of Activity
Minerals
NPL Status
Site/CERCLISID Number
52 CALIFORNIA GULCH S3 CAPTAIN JACK MILL S4 CARPENTER SNOW CREEK MINING DISTRICT 55 .C.ERT.RAi..CiIX..C.LEAR.CREE^
DAVENPORT AND FLAGSTAFF SMELTER. DFNVFR RADIUM SITE
8 CO
1895 (YakTunnei Early 1980s
8 CO
I860
1992
8 MT
1880s
1531
8 CO
1880s active (limited)
8 UT
1870
1875
8 CO
1916 1920s
56 EAGLE MINE i FAST HFI ENA SIT S EUREKA MILLS
8 CO
1880s
1984
8 MT
1888
2001
8 UT
1870
1558
61 FLAT CREEK IMM________________________________________________
8 MT
1909
1953
1980
1
M
1992
1
M
1931
1
M
2011
1
M
1875
1
O
1920
1
O
1984
1
M
2001
1
O
1958
1
M/O
1953
1
M/O
Mining, processing, smelting
Go!d, silver, lead, zinc Final
COD980717938
Gold, silver
Mining (last mine closed 1931 with intermlttant mining after that)
Silver, lead, zinc
Mining District, any current operations small)
(Includes Argo Tunnel draining 30+ Inactive
mines)
Go!d
Final
CODS81551427
Final
MT0001096353
Final
COD980717557
Processino (35 sites of Ra disposali
Radium
UTD988075719
Final
CO D980716955
Mining Sm eltertProoessina Mining and Milling Mining and Milling
Go!d, sliver
Final
COD081961518
Lead, zinc
Final
Gold, sliver, lead, copper,
arsenic
Final
MTD006230346 UT0002240158
Silver, gold, copper, zinc,
iron
Final
MT0012694970
Sierra Club v. EPA 18cv3472 NDCA
Page 6 of 10
Tier 5
ED 002061 00090629-00077
The EPA AVIL program defines AMLs as:
Summary - Mining and MillingTabSleit1es on the National Priorities L Source: EPA AML - Status = "Final" as of May 2013 Update (list check April 21,2
"Those lands, waters, and surrounding watersheds contaminated or scarred by extraction, beneficiation or processing o f ores and minerals, including phosphate but not coal*. Abandoned mine lands include areas where mining or processing activity is tem porarily inactive."
Site Name
EPA Region
State
Year Start
Year End
Year End
Design/Ap provai 1917-0p-r1e9a18n9d97l0ater 3 -129
Mining/Milling or ther Processing
Type of Activity
Minerals
NPL Status
Site/CERCLISID Number
62 GILT EDGE MINE
63 IN IE B fci Il N L S M E L X lfclfiA im fiE O ^ 64 J CQ BM ELIEB 66 L lfiB A 3aE 5IQ 3_3lJE
66 LINCOLN PARK (Cotter Mill. Canyon City. Colorado! 67 MIDVALE SL.AG 68 Ml LITOW N RESERVOIR SEDIMENTS/Clark Fork 69 MONTICELLO MILL TAILINGS IUSDOE1
70
8 SD
1876
1998
1998
1,2
M
8 UT
1910
1972
1972
1,2
O
8 UT
1870s
1970
1920 - start of
8 MT
large scale minin;
1990
1970
1
O
1990
1
M
8 CO
1958
1979
1
O
8 UT
1871
1971
1971
1
O
8 MT
1870s
1980
1980
1,2
M
8 UT
1942
I960
I960
1
M
8 MT
late 1950s
1973
1973
1
O
Mining (1986 DENR permit for open pit with
CN heap leach operations).
Gold, cooper, tungsten Final
SDD987673985
Sm elter/Processinq
Copper, lead, zinc
Deleted (10/11/2011 UTD093120921
Smeifing/Processins
Silver
Final
UT0002391472
Mining
Vermicute
Final
MT0009083840
Milling
Uranium, vanGadium
Final
CD042167858
Smeltinq/MillinqProcessinq
Lead,copper
Mining and Smelter (possible source of As also
could be landfill as source) (120 miles of
sediments above reservoir)
Copper
Final
UTD081834277
Final
MTD980717565
Milling Processing
Vanadium, uranium
Final
U38S0090035
Chromium
Final
MTD021997689
Sierra Club v. EPA 18cv3472 NDCA
Page 7 of 10
Tier 5
ED 002061 00090629-00078
The EPA AVIL program defines AMLs as:
Summary - Mining and MillingTabSleit1es on the National Priorities L Source: EPA AML - Status = "Final" as of May 2013 Update (list check April 21,2
"Those lands, waters, and surrounding watersheds contaminated or scarred by extraction, beneficiation or processing o f ores and minerals, including phosphate but not coal*. Abandoned mine lands include areas where mining or processing activity is tem porarily inactive."
Site Name
EPA Region
State
Year Start
Year End
Year End
Design/Approva! 1917-0p-r1e9a18n9d97l0ater 3 -129
Mining/Milling or ther Processing
Type of Activity
Minerals
NPL Status
Site/CERCLISID Number
71 NELSON TUNNEL/OOMMODORE WASTE ROCK
79 SlE B _aiiE E E K B U IIE A S E A 73 S W D & R Jm E
S U U M lIiilLL EM N E
U.S. MAGNESIUM 76 IJPPFR TFNMII F CREEK MINING AREA
URAVAN URANIUM PROJECT (UNION CARBIDE CORP.) 78 VASGUEZ BOULEVARD AND I-70
79
1985 (historic hard
8 CO
188S rock mine)
1985
1,2
M
Mining
Silver, lead, zinc
Final
CON000802630
Mining, milling and smelting (contamination
of 24 stream miles by industrial, ag, and
8 MT
'-1870s
1963
1963
1
M
municipal)
Copper
Final
MTD980502777
8 CO
1874
1974
1974
1
M
Mining
Silver
Final
C00002378230
8 CO
1870
1992
1992
1,2
M
Mining (1984 -CN Heap Leach)
Gold, silver
Final
COD983778432
8 UT
1972 Active
2013
1,2
O
Processing
Magnesium (from brine) Final
UTN000802704
8 MT
1870 1930s
1930
1
M
Mining Gistrict
Gold, lead, zinc, copper Final
MTSFN7578012
8 CO
1912
1984
1984
1,2
O
Processing
Radium, uranium,
vandaium
Final
COD007063274
8 CO
1870s 1950s
1950
1
0
Smelting (smelting center for Rocky Mountain west)/ Processing
Gold, silver, copper,
lead, zinc
Final
C00002259588
S CA
1963
1979
1979
1
M/O
Minins/Mill
Asbestos
Final
CAD980496863
Sierra Club v. EPA 18cv3472 NDCA
Page 8 of 10
Tier 5
ED 002061 00090629-00079
The EPA AVIL program defines AMLs as:
Summary - Mining and MillingTabSleit1es on the National Priorities L Source: EPA AML - Status = "Final" as of May 2013 Update (list check April 21,2
"Those lands, waters, and surrounding watersheds contaminated or scarred by extraction, beneficiation or processing o f ores and minerals, including phosphate but not coal*. Abandoned mine lands include areas where mining or processing activity is tem porarily inactive."
Site Name
EPA Region
State
Year Start
Year End
Year End
Design/Ap provai 1917-0p-r1e9a18n9d97l0ater 3 -129
Mining/Milling or ther Processing
Type of Activity
Minerals
NPL Status
Site/CERCLISID Number
&l CAR.SON R!VFR MERCURY SITE IRON KING MINE - HUMBOLDT SMELTER
'1950s (sporadic
small mining after
9 NV
late 1800s this)
1969 (mining,
AZ
late 1800s, 1906 1960s (smelter)
1950
1
0
1969
1
M/O
Millingjmultiple mills (75) along Carson River;
used Hg amalgam reactions)
Gold, Silver
Final
Mi ni ng, smeIter/Processing
Lead, gold, silver, zinc,
copper
Final
WD9 80813646 AZ0000309013
8? IRON MOUNTAIN MINE 9% KLAL!/.B U iiN A .V lS IA M i^i E
9 CA
1860s
1963
1963
1
M
9 CA
1868
1970
1970
1
M/O
Mining, milling
Silver, gold, cooer, zinc, iron Final
Mercury'
Final
CAD980498612 CA114119G578
84 JAVA.CAP.MNE
CA
1861
1943
1943
1
M
Mining (historical CN plant)
Gold, silver
Final
CAD983618893
88 LB flA IH A U M iN E as SULPHUR RANK MFROURY MINF
9 CA
1860s
1962
1962
1
M
Mining
9 CA
1865
1957
1957
1
M
Mining
Sulfur
Final
CAD98G673685
Sulfur, mercury
Final
CAD980893275
87 RLACK BUTTF MINF
10 OR
1890 1960s
1960
1
M
Mining
Mercury
Final
OR0000515759
88 RUNKFR Hil l MINING & MFTAI I URGIOAI OOMPI FX
10 ID
89 COMMENCEMENT BAY. NEAR SHORE,TIDE FLATS______________
10 WA
1880s
1981
1985 (smelter 1890s closed)
1981
1
M/O
1985
1
0
Mining, milling, smeltingprocessing
Lead, zinc
Smelter (also pulp mill, and chemical industries)/ Processing
Lead,copper
Final
IDD048340921
Final
WAD980726368
Sierra Club v. EPA 18cv3472 NDCA
Page 9 of 10
Tier 5
ED 002061 00090629-00080
The EPA AVIL program defines AMLs as:
Summary - Mining and MillingTabSleit1es on the National Priorities L Source: EPA AML - Status = "Final" as of May 2013 Update (list check April 21,2
"Those lands, waters, and surrounding watersheds contaminated or scarred by extraction, beneficiation or processing o f ores and minerals, including phosphate but not coal*. Abandoned mine lands include areas where mining or processing activity is tem porarily inactive."
Site Name
EPA Region
State
Year Start
Year End
Year End
Design/Ap provai 1917-0p-r1e9a18n9d97l0ater 3 -129
Mining/Milling or ther Processing
Type of Activity
Minerals
NPL Status
Site/CERCLISID Number
90 EASTERN MICHAUD FLATS CONTAMINATION
10 ID
91 E Q B M Q 3A M N E
10 OR
F.REM -Q-N-T-NATJ-0-N A L-F-O -RE-S-TA M iLT-E-K IM G -A N D -LU -C-K Y -LA S-S 92
10 OR
KAISER ALUMINUM iMEEAD WORKS d MiDNiTE MINE
10 WA 10 WA
MONSANTO CHEMICAL CO. (SODA SPRINGS PLANT
10 in
96 REYNOLDS METALS COMPANY (U SALT CHUCK MINE
10 OR 10 AK
96 TELEDYNE WAH CHANG
99 fiU iE iD fiE idlblE
100 NEW IDRIA MERCURY MINE
10 OR 0 CA s CA
1944 Active
2013
1
O
1S10
1537
1993
1
V!
1955 mid-1960's
1942
1555
1581
1957 Active
1960
1
M
2013
1
O
1981
1
V!
7013
1
O
1941
2000
2000
1
0
1915
1541
1941
1
M/O
1957 Active as of 2010 1904 1854 1970s
2013
1
O
1930
1
M
1970
1
M/O
Processing
Phosphate
Final
IDD984666610
Mining
Copper, zinc, thorium
Final
ORNG010G2616
Mining
Uranium
Processing (Aluminum Reduction) (1942 -
Final
OR7122307658
WAD000065508
Mining
Uranium
Final
WAD980978753
Processino Processing (Primary Aluminum Reduction Plant)
Phosnhate Aluminum
Final
m no8i83n994
Final
ORD009412677
M in in g /M illin g
Gold, silver, copper
Final
AK0001897602
Processing Mininq Mininq/Processinq
Zirconium, rare earths Final
Copper/Zinc
Final
Mercury
Final
ORD050955848 CAN000S06063 CA0001900463
Sierra Club v. EPA 18cv3472 NDCA
Page 10 of 10
Tier 5
ED 002061 00090629-00081
Technical Review of Kuipers Maest, 2006,"Comparison of predicted and actual water quality at hardrock mines: The reliability of predictions in Environmental Impact
Statements"
June 28, 2013
Prepared for:
Northwest Mining Association.
Prepared by: Schlumberger Water Services 1875 DLaewnvreenr,cCeOSt8. 0S2u0i2te 500
For submittal to: "An Assessment hotftpP:/o/wtewntwiEa2lP.MeApinDai.noqgcokvIem/bt pr-iasEctotPslbAoa-ny9/1Sc0ua-rlRrme-on1nt2--pE0u0cbo4lisBcy-asi-ntcevomlvseomfeBnrtistol Bay, Alaska"
Sierra Club v. EPA 18cv3472 NDCA
Schlumberger Water S&n'ices Tier 5
ED 002061 00090629-00082
CONTENTS
Page
1 EXECUTIVE SUMMARY
1
2 REGULATORY FRAMEWORK
3
3 TECHNICAL FRAMEWORK
6
3.1 Background
6
333...234 GKHueyidoprceohrgseemMoilcaoaeglsicttemRsteoinpdgoerlaitnnagdndmEoIdSesling
877
4 REVEAPLOURATTION OF THE SUMMARY STATISTICS CITED IN THE KUIPERS MAE1S0T
4.1 Criteria used to select the case study mines
10
44..23 DDaetfainiutisoends
1110
4.4 Evaluation of summary statistics
12
4.4.1 Case study Mines
12
4.4.2 Surface and groundwater exceedences
13
44..54.3 CSuomntmamarinyant leaching potential
1145
5 REVIEW OF CASE STUDY MINES IN THE KUIPERS MAEST REPORT
17
5.1 Background
17
5.2 Golden Sunlight
17
555...232..12 SREuxucmbeymeHdaierllynces
111997
5.3.1 Exceedences
19
5.3.2 Summary
20
5.4 Round Mountain
20
555...454..12 SFEluxacmmembeedaaeryunces
222110
5.5.1 Exceedences
21
5.5.2 Summary
22
Sierra Club v. EPA 18cv3472 NDCA
Schiumb&rg&r Water Services Tier 5
ED 002061 00090629-00083
Contents
6 CONCLUSIONS
23
REFERENCES
25
TABLES Table 2.1 TTaabbllee 44..12
NEPA and Major Regulatory Milestones
4
VSuiomlamtioanrys/oaflleingfeodrmvaiotiloantiopnrsesaetnctaesdeinstTuadbylem4in.1esof the Kuipers Maest Report 1124
APPENDICES Appendix A Review of Golden Sunlight and Flambeau Mines
Sierra Club v. EPA 18cv3472 NDCA
Schiumberger Water Services Tier 5
ED 002061 00090629-00084
1 EXECUTIVE SUMMARY
tTaoDhshfeesecpererespemspudmobripcreetotrinoseten7n,stoiotf2lfien0ttdhh0Eei6s"nCvad(otidohrmoecepunqammu"rKaeiescunnoyitptnaeiolsorfsIftmopPMprraeeaasddcesiictsecttstiSoesRtndastethaepenmmodraaet"cAdn)c.ectsutT"urdahabucelryyiWnKAogaufntisnepNtreaaSrQttsei.oumnMaMaeliaalntyeetsEssatnttavnaRHirdneaodprnrdeomJrrvoaeticemnpkwteauMslrcpoiPnoRnero.ctsslliucK-ystuoiiotpAhnpeecsrrtsorme,v(lNiaideaEdetbePialaAiitinny,) oepnfrogecifnefeescesterivisnegamtaimntidginaerteiosgniuteltaost.ihoanTrhdreerloaactuektdhmotroisnewnsao"tt.eeritqwuaalsityulptirmeadticetliyon"i,nttheendreedcotognaitdiovnanocferitshke, parnadcttihcee oapf psclicieanticoen, The review consists of a dual effort. One effort looked at the Kuipers Maest Report to determine whether ttTacrhoeochegtmeauuclaplloooalawnttrhocecerotldyhurnesaadeingoifrtdfnaeioosianrnsdtcssaetilreoretanhottotsekiufetihidcpdneapddtobeeesrepsvttyeeueoodndlofndyppbdemyrnmettehipilnnyneafetorvasrtKehm.tiruaoiafitnpytTiieostohrhnsfecetochMmmhoeinapseEtetlateoIhsSitrnoteyedslRydotouelafodipnbgioresyetrshetgaenucfntoilrtadfeerrtodpodimomrabyrtptyat.hoatehcrnIttiedatreinesrdtspeicpomiininoreptfrnsotoa.utrrnimftpdiacpanaottidlrosftenoovoreffosoltnocrhpieeitnmhnfceoteoirfninmchtciaslruitestiosovirnitoeyhnweosonns.f The review of the Kuipers Maest Report finds that:
Tpehremcitotendc,luosriotnos acnoyntfauitnuered minintehse. reMpoodrteranr-edanyotchrealreavcatenrtiztoatioannyacnudrraennat lymsiinsetsecthhantiqaurees bheainvge dchraawngaendyscoomrapdairciasollyn ftroommovdireturna-ldlyayalcl oonfdthitieonsstu. dies cited by the report that it is meaningless to
The conclusions regarding water quality exceedences cannot be validated. There are virtually no dsauarentaooufptnerednsinfeognrteeinndtvetirhrnoaantlmsauennpdtptoarinrgtdgtehreercmecpootnnoictrolsur.siniognsp.oinWtshreartehedratthaanarfeoracvoamilapblilaen, ctehepociintetsd tehxacteaeffdeecntcthees
Trpeehgreumldaitatteitoadnssd.eutrTinuhgseetdhsetiuntdratyhnesailtrsieoopnoipnrtecrliuniodcdleusfdroeams hpuirnset-poreorigncuadllearstaeitndecsae,cwtoivhfiitcymhtionwemerosediteedrsenvterhelaogptuelwadteiorpenri.osrtutodiemdodaenrdn tTsethucehdineriedcap, olplyretrsmdurpiattpweodsr,tacoboplneecraolutresvidoa,nliadsn.dbTarheseegdruelauitsepdoannusuteinncdghenmri-coraedlperwrenso-edrknatyathtmiaotenthisoofdomsld.i,neansditesmwayhicnho hlaovnegebreebne tThheewcaaysethsattuddaietas aerxeaminitneerpdrebtyedtheancdurinretnhterwevaiyewcoinncdliucasitoentshaatrethderarwepno. rt has serious problems in
Schiumb&rg&r Water Services 1
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00085
Executive Summary
TTCprhhooerncorseeuesgqsihsueoesnunottlimyna,vtutomeclhmvuecpodhtf,ttohofoetruhrneetdphdeoearrstt,atsatihntineedt-esctrphipteeerecdcitfadoictaniotcanneapaatrtnuuedraedlriesmacsonuuddslteisnel,gldatychoooeuunttcholyufodscfrioootgnnhesteeoaxlotrmegaiinmcndaeislmleasoanitsddetilsnyggei.ndoicsishcouelasmstiieocdna..l
twiTmwmhhhieetpehetoharterouirmtidteanhopenotlotohrarspgettriytaeohncscieenkencgcmsololsueinwnedctestleresibdsatuhignttteehidenaagqrttenoutadohinrcteeeactif:srsoienanmae"mssTmoiehtrneheegnianitstnstidfwthoeaienirltmilcarpooa2rcnte0ciccodo0uenil5clrpetitoicrsouetvnaicpoesloonrmlrlatteionmaocddnnteeedssdloit"mtanei(mtuBetcphsr-oeoertondfb-vcmeteeehhidpenroet-eeuapfmartsr,telioto2semde0f,eon0palds5trnaee.d)tdlisavi.cniettdTicvoheafipnstmrhedceedhetiasmhcpntoiogivdtseeest
The report has defined "impacts" differently from most regulatory bodies with which the mining arinendgyuasrpdtarlyerashmsaesotfetwor hcaeobtmohveperlyi.taisTpihrniemcaorermyppoolritrandsceeefcinowenistdhaarpnyeersmxucirtfeacecodenednoictrieognorsof uosnrudrrefwagacuetelarotirodnrgisnro.kuinngdwwaatteerrqsutaanlitdyaards
The report argues that many of the exceedences are due to "characterization failures". However, vgiurtiduaanllycealflorowf tahteerEreISssoufrocrethaendsrtuocdky cmhainreasctecirtiezdatioinnthaendreapnoarlytswise.re prepared prior to the BLM
Tdparheyesmerneintpinopgrrtiohrinatscoluctdhleeeasndeevdeveruylpoploitmltdleeenrctmoonifnsitinhdgeeroamptiieonrinnagtioofonpsa.emrabtiieonnt, ahnyddropgaertoiclouglaicrlayl ccaosnedsitwiohnesrethmatodweerrne-
pItroisvidneodt fpoorstshieblecastoe sretucdreyamteintehesitseus.mmary statistics cited in the report using the information
Spoctoernintigal simysptaecmtss used in the report have unrealistically low criteria to define the severity of
Sierra Club v. EPA 18cv3472 NDCA
Schiumb&rg&r Water Services 2
Tier 5
ED 002061 00090629-00086
2 REGULATORY FRAMEWORK
aKpMlruoieninppingeagrrwsaitrtieMhognaouetolhasfettiNorRnEimePpapAonordrdttaoaNncnutEdmrPeeAcgnoutnlcsato,itnomtuhrpyeelsidahentivsocteeoleorvypboymolvfetehNnetEtsoP.daAagTyeai.mnbclpeiTeleos2m.1cheoansnshtasotiewdiovesnorlivimhneopdvwoartrthtiaohrnuiostsurgmeahggiogueuhlnattctoithehrasyevwmepaielaserfsifoeetodxcnateemodsfi.nttehhdee AQsuaTliatybl(eCE2.Q1) sdhidownso,t eisvseune tihtsoufigrsht NreEgPulAatiwonass usnigtinl e1d97i8ntoanldawsoimn e19o7f0i,tsthmeosCtoiumnpcoilrtaonnt Egnuvidiraonncmeeunntatill 1983. Tsohme eBwuhreaat uouotf oLfancdonMteaxnt aagsemtheenBt L(BMLMdi)disnsoutefdallgeunnedrearl tNheEPFAedperroacleLdaunreds Pinol1ic9y70andThMisangaugideamnceentwAacst ts(mmhFpraaLeunnPcsaaiMtfggicBAeeLd)mNMEuelannPintntAidltoosg1,fu9thlii7ande6nca.ldnNuscdETeiPnuhganAaddt mdecaroricenmtisi,tnsspgailnijmaugonropicmsneedgirniacritoentiiotoaghnln,mes.ar.mitnhToTihnnaheggemsos,Faythdejsoeidtrreeerwmcrsatauaelybtdi.LjceaBcnIpttLsdlawM. nPantsooinlincguoyntidnauevnnordttliavl Mke1eda9n8saa8yllgstethreemamsteoatnuhttireccAepBcsltLaMno(FnnLiinsPBgsMLuMefAod)-r tTbpoerh1oge9ci9neNn8dieuntvrgheaesdirn,aeis1Bws9uLa9eM8sd.,liptrItneolecliacotdiogednsinit,ziooiannnsg,dtaNtgnheudeviadarnaddenaizecadBetLioofMonnrwffiwroasertteltli-hrsdesroesuceseuodmuagrnecraneoltyuedsndaedtsawN. aEatnPIendrArmaeanocnaodalgeylysnlinsiistegiosangnuadoindfrdaotnhcscketeacenhivdnaear2rar-d0cai0tzde8avr.taizionaPnctirionioongrf regulatory and technical framework, BLM updates these policies and guidance regularly. TcohnetinFuoeredsttoSeevrovilcvee aisnsduegduidNaEnPcAe oimnpmleinmeenbtoantdioinngpwroacsedisusrueesdinin12907094.. Their mining regulation practices wTamimhea1petn9llaeu8nAma9drlemsmfn,oyatriwnndCugheaiolcrilrnhepteghsauiastltiaontwtfhgioaeEnwsnsbeugatillnistaniimnes1de9afsr8tose.8rl.yThthwhaesiistihrwadilnrasavsowoflnovulenlaomdnwedeerngdtthoebninye1am9an8an7naytmetevammonilpunvtiianntlggorerspienitrdesoetscift.eiunsteesIndth.foe1T9rd8her7eelignAthueCelaaOttiAioEnCngiOspsaEruocetciidvesisdtNiuueeErsedPiiAnna wwPaarittoeerrrssto.. TFphaaecsisleiatfigfeleuseconoftnltsihmteriutscCtfeloedranmpreWiotaralttomertihnAiescstwweinerree1n9no7ot2t,npetrhcoeemrseuslagwraialtyesddneuosnigtpinlreDodheicbtoeitmipornbeevoren1n9td8di2sis.cchhaargrgeessttoo ssuurrffaaccee
Sierra Club v. EPA 18cv3472 NDCA
Schiumb&rg&r Water Services 3
Tier 5
ED 002061 00090629-00087
Regulatory Framework
Table 2.1 NEPA and Major Regulatory Milestones
Action NEPA becomes law
What
Date
Federal Statute
1970
CEQ Related Activities
CreEgQulaatuiotnhsorized to issue non-binding Executive order
1970
CreEgQularteiocnesives authority to issue
Executive order
1977
NEPA regulations
CEQ Regulation
1978
Forty Most Asked Questions published CEQ Guidance
1981
CEQ Guidance on NEPA regulations CEQ Guidance
1983
BLM Related Activities
Department of Interior NEPA Procedures AFectderal Land Policy and Management
GFIneutedidreiaroanrlcDeSetaptaurttement
1970 1976
BLM publishes NEPA Handbook
BLM Guidance
1988
ACNNDnaheeatvvaalaaryaddascaanistdeBBGrAiLLzuMMnaiadtilaoppynuunsbbcisaelliinssPfdhhooeerWlssicMayWRitneoaincrtkegRreARscoetiusvoritcuieersce
BLM Policy BLM Guidance
1998 1998
Nevada BLM publishes Groundwater BLM Policy
2008
Modeling Guidance for Mining Activities
Forest Service Related Activities
National Forest Management Act
Federal Statute
1976
Fproorceesdt uSreersvice NEPA implementation FRoergeusltatSioenrvice
1979
gFuoirdeasntcSeervice Reclamation Bonding GFouriedsatnSceervice
2004
Army Corps of Engineers Related Activities
Clean Water Act Directive to protect wetlands ACOE Wetland Regulations Wetlands Delineation Manual
Federal Statute
1972
Executive Order
1977
ACOE Regulation 1977
AMCaOnuEalTechnical
1987
ACOE Procedures for Implementing ACOE Regulation 1988
NEPA
Other Related Developments
Citation 42 USC 4321
43 FR 55990 46 FR 18026 48 FR 34263 516 DM 1-7 43 USC 1701 B1LM Handbook H-1790Nevada BLM Policy Nevada BLM Guidance Nevada BLM Guidance
16 USC 1600 44 FR 44718 AUpSrDil,A20F0o4rest Service 33 USC 1251 Executive Order 11990 UD19Se8li7AneCaEtioWneMtlaanndusal, 53 FR 3127
pErfoflmueunlgt alitmeditautinodnesrfoCrlemanetaWl amteinreAsct CERCLA Enacted SARA Enacted
EPA Regulation Federal Statute Federal Statute
1982 47 FR 54609 1980 42 USC 9601 1986 42 USC 11001
Sierra Club v. EPA 18cv3472 NDCA
Schiumb&rg&r Water Services 4
Tier 5
ED 002061 00090629-00088
Regulatory Framework
TsP(CihtreiEeosRr,SCtioAnLdRtAhicA)eatianeinmng1ae9tcnh8tdma0mt,eaenthvntoetosirdef itninhwgea1dsC9is8olc7imthtlaepcr,lrageriehfifseiaentndosyi,vgtherioanutEdnindcdvraiwintriookanintnemgroewfwnagtaasrtloenuRrenecsdsetwapsnoasdnateasrryred,stsotCawanovdmooaupirdlddesnCbsEedaRetiaovCpenLpl,oAlipaeenidnndgfaoLtruicanCebdmEieliRetrynClatAL.wcA.t Tlpimuhruiptsao,tsiopenrsis.orfotor m1i9n7e2dfeosrigsnuerfrasceto wuasteerf,oranmditig1a9t8io7nfodresgirgonu,nodrwfaotrerE,IStheervealwuaetrieonnsotomuesaeninfogrfuclomtaprgaeratstivoer tTrinhehigseiutsplpaeotiroininorftyadon,afcigtnyhecinslducuddieriiinssngcgu(BrstaLshpMieoidn,l1yFi9soc7trh0heasasnttgaNSinneEdgrPvsAi1cta9ec8t,ou0amtsen.psdliaaATnnChdcOeerEeamg)nuidwnlaiemntrigoeinniwnisngodarurnkesdingtrguyralaipnatiinodadnlny, tewuhvnehosilleevptirtnsliengtidclltiepeecavnhlovnlivFricioneangdlmetproeardnolatcyemd,suinswrieinansggs.
Sierra Club v. EPA 18cv3472 NDCA
Schiumberger Water Services 5
Tier 5
ED 002061 00090629-00089
3 TECHNICAL FRAMEWORK
3.1 Background
tTcmhoheonestmatalympapjitonoliracittamyiotiinoonnfeisthosdeufeeswwscaoieatrenskrstiinofpigccriioahortyertdodwrowtahloitetehgrymisnsiuddtupu-1pds9lityer8i.sa0lstdoAewmvareeisnlaoelfpoasmciwuteesansertedscnaooennnslsybsespotetfarcarpticfeoiecdtedeinnnbtitgaahilcnekseluetaorrtfienathgc1ee9i7s1a0s9nus5de0assng.dtrhoa1Hu9tno8drw0eweslaav.teteerd,r TmhineeUsnitietesdanSdtatoetshearnidndCusatnriaadl adewveerloepmamenontsg. thMeinfinirgst ccoomupnatrnieiesstotypaidcoapllyt esntavritreodnmtoenetmalplporyocoend-suirteesafnodr scntoearwfpfodhriasactdeipleliimnnevit.eirdontmecehnntaiclaol ffbicaecrksgfrrooumndthbeelcaateus1e98o0f st.heHionwheerveenr,t mlacaknyoof fetxhpeereieanrlcyemainsisnogcieantevdirownimthenthtaisl In the 1990s, the hard rock mining industry became highly proactive in response to the increasing sectonarvnpirdooarnarmdtesegnfootarvlseurrnerfaganuccleaetaiotnondaganrhodiguhngedurwidsaetatleinnrdeaash,rdea.anddTohfreampmaidinnlyyinogdtehivneedrluoinspdteruydslterinida-lhthsoeeucsdteoervsee.nlovipromnemnet notfapl reoxcpeedrutirsees aanndd Atlhelvel eomlfatinhniedngmatcaoajonmrpomapinenyrinaigttisocenolsfmaleprevaentyli.epsiIcnanmlolywamnhyoarcveoeuraingthoriiregoshu,sltehtvheealenontfvheiornosvneimrdoeennmmtaaelnnsdtatealdnadwbayardrleoscnaiemlsprseo,gsbueoldathtoioanntsaa. pcroorjpeocrtabtey sByosthtemhydurongdeeor loingvyeastnigdagtieono.chemDeisvtreylompmodeenlts oafreaonplyroapsergocoodncaesptiunaplutmdoadtaelavisailfaubnledatmo ernetparlesfeonr t athney wecmasoetlriiabmldnraainttmiegnofgunalihntonodruwinmvgrae.olrciidckaTastlhebeaenmhuaasolveydeseiosluif.nngcdUaensprteriwloecstheatuedthdueir1eer9sisn9g0awsnw,ditahtshisneitbeatahsmveeadoilnpauiabtposloertinnig1nr0epleuaxyttipevdeaearrliysteancchrfueoadsretothbteeepsertonpwvreidofduerikncdttiwhvaeeimthetaonnbotoiallisltryeffaootlo-rr establishing the current-day procedures. ttTahhgheeeenlaleactsiteeetas1.b19l99iMs90h0osmss(teTaonanftbdtlohefee2pag.r1ruol)yic.dea2dn0uc0ree0ssfobraygseFaoecdhreeersamullitsatnrodyf tStehsteatitneigmrefpogrrouvNlaeEtdoPrAstechdhaonsciucomanlelynutbnsedwceoresmrteaenddceionvmeglmogpoaenidnpelsadtcaerbtiysnignthcieen tAsMhuseapnaelyarrsseoetsfdu1etlh0td,e,tsoacEniIe1Sd5nttsihyftieecuaaydrlilesdysi-dsoturhnpasopottoiwrtntheecalrduetdEhecIiagStrhhrdeeieordccqouuonmuacetleitnpypttrssiEohIorSaftvousenttuhocdeenirleytmsabiindhet-eay1nv9ae9an0vdbsaemicluaoistbmiegledeatsipaoinrvnoca.ceileaTtdbhhuleeerermewsfiiodtwhretho,siculihatbtisesatra1oen9nt9lniya0olslwiny. improved predictive protocols.
Sierra Club v. EPA 18cv3472 NDCA
Schiumb&rg&r Water Services 6
Tier 5
ED 002061 00090629-00090
Technical framework
3.2 Hydrogeologic modeling
ttCcanm1hhono9ueoinnd8rsgerc0eemresmosnptouihibttttd-neuiaudgedasttaalwlswwytw.imaoeeemntrroreee.eeFdrteunuhmglroIto,ettiohltdniadzwesweneeraridmdladaisnnelottlgdyehlrnyeneotupo,aytnropots-druhpvcuinmeldaeipteldiopilddneuroaoteartrhettotreeylstyEdyemfpIamoSibminrcriesdeodacpdaolasrlteygceoiutloudessi.mniselcacwtetGuiolevunenfr-edtrto1tseiehl9uteetu9nthcbhn0delhaeatswinslclaiaikptctchhttraeeeoeaalrsft1nseemh9dtarnuie8osrtdl0pdt-dyodisreeidrea1lsiiacsyn9nenfg9docdno0aortctsatenoam.tfacdiovitreenEcoleypesuatpss1rgwsrl9yrioetooo9evrgfun0esidrnssoe.afdeduirrnweniseTnsvatdphievttwdiueelavoeatrrsipetvtotyeielmn,yrwrlgootudaompdnsiefaeoccfdelvdaesirpelrreiittbnrlwausnoriateatpnfhlortettleeeoyyrr faoprpwlaierdd imnosdueplpporretdoicftiEoInSs.studies, and the concept of uncertainty and mitigation was introduced into the
3.3 Geochemical testing and modeling
A practical understanding of the environmental geology of mineral deposits has only really developed wcirpnehriftaealhuldriiesnaicntcitccitaveeperciptzohrsanoettucxiotediemnpisetatusditnaeidgalliyzrrenaetothsiatouetnltrteeslamc,osofaptgntpind1nri5goztehcyteeoessreaosmfrmeosso.reedeeosAflff.oemtcghtToeeinohtgdehpehsekyueansraroifclarwyalcylleelaladabngbaodenordraacotohtgforerrytomyhuetirecnesadgstlwueinlcoatgsoltoenwgprtryreooqrlceusiseapdtlchioutryaoritetriclisymaarlcpfeooafroncnrtsgostew,raaocwicnhkhhieneiedocvmw.hinnigsthttreoay Atvahaplatlphindrooautathgiocohhnseepddraofotmcareofdhoduyerrdretnhrso-edlofamogyryodsgsteetaulosndcdihheaeasrvmd,esitshbtoereycyccocuhmhraraeevrdeaacviatnealsriltoiahzbaeelteivom.onlivdTe-ah1dne9d9sfi0irmgssnto.idfsieciHtaelionngwgtleyeowvcoeehvrr,eeemrthdtiesehstvereeylpoceaphaseartdlryadcsestotceumardidzeieeawstihaoahsnatsgdltoahotnaedotr tbraasnisspofortrocf ocmhepmaricinagl ctohnestitthueeonrtes.tical laboratory characterization results with actual mobilization and "Predicting Water Quality at Hard Rock Mines", nominally a peer reviewed report on models, methods and ysqfauetuparaaptthrelrsioet-.yoar fca-nhtthoemetse-inasderetthvsheietyeldossrpoteiusloddagynipcrabeimlrvinoaalgnrvisdliynggtioensgoctechiethehneecmUreinciwinatefiltodhprmriSenadthatieictoertneison,ntoCnuteancnwchaeandrtitaqea,urineatqsineu,dsas"ltAita(yKutesusptirpra"eelPidrasri,cetMdieoiacsntepsivseetc,aiat2ml0lomy0d6ienin)le.inthgTsehitoeeflsarwsetwaptoi1ethr0rt dTacoefhtmteiserprmailnebiftnoeoerudmttbah1ete9ifo9onp0reositstehhnoicstuoialtndilmsifhseoat"revanemnt dimnweo"itTsrhehtetorheaelrivaeaKbleiluleaaispbieenilirftsocyromoMnfataagteimeosonitncaRhonneetmpswoicatrotatel(rwpcqahaugateaerarlict8ryt5ee)sirm,iozwuparathcicoiectnhsp"do.sattWetaantiettahisafflte"htEchistIasSnsitnhthepmoeasirnbfeodilr,iEmtyIteShtodes te1hv9eo9l0mustii)do-nw1o9ou9fl0dtsh.ebegeeoxcpheecmteidcatol abned lhesysdrdoelotgaiicledevaanludatpiorencsisien tehaarnliearnNeEvPaAluadtoiocnumperenptsar(eladtefo1r9a70msintoe eaaftrelyr tAwgaaaimhdrnvtaeeoogeatsndurhrleytKeanepisfalgduiirientGeesiwepdg,drraezeiac(trpi(eeUsntcUoenrciSdrdS'MtsaF-icFobtsaSoCoSnaenrsa1shcewet19eaear99vnkeRas82etscre3)Mauac.zp)tloic.iTtnoinoiuderhcTonnt,ishftncidtwenheotpiedgeaunoss1tctrt1e(n9eiaAn9sno9nlBgli8tt2iztigr3aAiaminhln)EtgEt,dielaoynIinsSccnavtyianhsidiornitdidoegntinehdndhnnermtetoahttthrhiheiefenainnitecahtetwdragatsaplaenotnarhsemgAcetpeceiesedrvipepseowirdeopntfoaistracec0otssttikn.doehmt5teundoileaceturolntalagoieotftchco1anhk.r1c(3aEnh.thw6thoAieamn5ae)dgsgsamp/ptfslhpoer.egoerrx/cojblpTe.icpwefechieoicHactnedttsgtoeeugotawnderecaetd.eoitcaeuvcri(loegWdahStrcrileoc,Paakdm.dLstpahetPiirctenioasI)asctdlrludauundornitcduicsfedadeekcmscdutanbelliseencoesaamgiatrdieccone,hhiwndsttaabah/aottuilieeensnstr gdoriondkinaggwreaetmeresnttawnditahrdthfeorpzriendcicotfio5nsmga/nldaswiedlel nbtiefileodwinthEePdAis, c2h0a0r8g)e. permit requirement (and secondary
Schiumberger Water Services
7
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00091
Technical framework
AoecSRisoxvtuosianbudctlthsekeuineesagBqtoeeiGuunrdnreeoecanslaidybntueoewptnuhvloeateafrSnl1etusu1h9a9ne8ft8nloi9io1goMrnhnwADsEt-haREIceMScDQonidirnw,rwteehap,geceseertdlreynGdseeoersiodrentplaeedaqitrtneulimentnicirgifenoai.eSdemdutdembntshTytluioteghnthheiibnhctereideagMiftshcooiotianxraanetietidcen,ii2.gzdp0en-lag0Atdohn4ecen)nac,aeneocodMdrriraddeottcioinnnogmrtgmmoaantcmipoynkaoeoStbnrededaenregnkatieaudnianpcilolaai,wOdotgollfleeorsgosdweergne-(nsgAeteaar(RrapnaratDdrdteteei)tdnvwh,gieoaalu,oussnottstisohemkleyxeinesridowgsoicwmzirtkaeehae.tdsnAHbttooRahrdraeoDdyt.r
3.4 Kuipers Maest Report and EISs
During the period from 1970 through the early 2000s, the passage of environmental laws lead to new wareegp1eu1rla-ivoteidottneodsf,,rcwaaphliiidbcrha(itfienudtn,ueravnnedsnp)ruecrphrreaodndguteecc,ibhwlnehi.cicahIlt idpserlovikdeeulolcypetmdhaetthntetetchchuanrtricreeansltuapltdreevddainicnctievnseewwmilroledcgeoulnilnatigntourceya.pgaubidilaitniecse.thaIttwaares sSreiumgrufilaalacrteloyrwvyaadgteeuvreeqtluooapnlmitoyenns-ettasxnibsdtyae5rndttsouwn1te0ilre1ye9la8ar7rsg..elDyItewnvoaenslo-epnxmoitsetunentntoitl fpthprieroerldatiotcet1iv19e9792m0aesntthdhoadgtorpoloruegndideicwstiatvrteaeirlteesdctahbnnediqhauirndedsstwwheeesrreee developed and standardized to a level that could be calibrated and verified. The Nevada BLM recognized this state of development in 1998 and began issuing guidance for technical analyses. ohmItapeidsetrhoatohntdieloysnoisnapntpahdonerdpt/ulraoonsrcittecytledotnuosruyecreseoamfrfosoprraobwrreohstoihcmhttohhdameetolthhdryeeedlsimrnuogligtnseipnotrgoleodignriyecdtauiaolsintntydrs.y ghhTeaahdosicshpharehedmavstiihoseutbresyoleypmnpboofeudretneundlnsaimtmtyoaetdotneht,mealaocntnuodirtroitemrhnesptirrteoesftvsoainrndegduarhtirnhadges. Gmeeoacnhinegmfuisl tpryreddiacttaiobnassesisncaentdheleevaerllsy 2o0f00psra.ctical understanding have only been sufficient to provide Because scientific study methods have evolved rapidly, and because the understanding of both mining aopbpcyprreeteucdvraoiaioclmttuooivsprpseaesraritmnauntgddoindiettgehhslee,sc.orprneeTrdgeshiuudteillioatrcsenttoifsooornsrfiesseh,,maacarsilosnyglmderEapeImdaaSirtniltiyssiggtouaiamndtnipoideonrsfoisvttpheonledaoantwocsultidutshuaeisEnlfiunIcStlghofenosudrtlpuiaetddisiotaithent1eses0.rdctyhiaMteeenadadrrnesiygnmoumrotlahsrineteooe,raKthospuierptierptlheiseceraishsbgalleeMvitnetlaeeaeruntaspoaltdlypbaRteutiecebgapdlialocti.rnhatenetddoir TVprerhirocetecurneeatdllyuhsruaeavpsllepolaeofnmndthelyesnttabamneriydennaeNrsdEastPh.saAHmt oswawtleulerdevnieeuscrm,itebomderarSanotsyafteemnx-ielanewmeasdpmleapisrneeerimnscuitthprtireenergnmK,tliuytrtiaepotdehpreessrrianMtthcianaeegnstthuthenRedeaepodroroitrghptientwioaegnlrueEiodISfpaenmrcpmeroeidtdoteeifcrdntmi-oadonnarsdey. constructed prior to the application of modern-day technical studies and modern EIS standards. oMpaenryatioofnstheor cruer-rdeenvtelyl-ooppmeeranttinogf mexinisetisnginBtrhoewnUfineiltdedsitSetsa.tesInatnhde Cmaanjoarditay oafrecaesxepsa,ntshieonosrigoifnaelximstiinnge ttdcKhhueueervirrpeeehelnoyritsspdcmrnoMooelnoandgpetiitrsciwootpansRessyr.escptbeaoamrrsrtieealadinrreoeouunncthodptarrmivaoacirnltiteedorriatzbhlaiezetceioadanudsvaoeerfentanthsaeo.truferbaMaallsayreenelyinlneeoovfasbttueahrdsefaecclcioneonemaspntditdlaiuateagnnrcotuesup,noewdnxwhciweacehhtedicrcehosntmcutoedmsiecosocn,imltyespduoaccrhiecnuttrthhhaieent tpIhnreofapcceletr,astnhtu-eudrpye ooanfrehthisaetolearirncgvesiriotnenusmmaebsnetaralorecfshiunalsnttgaoenfscthecesaunwsehewedrsebtaycnomdmainpridnasgraiwtmivopeuollysderndeecbeeydnttthomecinomeninseiindxgpearcntohsmeiospneasnahysapivtesecetlshf..elApendy Of the 25 case studies used in the Kuipers Maest Report, only four sites were developed under current (post-1998) NEPA guidelines. The original EA and EIS documents for 21 of the case study sites were
Schiumberger Water Services
8
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00092
Technical framework
ttaaenhhxoptietsptepalmoidicnsrpaedigtbvenietlndoeolatoalFcpanoewepdnddopserraierkdrau-eeesltnrhinontatgrghtiaSensitecsaueutmpcerrerdioteadeasngdttsetelidyonnin-fccaeeyttpnhhpvtaeehlinireeoddKdnoauamrtiraipsegeecinnaiprestanuanldbltMEilaficimIacnSaeao,lsllrpyytaersnaoRidsvrceeaetapcihdlesoaeusrnbrtote.mlecs.poi.aTertehreTmedrheietwKctienuitmnghiptaetdshjrotoseurcditueMyiemxaspeoeaansfnnttsstdhiRoeaaenrnpseas.oilrtyoteTsnshehaesfishlesraeumvawpeaseitodrhsbneeetfdhenoeenor Therefore, in summary:
TrehpereKsueinpteartsivMe aoefsctuRrreepnot retndvriarownsmceonntcallupseiornmsittbinagseadnduppornedsitcutdivieesptrhoatotcaorles,old and are no longer TcohnesKidueirpsetrhseMfaacetstthRaet phoisrttomricakuensresgoumlaeteadttemminpint gtooccocnusrrideedrabtatsheelisnietecso, nditions but rarely TpuhbeliKcaulilpyearsvaMilaabelset aRnedposurtpmeraskeedsentoheatoterimginpat ltoanreavlyieswesu, pdated studies and analysis that are TprheepaKrueidpeurssinMgatehset mReopdoerrtnd-doaeys rnigootrionucsludaenaalyntyiceavl amlueathtioodnso, fwahnicyhEwISoudlodcubemeanpptsliethdattowaenrey future
mine development.
Sierra Club v. EPA 18cv3472 NDCA
Schiumberger Water Services
9
Tier 5
ED 002061 00090629-00093
4 EVALUATION OF SUMMARY STATISTICS IN THE KUIPERS MAEST REPORT
4.1 Criteria used to select the case study mines
Tgce"naorolheocntemetusunieKatddhnlueewtiwrspea2eadtt5rtehesratrcotMqaqausaubreaeaeelslisitttpytyruerR"edfpresayorpeesmonmssreteitnsnmincsetaiomsnttnhiienvwteangeei.tn.lraeosTrfgAhcaeesh"trnohssssuettueamabnttdebissideseptitrtrcrsoiimsobnfouaatfspririoualehynmgaerdbmdoua8afesr7reoygtdcooeksnftotheamtnhertiaiesntlatheiKcvescsauaiii2ltnptaeo5ebgtrhisoscleihrtaiyoMesUwseoanfeitsatshwetnteudaddRtieySmewrtppamaqoattueriecntas:trel"its"t.qoyI,nuTsdwamuhalhirettafiaycak-ahcirfneuoegtlwrahaettotehnhrreddees final selection of mines for in-depth study, the following priorities were identified":
Mines with long histories and NEPA documentation from new project to reclamation and closure. Mines with different proximities to water resources but indicating water quality impacts. Mines that conducted some geochemical testing, and if possible, some water quality modeling. Mines with different potentials to generate acid and leach contaminants to water resources. Taavdhaeeiqladuboalcteeu,mriseelliniamtbilateelsdeo"v.astluaatetisonthseth"alist thoavf emaindedsretshsaetdacwtauatellryqmuaeleittytphreesdeicctiroitnesriaa,ndpaimrtipcauclatsrl,yawnditharreesppuebcltictloy AsfrtosumdnieothsteedwKeaurbeipoevsrees,leMicttaeaedpsptbeRaasersepdothrtoanatniadnvctalhuiledaiibrnlgaepmwpliaincteaesbrilqwituyitahtloitwythadeteamrtaqi.nuinaTglihtyeinridemfuopsratercy,tstinhwegaevsnaelairdaipltyriisoorqfituyteh, seatinocdonnathcblelues.cioanses
4.2 Definitions
DKuuirpinegrsaMnaaleysstisRoefptohret uisnefodrmthaetiofonllotowidnegtedremfininiteiownsh:ich mines had exceeded water quality standards, the Wopaetreartioqnusa,lwityheimthpear cotr: niontcraenaseexsceiendwenacteer oqfuwalaittyerpqauraamlityetsetrasndmaeradssuorerdpearnmyiwt hleevreel,s ahsasaorcecsuurlrteodf. mining sfEaexccciloeitnyedd(aeer.nygc.d,ert:ianik(lininnoggtswsspaoetluectirifoiscntaa,lnlpyditadwredafsitneear,dt ,wanabysuttemionrontecitrkoprrriuenntgeodflof)c.fraotimonthweithtienxtthaesm): inaenyprvoapleuretyaabnodv/eorpwriimthainryanoyr These definitions are important because they are not put in context of the regulatory requirements.
Sierra Club v. EPA 18cv3472 NDCA
Schiumb&rg&r Water Services 10
Tier 5
ED 002061 00090629-00094
Evaluation of summary statistics in the Kuipers Maest Report
wfTddfouaeorhancfeewtiiclensithtriiiptoeeinouontsohrrninpteoggorrtruasoscietokueoefrndneodassfifnwntuoittNlaorutastEtfweefaPiersnacAcmtcaateeoninrigdusyhqenttueentoabncvieoivmlriidtisorytpeyohnosnnemirmttmteieacfpmyenhnantatcaptn(tafloNagltriEceeneitmnPlseottAhpiafaseascluScelcatKi,emhs(cuwseptiiihpa.aofgieesccn.,rtathsswtc1eihoh5Mr(aneo0ianttr8hoegr.ee8ersefr)tsuf.euistnRhclTetetdeshspooe)iofniwrnetranoctafrsonstehttrtrhareeeeees,xaaecmmamceooiesswmsodigtrawepnstanioetitqfhcnrriuiceienncainfgloenatemfsrts.n,asietniTsffriifnietcmhergaguicsatuctigooltmauiinrnntra)oaep.skrbsryueol,Ierstclf.iaaimetsnhcsidetaesI,t threshold so low that no significant human activity could avoid triggering it. saacOMFiornrgneaomynlemynipmsfoitleciitanaaxRnnecneceetrpseceeifotergdesrosuteum,sulncaasrchtarioaenitlrshagyyrseetmorhgdpfeeauoesalllwradtnsamtenpionnfgeorigdnyrcnfaaiuttiidrtpivlood.ieeenrsri,nsnsNtogpoimnremscmitpniohttieeeenverssnietmtoK.iaoriaut"irnnreiEpelgixoemccfrwoirsetsenseeiqMstldeluiasdae-itrseenoeproscrdeetretdchRsbtie"foeeeicqpayeuootmpnarnoadteld..irnebotttiAsfthrneawaorafs"yptceueooxlrorifmncacetcqaspeeutliidaooaoenfnlirntcscycgeoetrhmosa"rturpowaenlunoidamgdunwhaladcoardedutebestearitnrhmaveetteihxrpeyiopnopogtKleieiknunrzetaistoplityaneioleroalnys.tf Asqptuedaardnilpiditthiyaoernddraaaslltlyaaa,.rnepdTrnihmoientaecrdKoyunianispnitesdhrteessnerMtecpao(oeenr.sdgtta.e,rRvyeehsnpistoatwornthrdiedcanoredmtsshineicinynognamrsieiinmdeaeprtratarlbciibztasuestdeealdairnerteeoaocbsfotaenasndreeiltiinnoooefnttescn.doeneHfdixnoicteiweodeen)dvs.ee. rd,"Eitnhxecbeadesisdecleiunnsecsewiosan" teoisrf
4.3 Data used
The Kuipers Maest Report utilized data from the following sources: OofpAelraastkioan,aMl aonndtanpao,sta-ondpeIrdaatihoon,awl hwearteeruqpudaaltietydinEfIoSrsmwateioren ofrfotemn oalvdaEilaISbsle,,especially for the states Technical reports and water quality data from State agencies that regulate mining activities in states such as Arizona, California, Nevada and Wisconsin, fProomst-smoimninegmEinnegsin(eee.gri.n,gBeEavlaMluoautinotna/iCn,osMtTA;nGalryosuisse(ECEre/CeAk,) IdDo),cuments from NEPA documents Water quality data from files at the State agencies or from reports written by agency personnel or simmitiupnaiantcgiotsnc.somwpithanmyuclotinpsleulEtaISntssdfiodr nmoitneesxisint oArritzhoenaE,ISNdevoacduam,eCnatslifdoirdninao, taandddWreissscownastienrwqhuearliety
wWotahhteielerrwqtihsueealciatoyuntdhtaaoitnrasefdorerincthopegrnevipzaaerirdoeud"sthremaptinoaertdssdiiatteisosna"a,mlthaientitsreigfrohoctfusesmffwicigaiehsnt"cohyna"v.oebtbaeineinnggdaaintaedthabyt waansalvyezrinifgiabaleddaitniodn/oarl daUacnttfuaoarlctuitmneadotneailtyroe,riwnggiethnsetthraiectioe(nxec.gde.ep, stiNiogDnnEaotPfiodnwesfaintoeinrrgdqetuhsaeclirtNiypEtmiPoonAnsditooarrcienugmineacnnlutdduectidolizmfeopdrliaisnnptceheceifdeicavtaadlau1taa9t.io9n9A,-2sth0e0a3s)roeausnrucdlet,sfenowof ainrdeempeinnindgenctoemvpaalunaytioonr coofntshueltdaanttareispoprotsssciibteled.. Additionally, no agency contact names are provided, nor One of the basic principles of scientific work is that data and data sources must be cited to allow others to dmuepalinciantgefutlhweayw. ork. Lacking these citations, the Kuipers Maest Report cannot be verified in any
Sierra Club v. EPA 18cv3472 NDCA
Schiumberger Water Services
11
Tier 5
ED 002061 00090629-00095
Evaluation of summary statistics in the Kuipers Maest Report
4.4 Evaluation of summary statistics
4.4.1 Case study Mines
TC"coNcophaEaneelPsicrfeoaAlKurt.indusoiteinapuOds,edf.rtywtts"hhoeoMms(aei2rnee)esmsisuntilntIRbsedeseaco,phafoo7ur1,dst seehiitnxaaodid(lfie6cEd)aaItviSneeadviMilnaatoflbhuoniearltimratteyinoaantowi,ofesondrefea(vt1teha10ne.843(c7ETa)mIhsSiinoes/EdNeisAnetmscuv)ldau. yeddrTaeamd,waimenonneindntsyeeo-sfcn(i,vo1eeu)wl(di1m(t2h)i5nbin)ee13mW7einiixnsoteAcrfasolapntwhsosokelianasrt.ee,edfTcsohhuutoeborsjere(oe4cntp)thoaetironsrt
aUsssinegssmTaebnlteo4f .t1imeofofthoepeKrautiipoenrswaMsaceosntduRcetepdor)t., Othfetho1s8e3, imt winaes saitlseos vweerirfieedvtehraifite1d37(nwoeriendseupbejencdtetnot wdNoeEcrPeuAmo.ebntaOtisnfefotdhr.o7s8e switeitsh wNeErePAobrtaeiqnueidre,mwehniltes,thTeabrelepo4rt.1texotf itnhdeicaKteusipe71rssMiteaseshtadReNpEoPrtAinddoiccuamteesntNsEthPaAt
Table 4.1 Summary of information presented in Table 4.1 of the Kuipers Maest Report
State
# 1975- % of total Number of % of sites w/ No. of % of case
present
sites w/EIS EIS docs case study
(-2005)
documents
study mines
mines listed
mines
Alaska
8
4.4
7
9.0
1
4.0
Arizona
20
10.9
10
12.8
2
8.0
California
15
8.2
8
10.3
6
24.0
Colorado
9
4.9
-
-
0
0
Idaho
14
7.7
7
9.0
2
8.0
Michigan
1
0.6
-
_
0
0
Montana
15
8.2
13
16.7
6
24.0
Nevada
74
40.4
27
34.6
7
28.0
New Mexico
7
3.8
1
1.3
0
0
South
3
1.6
-
0
0
Carolina
South Dakota
5
2.7
1
1.3
0
0
Utah
7
3.8
4
5.1
0
0
Washington
4
2.2
_
-
0
0
Wisconsin
1
0.6
-
-
1
4.0
14
183
100%
78
100%
25
100%
ATaccbolerd4in.1g tporotvhiedessumamsaurmymsatartyistoicfsingfoleramnaetdionfrocmontthaiisnetdablien, TCaablliefor4n.i1a oanf dthMe oKnutaipnearsmiMneasesatreReopvoerrt. t6(rinh6e.e34pt.h%r2eme5)s.iencinnaeOctssenleudewdsweimtthsuhidnirlEieeee,IfsSeNFre(elda5vnom0acc%debuae)mt.oameutOinhnitenfesstW1ho9eaibs9rtec01ao4iunEnnesIsSddtian,et,rieint-wsraeaTpplsiapsrbeetienlsaedcer,lsnu49tdt.eh1edwe.d.etaOirnSebfitnlhetlhcieseeitsec1tdaihn4seaeessrtdrsaoithstureac.dsvuiiesnlisssg,itoebanduv,atf7oitlharsebtFalesltaietmeNs bEwaePraaeAsurnediopnotrcelSuissmeetecnetdtinoetindsn
Tmmreaiipnnbrielenesgse4inn.o1tpathestirehoaontsiwotuonsdfsy.sm)i,ginTnaehinfsiedcaisntnhtateNtoeesvsvteaatrtdh-eraae,wtphrabeerysereefanotrtvhaetethrio-eBrneLmpMorofessiCtseanavltcieeftoridvyrneiainasctttaiahvnteeed sifnMoturdodennyvteaehwnlaoavpmeimningliionnnegggsu.pidmrTaoihnnjeiicsncegtslefoah(dr4iss0tao.n4troai%elysus,noisdfaenaordllf tumhnearneKyguuoilpafettehrsde MmmaionedinsegtrnRaecmptiiovniretty.s. aMHreoisrletooocrviacetaerl,dathwcetiitvhriietniepsohrisat trioenrciaclunmdueinsni-ncthgornedteirsotClrliecEdtRsvCtahLraiAatbshleiatevtsehawatitlihosinnngotthheiasct2oc5royucnoatfseeodldsfotaurndidny
Schiumberger Water Services 12
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00096
Evaluation of summary statistics in the Kuipers Maest Report
rmeisnueltss,. which overstates the importance of old and "abandoned" sites and therefore skews the study Ccmooinnnecslsiudsweioritihnnsgsiotghfnetihfaiecbaronevtpeobsriattastotteocmwuearrnredtnss,t ooitlrdisfuaatnupdrpeaumrnerinentgintuhglaaotteptdheersaiKttieousni.pse.TrsheMreafeosret,Ritepisonrtoht aresaslieslteicctteodaiptsplsytuthdey 4.4.2 Surface and groundwater exceedences Statements in the Kuipers Maest Report regarding the 25 case study mines include:
76% (19/25) had mining-related exceedences insurface water or groundwater 60% (15/25) had mining-related exceedences insurface water 6to4%bas(1e6li/n2e5,)thheardefmorienin5g2-%rel(a1t3e/d25e)xwceeeredernelcaetesdintgoromuinndinwgaitmerp;a3ctosf the exceedences were related WThaetseer sQtautaislittiycsInafoprpmeaatrioton bfeorthCeapserodSutuctdyofMTainbeles."7.1TohifsthteabKleuipaecrtusaMllyaeidset nRtiefipeosrt:21"EoIfSthaend25Opmeirnaetisonaasl ehHaxilcvl)einegadrewenactaeetsrtrqiwbuueatreleitdyideteoxncteifbeieaddseenalictneeths,ecbfoounltldotiwwtiooinngos.fstihxeTmghirneoeruesnf:odrRweo,autenndroeMxmcoeuinenidntaegin-nrcee(lNastVe()dR; oMuwenasdtqeuMritoequun(aCtalAiitny); aSsnttdaillnwRdauatbredyr vsr(pMetirougoTlduba)yllt;ae.iotmConAasrsysntta"looeetttxaetMcwldeoooeiunfdonntefthainnetichneeteess((x9C"et)dAaoss)r;iwietgeAnnsmmitfooi(ceZrar3eionc6riat%ntmndviia(ocG9nalai/otrLitlvfiaoet(nhnCedosAuf2)wsm;5keiaynrmneedaisnnnetRdohstu)ae.BbtdeyhawaHlvhielMilchoh(NuabVndrt)aic.niognms)Mpwitnhlieeaersnecpweeairtpchrereonvsbtiuoalellgtametoisof.onlfsiCmmooitimrendeapsllliieanwgniteicitahdel tAd"heeexrseccdvereiieebsdwecedrnoipicfnteicoo"Snneoccorltufi"osvAniioocnt6laus.at3iolreonWgf"atah(rtidefeirnfKogQur aiuwpcaeatlurittseayrlMCaqanouednasdltpiittyrRieo)ednwpiscoaafrstoterwdheaigwashcalchitgeohrnmtqdeinuudeac. tleiwStydua.frsofFarpoceareaswctweahadteoterfinrtqthoauenaad2lit5tyag,cbroailnesufeonardsnmwtduaadtttihyoeenrmwtfierneorermmes tdchoifisfmeerpexaneritrsicaoitsneedairseinthdaethtfientheedtasbwulheme.mrearSayvoasutirlaactebissleti.cosTfhceoinueflodvramnluoaattitobioenn,retaapbsroledwsuecalelreda.psrovpiedreiodda-osf-Arepcpoerndd,ixidAe.ntTifhieedreisnultthoef wacuIfornaesmdtueepcerrhlxiqNacunaEeacePsleidtAtuyep)dn.oiymcinepwtsae.mcrteaJsyutfodrnogombmteecmconointnnsewdtsituouwcutteloedudalndbineeintnhvrvoeeirlqvofueunitrmuererdeevn,ietbaawelicnmiamgouprsdeaeactataac(ncfwouhrroiacccthoecmaiasspniltoidhanenamclpeourrreepppooroiensreattselidostofticredexedvcteieeeterwemdrimneingniencpaeirtfiootjhaenetcrtoeasf vIfiotlhaetiomnsinbeesfoarree 1s9e7p0arisat1e0d0%by, wdhaitleesthoofseiniatifatetiron19o9f0 misin0i%ng., Tthheis piseirlcluesntrtaagteed oinf Tcaabsele s4t.u2d. y mines with
Sierra Club v. EPA 18cv3472 NDCA
Schiumberger Water Services
13
Tier 5
ED 002061 00090629-00097
Evaluation of summary statistics in the Kuipers Maest Report
Table 4.2 Violations/alleged violations at case study mines
D ate
Pre-1970 1970s
1980s
N am e o f M ine
Ray M ine, Arizona Bagdad, Arizona
Black Pine, M ontana Round M ountain, Nevada Zortm an/Landusky, MT
O perations Started
1948 1960
1974 1977
1979
V io latio n (s)/ A lleged
V iolatio ns N oted* (2/2)
100%
(1/3)
33%
Jerritt Canyon, Nevada Thom pson Creek, Idaho G olden Sunlight, M ontana Jam estow n, California G reens Creek, Alaska G rouse Creek Idaho M cLaughlin, California M esquite, California Stillw ater, M ontana Florida Canyon, Nevada Rochester, Nevada Tw in Creeks, Nevada Royal M t King, California Beal M ountain, M ontana M ineral Hill, M ontana
1980 1983 1983
1983 1984 1984 1985 1985 1986 1986 1986 1988 1988 1989
1989
(6/16)
38%
R e gu latio n s En acted
N E P A (1970 Clean W ater Act (1972)
CEQ NEPA Guidance (1983)
BC Task F o rce -A cid
1 1 L U I L L I U 1 1 VJ U U J I ICC,
(1989)
1990s
Am erican Girl, California Lone Tree, Nevada
1989 1991
(0/4)
Flam beau, W isconsin
1991
Castle M ountain,
1992
0%
C a lifo rn ia
Ruby Hill, Nevada
1997
* Violations based on those alleged in the Kuipers Maest Report. No independent verification was conducted.
4.4.3 Contaminant leaching potential TcohnetaKmuiipnearnst MleaaechsitnRgeppootretnatilasol ddeesfcinriebsedtheinsounrefaocer mororgerooufnthdewaEtIeSrse, xncoeteindge:nces by using the
4(226%%)(;8/319o)f tphreed8icitnecdluldoewdcionntthaemsintaatnisttilceaacrehinligstepdotaesnt"ianlo(ibnufot rnmotaetiothna")t Table 7.1 only lists 5
42% (8/19) predicted moderate contaminant leaching potential
15% (3/19) predicted high contaminant leaching potential
wTgmehaooelbl,cichlwioteyanmstoaticefmacrilnootanceknss,tttisttluaeaeialnnicndthgsi.stnh)getInonpotltoehteaenccothKiamulcpiopisanersurestsitteuhMdeeanienttess.stthtiRsCreeucsprouroenlrtnttse,txwqptiurtthaaoclistdtiaicetteesivcmeirsibootenorittdcoheareitlncegaurmbladilitainettyedaoltpeforaaecdndheyiictnetmgiromanptiseonrteeiinantlhttih(eaeel.agucE.s,tIuinSpagistl
Schiumberger Water Services 14
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00098
Evaluation of summary statistics in the Kuipers Maest Report
wwtssmhoiiegeetmhrnteamiefmliswicsnuahcelcnota.io"tprtenliendnce.ceEgrneIQatSartuasisva,teeioltsihtna(eesoti.vvgEeee.I,rSxptsbhwetaeacicttthekepmgdothrteoeefnunrtonhtsimadigl/whbfeaemossrrietnecilpniosnogncettoeaorncmepotidaeninlrcaaateontsnitotgrnslaeesttanaiotecwenhrdaesintr,egeotnhcedeoxepnisesatatncgsmrte)ir,byinet5hawd0ena:tsase"sniswftcra"toyhlsorewewuda"sEseaIodSssr caasaostsra1etth.denemFoaostescrnohamtarevi2wni.nfeaogssIrf The contaminant leaching potential scoring system was defined as follows: None - No information = 0 Low - leachate does not exceed water quality standards = 1 Moderate - leachate exceeds water quality standards by 1 to 10 times = 2 High - leachate exceeds water quality standards by over 10 times = 3 The following points were stated on page 50 of the Kuipers Maest Report:
mInathteeriascl owriitnhgt,hceognrteaamteinsatnptoleteancthiainl gtopportoednuticael wcoanstacmatiengaonrtisz.ed according to the unit or Taoabpfhspeleoraoclucaathtceeihngiegnosrtpieterorosmcqaesundaodulfirtfaepatsocivttweoenriltsythiadcdlheieosffncsevrerieibnronintntogmssotehclinoedtr:aeclilqoauinmnitdadpmardacienttisaobcsnerticb(slaeeeuaecscoehMnidntaagiefmfseptir,onetaenetntntatmillae.i,lna.2ec0sh0inu5gs)eapdnoddteifdnfeitfirfaeelrneatnrtetypneost The potential for contaminant leaching is predicted without considering mitigation measures. TsacHtophoanpewntrdaeoEamvanrecvidnrhis,rao(inftenotimnrslvehemiaranocoztnahraemilrndPgaeorpnoufprttsaoerolmwclyptairompisanrtioteneAtientgthcgoeatinwvtucesaaye)rsettuteohsb.egeaassfoientuhdreaoctnraootxu1eig0cgh0ocrthuiiemensmdeelsiicrssatthetlaedlneddaaribcninhogkvipeonrfgoatchsweeaadtpuceororetness(tnTaetniCravdLlaaPftori)vdresle.achate sSccoinoncrseeesrnvioasntipevoesosdfietbhflieen.itdioaFntuarothafre"eremxpcoreerees,ednaetnercedea"ilni,s(ttiiihc)etrhereveipeluowmrt,opfinntoghreaalrrleeEsucISaltsldcuaisltaamtitoaondgseetidhniecfflriucrdueelgtdab,redncloeasursespeorfooidfmu(ipc)rttiohovenemoovfeetnhrtlesy di(pKinnioiruie)twihnpsaeetoehtntreesKtuerusMdqeeipauxepaeparnosalsidittnnyMdRt/stgeheaedoepeofoscctsrrhteotraegmuetmuseppeldoialcsiratatodnoldricvysoaeecs.rlnrsalyeoei-mqtscusoeriemnrreslsyemenaoretvnnnadottrsrievaecestoxhsgspruconamouinzrgdpeinhetdigodsnot.isrrmeIstqe(tiub.asiunraleHdlelmasotorwedpneeotvpvsieirndortfe,sotonrctbaocatbhhlssoaaevrtfdeaot)hcr,teoiemnirtcipzoitaasnhctceitoalunpasspsicwoasoenritrehssinnsgptmtirmteehssenaye,ttsntaatetennhmddde
4.5 Summary
The evaluation of the summary statistics in the Kuipers Maest report can be summarized as follows: TsrpimetahagpernaaodrmsKdaselureidbtispesleser. rsoafofbMrowvahaeeenstyhtaeRsrpietrietpimoiswartriitynhdecofsoirnhmeaspslelloicaawonnncdgeearxorwcyuietnhesdduwperfeanartccemeeritooocfrrosnnguderrioftaaiourcbnneysd.wosaruTtreghfarrisocudemnridnewwkthaianotetgderrwmtqoaautkaenelroisttysitteaanxsncedeaaaernrlddyy
Schiumberger Water Services
15
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00099
Evaluation of summary statistics in the Kuipers Maest Report
iInt fiosrmnoattipoonspsirbolveidteodrefo-crrceaastee sthtuedsyummimnearsyitessta. tistics cited in the Kuipers Maest Report using the Torhedegneynceoranlclluascikonosf creitaactihoends finorthdeatraepsoorut.rces or monitoring locations makes it difficult to confirm frDoeargtaualasfrctooiemryntraifelilcquNsitEruePdmyAe. ndtosc,uomr esntattsedarree-traesasteesdsmeqeunatsllyofreingfaorrdmleastisono;fwchhiacnhgeissclineasrclyiennotitfiacpmpreotphroiadtse, Spoctoernintigalsimyspteamctss in the document use uncharacteristically low criteria to define the severity of
Sierra Club v. EPA 18cv3472 NDCA
Schiumberger Water Services
16
Tier 5
ED 002061 00090629-00100
5 REVIEW OF CASE STUDY MINES IN THE KUIPERS MAEST REPORT
5.1 Background
tTamMNhnheeiadneveeaasapsdctlultaefRurr,gpoaeeaomlpndsoimdetrchtp.oFoeamlfaTcltmipthshsltieibsaaoenmtcafchu2miena5eiipninsscteseWasursseeieisiltsseec,scsototatnuetnshddddiaynewtw.tmeewerTrimreneehre:ieensaGelmustoooswilndeahseedseisntsetfhwoesSesreuwrsrtnhehtlhheiegseorhecweltKaedstuicnhaeitpeetMaesdctroucsatnoodstuMieaeplndasrsoa.etbv,useidtTdRiehReruaisbseapypwitcdoeHuelrmytrrilrelpoaeabocnhntrctaaadunrilnredRarevalteodieendulgwfynoeidnrcsohtetMhfhaleeeoprcaueptcKenrutmdteurapriipitifnotzoeinseuriegsnsr of review.
5.2 Golden Sunlight
AdGodocdlduitemionennaSltlsuy,n(lri1ge9hf8et1reisnacneadsn t1oo9pt9eh8re)at2ian0ng0d5maDinraFefitnlaSolcEaIESteAdar(e1in9m9J0ae)dffeewrsesironencerCebvooiutehnwtoey,df thMienonathtuaetnhaoK.rsuipwTeewrrseo Min(2va)oelsvFteindRaelinpEothIrSte. Multiple Accounts Analysis (MAA) for this SEIS. TgTacmi1mhe9chha8iapoeedt1nace-gghcKr1ite9eeauEs8dnmlisIp1,aSe.iencr.mraadpsStiolituanrtMIeedbpgt sisapdateier(ssoScqs.ncpatuonurneTitRoradnahtgetietteeoepdOpomcrbplresottierhtedmeilcagnoidcomta,witnctiooifttcoohtinnolhnruesnmedamsaeneEwtedswrIaaSGehtatsheorecueerldacdrroedeteemascpnbuoatwwelmdfeSadeetueshraenknernanletidigogmHfhwwaawaptrailrdlleaueidsnidsnmrdeggRcideecooeniatnhmcvtateeeketppddltriogBhleeapaeauddseotrihcdecatitaihbgimoruiheenene,fmsopouporwiocxelefttaai.edraslsitnzchoctteieinhdhadaaal lctrafoaoocdorcnreovxtd.emAeidinrtRimiiztosADetunsidocnsasfimcnobasdoreaettftasihsaotenohsndwdsde,aoeoo2rmcrldnoe0iaiig0nzttni4eeeheo)dddes.t 5.2.1 Exceedences TcRoheneptoaKrintu.eipdAetrdhsdeitMidoaanetaasl)lt.y,RTaehcpetouraftol luloitmiwlipzinaegcdts"deafxrtocaemepdrtheeesnecAnetpse"pdewniendriexthdeBeft1ian9be9ld8esinE(ITSSaeb(clltieikoen1ly46.1t.h3e.f1o4r19Go9fo7tlhdDeenraKfSut iupEneIlSrigs,hMtw) haaiecrseht included.
TGcohoneldceeKnnutirpSaetuironsnligsMhaatbeosistvetRhseetpaotnarditlainnrgdosstesaimn"dtphoheuanspdrrmimeqeaunrityr.esdTohnueurcmegerooroufunesdxwmisatiittnieggratgcioornonsuta.nidnws acteyranciodnetaamnidnactioopnpeart tGD1h9ireso9rc7euunfosDdrswerioaanfittt:eiErsIQIStdu,iifsafiplciuatuygnltesctlteao1ate5rcs8ow,m"ihmumicnpehdanectdrtsaoEtntaovatwghlureeoaruteaioncnducwuseoraadftceHyrfridosoomtfowrthintchegerSasetd1aei9tepe9nam7tgeoeDnf rttI.ahmfetp/V1pao9ucl9mtus8mptbeFoainc1CakluowrfEreetIhlSnlse,t
Schiumb&rg&r Water Services 17
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00101
Review of case study mines in the Kuipers Maest Report
fsscanpoyeofiottrscrnienatttcrheittoeseem1nn9.mtcdri9onaoi0nndtNwieciocohnesnaaginsttvmreitnaeraaegdirsnteibietotaehinonrteeetns.ntdhpufeougocfmrrdeBecdopdaaowbosttplaeoywnpcdgnelrkregeravsrdodeacynuilodsecsuitneeeilbtnddnmefetolonobrimsrdmewoefaoufanltofininimotutcoyhnnitrneidisonatnmigatnieinnnidxldgot"irhanc.epegraldratOozitoip2doonn0eonne,1rwel1y,Ogtno.rwgWaArhTgpa-nerhh4donre,ieueuonipnasfndotlotwiopontrReaftae-xtetlosehcpefecre-oncyermtopatde,munoedminndpciceilpotnioaebprsnatapihnncceoigedskrf any constituent have been identified since the mixing zone was established. AoExcviciddoaertndiocinneg astnohdoKwpusoipteesnrostmiaeMl afoseprsrtianRcgiedspodorrnta,intmhaegone,iptorwroiinjtehgctosofsmiteexeiswptineilegreswaiamlrsepteaacdtryeodcpk,rodbduuumtcipnlasgrgsaehcroidwimeddpraascinutsalfgideteo. groundwater or surface water from the waste rock dumps have not been evident to date. tccmDErmhooaIiaiicSsnngttckctrehisaunartmathsuaiolwsaeetsenissenosittnsts"tii:"hsHnNpaegoIornnawedtfgAsctrereoeoRvipbnonneaDutctrtrlrt,hyteailisesymdsomtcmtcootuicincoingruaigrtrtreoleahrpnriotenaipitncnglroygahtgtbeeddtoomvuonisfevteiciecrcaehyaotlfosalnfstortdaroglrioenittitesnwaifogimgclltnyettreiosafnornttoenhiitonmrls,rianom,ptruteweiahotgcghefhlAemiacmwRithemh1oaDt4eieescs1todoteduarnouirdncsrfemudouV.mcpwmoktspahleMu.dstameouotsrnTmrehihotdprooe1xuiswrsindi"osnss-.afiolgpoTtttniahhwohdteaneeabtrt1dayawtoh9tisefae9suct7uespuowgurssfD.agllsfotrseiihdoapAtsieenfesttt tporeesseanntd, ,ththeesreefporroec,eistssepsotaepnptiaelamr tiogrbaetioenffeacntdiviemlypalimctitoinngththeelopcraoldeuncvtiioronnomfeAnRt.D" at dump The spring(s) showing impacts from the waste rock dumps were not identified by the tGcKiibrnnoeauoftvleciulpedrereeemernefrmneiscdttreeerMbtidSnnayuatglsbtnesh.yltpsieogtrATihnERRththgaeeDessptM-hteloMiaiWkrnstteie.dapwasrsaistPnpoesgrlauoSsgRptjpieeoooarcscinrnt1seksg4ibaD7calwroynueonhdmaafsiscpithdshhhaeaoeavnrcweevdi1aaed9stsse9onedc7dmeahepwteeDusamirctrgehaarieliclefb.ata.vein.slEa"dtIacecSaboTodpanmhstncteupapdortoeaonKesdgncsuieeetiaipdno"nSe1tnrdar5esasd4vtsiieotMet.ohrnnaafastTlettthshosoitepsaftrrRrsiesenEuepagIlprStfssmiaonttrrgeeaitonnsnmwattg.hnaaaldensyy With respect to the summary information regarding Golden Sunlight in Appendix B, Table 14.1:
Tailings: Predicted impacts to groundwater and surface water were listed as "slight" in the 1981 EIS (incorrectly identified as the 1983 EIS in this table), 1990 EA, and 1998 EIS. Actual Impacts for tailings were identified as:
1990 EA: Contamination of cyanide and copper in downgradient wells 1998 EIS: Continued contamination of cyanide and copper in dowgradient wells Water Quality Monitoring: Capture not 100% efficient due to operational problems
irDMnoiousantclilinutocesorlsyinniosgrneti:ctrueoTesmhunemlttssecaniynsdasstnohi8ced0iea2%t0ea1dcn0adwpAittcunhorneptuhpaeeelffrtiRacciieeliopnnnogctrsyatmfiiomninrdpaipcotraiueotndendicamtiisoecsnonusnte.sreiwslteaeasnstepd.roewTvhinoegursMalydoinedtniastncdauesDcsleEindQe.
Waste Rock: Potential impacts to groundwater and surface water, based on more accurate geochemical predictions of the 1990s, were considered significant. Mitigations were proposed for potential impacts, as required by NEPA. No actual impacts were
Schiumberger Water Services 18
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00102
Review of case study mines in the Kuipers Maest Report
dmnuoetmetadplsianlentadhcehpioKnrgueipimwerpasatecMrtsai.ne"sat lRl ewpaosrtte, arlothcokugdhumitpwsasindnioctaetde "lsopnrgin-tgesrmneaacrideadsrtawinaasgtee raoncdk wDmaiistsicgtueastisodionun.m:pTshTehareesfoihmreapv,aitnchgtetoaacsthupiagrilhncgopsnodwteiatnisotinapslreatovreioicmuospnlyasciastdtesdnuretrfswasciteehd.parneTddhicegtreomduinnceodnwiddaiettienortnifswie.idthothuet
Open Pit: The predicted impact to pit water was not considered in the 1981 EIS because the pit was above the water table. Subsequent EA/EISs predicted the pit water wThoeurldefobree,cthhaeraacctteuarilstiimcpoafcAtsRaDre. thTehesammietigaastiothne fporredthicetepditimispapcutms.ping into perpetuity.
5.2.2 Summary In summary, for the Golden Sunlight Mine:
wGpraoeslddieacnbtiooSvneuontfhligeAhRnt Daptruearpanadl rwebadetfeiotrsretafirbtshlete,EraIeSnqduinwire1a9ms8ei1nn,tobxfeoidfroizraeendythreeoxcatked.nvseinvteoefvsatalunadtiaorndsiz.edThmeetphroodpsosfeodr thpeit Predicted impacts in subsequent EA/EIS documents correctly predicted the high potential for
ARD generation and associated impacts to groundwater and surface water. No exceedences have occurred at the point-of-compliance for groundwater. No impacts to surface water quality have been identified.
5.3 Ruby Hill
The Ruby Hill mine is located in Eureka County, Nevada and has been in operation since 1997. An EIS wSpiuat bsbseecloqowumetpnhlteelyteg,draonuinnSdEw1I9Sa9twe7ratsaanbcdloem.thpeleteKduiipne2rs00M5 atoesptreRdiecptoprot tesnutmiaml iamrpizaecststahsesowcaiatteerd qwuitahlitdyeeppreedniicntgiotnhse. 5.3.1 Exceedences The Kuipers Maest Report noted that water quality monitoring and compliance data were obtained from t(nhBoeLteMNd,efvo2ar0dt0ha5e)Dsaietlespo.artsmumenmt aorfizEendviwroantmereqnutaalliPtyroatet cthtioensi(tNe.DEPN)infoergthroeunpdewrioadte1r 9m97on-2it0o0ri3n.gTlhoeca2ti0o0n5s DwEerISe The following "exceedences" were alleged in Section 6.3.23 of the Kuipers Maest Report:
w"Oenllsly htawdo hcigohnsatirtsueennitcschoandcesnutrbasttioannsti,alolyftehnigehxcceoendcienngtrMatCioLnsv:alauressenbiyc tawnodtoniftorautre.timTewso; concentrations increased by about 20% between 1996 and 2003. However, the highest concentration occurred upgradient of the mine.
Elevated pH values were also common in groundwater wells. Nitrate concentrations frequently approached the MCL in several wells. The 2005 EIS suggested these predated the mine and were due to septic systems. There were lead exceedences (less than twice the drinking water standard) during the fourth quarter of 1997 and the first
Schiumberger Water Services 19
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00103
Review of case study mines in the Kuipers Maest Report
qpuoianrtt.eSr ionfce19th98e einxcmeoendietonrcinegs wdiedllnMotWre-4c,ura,ltiht oduidghnontorepsruolbt lienmasnywaecretiornecboyrdNeDdEaPf.ter this Wareatreerlaqtueadlittoy bimaspealcintse wcoenreditnioontse,xthpeecwteadtearnqduadliidty nporet doiccctiuorn.sTwheerreefoarcec,uraastseu. ming that the exceedences
tgsDEmhirtuieioesnruc.eineunkgasdTasrwhliyaMoeacnti1neta:i9ivlrnlU0iectg0ygnosdenD.edbdirseigtetiTcorrxaiohnccuuetsesn.ehedlodansemtgnhriceneueyisnnsug-ldrdteeihodgdausnnlionaoottctecscdouurmebrhrcspeiutsladertonxirtnaiyabnttadhoesefeatluhvinnnieycedyinepwirotwgyatreetooenruefrtintaqhdlrueeiammlaRliptitunyeabidnccygtostHnoaddilculittpeimiovreniittno-yseexraiensistcintettinhhcneeget Tccoohnneddii1ttii9oo9nn7ss,aaatnntdhde2t0Rh0eu5bKyEuHIiSpilel rdmsoicnMuemaweeesntrtesRaepcprcoouvrrtiadteseu.papAogsrotaosdrtehcsahutaltrthaoecf ttehpreirzeapdtriiecotdneicdtoiofanntshd,emobbitasigseaertvliieonnde cBDmoaieansamcinseousnnrttedroasVtriewoatnleulesrrneyingtihmrteohpuewlneaddmteweewarnatfteretoerdmrbinastgsuhicendc.iedssecswhfauarltgleyer,i,nagthnsudyssintfeamcailittbiamaticenklgytoumsthaeenonwfeart,hteetroRreraespdoiduucrceInefsialtrorsafettinohinec 5.3.2 Summary TEhISe dRoucbuymHeinlltmpirneepaprraotvioidneasftaergtohoedlaetxea1m9p9le0'so.f the current adequacy of the NEPA process with regard to
5.4 Round Mountain
cpR1or9oon7uvd7niuddacetnsMeddoauEtosnAutssamuinwpmpeiasorreryat ntcohofeomtphmpeelirenatewteinadmgteifllorminrqignumeaainnliintdeytNeapxyirlpeienadgCniscsotiieuooxnnnptssya,ntihnsNaioe1tnv9was8.de7are.anrTdehv1eie9wm9e2idn. efohraTtshheebeK1eu9ni9p6ienrsEoIpSMe,raawetsihotincRhseiwpnocaerst m(FNooDrnEitthPoer)infeogvraatlhuneadtpiocenorimoodpfli1aa9cn9tcu9ea-l2d0wa0ta3at.eorDbaqttuaaianfleirtoydmcfrotoenmndigtitorhoneusn,NdtewhveaatdeKarumipDoeenrpsitaorMrtimnageenslott cRoafteiopEnonsrvtwiruoetnirleimzeerdenvtaiwelawtPeedrrotfqeoucrattilohitney site. 5.4.1 Exceedences gSErexoccuetinoedndwe6an.tc3ee.r2si2sonof ofattlhukemnoiKnwuunmi,p,ebrufsltucoMoraiudeleds,tbieRroednpu, oelrett.aod,bTahmcekagnrergopauonnretdssegt,arotaeunsnddthwTaaDtt:Se"rthiqneuagclriaotyuusnaednwdo/afotrtehdreiswceehxraceergereedpefornorctmeedsthiienn ttsdcihanioegaidlntintienccirgfaaemiclstrlenainesnofextortcdhrpee.h"oleeetmdaeaepncitnthigicailneaelgatstiocofhnarloreemmfaacacbhtyiahlictecbikeoewgsnwratoaoosumtrrnekididnnr.eaogwncF.tkalsHu.t,oeoItrrtwhiidnseeeguvfgeaigwsrc,eatttshtthehtesera.rtbtehtiBghaaegetrceerteahstuetriessisbnersadeutsslheaeettlhiievnasweetplaycwesaclatinetitatnelelolrryotgqcsbrukoienauclweintexyadpswiwtlaaaisistnsheeoarndwccoonbotnynattsaodatmesitshquinuaueamvantettiieonolngayf
sDuispcpuosrstiinogn:datEaxatomiandindgresthseth1e99o6ccuErIrSe,nctheeroef ealpepveaaterds ftlouobriedeadweitqhuaretespdeicstcutossbioansealinnde wwreaacttheearrrgqsaeumawliptaylet.esrsTahtinethddeioffsceiutreemnemtnaptyrsotbpaeotertasionrtehssa.utElt"lTeohvfeamtecidxhiencmgoincTcaeelrntcitaorarmytipovonosslcitaioonfnicfl,uoofgresidhoeathlleionrwmsaaamll,lupavlneiadsl
Schiumberger Water Services 20
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00104
Review of case study mines in the Kuipers Maest Report
vfsff2arrliuu.nooc0ogdmminrgmiiadettsyhrieshlseltiaoegclfsnarlooahtninhcwmaceleicslanoonglfwllpnteuurecoaveaerttinalhinloculleitntevrareasimnartfidlaeroaolxmnndmcwsdeoeeneearglipdaltsfeoeiinenorrwgilgtndeghegdeetllh(orTwmeaatahessabeFllllsreheemidwlgien3eahav-rltat9ahewat,leersa"sGd;tsee2Socarp7us-onH.1t5ndhi,ndea2maarnt,nhrlgdys5i/soalt"manea.nd"mar(DdexRpwaeiomeJeeu-orsup2anftme)tedturhrhrneceMagodrpponovourateuoranlltnjuemiteodaevcniiwasnnts.taasenMtiodteetSfirntfalhaleeumilnevloepErhsltilIadheiStodeees,f February 1996) 5.4.2 Summary TapnrhodepseRurlopyupanondrtainlMygzoeusnttuhtadeiinehsy,cdatrhsoeelobgsaytu,sdeaylnindperhocavosidntechesenraternafotieroexnamsmiaspnrleedpsoreofsuherocnewtedothftefhlueKomruidiopeneirtisnortiMhnegaegdsartotauR.nedpPwoerartttehhraessy1sf9at9eil6emdE(ItiSno tfdORphluooeenocsp-rutgvoidmcoirceltioneinhsgnciauttoyesrnmedoocoepfmgnintteihitttotlroeaeatrkdhtinRieeogt,ornhmwuisanahatdsdilcsothroMhceceuwsoiamouiltsluneeircttdncaeoteiannwsstiaiuttoMhriptneuipntathaoee,enrwtaadsgrhpeehiaecaoahr)tsmhhhteirahgaernemhvmereeaanffllitbounrehroseeeyrsinwddomreiuotaihrsgdcircneeeeooqpnwtlurhoceiaeglelstineecrmtelnrysamtiinentdaiedokoi.nnctPhuwOemaiOntsehointinmebteoatcdhulo.yennddciTaniathripyoet.thnuesKreTuahainzpredoeenareisemleoMpovfafaacttteehhtssdee.t
5.5 Flambeau
Te1n9h9ceo7)mK, pethanesnsemecdointte18Fp1lraoamdcubrceeesad,uw1Mi8th1in,0eth0e0istpoiltnocscaootvefedcrionipngpeaRrb,uos3uk3t43C5oouuanncctryeessi.nof Dngouorrltdihnwgaenidstste34r.n3+ mWyeiilalsiorcnomnosinuinen.cleifesTho(1ef9s9iml3vientroe. 6Op.rr3oe.c2we5sa,ssininsgch,oiporprpeeecdrtalyvtiinaigdreafrnilotfimfoier1sp9r9oth1ceetossF1ilna9gm95ab.teaaumiMll iinneOnatsariaon, Coapneandap.itThleeaKduiapnedrs zMinacesmt Rineepowrti,thinfSloetacttiioonn AsaRpbisrutiovecsseveoinriarcd.etniieafsdiAstcsioda1andta0etinrtwiamdooiitnlfihhlreaceeslotlachymrdoe,efpaaaCletteniiqottdthiyunoepenoaspfrtraearLkniqraiakndund.geybstsfrootTmanroihlditstfehhtre,hheaeaflaroevedCuaeajrsaitebycmheeawoielnesfnatsLsetdahoqiedrfsuevysweeesusamleotlfrkdpioitaihnernimn,gdt3e2rta2rar0adi0liajmslas7c.cinrehfeeonasrvtboe1tuof4ibt9lhtdeheieanencgmrmsedinseineovecoescflisoutteihppteeeiweddaerenroedcbnlyastthiehmteteeenaFdrsaelinadcstmliesateibfm.oeaernaIdduna 2In0f0o9rmAantinounalfrRomepoTratbfoler t2h5e.1miinnet.heThKeuAipnenrusaMl RaeepstorRt wepaosrtavisaiclaobmlepaornelidnetoatinwfowrwm.afltaiomnbepareusmeinntee.dcoinm.the 5.5.1 Exceedences fTlinorohctmeahteiKothSuneiepace2ntri0dos0nf3Mo6uaA.3ren.sg2ntr5uoRauoelnfpRdtohweretpaortueerttipr,liozmGretod:roniumtonordinnwigtaortleionrcgaataniondndsScuworemfarpeceliuasWnecade.tedrTaTthaerefnofodrllstoh.weiOnpgneereioxsdcuer2ef0ad0ce0enctwoeas2te0wr0e3mreoonbaitltaloeirngineegdd
"Four monitoring wells in the backfilled pit showed exceedences of drinking water MCLs or sscueolcnfaotitnneudea(durypisntotcarne1da,7as0rind0gsmfoogrr/l)eirlaoennvda(teutopdtatcol odn1isc2seonmltvgrea/ldt)i,osnmoslaidnosgf ai(rnuoepns,teosu(3ul,fp4a0tteo0, 3mT7Dg/Sml),.g/Oal)nn,depHmina-(panisgt awlnoeewlsl eas;hsoo6wt.h1ee)d,r wtAshufeatlelfnlasrttegshhreaooynuwdwnedeTdwrDedaSetbeceirrnetwcearleeseeivannasgetitodchnoeasnnpcdrietentaputrnHrandtediotdehncestro.eraiGvpserreoer,du-m.nsodVinwaiwnlauagteetesrlerevfpoleeorlvstpea, Hntciotoianbnleslcyfewonfreleotrrweaptsuihomifngropshmienorgftihnbireeothngpe,aitnbmtoawacntekhgrfeieallenrqdeivuseipterei.,t
Schiumberger Water Services 21
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00105
Review of case study mines in the Kuipers Maest Report
vcm(faoraorninmacgebanleantrea(hs5tiei.go8hn(sf-roo~wfm8e~.r3ea1).,v3haC0igr0ohianbmcoleefgn/oalt)vrn,aedtrbiosu5ntt,isl0la0(ara0epsppocegfoa/l2nr)e,0tidn0s3uut)ilonfa~gtp7ee0toa0(fkrpoinigmnc/lr2e(a0aL0seh0ehigrhkafeono,drf2iwa0role0mnr4eo)(.s"ustplo7w0to0ly ~md6egc/lmr)egaa/nsl)di.ngTZDifnoScr waDshisecnruoestesdtioh.ne:TsIhnyecsrteeinam-speitswwainesllssodmeasreeignpneaodrtacmtooemteprrelsia-eninqcuegilriopbuorainntdetsw.aatnTedrheinwpathisteisnbotahtcekrfieallqrewuaiereroedf pthtroeedmihcatienvdee preafrearmreedtetorsbybtehleowKugiproeursndMwaaetsetrRderpinokritnigs awctautaelrlysintacnodmarpdlsia.nceThweitrhefroergeu, latthioen.pit water
w"Aalttheoruqguhalcitoyntcreenndtrsa,tioanrsepinorstufrrfoamcethweatGerreuapt aLnadkedsowInndgiarandFieisnht oafntdheWmildinliefeshCoowmemdisnsoiotnemsptaotreadl tqomlhoupcainaeatelrtiaetwystdiiaot(entCae,boaronlaevdqnmeudtaahttnlehhit,reyae2tfd0opti0rhsae4ecr)ahm.cmahareIgyantenenagrodspetdociimmtnaiotpaentkafu,oesrrtsuehrseeiatudllrrifemraephcploaeeorvastewssseiatbacstlheetefarrsotnocmgtohecmatdohtimnetfghprmeoafmirrndeoeom.twd"hunotrhssineterges-amomauentahdssaeumaprsoeptsdletp-modsruiitnterioiinnnSggWowmf-a2tithneieesr scDHuoiisslnftcadouturesiccstawiivol eintdyr:e,atNacaoodfpdrspoeuemdrrf,attochheeathrdw2en0ae0ctes9osrn,AsitmnaitnnupudeaanclzttsiRnlicsehtpafovrinoertmNsbhoe1ove9wen9m1tdbheeoetrnewmc1ta9ienr9dde9..ihnaITsrtohrenemn, edFmalsaaaumnnraegbldayensaeefuiessledRsihavpoenHwrd,. declining levels of copper and zinc.
5.5.2 Summary In summary, for the Flambeau Mine:
The Kuipers Maest Report does not state that in-pit wells are not compliance points and infers that the elevated constituent values represent compliance excedances,
Surface water data indicate the Flambeau River is not impacted by mine activities.
Sierra Club v. EPA 18cv3472 NDCA
Schiumberger Water Services 22
Tier 5
ED 002061 00090629-00106
6 CONCLUSIONS
The key conclusions from this review of the Kuipers Maest Report are as follows: Tanhye ffiuntduinregsmoifntehse. repCourrtraernet ncohtarrealcetvearniztattoionanyancdurraennat lmysinisestethchant iaqrueebseihnagvpeercmhiattnegde,dorstoo rmaedaicnainllyglefrsosmto vdirrtauwallaynyalcl oomfptahreisosntutdoiecsurrceitnetdprbeydicthtivee KeuvaipluearstioMn apersottocRoelspoorrt pthearmt itittinigs requirements and conditions. TvWrpeiohrchtieuneeatprsceltlooyrdrnsanac.totlhuaedsariaortenathsaapvnrraeeisglfaeoabnrrldteeic,ndogthmbeywplctaiahitteneecdrKeqeuuxippcaoeeliirtensydtsMeenaxtchceeaessttedaRaerefenfpecooceftrtstettnhhceaafotnrsnsuiuonprttrepobrounernatdltvhianaengliddraetetrpenigodvgri.treocrnoTmmnhcoeelnnurietstoioraainnnrsdge. TpprrhoeedpuodcnatdtiaoenrsaenbtceuefsooerefdmianinnteyhesrietKegsuuiltpahetaortsrywMecaroeensssttturRadeiineptdosratenivndecpnluedreemxsiitstheteidsdt.odruicriTanhlgestihtereespt,roawrnhtsiciathilosnowepirenercilopududtefrsionmtoa dsbuurenape-wrpnesogsruttcualoadbntileeecddlu,osaroiocpvnteiavsrliiatdybt.eadtsoTeadhnceudurreprreeoningstutalearnecteghudunnliacudtaseioilnrn-wgr,eompbrkreoefdtsoheerarenntt-aipdstraioeoyndldimc,oteiafvtnhemdoodpmdsroe.atryoncnomolsinloeenxgsisietteresdb,.ewtThehiccehhnsihctauavdlleyy TiMunnhadetehesefrtostRuawrenapdcyoarstthceoehnascsctulousdnseiceiroiesonpustesuxaapalrmreomibndloeerddmaewslbnyio.nftthhtheTeehwceumaryrirneetehpnoatsrttridteeavmtieaeinwraeqrleyhuaerevesexptitorrehansic,gethsnthltigeedhdathteaaydnddwrtohiitngahteteoorutlphotregetitrceKyadiunl,igpaaenntrddos gCreeosonucsltheineqgmuecicnoatnllyc,lupmsroiuoccnehsssoaefrsethmeinidsvlaoetlaavdeiidnn,tge.roprrettahteionsiisteo-supteocfifcicontneaxttu, rseo iatnisd nolatysouurtpriosifngthtehatstihtee. The Kuipers Maest Report neglects to discuss that increasing data collection and improved models and predictive methodologies contribute to refinements in predictions and site msiocntovafoonetdrecrmee-tolpiamfmtt-uiteohuaneslot-miansbroecttdhooreleelflesppc.mrrteTeeisnhddeeii"scn(ttsBidaviertteeeisv,dpemeiateheontofhdtehtohfedtie,tsa2cmuw0ato0nhhs5eot)crr.esihmianapncgotkhrenetaoywnwtiilntephcdrlogutidcimneegeststhhaeeest qtsahuaneomdteemr:eiiannce"tTthihoseeniitress2it0athe0na5dct owraneislcpleoomprcttocuoruanerl wThheichKuthipeerms iMninagesitnRduesptoryrt hhaass tdoefcinoemdpl"yim. pTahcets"redpifofertrednetlfyinfersomanmeoxsctereedgeunlacteoryofbsoudrifeascewitohr
Schiumberger Water Services 23
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00107
Conclusions
gdrrionuknindgwwataetreqr usatalintydaarsd arengyapradlreasmseotef rwahbeothveerait pisriminacroymoprlisaenccoenwdaitrhy pseurrmfaictecoonrdgitrioonusn.dwater TfparhiiloeurrKetous"itp.heeHrsBoMwLMeaveegsrut,iRdvaeirnptucoaertllyfaorarglwul eoasftetthrhearetEsmoISuasrncyfeoorafsntthduedryoecxmkceicnehedaseracniccteteedsrizianarettihodenueraentpodor"atcnhwaaelryrasecistpe.rreiWzpaaittrihoeindn
the context of current analytical techniques, the conclusion has no validity. TccoahnseedsiKtiwounihpseertrehsamtMwoadeeersertnp-dRreaesypeomnrttinpiinrnigocrluhtdaoestshcelevdaeenryevedlliotutplpemoecldnoetnrsomifdtiehnreiantgmioionnpineogrfaotaipomenrsba.iteionnt , haynddropgaeroticlouglaicralyl thIhtaeivseinnuofontrrmpeoaasltisisoitbnicleaplrtlyoovlroidewe-cdcrerfiatoetrericatahtsoeedssuetfmuindmeyatmhryeinsseteavstieistertiiscty.socSfitcpeoodrtieninngttihasleysimKtepumaipcsetsrus.seMdaeinstthReepdoorctuumseinngt
Sierra Club v. EPA 18cv3472 NDCA
Schlumberger Water Services 24
Tier 5
ED 002061 00090629-00108
REFERENCES
BureFNaienuvaalodfaS.LuapnpdlemMeanntaagl eEmnevnirt,on2m00e5n.ta"l RIumbpyacHtillSMtainteemEenxpt,a" nBsiaotntl-eEaMstouAnrtcahinimeFdieelsd POrfofijceec,t Bureau of Land Management & Montana Department of Environmental Quality, 1998, "Final
Environmental Impact Statement for the Golden Sunlight Mines, Inc.; Amendment 008 and Mine Life Extension." Bureau of Land Management, 1997(a), Ruby Hill Project, "Final Environmental Statement," Battle Mountain District, Battle Mountain Nevada, January 1997. Bureau of Land Management, 1996, "Round Mountain Mill and Tailings Facility final environmental impact statement (EIS), for the Smoky Valley Common Operation, Nye County, Nevada," Battle Mountain District, Battle Mountain, Nevada. Bureau of Land Management & Montana Department of State Lands, 1981, Environmental Impact Statement for Amendment 001. April 1981. Coleman, J. 2004. Memorandum from John Coleman, Great Lakes Indian Fish and Wildlife Commission, to Neil Kmiecik, Biological Services Director. Re: Report on the status of the Flambeau Mine, February 22, 2004. Kuipers, James R. and Maest, Ann S. et al., 2006, Comparison of Predicted and Actual Water Quality at Hardrock Mines: The reliability of predictions in Environmental Impact Statements. Lehrke, S. 2004. Memorandum from Stephen Lehrke, Foth & Van Dyke, to Jana Murphy, Flambeau Mining Company. Re: Flambeau Mining Company - 2003 Annual Report Groundwater and Surface Water Trends. January 1,2004. MaeMsti,neAs.,: JM. eKthuoipdesrsa,nCd.MToradveelsr,s,UanncdertDa.inAtiteksin,sa.n2d00S5ta. teP-roefd-tihctein-AgrtW. ater Quality at Hardrock Olsen, Sandi, Personal Communication (with Kathy Gallagher), formerly Hard Rock Bureau, Montana Department of Environmental Quality, 2004. UnitRedegiSotna.tes Forest Service, 1991, Greens Creek Environmental Assessment, Alaska
Schlumberger Water Services
25
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00109
References
United States Forest Service, 1983, Greens Creek Final Environmental Impact Statement, Alaska Region, Admin. Doc. Number 115, January.
Sierra Club v. EPA 18cv3472 NDCA
Schiumberger Water Services
26
Tier 5
ED 002061 00090629-00110
Appendix A Review of Golden Sunlight and Flambeau Mines Information Presented in Appendix B of the Kuipers Maest Report
Sierra Club v. EPA 18cv3472 NDCA
Tier 5
ED 002061 00090629-00111
SRRueerssfpoaoucrencsWeesatteor
Table 14.1 Source
Summary
of Potential, PImopteancttisal
Predicted and Actual Mitigations
Impacts and Mitigations PImrepdaiccttsed
at the Golden Sunlight Mine, Montana: Groundwater Actual Impacts RESPONSE: Actual Impacts
and
1981 EIS
Groundwater and Tailings
Geochemical
Facility design to Risk to
None listed
An additional mitigation listed in the EIS
Surface Water
tests indicate
prevent ground- groundwater
was the construction of downstream
ARD potential but water and surface "slight"
monitoring wells. Monitoring wells were
site indications used to suggest
water impacts:
o use of finger
required even though monitoring systems were optional at that time
low actual
drains
unless pollutants were "likely to reach
potential
o clay liner
surface waters or present a substantial risk to public health" - ARM 16.20.633
Potential for contamination of
o cutoff trench
(4). The EIS noted groundwater impacts were viewed as possible due to
groundwater from tailings solution containing cyanide
o impervious
nature of the underlying sediments
"a drainage system failure or irregularities in the underlying soil materials..." Because of its chemistry, cyanide was not viewed as a significant problem, although the EIS noted heavy
metals were a "potentially greater
concern."
Waste Rock
Same as above
No mitigations identified as needed
Risk from ARD "minimal"
WQ Monitoring: No actual impacts noted to date although springs near East waste rock dump and pore water in all waste rock dumps indicated long-term ARD and metals leaching impacts
Data through time have indicated continual declines in downgradient constituents. No parameters are above designated levels at the mixing zone boundary. In 1981, the agencies generally viewed oxidized rock as non-acid generating. Widespread guidance for prediction of ARD using static and kinetic testing was not available until the late-1980s. Subsequent evaluations utilized relevant guidance and it was determined waste rock had a high acid generating potential.
There was an analysis for the 1981 EIS that indicated acid generating potential, but observational data suggested ARD
Sierra Club v. EPA 18cv3472 NDCA
A1
Tier 5
ED 002061 00090629-00112
SRRueerssfpoaoucrencsWeesatteor
Table 14.1 Source
Summary
of Potential, PImopteancttisal
Predicted and Actual Mitigations
Impacts and Mitigations PImrepdaiccttsed
at the Golden Sunlight Mine, Montana: Groundwater Actual Impacts RESPONSE: Actual Impacts
and
would not be an issue.
No seepage from the waste rock dump complexes is evident today, although it is anticipated based on analyses in subsequent EISs.
While baseline data are limited, a 1980 water sample was collected from a spring located north of the proposed impoundment (now known as Tailings Impoundment No. 1). The pH was 5.48 with TDS of 533 mg/l and a sulfate concentration of 315 mg/l. Pre-historic ferricrete formation at the site indicates a long history of acidic water from the strongly mineralized area.
Groundwater, Surface Water and Pit Water
Open Pit
1990 EA Groundwater and Surface Water
Tailings
Pit not expected No mitigations
to go below
identified as
groundwater level needed
Potential for ARD and metals in leachate
Capture of contaminated groundwater
No impacts to water quality
Prevent contamination from becoming
WQ Monitoring: Monitoring of pit water indicates ARD characteristics
The spring(s) referenced are not defined, but acidic seeps were present before placement of the East Waste Rock Dump. The Midas seep is described in detail in the 1997 Draft EIS. The pit analyzed in the 1981 EIS did not extend below the natural groundwater table and there was no pit water.
Pit water was analyzed in subsequent environmental assessments when the pit would extend below the natural water table. The ARD characteristics of the pit walls and pit water resulted in plans to capture all pit discharge for treatment.
Contamination of cyanide and copper in
The accidental release from Tl#1 is discussed under the 1981 "Tailings" section. Tailings Impoundment No. 2
Sierra Club v. EPA 18cv3472 NDCA
A2
Tier 5
ED 002061 00090629-00113
SRuersfpaocensWesatteorTable 14.1 - Summary of Potential, Predicted and Actual Impacts and Mitigations at the Golden Sunlight Mine, Montana: Groundwater and
Resource
Source
PImopteancttisal
Mitigations
PImrepdaiccttsed
Actual Impacts RESPONSE: Actual Impacts
o Slurry walls
more extensive in downgradient
was designed with a liner and a variety
and down-
groundwater and wells
of collection basins.
gradient wells protect surface
water
High copper and cyanide concentrations
were identified downgradient from the
initial pumpback wells. Two additional
rows of pumpback wells were installed
and the area is maintained as a sink.
Pumpback wells east of the
impoundment were also installed.
Captured water is routed to Tailings
Impoundment No. 2. No levels of total
cyanide or dissolved copper exceeding
standards have been identified at the
mixing zone boundary.
Waste Rock
Groundwater, Surface Water and Pit Water
Open Pit
1998 EIS Groundwater and Surface Water
Tailings
Significant potential for ARD and metals in waste rock leachate
Capture of contaminated groundwater
o Slurry walls
and downgradient wells
Mitigation to prevent significant long term impacts from acid drainage.
Significant potential for ARD and metals in leachate from open pit
Engineered covers to reduce leachate production Capture of contaminated pit water
Mitigations to prevent significant long term impacts from ARD
Short-term tailings leak
Capture of contaminated
Little or no long term impact to
No actual impacts noted to date although springs near east waste rock dump and pore water in all waste dumps indicate long term ARD and metals leaching impacts. WQ Monitoring: Monitoring of pit water indicates ARD characteristics
Commitment to treat mine discharges in perpetuity. See discussion below for 1998 EIS "Waste Rock." Waste rock is expected to produce acid.
Commitment to treat mine discharges in perpetuity.
Pit water captured and routed to water treatment plant and impoundment.
Commitment to treat mine discharges in perpetuity.
Continued
The accidental release from Tl#1 is
contamination of discussed under the 1981 "Tailings"
Sierra Club v. EPA 18cv3472 NDCA
A3 Tier 5
ED 002061 00090629-00114
SRRueerssfpoaoucrencsWeesatteor
Table 14.1 Source
Summary
of Potential, PImopteancttisal
Predicted and Actual Mitigations
Impacts and Mitigations PImrepdaiccttsed
at the Golden Sunlight Mine, Montana: Groundwater Actual Impacts RESPONSE: Actual Impacts
and
containing cyanide and
groundwater
o Slurry walls
groundwater from cyanide and
ARD
copper in
section. Tailings Impoundment No. 2 was designed with a liner and a variety
other
and down-
downgradient
of collection basins. The Tl#2 east
contaminants
gradient well
wells
reclaim basin liner leaked in 1995.
expected to continue
o Landowner
Capture not 100% efficient
Monitoring revealed the leak and the basin liner was repaired. No evidence
buyouts
due to
of leakage currently exists.
o Replacement
operational problems
A site-wide mixing zone at the permit
water
boundary has not had any parameter
provided
exceedences including total cyanide and
copper.
Waste Rock
Significant potential for impacts from ARD and metals over long-term
Capture of contaminated groundwater
o Slurry walls
and downgradient well
Mitigations to prevent significant long term impacts from ARD in surface water
o Installation of
drains and
other seepage capture devices
Reclamation cover to decrease long-term potential for impacts from
WQ Monitoring: No actual impacts noted to date although springs near east waste rock dump and pore water in all waste rock dumps indicated long-term ARD and metals leaching impacts
Capture was never expected to be 100%. Typically 80% capture efficiency is used in mixing calculations. Some EIS analyses (presented in the appendices) indicated higher capture efficiencies were possible. The spring(s) near the East Dump are not identified. The former Midas Spring occurred in an active slump area now covered by the East Waste Rock Dump. Historically, the spring was intermittent and did not always emerge from the same location, probably due to the changing hydraulic conditions in the slump. The source of this water is still uncertain, but could be the result of discharge from the abandoned Midas Adit, which is now covered by waste rock. The drainage above the slump (to the west) may provide a catchment area for precipitation, which infiltrates into the ground and is directed into the slump, re-emerging as a contact spring. Water from the former Midas Spring is
Sierra Club v. EPA 18cv3472 NDCA
A4 Tier 5
ED 002061 00090629-00115
SRRueerssfpoaoucrencsWeesatteor
Table 14.1 Source
Summary
of Potential, PImopteancttisal
Predicted and Actual Mitigations
Impacts and Mitigations PImrepdaiccttsed
at the Golden Sunlight Mine, Montana: Groundwater Actual Impacts RESPONSE: Actual Impacts
and
ARD
intercepted and conveyed by pipeline to
the Golden Sunlight Mine mill facility.
Flow measurements taken from the
discharge line are low (approximately 1-
3 gpm).
Groundwater, Surface Water and Pit Water
Open Pit
Pit water expected to be characteristic of ARD
Capture and treatment - no pit lake allowed to form
Mitigations to prevent significant off-site impacts from ARD
WQ Monitoring: Monitoring of pit water indicates ARD characteristics
The ARD characteristics of the pit water have been well documented. Since the pit was developed below the water table, the pit closure plan has required dewatering and treatment.
Sierra Club v. EPA 18cv3472 NDCA
A5
Tier 5
ED 002061 00090629-00116
LReeascphoantseeasntdo GTarobulend25w.1ate(Ar ppendix B) - Summary of Potential, Predicted and Actual Impacts and Mitigations at the Flambeau Mine, Wisconsin: Pit
Resource Source PImopteancttisal
Mitigations
PImrepdaiccttsed Actual Impacts RESPONSE: Actual Impacts
1990 EIS
Pit Backfill
Pit
Pit backfill will
Backfilling to
Pit backfill will Four monitoring
Increases in some parameters in groundwater in the
Leachate
backfill eliminate pit
eliminate
eliminate pit wells in the
backfill were predicted as noted. The pit is the area of the
waters
possibility of a pit waters.
backfilled pit show mine where the system was designed to re-equilibrate and
lake. Liming of
Predicted
exceedences of was not required to have parameters below groundwater
backfill.
leachate
drinking water
drinking water standards.
concentration standards for Fe,
in pit backfill was 0.014
Mn, pH SO4 , and TDS. One in-pit
Annual Reports from 2005 to 2009 are available from www.flambeaumine.com. The 2009 Annual Report
mg/l copper, well shows
(Section 4.1.1) notes "SRK Consulting performed annual
0.32 mg/l
continued
assessments reviewing results from the 2001,2002, 2003,
iron, 0.725
increasing or
2004, 2005, 2006, 2007, 2008 and 2009 monitoring of
mg/l
elevated
pore water quality. The monitoring results and
manganese, concentrations of assessments confirm the findings presented in the year
and 1,360 mg/l sulfate
Fe, SO4 , TDS, and Mn; other
2000 monitoring results assessment. An annual assessment was again performed by SRK Consulting
wells show
reviewing the results from the 2009 monitoring of pore
decreasing
water quality. The February 2010 memorandum,
concentrations.
Flambeau Project - Backfilled Pit 2009 Monitoring Results
is found in Appendix A. The results from the 2009
monitoring period generally are in agreement with the
results from previous years and support the conclusions
previously identified. In general, the results indicate that
the objectives of the lime amendment program had been
met and that any acidity that had been present in the
waste rock has been neutralized. The results further
indicate that concentrations of major ions in the pore water
are stable. For most of the backfill porewater, sulfate
concentrations are controlled by gypsum
dissolution/precipitation. However, isolated zones are
developing where backfill gypsum equilibrium conditions
do not exist (e.g. around well MW-1014C). The results
provide ample evidence that the porewater in these areas
is being displaced by inflowing groundwater. For example,
concentrations of sulfate and other solutes are decreasing
around Well MW-1014C, without any evidence that
precipitation reactions are causing the decrease.
Sierra Club v. EPA 18cv3472 NDCA
A6
Tier 5
ED 002061 00090629-00117
LReeascphoantseeasntdo GTarobulend25w.1ate(Ar ppendix B) - Summary of Potential, Predicted and Actual Impacts and Mitigations at the Flambeau Mine, Wisconsin: Pit
Resource Source PImopteancttisal
Mitigations
PImrepdaiccttsed Actual Impacts RESPONSE: Actual Impacts
This 2009 Annual Report also includes a map of monitoring locations, trend analyses, and statistics.
Groundwater
Pit backfill
Waste rock from the mining operation would have the potential to leach contaminants to groundwater.
High sulfur waste stockpiles and ore crushing/loading areas lined. Treatment of mine water before discharge; Liming of backfill. Settling ponds to collect runoff from low sulfur stockpiles
Slightly increased TDS, hardness, SO4 , Fe, Mn may be expected from leachate infiltration. No impacts from high sulfur stockpile, ore crushing areas. Worstcase leakage would leak into mine pit where water would be treated before discharge. Groundwater under ponds flows to pit, limiting contamination
Samples taken from a well between the river and the pit show exceedences of drinking water standards for Fe (2.8-7.4 mg/), Mn (3.1-4.2 mg/l), pH (5.9-6.2), SO4 (250-460 mg/l), and TDS (8101,100 mg/l)
Section 4.1.1 of the 2009 Annual Report also states: "As part of the permitting effort for the Flambeau project, assessments were completed to determine if the reclaimed site would comply with the permitted groundwater quality standards at the compliance boundary and protect surface water quality in the Flambeau River. The original assessment relied on predicted post-mining hydrologic conditions to conclude that the Flambeau River would act as a hydrologic boundary for the pore water migrating from the pit backfill and that backfill pore water would not migrate to the downgradient compliance boundary. In addition, the original analysis showed that the flux of backfill pore water into the river would be so small relative to the flow in the river that surface water quality would not experience a measurable change.
Section 2.2 of the 2009 Annual Report summarizes groundwater quality assessments as follows: "Assessments of the backfill groundwater quality have been routinely performed with the most recent being completed in January 2010. The assessments show that the regional groundwater flow, including backfill water, is flowing toward the Flambeau River as was predicted during permitting; stable conditions have been reached at depth within the backfill; manganese concentrations appear to have stabilized or are decreasing over the last three years; any acidity that had been present in the backfill has been neutralized by the limestone; sulfate concentrations in the majority of the backfill are now controlled by gypsum precipitation and dissolution; and concentrations of solutes in the backfill are stable and should not significantly increase in the future and, in fact, many are showing a decreasing trend. Further detail on
Sierra Club v. EPA 18cv3472 NDCA
AI Tier 5
ED 002061 00090629-00118
LReeascphoantseeasntdo GTarobulend25w.1ate(Ar ppendix B) - Summary of Potential, Predicted and Actual Impacts and Mitigations at the Flambeau Mine, Wisconsin: Pit
Resource Source PImopteancttisal
Mitigations
PImrepdaiccttsed Actual Impacts RESPONSE: Actual Impacts
groundwater quality can be found in Section 4 of this
report."
Data for all wells are also provided in appendices to the 2009 Annual Report.
Sierra Club v. EPA 18cv3472 NDCA
A8
Tier 5
ED 002061 00090629-00119