Document 1QLK7XqnDor68JJ3GQbyMNdOm

_--_-- AR 286 -- 1365 Study Title TENNESSEE RIVER VALLEY SAMPLES Author Mark E. Ellefson Study Completion Date 17 December 2002 Revised Report 06 January 2003 PerfoWMrEmnviionogmentLlaLabboroatroray tory Bukdng 235.00 536Bush Aver Spal MN S510 Project Identification 3M Environmental Laboratory Study # E02-0443 Total Number of Pages 75 001750 ree Repo Ei 0us eee eee -- . Ten.RieVataSaris . TAOFBCONLTENETS LISEOUTOIO.....cocsssessssssnessennees PY Purpose. s----------------. Test andAnalyticalReference SUDSIENGES......vvvrvrreenseenr TESUSYBIOMS ..c.cocoosssssssmeeseennene MNO SUMTEIES........c.cecsssssssneeenne 8 PIOPATBIONYMODOGS.......ccnsssssomnsseeese 8 ABYC MORO... 12 ABI RESUS... 13 DBESUTIEY cocoons 20 SESHCAIMOUS...25 StatementofConclusion s---------- I ROEIBNCES....c.cocorssssssssneneeneseseeennre 28 LtOFARBONMIS...c.cnsssssseronne28 SIGE PAS... 21 AttachmentA:AnalyticalMethodand SOPDEVBIONS........c.rn 28 ABCA 8: D318SUMTY TODS... 40 AMGENC: SAME CHIOMSIOGIANS ...vvvenrn 67 tachmenDt:SamplePrepSheets, TestSubstance, andTestSystem NGL ..............230 AtacEh:Nmoleestno t Fi.. J meses 270 0017s; ------------e ReportE02.0043 eee. "Tom.RiverValleySamples LisT OF TABLES `Table 1. Sample Location, SampleType, and ANalYYCal Dat SUTITLY.......c......ovonrn5. `Table 2: CharacterizationoftheTest and AnalyticalReference SUbSNGES. ............c..v...6 `Table3a.DescriptionofFishTissue Analyzed if th SY ......e..crcvscnsnninTn `Table3b. Descriptionof RiverWaterANalYZed inthis SIUY .......v.curernssnnn `Table 3c.Description ofRiver SedimentsAnalyzed ihthis SIUJY .....crcrcevunccsusnnsT `Table 4a. FishTissueSAMPIePreparation MOthOd..........m.ceourmmesesencssnnns `Table 4b. Preparation ofExtracted CalibrationCUIVESfor heFish TISSUE. ..............c.crmn8. Tabledc.FishTissueAnalyticalData QUalty OBCEVES...............roresescssenimns `Table4d. RiverWater Sample Preparation Method .......v.rusmesescsnsinmon Tablede.RiverWater Sample Data Quay Oblectves ............. sna 10 `Table41. RiverSedimentSamplePrparation Method................wmsesesessescn 10 `Table4g.River SedimentSample Data Quay ObJECHVS..............c...... I Table5. SampleAnalysis InfOMAON....cc.. cmon -- Table6a. PFOSCalibrationStandard REproGESSINGSUMHTENY .........cvsessnsmnn 14. `Table6b. FOSACalibrationStandardReprocessing SUMMAIY ........eurweusnn 15 `Table6c. PFOACalibrationStandardReproGESSINg SUTITAIY ............corsvsvruneseno 16 Table6d. PFHSCalibration Standard Reprocessing Summary.. pam 7 `TableGe. PFBS Calibration Standard Reprocessing SUMMA .............c.cusere 18 Table 7a. Catfish ANBIVHCal DAR. .crrvvsnrovsnnmnonnsnsns ssn: 21 Table 7b. Large mouthand Small mouthBassANGI DAA. ......coreconnensnncni 22. Table 7c. RiverWaterAnalytiDcataa.l ................ sennmmsmemmsssmssmi3 Table 7d. RiverSedimentANaltcalData. ........... sn 24 `Tabl8e. Sample Location, SampleType, and AnalyticalData SUTMAIY...............ces 25 v03:52 _--mmmm Report 02043 Ten,RiverVaty Sapes ) cemeteri ----e ----s -- STUDY INFORMATION Requestor 3DaMleEnLvBiraocnomenntal Laboratory 3Bl5dgBu2s9h6-A0v9enue 6S5t1P.a7u7l8,.M47N3655106 MSatrukdEy.DiErlelceftsoorn B3lMdgE.n2v-i3r6o-n0m9ental Laboratory S93t5PaBuuls,hMANve5n5u1e06 851-778-5405 Study Location 3TeMstEinnvgiFraocnimletnytal Laboratory 9Bl3d5g.Bu2s-3h6A-v09enue St Paul, MN 55106 `MWairlkiaLm. KA_ndReerasgoenn,,ALnaabloytriactaolryChMeamniasgter `COignndjyenM.kaCKarrulpsloann,iAnn,alAyntailyctailcCahleCmhiesmtist Experimental Dates ``SSaammppllee AAnnaallyyssiiss ICnoimtipaltieotn:io2n6: 1J2unNeo2v0e0m2ber 2002 Locationof Archives `Aalccoorridgiinnagl troa3wMdaSttaanadnadrtdh OpreerpaotritnhgaPvreocbeedeunreasr.chiRveemdaaitntihneg 3sMpeEcnivmiernosnmpeenrttaailniLnagbotoratthoery tanhaelqyutailciatlypohfatsheeopfretphairasttiuodnyawfiolrbdesaervaclhuiavteidona.t the 3M Environmental Laboratory for as long as 001753 -_----m---- -- m--m--m---- Reger E020u3 Tom. River Vatay Sales _ SUMMARY TFiesnhn,ersivseerweatReirve,rnaenadrrtihvee s3eMdiDmeecantturs,amApllaebsawmearfeaccioltlyl.ectTehdefrsoammptiherseweelorcoaatnioanlsynzetdhefor p(aneParFlfOyiAso)er.sobpweuertrfaeunoearcsoucoiocftmoapnnaietsehse(uiPdfFobBnySy)ei,xatmprieadrceifiu(nogOrStoAhe)e,xSaaanmepnisouplsefruofsnuaiotnrego(SoPocFtiHadSn)Pe,hsaupsleferofnEuaxottreroa(ocPctFitoOanSn)o(.aStPeTE)heand then analyzing them using HPLC-Electospray/Mass Spectrometry (HPLOES/MS) WrSaaomsmpaltcihrneogfsasLcoitclhateytrnieeosnaerr1vtoh(iSerLf-F1ro)oxwmCartsheeelok3cMcaotneffdalcnuleetnaycreo.utthael3.MSafmapclitnogutlfaolcl.atoSnam3p(lSiLn-g3)Lowcaastidoonw2ns(tSLr-e2a)m Analytical resuls are presented n Table 1 Table 1. Sample Location,SampleTyps,and Analytical Data Summary. oy S`pSeacmipeisnSgaLmopclaetdio&n. [ETE [e] pris [Le PFOA at LTS [CZ --t SLAC (n=6) SL2.C (n=7) soa <U0Q <ioa <lo0 loa loa 09 13 toa <iioa EER (NCIC <loa <a loa oa <ioa 43 lice <troa 223 [5] ROSA ROSA lca lca <ioa _ <oa <ioo ion ion 281 ica <ioa EEC loc ica <0 <ioa <Log J Pres I PrHs I pron ES CE EE 4 196 <ioq 5 550 <ioa 25 io Zo] <iog EE <iioa 7 <iloa lio io River Scdimnts, [ (bg/g) PrHS [2 PFOA 2) fosa pros Rr EER PE 17 ra 130 732 <loa loa 1440 a1 3130 as7 sL3. Rs a2 <uog 131 & 418 2 numberosfh pr sampling re 001754 Reson 22043 Torn.Ror ValeSampin --- PURPOSE taThnhedeTPpeuRnrOnpeSosssienesoepfotRrhitivsecrsatunugedhayrtifDsiestchoa,ptieuvrre,frowArlamatbeqaruma,anai.tnadtirivveerscsreedeinmienngtsforfrPoFmBtSh,rePeFsHaSm,plPiFnOgAl,ocFatOiSoAns, of _ TEST AND ANALYTICAL REFERENCE SUBSTANCES 0000 Tabl2e: Characterizationofthe TestandAnalyticalReference Substances. ELN R Mion Itai `Compound [Co3MmpLaeboCroatnodriyons EN [EY LN PHPeSrf,uoarsheranesufonate|FPPOeoSrruAeorooctanesuon- | FPPeFrOrfAu,cirotoctanoete 3BMldSg.pe2c3i6-a2l8y-M1a1lerisls, |3BiMdSg.pe23c6a-l1y8-M1a0tera, |3BMldgS.p2e3a6-t1y8-M1a0tias, [Frozen [F[ reer ren] L or a prr Uiesmned 50%2708 | Compound |[Sei| [StwrmossCondtoWnensthcaton Bm| [Phoboscitin PSFoBnSa,tPeotassium Perfucrobutane | PPeFrOfSu,crPooocstasnuesmufonate "3M Speciaty Materials, Bic [Frozen Fragen |Wniecosas | vm rowse 001755 -_-- wou rnartes . 0 TEST SYSTEMS Table3a.DoctofFi TsunArsyzdi thleSty [serce TT reomsorver "yes Eo SCrCateofitshoodthBaesse -- ams DoresbsomvBoYr [[ ome mmDor wanT eForr] Gsk *The fish werefilited and representativealiquots ofthe fillets were analyzed. Table3b.Description ofRiverWaterAnalyzed InthisStudy [mEo mEs me = Dwosur DenrSTePesFeboo] oravCmrmaarll Tube.Deronof versacri Anstyed hieSy [o[[ ommoeempi mmHra DamosevDomrrasT erem sFebooraoGnveFRnoaRrs| 001756 eee: Repo E020043 Ton. RiverVateySamples - METHOD SUMMARIES R`LiiTvqheueircdSoCehdnricommeeannttotsgwrreaaorptefhyidP-eFoEtBlneSers,cmtiPrnFoeHsdSpbr,yauPysMFiaOnsAgs,SSoFplOeicSdtAPr,ohmaaenstderEyPx(FtrHOaPScLtCiinIoEnFiS(sMShSPT)Ei.)ssauned, RHiivgehrPWeartfeorr,maanndce - PREPARATORY METHODS * `sTWahamtepeflro,lelpaornwedipnRagirtavatebirloSensemdeesdtchrioidbm.seaetmhpenlseatsm.pDlaetpraepQauraatliyoOnbmjeectthiovdessfo(rDtQhOe)FairsehaTlissosguiev,eRnifvoerreach Fish Tissue Sample Proparation Method Table 4a. FishTissue SampleProparaMtetihoond st rr -- |[TAshoepuhroomdsomghaeepenhayot2emeowfganesnFadcthaerTiausgveodaonsdimadt.sofAhSeTfoMaTmypaond1 tenrshwaekraonhhorioexmedog>e | [| Eraxrsfhaoirnogo1m.r0te oefshosmoageanadloto 3seepairatcea1r5pmii.ncTohnvtaigsssiscs.ore W(Mo4ar)rs1p.i0kkmeeidsow(f4hhSom)1ow0g0eeurnLaoptfreew1pa.ar0seuagfnohrsi.evepemreykdlthoseacnhchotohnmecrgo1ne5tnmaiaLnticn.geIennatcahgocefatushese,ef.oTtSh3e0M8S's substances. [|sh5a0kmeLnoffora2c0amoinnirew0a0spme.naddedoecenbfuge bes.The beswarscappaendd `Asluapremabtianng. hesampleswasGriiged a 3000 fo10 ines o ary [7|Teesmemarive dwrid rowSO orgswossn nodwrml WAWoaeperarsspilmaCac1etd6loyTir1o0vuanccououfmnme,rtaShnaeknpekPiawskaas1na,d6dpdcre-dScoPotnEhdceioacinroedm1wshiaehnadbcohhwo eivnadgc7aa0 rwrer.sesapopnfed. ``WmOLa)ns.ooWmrhoysetnsommfoatlshlteammeot4uhsanwntceoftswhaaputlbeeedfeinonpuuglhehed,msovarcuovowh,a,AahSrowTsaMisoTpayccopdceek1wdi(at1se0rmmwe)ad.s1Wadh5deepndi(t5rh.es10 TVa hAGesuvpesmatae hnettscfwoao oksme.scetu Tpchoe7lwicsecoirnm.pTsahswseeecdroenioonutsagkhwoewhsedap1rl.-ec9oc0nd.oonyedfoSaPElcaosurSsi.ntTohne. [0]ThoSessahteesrewpaerrateihondwdashoremsrefSorPbEecrosrancswiuthn2t0,tmec,fsmpaeaedr,oe.lo autos] 001757 _-- Repo E020443 Toon.ReeVetey Sump Table4b. ProparationofExtractedCalibration CurvesfortheFishTissue, BE TE pr--r~ ReTanhndeogrgeeewfnerodrunstgweoevxeepxsearocifmtehenedtFsnwiesahrTesdso.nuTohtecona,dbroeaneoenrLacerugwrevhMeiosc:uhLtFairoBgheeTsMisosauutnehsoBnansdsCaahnetidoaCwaesfsairphle Mo`untiohaiBiannsghtseshccaaeltlabsataturmonocaucaconvutrenvt.oefse.nTdhoegeSnmoaulsleMosutshuBbsatasnwceasswesnraesvzeedcsgathheeLmaragtete fTSaahmeppleresoriceumpraarteaitcfio.ornTp,rheeoxpadcreifnpgtlhheeoveoxrtkrmraaeecatnssewdcelcroaeolwsbssrca:atolndivetospirsotvhi saamameoagsetnheeoFuisshbsaukeof [|eApprovimaie 10 of FishTissueand40mLofASTIType TWarwereGombinedand [ [2 5| E0acmhtoofwhoemsosgpeinseidswwianstvhanprseidreotderimoinheedampoupntroof ppikre iscavfttenbes Table4c.FishTissue AnalyticalDataQualkty Objectives, Stee DeTe erm WReacoxverspyiksehsowukedrbepeitoi d+3o0n%hfolm fexphecfihedovfekssaecs. yAootFaolromf a10cmhastarpsinpgheoswcseiro.n `pWrteorlporacHrtdanropktr,hoccoeFrsissswihseirTneigpssrouefepasanarmlepudleowsit.hosfawmaplloesrfnomreoaucghhsaroirnegslSocratlon.pWraeplaarabtiaonnk3nsd ccoonnstiaidneirnsgs<ccaLpLiOabQlo,feachan for det stn ich eywereurwar LEGLxaOaQc0ot,f cwHaaacrnhakpsnr,aocpoansriefsdotrfitonhrgeedocfaahansaemtpunicntgiofcrchaltthihaoenny.cwElesrutsascBioawnehbraoracpkrosncscodnotrnaedidntioanngcsed<pStPaEie [5[Wipm osworesb odsacoo ve rne| + RiverWaterSample Preparation Mothod Table 4d.River WatarSampleProparation Mathod BE EE -- AWpWpeorrroxspiClm-aet1deloTynst1o0nmvcaiscouonfuammlem,hSaeapnn-cdPaswkaas1na5d,d6pd0re0-dScPotEnhdceicoinotednsnswhiahlstocw0hivendga7cr0aarmwerer.esseprvpolires. `WOmaLn)s.anmWlohysetnosmfmotashlteamomfeotfuhsnawtnoacfshwpaautdleberdefnipulghlhed,mheosoeurvgowhra,,tAehSroTsaMosTpycaapccekdv| W(a5ts1e0mrmow)ad.saWodhsdoeepd(b5oh.er1s0 2Va0cmoftttheheRcivoerVmi.toTrhweascoplausmnsswbee weralowedtodyforato mien, otsrowsecdonigoondsydSPEcali Thacomes [3 hoanaeswar oko om he conn wih 20miof thasrlmovi 001758 -------------------------------- sso YoSeve arin Taiode.RiverWit SampleDtCuttyOtjctes ef eke oan nr es epreha oyaeym errde Srnentc N--eeaimeCsE vwasaSReSoa oa T TT A ig s [51 Noma spikesworeproormedduring hosampleproperatooftheRive Warsamples. * RiverSedimentSamplePreparaMteithoond Taio. RverSSalooPrmapaeaonnMetthod FE aaene ieneptemsrreeepeotpotem oee wre Hoo TSAarSoEorrE eFp miRahToei 3 FhA a [owrsavircolpsvr |=]`Matrixspikeswerepreparedb yadding sv 100ulof parr 1.0 ug/ml spikesokstion rrr or to the. [5|TVheayswseareCeTrthsnTecooncicraogedi aSnto6pl0P0as0RdGe FrorS2c0Emosrna ie.ed bo G Bas weagTrarer, Tpemyoteehsameear npisAe e leeenrhi eAStTTeyA pes Wocr ia0150 Tl FSE ea rar Es T TemLeaberebseentneSeRePeaaodrvcnae SPcioa A TTa hoecohlociesd methTannolwsassthernaodded1o0napp peximaiS ely200mBEofAaSTMType 1Wer [io s SPEcominFov ntrm rs] woul So eee ReponEn20u3 Torn, RverVataSamples Table4g. RiverSediment SampleDataQualty Objectives B= LE Te pry WAliaimpslpeksowsewreroepprpaerredeinopnaeatc.hsTahmpele%.RRSoOcsovheoryudsbhoou5d2b5o%w.i 230%of expectedvakes. u"psTrewocodlebsebcacanoudnsaantashlaeydmzapeltdeawssi,uChgtogheressitanlwoefs,spwiekmrpooswpaarilotiepecroreri.eecHdoFvreorosukiwtedoaeSnoamrivaosieoranomcwraakcskn,iofted WaaxlttaoocrrtwBoahrnekpnrsov,ceceorsnsss,oiwdsemirneegnoptrfweaapnsanaroelt.oAptcrceosefepwntatat:belrervuanlFuveoswugehre< G4riLLpOrGepfaoratthiocnaatnsein which heywernoin TchuroveR.iMvearcSoevdemacnatbraamtipolnecsuwrevreopouiasrwiaeireedusedng83aGnoorv-eo.dracedshartSon -_-- 00 SAMPLE ANALYSIS TEOhntvheiesrroSnaymsetnmteamwlspeLrUaseblioanrngaaetlHoPyrLzsyCeM-deEutlsheiocndtgrEHoTPsSLp-Cr5Ia-Ey1SM5Ia5M.s1Ss."STpehAcatrnoamnaeoaltyfrtyWli"acasyltmeesStthrioedaswma,WsabtaesredEoxtnractthseo3fM o`fTheeafcohlslaowmipnlget.able details sample run information, including the sequence and therunstartdate. Tabl8e. SampleAnalysisinformation. [sit | ooeoew | 2eunce | taveMounBass [Sz | oes| aumoz | [3] [ Ss Sraiosheess T7615 | owes | zune comes| zoumoz | | [s [ t TTS owmwee ||T eamgmea || 2A 02 FuverSedments [ST [7TSz | ee |one| eerie| taNvez | [so Te | ee nw | 001.60 _--_----m-- Repo E0204 : Ton. RiveVateySales _-- ANALYTICAL METHOD Sample a`OntahleyrzSeaydnsautlseiymnssgisHUwsPaiLnsCgbEaHSPsLIeCdM-SoElnieEncTttShre-o8sn-pe1gra5aty5i/.vM1ea"soAsnnSamploeycsdtiers.oomfPeWtFarBsyS"t,.eSPMtFerHteSha,amnP,olWFaeOxt,terraFcEOtxstSrwAaecratsendOr M1Pi0Fz0O0=Sn4gl1e3avne(alPisFywOteeAr/)me,..emvaTzlhu=eatt4ae9rd8gve(etFriOsouSnsAs)wc,aelarbnerdaatsmi/ofnzosl=t4oaw9ns9d:ar(vdPzsFOr=Sa)n2.g9i9Tnhg(eiPnaFncSao)lny,cteminctzarlam=t3eiot0nh8ofrd(oPmFuHs1Se-)d, fionrdiavniadluyalsiisnsistrpurmeesnetnst.ed below; maifcatons may be necessary 1 optimize the method for Analytical Equipment `ALnCiaoqlluyuitmdincCathlercmoopmleruaamttnou:grrKe:eayp3sh0t:oAnCgeleBnettHaeswiilTMetC:isPa2c+k5a0rmdm,SeSryiemsp1a1rt0i0clLeisqiuzied Chromatograph system FCylcolwerTatiem;e:3090.5yLm/imniuntes MInojbeicltieopn hvaosleumceo:m4potnoe2n0 ts: `SSoollvveennttAB:: H2.0PLmCMGarmamdeonMietuhmanaocletate in water Solvent Gradient T0i0m0e 810% 008500 6100%% 535500 110000%% 865500 1100%% `MSaofstswaSrpe:ecAtgirloemnettGehre:mASgtiaetntoHne"wlAe.t0i8-.0P3ackard Series 1100 APMass Spectrometer Detector Fragmentor Voltage: mmzz 239999== 110200VV. . mmlzz 449183== 81000VV mz 499.= 140V GCaapiilnl=ar1y0VoEaMgVe.: 4000 V GMoadseT:emEpleercartousrper:ay35Ne0gaCtive: NDreybiunigzeGarsP:re8s.s0urem:in3.0 psig Analysis Type: Single lon Monitoring (SIM) vo1761 _--m Report 220043 Toon.RiverVatey Sales _ ANALYTICAL RESULTS Dataqualtyobjectivesoutined inthePreparationMethodssectionweremet. + icmRueprgrvroeevsseshiaqoudannlste.iatsaQttui-aosndqrouaavtreiercittchsuerocvfoen0c.fie9tn9wt0arosartaigporpenlaitreeard.ntgoeacpapiroorpariioantestfaontdhaerddastaa.ndAslalmcpalliebdraattiaonto + vC1a0l0oi0brlnaogt/ufimo1Lnm0SwuteeLa.rneIdunasrsedodsm.foe Sithnestctalaiabnrcarttaenihnosegn1,icd.nu0grinvgeans/c.moLnr.Tcsehtndtarsnatdtaasinroddnawrfadrsocmuirnavjpeepcrptoeodxianitmtsatshemaladyllae1nr.vito0nojleuctmieons s(c1tu,ar2nv,deasarnwddewr5eeruleu)nc,abtlecifusolrawetaeesdv.deorHnyiaegnhta-oleyentxditcceaunlrdsveteqhupeoelinonctwsee.tnhdaPotefrwtceehrneotcodauellivsbiiradatetiiotonhnseoc:ufr2vs0ea.%chcCracilatlbeirribaartaoitfoitnonhe tWaerrgeeotuctosnciednettrhaetio1n20w%ecrereeixcalwuedredoifnrcolmutdheedciurtvheeccaulrcvulactailocnusl.atLioowns-benudtecxucrlvuedpeodinftrsomthtahte LowerLimit ofQuanttation (LLOG), + wCmiaottnhrtaiixnicuamilinibogrfaCtail2oin0b%crhaedtecivokinawtVaiasornfaionfcaatlthyiezoetndar(agCteCtlVec)ao.sntFceeonvrterrqayutaitnoetnnists.aatmivpeldeestteormmionnaittioornsI,nsatrmuimde-lnetvaelldif, + LcaolwiberratLioinmicturovfeQ,uwaintthiataetvieolnof(aLcLcOuQr)a.cyThweithLiLnO2Q0w%a,stheaqtuadlemtoontshierlaolweedstasrteasnpdoanrsdeingrtehaeter than two times th responseof analyte i the bank samples ScyalsitbreatmionSucluarbvlelkttoy.meFaivseursyesttheem-psruectiasbiiolntoyfstthanrdeatrednstiwoenrteimaenaslaynzdedpebeafkoarreeeaa.chThineital precision criterion of 5%fo the mean arearecoverywas achieved. LainbforCmoantitornolwaSspinkoetsus(LeCdS)b.ecLaCuSseswtheerdeatpaersfuogrgmeesdtfetodhit ewaRsiviemrpoSsesdiibmleenttos.recHoovweervsepri,ktehde = `analytes from acidifiedwaterwhen riversedimentwas not present. Matrix Spikes (MS). Maur spikes were performed for the Fish Tissue and the River h`Siesdcirmietnertiasamples. Desirable mati spike recoverios aro 30%. Not all matrix spikes met caTanhldeibRrFaiitvsiehornSTiecsudsriuvmeeedrnaattnsagaewtmahpsaletqsuwaanwsteirtieanjtqeeucdateundstiiwnaagtseadnfrueosximtnr1gancutgneiedxmctLarltaiobcr1ea0dt0ico0aninclgur/ramvtLeo,nwbhcuiutrlhvetesh.eraRTnihvgeeeruWsaetder `daimlfeoetnrhgeodwd.itLhTowhbeaetrtcahLbiulmiestseodtfhaQtnudfaonttlhioeawtacinoaonlntyas(iiLnseLdOtaQht)ee.rfotrThhteheecsaalanimabplrayltteieospfnroesrptaearnaadctaihrodnsoarmtmephtlheeoasdaLmepLalcOehQplrowecipalatrboanetion annotated in the tables. 001762 _-- co zoss [-- Table8a. POSCalbration StandardReproceSsusmimanrgy PFOS CONCENTRATION [Coemmear ||o me mom C |e y Ce]ro | [[[eiEmmmiam| ||m mmmaminm on | o ioommms]]] [[[ mormee os|||r t ooomo msa miimns oees :| | ie a s zons | ]| CC[TTC|E T o oomom anr r m ersrs] [CC om ss| mTmre nem| an] [p | naas m| a som | eseon e7n nd105.Wap 08 Fon oS ren 001763 | ------------------------------------------------ -- Yo Sowvinysum Table FOSAClbratonStandardRaprocessingSummary ES [|omcmomeos| |oow ome mwas| |mawamwns e|| [[ocmovommoemsna|| ocmommamvonas| | am sows | | [tat sa| [moan sis| wommma | oanmance | sw sown | | [moms as| [oman| mms oman | | som ame | | I I [[Coowmesr || wommanzmaanse || memr]| I I TCXL NT [means EE | meizaion CT | or CT | [prP--si--on--|--we-- ao-- m| --eww----| -- 001764 _--_-- rn -- Tat.PRONClbrtonSant proses [[[ocCemoomameersr|||oommmmmamonwwaea| | | asuowmm]]| [[ [ mmom m|||ii ooommmmmn mnmmmim imoaasi | | |e m ssamos wa m]]| [[ ([ remmam r |||o o i ommemnm aam nma | |a s eos] n os mm]] [I oweos| sm CiTmam| EwTore] [ [Co[o movmaw eerrss ae] ] [ E o | TmaTmw e a| s snr] mm grrr co176s - raion ro vyre 4.7 corto setpss uy [|[CCcooommmeeesrs| ||ocomwmmmmmmnnam|e | assmm]]] [[[mEiimmmmmoiosa||o ommmamm n| | ie ooommeye]]] [I[mE ECrmosa||o N monm n ||T ome sm]] [Ie[ Eve o st|| om mrwmmnirv mnoza|i msas n]] [[ECroemes [were |||| m m ceommmmaa r m |m] ] me r] rone155Sea or arene 001766 | -------------- J, to orre Table Ge.PFBSCalibration StandardReprocessingSummary [[cCoJeEmomeess |o owm n | |eusaonn wm ee|| [[Ceomemner|| ommamnanea| | [mmimoms | mmr oowm] w| [[nE oimeis ||o oE m mron n||T i e armia s s]| [o[ wwess|C |ocom mor nmn z|| i m wmwes ee] [[CCoovmemnies||o owmmmo| |amiinmmme ess]] [ [ po oov-- m ||s me-- eammmmmear| | =mm --s --tnmo--mrs ss]--] -- 001767 ReportE02.0443 eee eee Torn.RiverVateySamgien Blanks. * Mmethe od bola fanmkess t,hMoidlu lb-aQckwragtreoruentda.kIenntthhriosuegh xthepsoliedtphhreaysweieerxetmlraacbeteiloenndparsotc"eWs,sE,.pOronveidsedeta `fwuanswpithrtheeCaftpofriseahascarhmlpolceaetsi.donA.cIcenptthaebFliesvhaTliusessufeoprotrhteibolnaonfktshweeerxpselreismsetnhta,nth5e0y%woefrtehe LowerLimitOfQuantitation (LLOQ). All methodbianksinthis studymethiscriterion. TcharetrFiidsgehsT.iTshsueesseewgemreenltaobfeltehdeaexspe"rSBi"maenndtaciosnosciosntteadionfemdemtehtahnoodltblhaantwkasfsourstehdetSoPE `extract blanks mperet-tchoendpirteivoinoeudsccorlituemrinosn.that did not have any sample added. Al ofthese method + S5coo0nl%tvoaemnfittnbhalteiaoLnnko.sw/eMArectcLheimapinttoalObblfleQaunsaoknlstvie(tnmattebitolhnaann(kdLslLOmiQun)js.etctciAoolnnltso)afipntrholeevviseodllesvdeoanfttmabrlgaeentkasanaiolnsfytithneiussltsertrsuusmdtyeehnmatent this criterion except the following: Ntohteecr-itSeorliaveanrtsnBoltarnekcstohradtewdeberleobwe.foretheSystem Suitabiltyinjections anddidnotpass. WDe0r2e06c2a6useexdtrbayctceadmsyaomvpelrefsro0m05h0ig(hPerFlSe,vePl FsHtaSn,daarnddcPuFrvOeA)poianntsd. that were run after these points showed minimal camyover. 0051 The (PFHS). solvent These blanks. w'Da0s2c06a2u8sesdambpylcear0r0y5o1ve(rPfFrBoSm,tPhFeHhSi,gh-alnedvePlFsOtAa)n,da0r0d5c2ur(vPeFHpSoi)n,t.anTdh0e06so3lv(ePnFtHbSl)a.nksT.his thatwere run after showed minimal camyover. ('DP0F2H0S6,29PFsOaAmp,laensd0P0F5O9S)(.PFHTSh,isPwFaOsA,caFuOsSeAd,byancdamPyFoOvSe)r,f0r0o6m0hi(gPh-FlOe)ve,l asntadn0d0a6rd1 efcfuercvte opnoitnhtes. qTuahlety0o0f6t1hMeedtahtaan.oTlhBelannekxthsaadmaplsieghniafdictarnatcleevaemloofunatnsaolyftaensalbuyttethiasnhdwadanso tbheelosawmtphlee.LLTOhQefnoerxatllsaonlavleynttesb.lanTkhe(r0e0f6o7r)e,htahden0o0m6i1naMleatnhaalnyotle Bcloancnekndtirdatniootn.influence 'D020702 samples (POS),Thiswas 0c0a4u2se(dPFbOySc)a,mr0y0o5v9er(fFroHmSthaendhiPghF-OlSev)e,l 0s0ta6n0d(aPrFdOcSu)r,veanpodin0t0.61The solvent blanks that were runaftershowed minimal carryover. c'aD0m2y0o8v1e2r(Af)rosmahmipghleersl0ev0e1l6 s(tPaFnOdaArdancdurFvOeSpAo)inatsndor0s0y3s1t(ePmFsOuAit)a.bTilhtey spoeinwtes.reTchaeussoeldvebnyt (blPaFnOkAs)thaantdw0er0e39ru(nPFaBftSe,r tPhFeHsSe,poainndtsPsFhOoAw)edhamdinciamnayl-ocvaenryofvreorm.saSmapmlpesl.esSu0b0s3e7quent blanks showed minimal contamination. 0103291(1F1O2SAs)a,mp0l6e6,s0(1P2FO(APFaBnSd, FPOFSOAA),, a0n6d8 F(OFSOASA)),,0a2n7d(0F7B1S(,FOPSFAO)A., AalndofFtOhSeAs)e,can be attributed to canryover from high-level standards or samples. 001768 --_--_--Pm,,,,,,eee--eeeeo-- ReportE0204 Torn.RiverValeySamples _-- DATA SUMMARY ``aTvaebrlaegse7daa,t7abf,o7rcs,aamnpdle7gdprroeuspse.nRtetphreesdeatnataftoirviendcividhual rsampolesm.arTaaebplrteas8eonstuemgdmiarnriAlzteaascthhmmeenst C. T`saabmlpelses7.a,A7lbs,oi7ncc,laundded7adreditshpelaayvetrheagone-ccoolnucmneanntdrcaofrtoreircoteeandcshcsonecteonftrsaatmipolnessfosrtiannddiavriddual dceviaotionr,foanrmdi%leuCiooencf/fcioctniceennettorfaVdtaorinatfaicotno,rwshienntraopdpulciecdabdluer.inTghseamipnlalevparleupeasrrateiponoarntdaerbydeinjection ``vaolbumbe drifefevraeinrceaeas.tsfiTolholeonwrsse:poSrLted--vSaalmuepslewLeorceatniootna,djCusCtaetdffiosrhM,aLtrMix--SLpairkgeeRmeocuovtehrbieass.s,TSheM. -- Small mouth bass, RW- River Water, andRS ~ River Sediment. 001769 E EE EE------ Report E02.0043 Tom.RiverVall Sapien Table 7a. Catfish Analytical Data. PA 42777 [SLAG] LC CFeSNEAA <Lloa 17000 1 10a| 59 ser ey Nt Ca3 TS iz Te ssuutiiccriaz|[ waiiooaa|| wiocna|| acowna|| 532 | SLica1| ion| aoa| <moa [ie ss2s0 e3ax|| 1100s0 ws as 11005 55700% ssuuirccaasz|[ wwiicoaa|| cwocna || iacoaa|| 3462 sSLuir.cees1|| wwooan|| owoaa|| wwoona|| T71o a1r szaew 78577es || e7r0 Tmowr 7 SsCurrCc4srs|| sucez| waooaa|| woa | c0u0caa || won | wmeoaa| woa| T|av 37 w ns arae| %7 im| w[Tar oe 1752 10s s15a6x7 8e2l SsCuii.cCee1s|| <atooaa|| suicsz [ awoa| iacoaa|| awiocaa| <ioa | aoa| [3edT a1 suicsy| aoa| aca | won| an Ssw:omsea|| ieers o7s arml| 76 i8os 2T0os% 02 17 sSLuii.cceezr |[ suices| awooaa|| wioa| owoo <uco ||| <awooaa [ wea| [rso 7o @we1ss oeas|| 8508 om| so wnes a7 577 10057% SsCiZzcCiiz [ suzc13| <wiooaa|| aoa| owooo || woo | eaoona|| won| awiooad woe o<iiaoq won SsLtzzcCe21z| stzcza| <wooaa|| oa| owwaoa || woa | <wtooaa|| won | <wiooad wea waooaa oa sSCtzzcC31z]| suzcs| awooaa|| aoa| <<wIooaa || Soa | weoonn|| aica| <<ooad woe <1u0oaa <uoa sStzzcCe41z| stzces| <wiooaa|| woo| <<wiooaa || awoa | w<ooaa|| aca| <wiiooaa oa owoaa uoa ssSttzazccCssaisz||| wwaooonaa||| wowooaoa ||| "weuoosana||| <owaod Sioa <auooaa <uoa TH|SssLtt2z2Ccceeetsz||| w<wioooona||| a<wioooaae||| aG<wLoooaea||| S<w1it0ooa3a wwoooas sSLt2z.cCr7a1z|| sizc7a| a<Lwoaa|| won| <wo0a || aoa | w<tooaa|| woo| a<icoaa woe T<uooaa woa ssSttaaaic.caiaz|| wotioaoaa||| <aSwowoaaa ||| <awioooasa||| <<ioioaa Sida T1S9 ia 1T"E7Deo27n75 sSt3acCe21z|| stycas| wtooaa || won | w<wooaa|| woo | awrooaa|| wea | i<icioaa G08 Tiz iz 1T1Es oTuT 22 37% sSLtIacCasiz| stacss| 0woaa| won| omoaa || won | wwioona|| i<icoaa aioe| disa o<uqoa <uoca ssSCut3saccCaeastz||| wwaIoo0aoa||| 1aw0coaaa||| w<wooaa|| wee| <wioioaa Sod 3375 pr] 3=1 277a2 4 Tw sSLi33.cCsez1|| stscss| <woona || oa | wooaa || aoa | owoaa|| woe | <<toioqa oa pwroeay <woa ssStsSaccCseezs|| aaooonan||| <iIocoaaa||| woooaan||| o<<iidooaq . 001770 _ ~ Report 02043 -- Tom.RiverVatey Sales Tabl 7b.Largemouthand SmallmouthBassAnalyticalData. . mameI gC el gmT (ge) SssLutTrLoWe-wsT||| a4d4io0oa0a||1 <adLoiL0aaG||| waSeooaaa ssSiuTirwwwzazzs||| <0iiciaoaa||| <iidcoaa||| <<oiiiacoaa SssCuuTrr.w0wiwssszsT||| oo10aa0||| <oduiodoa||| twroeoaaa SssCiTu.truwkeeTsz||| di1ic0oa0a||| oqaa<tLoa||| oesa aton SssUuTu.vruDmeessszs||| <dd0io10oa0||| do<ilcoae0||| wi1o0cd0a SssCuTt.voo0vees1ss||| <<ciu1co0aa0||| <odioacae||| <woiotdoaa SsscuzzzOmuniwtzs||| ai1oc0aa0||| <w<wwooaaa||| raGoo6aa3 SsstttazzwMwe22z1zs||| 1dqi0oo0ao||| <woooaae||| <6<uwiidooaa Ssizaiomwssz|| stze33| ooaa|| oa| waioooe|| quod| <<iiooaa won Ust2z sta Mwezt|| vees| d1i0oan|| aioe| a<o0a|| dice| "iwooodna SssCi3uauWeeiisrz||| <<u0o0a|| soa| <ai0oe|| woe| <wieoaq Sioa sstuasTww2irzs|| w[iiociaao||aT<wotiaoe|a|T<a$ti4eo6qa3 SssC3aaewwTs||| 1ad0ii0ca||| <waooosaa||| a6wiodoae Csst3aawwwaTsz||| <aiot0a0|| dca| <oitaoa|| woe| <oiiaoa soa WB| sSs0t3aaOwwwsse2||| <iaoocaaa||| wodooaaa||| iatooaa wea $sstu3aswiwissTsz|| [os1i0ac0a||| <wwooaan||| wSa1io8oe8a SsCiSau0i7r1z|| suse| 1a0o0a|| cuca| <wioiosa|| woe| o<itaod wed Ussit3ayssSwurrwzs||| <dtuiosoaan||| <owioiaosa||| t4ioo6aa3 Cor 23 r[e a g:e) ogcgv ww<uoeonaa || rwweooe iweos ie 238 we wwoooaon || |e5ed2 e5 n om 2wr5 se wwwoooeoo || [mhsr me eeea 0T2w sx ws | odwooaaa | [[emeyrs eTeemw 8277%% awwoooaaa || [4wss ss aaes 0= 82% wWcuoacoa ||| ess smoe mseme awrs 3% <wStotaoaa ||| <ww0eeaaa wswuocaoa || iSizcgeas ms wSooao | v[eeT woo | 8s wgiTs er 6Tw7 wm waooa woa || B ssiv ressae 2=0 7% <wtiaoa | suoa | [d<oiaq woe dSworoa || aSoiae owwooaen ||| <wdiioosane Swioona dca || | wteraa woe w<dtoaoaa ||| w<cuoecaaa Twsooaaa ||| dwGiiotdaoe woscaaa||| ww<witoooaaa o<wietaoaa||| twwoooaas 001771 I SO Tal7c.RoneWtAnte i JI B d=-om |e,mehe || [3usrgory mn [Ce JC] py y E|a,ene | |i _--y =- I oe Seyern = eC LET s3FB8o0ll2t5 I wShore |Be2IZ1S3 oom07 ==o55n0 J=ou oa{mm,ea ||| o1Lmhae eT dV) M mm Fl I ETE = =i Le | m Ca w = EmieIeeee || ae a" CesaTTraomepEOads-- o ls--20 x-- ccdsr oslaee,--a p-- en, n-- d clb--ron to match the appropriate analytical rafnoregxtreactsed samples, matrix `spikes, and calibration 001772 | ReportE020443 "Torn RoverVaySamples Table 7d.RiverSedimentAnalyticalData. 1s 3004Nka1m,e501 PFBS108(ng/g) 300442501 108 Vol. 5n3glg) 53 50re 0 Se0t5 |300u5413,,55L113 e045 | 3a0452.503 1w3s5 a3 a67 a oEny as sais |330000448s,, 5523 1500 300482)5L2 82 5so 31 Poary Eq LSE 300E48T3.T5U2 OnC1ol7umn Adjusteid]for. Ey Adustedaor Sample [) 3300044402,5S1L1 300443, SLT 227s 25 1T3a 12 3= 24 sSoouuss sous | | |SewassT2.sSsL|I| wousasis| aLo0a8 dion wooaa uca wooaa soa sSoocukeet2,s5iz0|7| ssoe3sia| a<Looaa aoa pro)a <uoa wiooe pr po ad SNaommpele POFnOCAol(nugming) AdVojl.u(snfgto/gre)ndj, Adj[uesfotreeSadmple 330800446421,S5U1T1 300443, 5U1 56127 781 55 a80 ot es00o0as0s ||ss[amS0oaaesss32is55us33|| 2AU80a ice pr1e3g ica 1o31a icq dSeosis |[Ssmmeoee2isSizz|| 30 |sao s2| a<tooaa io ooaa won u<Iooaa oa hI s Home On05Col5u0m)n AdysVedol (tnoryian)y. Adys[terd fior Sample 3p300r004o0613t,55a11)1 32229s47 1a202 i146z8200 s3S0oa0ut4ss5 |||3S3a0a0o04ua6512.sSSU1sS3 1T2T 17 00%8 08 @ a sSoooukse soi || ssea0ddse2,. | se0483. SSuzz 52 2235 32 1T3s is 2Tw ot UF SE ime X FOS (nglg) eVol.TinTgloe)Yrvrroe r era s38o00u4 |330a004e-a1z,5S1t sous |sansSU 7703 04 3318 22 3383000 220 soSaoiooiksss |||33330m000444585132,,.55UU333 5os 01 pry as awo os 3S0e0i4s6 || 338m004a66,2 SS1L2T sous | sanaes siz 85s0 105 a5 53 a5s 525 pEA A 184% =" a10r% siiw Avp erage. so d. D 1[)0 o%a wwooaa opraey Averagei. oSint. D p72ro %o <uToIa caoaa o<uaca AvSeragEe. Std C 0i20o 2a sTaor 2i%" E wes rT are 3123)0 Tie 1a0% w=o 1% 001773 _-- zn So me P wr T ---- Table8. SampleLocation,Sample Type,andAnalyticalDataSummary. Es EES iso PEaER LC Ci io DOlE -- enter cotsnett y wSots cv sdcin STATISTICAL METHODS et ns sn 001774 ---------------------------------------------------------------------------------------------- Roper 02443 Torn River Vali Samos STATEMENT OF CONCLUSION Fish Tissue: PFiFsOhSt.isFsiusehotbitsasiuneeodbftraoimneSdafmrpolmeSLaomcpaltieonLo1cactoinotnasin2eadnqdua3ntciofnitaablieneldevqeulasntoiffPiaFbOlAe,leFvOelSsAo,f PanFdOS only. River Water: PWFaOtSe.r fWraotmeSraombpaliinnegdLofcraotmiosnam1pcloentLaioncedaquta2niiaiofnindab3slecloenvtelasinoefdPqFuBanSi,ifPiFabHlSe,lePvFelOsAo,fFPOFSHAS,oannlyd. River Sedimants: PRiFvOeAr,SeFcOiSmAe,ntaonbdtPaiFnOeSd.atRSiavemrplSeedLiomceanttioonb1tacionnetdaiatnesdaqmupalnetiLfoicaablteiolnev2elcsoonftaPiFnBeSd,quPaFntHiSf,iable `lqeuvaenltsifoifabPlFelBeSv,elFsoOSfAP,FaBnSd,PPFFOOSA,, FRiOvSeAr,SeadnidmPeFntOSo.btained al sample Location 3 contained REFERENCES 1. S3yMstEenvmisroUnsmienngtHalPLMCe-tEhloedciErToSs-p8r-a1y55M.a1ss"ASnpaelcytsriosmoeftrWya"ste Stream, WalerExtrOarcOtthesr LIST OF ATTACHMENTS Attachment A: Analytical Method and SOP Deviations Attachment B: DataSummaryTables. + Atiachment C: Sample Chromatograms + Attachment D: Semple Prep Sheets, Test Subsiance, and Test System Information + Atachment E: Noles to Fie REPORT REVISIONS `TThyepongurampbheircaolfefmisohrssafmorpltheeduartiteadceshilgoncaattoirosnfwoersTaabllseosa1d,dGead-e{,6 T7aa,bl7ebs, 71da,nadnd. 8 were corrected. 004778 eeeeeree-------------- Report E2043 Tou.RiverVatey Samples SIGNATURE PAGE Wecertythattisreportis atrueandcompleterepresentationofthedataforthi study: KE. Elefson, Study Director 2/2,bs Date Wr-- Wiliam K_Reagen, Testing Facity Management 0/04/63 Date 001776 J ---- Repon02043 +=. TennRiverVeySamples ATTACHMENAT: ANALYTICAL METHOD AND SOP DEVIATIONS red _--_-- Root E02043 ee <n. Torn Rive Vatey Sales Document may be used, ifcurrent, for 14 days from 11/21/2002 2E 3MM EN NVIV RONMI ENTR ALLLAO BOORRN AATTOOM RRYY E~N ~~TAL MetrOD ANALYSIS OF WA'SHTPLECS-TERLEEACMT,ROWSAPTREARY/EMASXS ST PEOCRTRROOTAMHEETCRRYSYTSTESMS USING Method Number: ETS-8-155.1 Adoption Date: {1/12/50 Author: MaskL.Anderson,MarkE. Ellefson RevisionDate: S/30/0( Approved By: LabZ oratoi ry Manager -- A [2 sDhmo, 5/30 fo) 001778 ------------e ----e ----e -------------------------- Repent 02.00) _ Tern River VeySais Document may be used,ifcurrent, for 14 days from 11/21/2002 o1s 0 SCOPEANDAiPPiLICATION 11 Scope: Thismethoddescrthieabnaelysssofwast steam,watersamporlotehesr 1.1.1 stSapnecdiafridc(san)aalyntdeost,hieornpsa,rmaamlertiecerss,vsiolllvebnetdse,fsionleudtiionnst,hquparloittoyccoolntorrotlhs,esiantmeprlnael: preparation worksheel(s). 12 Applicable Compounds: Electrospray ionizable compounds. 13 Matrices: 1.3.1 syWsastteemsSotrraeasmdsaensidgoattheedrisnytshteepmrsomtaocyocloonrssisatmopflaeqpureepoaursaatnido/nowroorrkgsahneiccts(osl.vent 132 sWoaltuetironSsa.mTplheesmiantclruidxewtialpbweadteef,ingerdobunydtwhaetperro,twoacsotleovirastaemrpalnedportehpearraaqtuioenous worksheel(s). 2S 280 O SummM ARY M orMerA aOD R oY eOTMETROR 21 elTehcitsrmoesptrhaoydmdaessscrsipbeecsttrhoemaentarlyys(iHsPoLfCe-lEecSt/rMoSsp)r.aTyhioenainzaalbylseicsoimsppouendrs,fusobinyrgtHhmPeLmeCa-dss selection ofa singleioncharacteristicof a partculer compound. 30 Deevrions 31 `AqtumaodsrupphoelreiscysPtreemsssuarleloIwonfiozravtairoinou(sAPmIe)t:hoCodmsmoefirocniiazlaltyioanvabiylaubtlieliHzPinLgCa-vEarSi/eMtySosfingle Tsoniozatiuopnro(rbEeSsD,)c,anAdteimnotsesprhfeacr,eisc.PTrheesssueriencchleumdiecbaultIaornieznaottiolnim(iAtPeedlt)o,:TEhleercmtorsospprraayy, tc. Tvhaecuiuonmi.zation itheseprocessesoccurs a atmosphericpressure(i,notundera 32 Electrospray Ionization (ES, ESD: A methodofionizationperformed at atmospheric pdrreospsluertse.,wThheerseedbryopiloentssianrseolpurtoidounacreedtbrayntshfeerarpepdlticoatthioengoafspa htarsoenvgiaelteicntyrcichaalrfgieeldd. 33 sMiansglseSqpueacdtrruopmoleetemras(sMSs)e:leCctoimvmeedrectiecatlolrys.maTnounfsaacrteusreeldecMteSdsoynsttheemsbaasriesoefqumiapspsedtowith charge rato (m/z) and subsequently detected. 34 MspieccrifoimcaospserMataisosnoLfyannx/HPHLPC-ChEeSm/SMtSa.tiPolneaSsoefrtewfaerret:o tShyestmeamnusaolftfwoarrtehedesspiegciafcidcfor the instrument software. SM Envi Ltenory em EE 001779 Pgszarto --e -- e-------------------- Repo EC2.0043 __ Tem. RiverVateySales Document may be used,ifcurrent, for 14 days from 11/21/2002 2W 400 a WARNm INGSw ANDCAo UTIONs S AwCavwors 41 Health and Safety Warnings: 41.1 thUespercoabuteieomnpwliotyhsthaevovlotlataggeeocfaablpespfrorothxe ilemc5ta0ro0ts0pVeroalylipyr.obe. When engaged, 412 Wahndeenyheawnedalri.ngsamplesorsolventswearappropriateprotectiveclothing,gloves, 42 Cautions: 42.1 Obapcekrparteesosluvreeaetxcpeuemdps4s0b0eblaorw, atbheaHcPk1p1r00ewsiolslfu4irn0iet0iabtaerau(t5o8m0a0tpisc)s.huItfdtohwen. 422 Do not run solvent pumps to dryness. 50 InteRneezRences 51 Tstoormaigneoimriaznsyipanrttofienstrruwmfheennetaatrniaolneytzhinantgsccaommepelseissn,cToenftlaocntwsithhthoneostuabmeplluesodedrefxotrrsaacmtp.le 60 ELouLrment 61 `Emqoudiifpimceantitolnisstiendbtheelroawwmdaaytab2esmmoedtihfoideddievnioartdieonrst. optimizethesys.Documentany 6.1.1 MelieccrtoromsapsrsayPlfaotnfiozramtoLnCsZouMrcaes.s Spectrometer (orequivalent) equipped with an 6:12 HauPtLo1s0a0lmopwlpoeurlseqeusiovlavleennttpHuPmLpC,ssyosltveemn.t degasser, column compartment, and R 70 surries wo Mareniass i 71 Supplies 7.11 Highpuritygrade trogen gasregulatedtoapproximately 100psi (or bousaier system). 7.12 HsiPzeL)Coraneaqluyitviaclaelntc.olumn,suchas a Betasil C18column (S0x2mn, umparticle 7.13 Capped autovialsorcapped 1SmLcentrifuge tubes. 80 REAGENTSAND STANDARDS 81 Reagents: 8.11 MetHPhLCagran deoroequilvale,nt. EiraLoser reir EE ~ 001780 Psat Rope 02.03 eet ------ Tom.RiverVateySales . Documentmaybe used,if current,for 14daysfrom 11/21/2002 812 M`wialtelr-oQrTMeqwuaitvearle(ntA,SaTnMdtmyapyebI)e,parlolwvaitdeedrubsyeadMiinltlhii-sQmTeOthCoPdlsuhsosuylsdtbeemMoirll-QTM anotherveador. 813 Ammoniumacetate, reagentgradeorequivalent. 8131 Whenpreparingdiffeentamountsthanthoselisted,adjustaccordingly. 8132 a2m0mmonMiaummmacoentiatuem.aPcoeutartoestooluat2i0o0n0:WLevioglhumaeptprriocxfilmaastke,layd0d3th0e0 g S`taopprreoaprtiraoteovmotleummpeeroaftMuriel.li-Qwater,mix untilallsolidsaedissolved. 8.14 pOrtetpearcsaotlivoennwtosraknsdheseoltu.tionsmaybeusedassatedintheprotocolorthesample 82 Calibration Standards: 82.1 Toyfpi5csaolllvyetntwsotmaentdharoddsabrleaannkas(lMyizleldiw-iQtwhaetaec)h,gtrwooumpaotfrsiaxmbpllaensk.s,and aminimum 290A SammsBADLING eee 914 Scetnatnrdiafrudgseatnudbepsroorpoatrhcedrssaumiptalbelsemcoanytbaeinestrosruendtiilncaanaplpyesids.autovials,capped15mL. 92 Iafpapnraolxyismiastweilly b4edCeulaatyielda,nasltyasndeascrdasnabnedpperrefpoarrmeedsda(rmepflreigsemraatyorbteermepferriagteurraetsedmaatyhave: a detrimental affect on the solubilityofsaturated solutions). 100 Quay ContRoL 104 Blanks: 0.1.1 Solversblanks,methodblanks,andmats bias areproparedandanalyzedwith eachsampleset odeterminecontamionracatrryiovoern. 10.LLL `WihteeartohreHsPtLuCdygmraatdreicoersgcaonniscissotlvoefahtisg,htlhyepumreitfhioeddseonldvemnattsrsiuxbclhaansksTympaey1 bereprbyeassingelesnolvtentbeladnk. 10.1.2S`oanldvmeanttrbilxabnlkasnskhsosuhlodubledabneaalnyazleydzperdiaofrtteoretahecihnctailiablrcaatliiobnractuironvec.uMrevtebhuotdpbrliaonrktso the study samples. necessary. Ifcamryover is aproblem, consecutive solventblanksmaybe: 102 MatrixSpikes: 10.2.1tMhaetstiuxdsyp)iaknedsamnaaylbyzeepdrteopadreetdefromirneeaecxhtsraecttoifoenexftfriacciteendscya.mples(ifspplicableto ME Ltomory rEr E any 001781 Psedotio ---------------- ee--er--e ---------------------- Repon E020043 Ten. RiveVeySamples Document may be used,if current, for 14 days from 11/21/2002 1022Maastsroicixastpeidkweidthutphelainaclmyasaitsy.ebsepreparedperitoomdeaisurcethaeplreclisiyon 10.23aAnsatlhyezoeritghienmaalstarmipxlsep.ikeandmatixspikeduplicate ifprepared)inthesame run 10.2.4Mraatnrgieoxsfptihkienaintidamlactalriibxrsaptiioknedcuuprlviecoartsechoonuclednbtreaptrieopnasrsehdoautl1d.f5a-l5itintmhesetmhied- `leonwd-orgaenngoeuosfctohnecennittraalticoanloifbrtahteioanncaluyrtvee.iSfpeixktercemeolynlcowelenvetlssahrroeuaelxtdpfeiacltloiendnt.hse 103 Continuing CalibrationVerifications: 103.1 Caonticnuiocngfctauhleibcraraltiibornaatvieorncicfiucryavtei.ons (CCV)areanalyzedtoverifythecontinued 1032A`nalmyzeiaomfinod-preiapnegrezscaalmiupblreastmieotn.standardafte everytenthsample,with a 104 InternalStandard/SurrogateStandard: 10.4.1eAsntaibnltiesrhnianlgsatraenldaatridon(s1Sh)impbaeytbweeeunstehdtroaqtuiaoontfiatnyatlhytetraergseptoannsaelyttoes1Sbryesponse aanndamaokunsotwtnhactwoilnalcweitohfnintththeeamnriadla-yrtaetongfieiontfoetrehsnetc.alTihbreaItSiosn churvoeb.eTushpeilkIeSddat shouldbeaddedaftertheextractionprocess andbeforeanalysis. 10.42 qAuasnutrirtoagtaitveesltyeavnadlauradtmeathyebenetuisreedanfaolryqtuiaclailtpyrcoocnetdroulr.eiTnhcleusdiungrsarmopilsgeu:saetdteo sapmrpleeppreapararnaadtiatonnailayonsdsn.shTohueldsfulrrlowgiattheisnhtohueldlobwetsopmiikde-draatntgheeobfetghinencianligborfattihoen curve. 110 CALIBANDRSTAANDTARIDIZOATINON 111 Atnwaolsytzanedtahredsctuarnvdeasrdmacuyrbveespprliootrtetdobyanlidfnoelalroewgirnegscsaiconh(syet=omfxsam+pbl)ewse.iTghheleadveLxr,aorgoef cqaulaidbrraattiiocnitc(uryv=esasxh'o+ulbdxno+tc)buesfionrgcMeadtshsrLoyunghxzoerroot.hersuitablesoftware. The 11.1.1 Tcrhietercilao.siInfgocnlyathlefirisctucbruvrervmeaasyubsteedei,xtchloeucdanelidbirfatthioenCandsCtamnedsV artdaiczc'aetpitoansble: paramareettheesarmes. 112 I`fmatihnetienintainacecaorlipbrreaptairoencaunrevwedsoteasnndaortdmcuerevtaec(ciefpnetcaenscseacrriyt)erainadpreeranfaolryrzeo.utine 113 For purposesofaccuracy when quantitatinglow levelsofanalyte, itmaybenecessaryto usethe lowend ofthecalibration curveratherthanthefull ange. Example: when SM Evian sors rir i SE"LES " Pessor10aro 00178,2 e e ee ee------------------ Report E020443 .. Ten.RiverValey Sales `Document may be used, if current, for 14 days from 11/21/2002 caotntseimspttiinnggotfotqhueasnttaintadtaerdaspfprrooxmim5aptpelbyto1100p0pbpopfbraantalhyetret,hagnenetrhaetuelalcraalnigberaotfitohn eccuurvreve: o(5fphipgbhtocon1c0e0n0tprpabt)i.onTshtiasndwairdlsr.educe inaccuracyattributedto linearregression weighting 11.4 Hoviegrhtahnedl/ionrealroawnpogienatpspmroapyribseteextcoltuhdeeddaftraomottbheeccaaulsiebtrhateiyodnicdunrvoetsmteoeptrtohveidpereab-etterfit aderteeacromuinntesdaacrceenpottaantcleecarsietrwii.ceLtohwat-loefvtehlemceurtvhepoodibnltasnskhso.ulJdualssobteiexffcoilruecdxecadliutfstiihoenoiornf calibrationcurvepoiats willbenotedinthe rawdata. 11.4.1 Aminimumof 5pointswil beusedtoconstructthecalibrationcurve. = 120 P_Poroceeoutmes Pow 12.1 Aicnqsutirsuimteinotn.sAectt-uua-lpppalreaasmeetreerfserweinlclebtehreeScOorPdetdhaotnpetrhteaiinnssttroutmheenstpperciinftiocuts. 12.11 Sethetsamuplep list. 12.0.1.1 iAnssstirgunmeansta(mTpfloorliTsutcSkelre)n,atmheeuyseianrg(t0h0effiorrs2t0l0e0tt)e,rotfhethmeonnatmhe(o04fftohreApril), `laisntditshemdadaeyo(ntThe0sa0mfeo1draO0yc,tu1osbe2eirn1c2r,ea2s0i0n0g olentTtuercskoefrt)h.eIaflmphoarbeetthsatnaotinneg with A at the endofthe list 12.112 Asamsethiod (gMS)fnle. 12.113 Assign an HPLC program (Inlet il). 12.114 Type in sample descripatnidovinasl position numbers. 12.12 Tspoeccrteraotmeetaermheethaoddi,ngclsiacnkodsnemleetcthSoIdRi.nStehteAicquoistniomniocodnzetar3oaalpppatrnoeplirtihaeotnemanansds `amdadsistioon4t9o tohreoStIhResr.aSpapveraocqpuirsmiiatsaisotensem.etAhfoudl.lSseceanthiseusMuiaclrloymcaossllMeacstsieLdnynx `GUIDE TO DATA ACQUISITION for additional information. 12.1.3 Tsytpaincdaalrdlsy.theanalyticalbatchrunsequencebeginsandendswithasetofsolvent 12.1.4 aSfatmeprleevserayreteanntahlsyazmepdlew.ithSaoclovnetnitnbulianngkscaslhioburladtiboen avenrailfyizceadtipoenr(ioCdCiVca)lliynjteocted `monitor forpossibleanalyte carryover. 122 Using the Autosampler/Column Heater : 12.2.1 Place sample vials Section 12.11. into the sample tray according to the sample list prepared in. 001783 SM Env"ironmentLibrary romerE Pass otto _--_--nmme Report Ex2.0063 Toon Rive Valey Sampies Document may be used,if current, for 14 days from 11/21/2002 122.2tAhtetsawcihttchheipnrgovpaelrvaen,aelnystuircealtchaotlthuemtnubtihnegicsorluunmtnohetahteaeprpcroompprairattmepeonrtt.s.If using 123 Using the Tnlet Editor 123.1S`ceotnsuipdterhseaHpP11p00rufsoionrgpotpthrifmoialllroaewsipntogcnoesned.iRteicoonsrdoacatucaolncdoitniodnis tthienoanntahsleyst instrumentlogbook: 12301 Samplesize= 10pL injection 12312 Flowrate =300 uLimin. 123.13 Cycle time= 10.0 minutes 123.14 Mobile phase components: SoSlolvveenntt AB:: 2M.e0tmhaMnAol (mMeOmH)oAcentatieinuWatmer Solvent Gradient: 0T.i0m0e (min) %B 500% 100 450 500% 950% 800 850 95.0% 500% 100 Stop 124 Instrument Set-up 12.4.1 'REeTfSe-r9t-o36t,he"POlpaetrfaotrimonLaCnZd UMsaeirn'tsenGuaindcee,oftthehMeaMsiscLryonmxasNsTPlUastefro'rsmGLuiCdZe, the E instrlumenet. ctSperctroometesr",opthreSOaPthyatpe/rtaiMnstoathesspecisfic 12.42 Check thesolventlevel in reservoies aad rolIf necessary. 12.4.3 eCyheepciekcteh.eTihpeotfitphsehosutalidnbleesfslsattowoil tcahpinollajrayggaedtehdegeensd.ofItfhtheepfrpoibse with an foutno bde unsatisfactory, disassembletheprobeandreplace the stainless secl capillary. 12.4.4 Tum on the nebulizing gas. 12.4.5 Open the tune page. Click on `Operate' to initiate the desolvation heaters. 12.46 Openthe Inlet Editor. 12461 SetHPLC pumpto"On". 12.462 Set the solvent low to the desired flow rate. 12.463 `Oebxspeelrlveedwdirtophl0et0snceobmuinlgizouigtnaogsftlheaktipnogfatrhoeunpdrtohbee.tipAoffitnheempirsotbseh.ould be Readjst th ipofthe probeif no mist is observed. vo17sq MEnea ory SE Peratio ee Report Ec2.0us ------------------------------------------------------ <-. Tem.River VatoySamples: Document may be used,if current, for 14 days from 11/21/2002 12464 Allowtoequilifborrataletaset 10 minutes. 12.4.7Tmhaeyicnhsatnrguemeinntoursdeesrtthoesoepptairmiazmeettheersraetstpohnesfeo.lAlcowtiunaglspetaingrs.aThvmeisleelsbetetrieencgorsrdsed ontheinstrumentprintouts. 1247.1 Drying gas 250425 liters/hour 12472 ESnebulizing gas 10-15 ltershour 124.73 HPLCconsfltowamondet, flowrate 10 500 WL/min 12474 PHrePsLsCurieso<p4e0ratbianrg(coTrhriesctpleyr.a)meterisnotsetit is aguidetocasurethe 12475 Source Block temperature 150, 124.16 Desolvation temperature 250, 12.48Psrpienctttrhoemtetuenreipnafogremwaittiohn,tsapnadraalmleottehresr,atphpelIinclaebtplaeignef,osrammaptlioenlasntd,smtaosrsit inthe studybinderwithcopiestaped itotheinstrumentrun logbook. 1248.1 Alcopiesmustbeiniiasndldaetedd. 1249sCalmipckloennutmabretrbsutetnocnoomnptahses aMlalsssaLmypnlxesttooolbbeara.naElnyszuerde.beginanndeindningg 13.0 DATAANANADCLALYCUSLATIIOSNS 131 Calculations (including, but not limited to): 13.0.1 Calculate matrix spike percent recoveries using the following equation: % Recovery= OBbsearvecdReksulgt rouRnesudlt x 100 `Expected Result 13.12 Calculate percentdifferenceusingthe following equation: %Differenc=e ExpConee.-CcalcutlateedCodne. x 100 `Expected Conc. 13.13Calculateactual concentrationofanalyte in matrix (g/mL: On-Column Concentration (ug/L) x Dilution Factors = Calculated Concentration 14.0 METHOD PERFORMANCE. 14.1 TahnealLytiemsi,ttohefQLOuQaconncetnti(raLttOioQan)iitsssmeielteohctoendd,asathne loawaensldtmaacytcreipttxsapbeelceinf,oinc-.zFeorro smtaannydard in the calibration curve. 001785 SM EniooraLavosry rig EEE nen Peteio Report02044 <2. Tom.RiverVateySampes - Documentmaybeused,ifcurrent,for 14daysfrom 11/21/2002 142 cSaollivberanttiaonndcumrevteh.odblankareacountsmustbe < %tha ofthe lowestsandardusedinthe 143 oTrheecoqeffui0ci0ae.n9t8lo0.fdetermination (7)valueforthecalibration curvemustbegreaterthan 144 sCtoanntdianrudicnognCcaelnitbrraattiioonn.Verification(CCV)percentrecoveriesmustbe + 30%ofthe 145 InternalStandardrecoveriesshouldbewithin + 50%ofthespikedconcentration. 146 pIeafrncafrlioytsretmr.ieadDloisnteotdhienstc yhasiltlseamu mcettaihnom dnossdipaneme trpfhloeersn rmraawenadcnateatslaey.czteidoonraortehneoratcmteito,nmsaaindteetnearnmcienmedabyybothe 147 1fofodtantoatiesdtoonbteabrleepsoartnedddwihsecnuspseerdfionrtmhanecteecxrtoitfetrhiaehraepvoernt.otbeenmet,thedatamustbe 150 POLLUTIONPREVANEDWANSTETMAI NAGOEMENNT 15.1 SglaamspslpoipeextttreawcatswtaestiesdainsdpofsleadmimnabblreoskoelnvgelnatsisscdoinstpaoinseerdsinlohciatgehdiBnTtUhceonltaabiornaetrosr,ya.nd Tp 15166.101 EB_aoRcehcpoparagogessggerneereatteeddfoorree asstuadymeuesthavethefollowingine formationincluded eitherin thinetheegraadteiornormehtahnoddw,rsitatmepnleonntamhee,paegxetr:ascttuiodnyodartper,odjielcuttniounmbfaecrt,oarc(qifuiasppiltiicoanbmlee)t,haondd., analyst. 162 1rPr0uiinnntlctolhguebdoteouiknn.etphaegaep,spamrploelpssttr,udiaycfqaouiltsdieetri.oCnomeptyhtohedasenpdaaglelostahnedrtaapppleiicnatbolteihnfinosrtmrautmieonnt. 163 Plotthecalibrationcurvethenprinthesegraphsandstoreinthestudyfolder. 164 sPtriundtydbaitnadienrt.egration summary,integrationmethod,andchromatograms andfleinthe 165 Summarize datausingsuitablesoftwareendstoreinthestudybinder. 16.6 bBaacckke-du-puepleelcetcrtornoincidcadtaattaoianptphreopsrtiuadtyebmineddeiru.m.Recordthefile namesand locationof 167 loDotc#u'ms,enptuarttiyo,enxopfiraantailoynte,(asn)dansdtoarlalgerceofnedrietniceonssu.bstances will inctralcemuumbderes, D1A 70 M _ATraE caMENTs 17.1 None MEmin Lavon rome EEE ee 001786 Pessorto Report 02043 ET -- Document may be used,if current, for 14 days from 11/21/2002 1-8_--0 Rereexces 18.1 PSlRaZtf;oorrmFlLoCatZsRUoseard',sWGyutihdeen,MsihcarwoemMa2s3sU9KLZL;imUintiteedd,TKuidnogrdRooma.d,Altrincham, WAL4 182 MSassRoLryZFnlxoNa;tTs URsoeard',sWGuyitdeh,eMnicsrhoamMaw2se3sU9KLZL;imUintietde,dTKuidnogrdRooma.d,Altrincham, WAL4 183 AMlatsrsiLnycnhxamN,TWAG1ui4deSTRZo;oDarFtlaoAactqsuiRsoiatido,n,WyMtihcernosmhaaswseUMK2L3im9iLtZe;dU,TniutdeodrKRionagdd,om. 184 EEqTuSi-9p.p3e4d.w0i,t"hOpaerMaatsisonSpaencdtrMoamientteernDaentceecotofrHaenwdlleotrtaPPahcoktarodDiHoPdLeCAr1r1a0y0DSeytsectteomr", 185 EElTeSc-t9r-o3s6p.r0a,y/"OMpaesrsSapteicotnaronmdetMer"a. inofttheeMincroamasnsPlcatfoerm LCZ = 199 _ArrecraneDoceumeents 19.1 Nome 200 Revisions Revision `Number -- ~ Reason For Revision TT ReDavteise 1 Sectio1n:`EconmlmaerngtesdtbhoeuctosppeecoiffTtihcipermaCemthehatonergsbowyiilnlcblueddienfgiandedditionhaelmpraottioccas Asproepasdhdeeetds. 09Mayol S`SSeeecctctiitooinnos33n::1RC4eh2amdno2:gvReeeddtmpooravalgeloadwprehffeeorrneenCncoetnvytoensrpteiscoinsf!incvdic.aomZfp:oaSuprnad,ysp.robe eric. SSeeccttioo3nn::BArdodaeddepnaerdaghroatpyhpaelsoowfisaorafogetcohntuaoinoefrsaahnerdmctoinvdeistoilovne.nts sadsouions. Section10: Adsdedtcaomnmdueanpptlsidtcaobaillsliotwy.fo flexibility ingualycontrolsfrdiffrottypesof SSeeccttiioonn 1111:; AAddddeedd aappaarraaggrraapphhs(l1o1.w4i)nagllfoowritnhgfeeoxrctlhueddirnogpopfitnhgeosfccounrvde numcburv epoinrts oneedfed. pcuorvtes. and misma SSeeccttiioonn 1122;: CAodmdeecdtceodmmnuemnbtesritnoge.frenc he specificSOP's orsetup. SSeeccttiioonn1186:: AAddddeeddpreafreargernacpehtoonthreecmoertdhsoodfferntlhyoesHeanwdlseu-bPsatcaknacreds.LOMS. SMEmon Libasey room SER vo17s7 Paet0srio Reson Eczaues <-. Tom.AverVay Sampies Record of Deviation I. Identification Study / Project No. Deviation Type: (Check one) IN River Valley E02-0443 asop BMethod 0 Equipment Procedure DOProtocol 0 Other: `Document Number: ETS-4-04.0 " Date(s)ofoccurrence: [Tune Fos = prt 1. Description: : Arco hRaenqduliirnegdsParmopcleedsurteolrpercoocredstsh:e_EmToSv-e4m-0e4n,t0ofsetchtoisone 4sasmtaptlees,so"nItitshtehientreersnpaolncshiabiinltooyfcfusatnyoodnye BIE, cee oreo ere meee er OR Actual Procedure/process: the courseofthis study. The intemal } chainof custody forms were not generated or used in . A |s No ai dditionalactieoenwill(ibechtaaksena,maetlnihld.emeAinnctftoiirsomsnautseid,oTnaSkcOaePnnn:rotbeerveciaeltlsce)disoo1onng a,fter the Fact Recorded By: oo ome - Coe fn) 7 IV. Impact on St/uPrdojeyct Date: Tie m This deviation does not adversely affect the quality of the data, ~~ 1 Authorized By:(StudyDirector.|ProjectLead) Date: ra: lS ~ 2 SUI7s8 SYEmon Latartory / dy SudDistrooroPvitatoLnoNoT , ___|_ ; A _ | BE ---- Reso E020us - ATTACHMENT B: DATA SUMMARY TABLES [SO -- 001789 : i Sere TaiiannEEE H BRUSie SaEsE s es ss aEEpEpEaemsiFaEaeEn sEra TesEa Y EEL SHE asian E SSEooETI eraR5IsENBIeNFLeESi: i EEEIEEE i vo190 S SE eEem EaE a | EEEEEE Bo tim mk mene Semen EOEORLTELIRLY Lo 4AIS If RISE GS vo i= |i 001791 | Bee sais Ei Esr Eese i ree aeET BE E En EEr NRRENIN , EEESEERIRIRIRS i i 001792 : i | SESE es Rs REa IELT FEE= ER RR ER SR Ea i i TEES EE Ei Ee msSead i EEE SENN REN 001793 Ff Ere CTLTTETT i or a El ll ll i Wind nd [Sess somes |=2 22 58(S8 |=& 001794 i | i hh 001795 | fm TE eee | BEES idEi ! ii : i 001796 ee a EERE Erie oo HETLT TTT g PEER mm SENERNES aiES (Em il 5R2TAp2a |El -- i] [SoCe ame mmmeare H ny 3m | tm ti| a B (EEEEmEla = =) mma or mes | Es a= x en Bimlm pial ky | EEE Eee EE EL Er By 001797 f eres = mTLTLT LTT i EER aeSE FETEee { i] i i 001798 i SE EE E Ele 51 pa ftf:em THE ary Tas mem He site wale tes iiEiES Si = Eim TloF g bia[M esi 8| Ii EE iHES SNE. [iE hr 4 eensppaanht + fm ae = ae eo ee fiei Sere Epe esn EEEel , E [(EEeEee Se Es e ECnEELRS e SUS e 2Sa8B rJT i ooe =aIB e EB Ee s E Eme eEY i EEsss sale Ea EE oh 001799 21112 ) EEHE Eaa FEEEa [TEE| EEE TET Seria Ee Eee BREE et Ee i IE Tne Eee aTE Er REE i [Eor e m eae El E158 ee 001800 | - p= EEa EE--E 0E= e PS 30Pa er h a -S i ii i i 001801 | --_--VA--AAAAAMTMMAo--TMTMAYlomA--A----m--" RoperE020463 Tom. AverVatoSamples SumRivLeo0rc2aSto1ic1oin1m1e2n.t3s.04. :. a TcotonrnOhnec"e CCaSm Dn CSmTecnasruuanl, ER cool tonto pre Cop2EmomEmine:mmmoeuumceeraasdfiEoeem ELE] 2 Son SiEmnnhEn HESTEE E55 IesSEo-owmamidsmSfeoEmSuMecNiIiIshIELnEe HE5 saame mmeIiSmEerMiGhREeNe Bowel Howser sifmon # 2 sSmC:-EGEomSumminanah mn EL -E id nse ei Ememmiiuy be SE b43 o 8 5mwoa) non oa Bom. NhSSe ERbERr EE-E]-RR iNayeS mHoaa moa m-on 14] nome ae m CEm) a wo Eo OE " Se Ss e as E SA Iomtmiea,ns TuEartromy Emme [I Ef na = om now a FirSevhelIEo eEo Ra rd aBn om om TFleeere-EoEvniAseoSri Nu $m=ma 2 SR mammeiiiem ob 80% 001802 ---------- RasenEc2ous Torn.RiveVata Sais Combined E02.0443 Large MouthBassData Table - Samos : stor tame sscciiuieerisd|] iocaa|| smaiooanm||esbeoiao op wr oo| me o ies' me3r moo| io ier ma 31 5--nti0oc3as || {smBioioaas||| Bssiisoaas SBI Stoa [Sioa Bios mHnoooeao|| m5a eimpi sFeee aR ssSciiEnesdTs]| mmiooHisoaa ||| saaiicooaen||| maeiossaaa srw moa| mon | sa HH mooaa||a m4e mwmri es | moa| ar sms aO%m sw sored] 8Ssi8o53ae|| eamooada|| s[mBiiiocsnaa mo sooos|| ado sn mGem ss sBeRm 3 : sSooC oa || Emmooaa|| moa mia uo| aide| Boa osoo5a| Wi ep WR Boo 3i {SSsLisszUiedas)] smsioooaaa|| mbioooa| smoo{8aa0a 52weal oa| sion| aoa GmHoooa||omsoos ao s Boa| moa emsSsias0ia3dl mtmoooaaa|| msoosiaaen||| abmiooodag pretrees lel Boll ed apworoaec| le] we ms _ wm rll IC i wreSpraetaivessaamBroeal | Pre sBilaolea| Be|issea BmBooas||oas&i sGels sBiwY {| |SSSuinids mmBoossa|| sa[Bisisaaa|| as8iioa0ae Saunas moa | sia| Boa wmSoosoa||im8so5a% Hoa| soa i +: CsunE anil moo | moa| isa ea Ee Satis woo| aoe mH u oo|a o sie H Boo| aioe BR e 5pe3rurrioiss)|avmeols | lmeola| emoea (Sr| Bios sioa [bide wbSiooooda|| maiodsaosa {SSSEaaelielsosmaeosa|| mBmiossaea|| ma|soeea S3lkes| moa | moa| mos 5wSoe5no|| mmos--stsaos won | moa ::1 S[Si3SiUsiietsd]|l mssoesas | | aBsisoseaa|| aBmiiosdaee sated] ae | 8%| 8 5nS0oiss |o|commoonae us| 85 E SS3e8r0a] maaoa|| maicda|| AmoThae ouTse ||hm8ao%s CSomncstrosmmonns, tua a FsRwA -- sme [. = w A sam w n* w001803 esses ro rt Cons[e02a-0n443aen ~ H sich|EhoaEIEEESomIa E| CM0o)et om Tm Deord| wr ee sPBESpwicEaaEohETlElEEB eRTlIIETE eEsETllEEeEeTI EllayE F RE a8vIE alR orE Ryiyea EE E wwwonyw FBEEEE 3 BoE oo i| |e EE BsFEd AHAilE| EEElRae asIIIlE|EEEmae]eIIIe [EfEEnaoI=ol] |EEEe@ Lwoes a& gElElmelE E==is5ia iE a io E EHeBAlElEEEAsIEEEEEliIIIeIEEEEE0IIITlEEEEs| &a B ii3 o i JiDeEEsEsg HlEaAsilEHlml IEeEsaEIEe EElE=IseETEE biaB=E rm ! BEB HBHHoEEEE E EIIEE EE ILE IEEILR R E IEE BEER EE 2a 2a i=Er BagEl E EagBll iaE eeasE s sg F-- iTey EEEE E EEir E so mann e TEae o TMWET= error sein t | en i Eee Taste i TTT ---- Eo a i i i i vo1sos ae EE { EET| == SEE i_ EE i U03s06 | | EE re Be ! oy $i i i |:| EE arsE ra FR e EEe E E r E 4 | SEE ren EEHEHHIEEHEERIEEER] i ii i i 001808 wee S--_-- ContrrrOaTu B EE coE n H e em na EBFe SELF| EEE Em] ees EEE| | BEET [Th - = EERFE E C EELEE FEHR HEHE ---- 001509 een is mi E02-0443 Tenn. River Valley Samples `Summary Table Location Averages : a e=n| IEEE: |e; | (EE) [CTT] NO) () ao| won| oo [oo| ws w aetEe| Location 1 toa toa u o43 FiwEepnk ]lon wfoo|o nwo |]=[wo ]| oe = [rPFEEmaEnme]sowoal w|oCwo|Aa|Et|R|Ewo= [CEE [CE : e A E Hiam n em e e ere erwnw] SampleLocation 2 ue i) EE oe ae -- wit is--001810 : sme or=e | EE BE il fa ee= r 5 EE f fa SeEe=eee te ee e eE m ee me ae e ea 7 == Ee Ea jet i [C SE = = = SE aslESaeiE ESal Esr iEs E a ceees == , :: i a =2]Pa- A rmmrEEiySwtin :'i i -eTjotoBgDeeO.! i SE i lS Fhe 001811 |  fmm |ei[om es Aa coErmsecsinncnd A pee I EEt E E TRE ea r iaa reE s aa t es EEEE TT [B S a aa ay a ae r EE eSs r SEi - Eau |3 Blin i: : pfeem 7 P -py: dl E is i en kseewa sas BYi. f 001812 r--_-- DotaearFsrtooxnamctod | ee ee { E B B B ee e e e r e e e Hr r ee e e eee e e e ee r e er a e ee ee CiarEa T E r e Ermae mr e ene e r tot Ha E= E EeS --t r] H EERsras a fi4 jsoe i5 ut5esHogrrmyes JesoSJenaedsieansaeaar]e ; i 001513 spas DoeavoszaEsesyinracted [a a e Pe E Brer ES a a rem es hTtHre eaera rtaaar a ee t ta ead) BE ee E E e EE re TE Ces Er Fo ESE. E nd S ToerEoer jo. Eeg err] ) E == g 3 i {maue erma4 om i, 001814 mn pC=o-- E E E E E EE E EE e HEErEaE e uEEeEEd E E E EEeE E E E E E E . al BEirs EHA B E weeElE E ETa E, T EE S nem ee s i ii f--o i1 ==:P:erP rScaeacr a:t]' . i 001615 [-- Too Rr Vale Sams e rere ceSe eemmpemese ls ATTACHMENT C: SAMPLE CHROMATOGRAMS [-- go1816 Pamir [-- Ts free A Data File: DUDB0056.D - Page 1 10 Trebuomaton bvsasony D5r2ag8taSfIilPeM :: S\\TBitd staorgteat2\0c22-a30r8:g46e3c,ichTaemnind.udReisvse.rLvall\ey DSEamEOprlaecsZted0.B\DSUDE2OOS6S.D SaErn ibo g | Toh waver vattey pian. prep 1500-- 8 of ion. 20 oun 02 itMEtehtphEDDasacttoee:l: iAA3)\-RyhuasrEs3u0a:0r3gEatr:B1\3iv:da5sr3yed\\cuchdheeemy\s\driuydtejeddxE r.u.Aai\nDIeOtRS ypEesESpseL prcpted. eVPADOIOGTS0oRsEtES , E HI s soe a rtie:ea 80, 0 Compound tides: wid.ous . i CCopnaceVnatrriaatbiloen Formula: Amt Z*ocDaFl C*omCpponudnVdarViaarbilaeble BEI rr son wn i | a co name Sm 2 ; ima Exes coresnga : Inital Dats. 001817 Report E02-0443 "7 Tenn. RiverValley Samples. -bar TT r E SRR BataFlier NebatagetstargeDrUZcEhRoanctseda,WuNDeECsOrRG,.D el ; ppry} se Page 2 { pe ii EH we ; i@ LTE |FI t2 i i, STTTE ERE me 1 5 LLL. ii aHeg, TEEH |! lis i3i5 : iboE #4 36303 de 4 TEE ees BactCezy ofOriginal LCanoe hates w101s: [-- [EE-- Bata Flat ELS go tar ob chemo me | DONA debe NI056,0 fa J a ' PEeb ad i I iopE Ei wigs : my I= Lok bors : EEE i i Page Cor_ Ect Copy tie o Deiginy Initial Data 001849 Report Ec200 Tem. RiverVateySumpis RDeaptoartPilDea:te:DUD2E7O-0RSuSg.2D002 13:27 - rage 1 3M Enviromental Laboratory t DDaatbasufpile14;: S\L\-1B,tsLt3a2Br20g2-e04t4\3,taTregnne.tR\icvheremVa\ldleuydeSajmrplr.ea{sct\eDd.0b2\D0U6D2EO6OESxE.ED OTpoerDaattoer :: m2i6a-00N-2002 23:38 Inst ID: dudejr.i |i MCSiiokpmeeInTntaftoo ::| Tenn. River Valley Fish. Prep-17 dun 02. GHO/MLA. 20 Jun 02 CHMaaeltthhDoaDdtaec.e :|| \2\6'-EhJstUeNs"-3t200a00r32 g21e231.t03\05dtuadrejgxeit\cCQhuaaelntnF,\41Tdy?uped:Deub1jE8r01a03.c4t1se.d\D.Db0\D2002066266eExtXrCa XDIinsltebFgoartcatttlooerr:: F145.a0l0c0o0n0 Compound Sublist: all.sub , Tameet version: 4.12 {{cGonncedntrNaartlianoine Formula: Amt L*oDcFal C+oCmpponudnvdariVaabrlieable amo cwouasie om oe eer Pgayri Ge rCoe py ofOt rginal i| Lnina saDfiaoiyz 001820 naponEo2ous TomRor vaySaris - RE Ss Data Files Westargat aretahentdu, (DREICLed, WAREOOSR,D Paez wi io : pe | TTI I ER IIR ae ks Be sh en eR TE eR : Te ii |Lg 2B0y Bl Ti3a ;4 | bed CoHfk fr To Ey3 3 errr Ema sm On ase Exact Copy Original Wh pele 001821 [--- ---- cn Tom vse BataFiler \\Etataeget\tarnn,(\gDIe20tG2i6Ecxhacetmod \BAcTUhNOuUSiS.eD. - ae 3 fi i- |e xEX vg we Bos 8.2 = |- 5po ! | i! Ect coy ogi Snlr 12/13/03 001822 Raper Ec20042 se. TenRuevateSamples DRaetpaortFilDea:te:DU2D7E-OA0u3g.-D2002 13:27 - rage 1 3M Environmental Laboratory ! DLaatbaSfpile1a!: \SL\iB,tsWta3r-g20e2t-0\4t43a,rgeTetn(nc.hReimv\edruVdaeljlre.yiS\aDmp0l2e0s6268b\xDtUrDaEOcOtSe3d0. OSIpnfjerDaItnaoftroe: Nike Info | mT2ei7na-n3.0-R2i0v0e2r 00:33 Valley pis. Prep Iin7stduIDn: 02d.udGeH/jMirIA. 20 un 02 i MMCeeottmhhomDdeantet:|| \2\7-EAtugs-t20a0r2 g1e3:t2\2 tdaudregdze.ti \cQhueanmt\Tdyueed:eBjSrrEaD.cite\dD.b0\D20020662256eExtxzta xDCliasll DbFaoattcett.olre::: 24165.-0J0U0N00-2002 22:00 Cal Fild: DUDZ04s.D ; ITnatresgertatvoerm:stoFna:lcon4.2 Compound Sublist: all.sub ' CponndceVnatrriaatbiloen Formula: Amt L*ocDaPl C*oCmppnoduVnadriVaabrlieable --_--_ i : 20 ma om :ii an J -- me we nn a mo am dim ssa Sod dmoSn ww Woooommdmmadouannm sse wm moe anon w wmm oomowaes oomw | BactCopy Orginal i Cov afer ta Dats 001823 roars TemRr sans Bata CTTs File\\EtatargaetrstBaOrREeRbAardcMhBEeONnT.sS Pag2e lHeo a i wl fd Ci IE AE: il Armee tr TEE ees i TE | LE |i { uo i i! iEpe 5 : -- Fe i w % b1ok os] 5 I fmm es Bt Copy Orga Gan yhee 001624 Reptsozous [EE R-- Ft apEr NERS os nm me ii | i ho 2 i. ffset i | : -- : ExtCapy of Digin nea ! Inital ! Dats vo1s2s ReonEazaues wo. Ton RieVateySais DRaetpaortFilDea:te:D2U7D-EA0SuEg.2D002 13:27 - Page 1 34 Environmental Laboratory ! TDaabta'sfuiple1a:: S\L\-B1t.sttarhgde-5t20\2t-a0r4go4t3\cTheemmnd.udReiivre.r1V\aDl0l2e05y26SEaxmEprlaecsted. B\DUDEOOES.D SoTipnperDatatnvooer ||: Tm2e7am-a3.0-w2i0v0e2r 01:28 valley Pish. PreIpnsstou1n: 0a3udGeMjrA. 20 Sun 02 i VMCaaottmhhmodDeantet:|| 3\)\Bkteseta3r0g0e5t\t1a3r:3g3et\dcuhdene\sdirudejrQu.ain\tD0T2y0p6e2s6ExBteraacted eVb\DO2026extuera DaCaill'DFbaoattcect:loer::; 52136.-000U0N00-2002 22:00 &al"Bi TEE budaooas |i TIenntgelgtratvoerr:sioFna:lcon4.12 Compound Sublist: all.sub GConndce'nVtarraitainoine Pormila: Ant LoDcEal C+omCpponudnVdarViaarbilaeble -- mm wt ------ | rayan wSomm Omnamn aSee eam Jenn i BactCopyct igi) wnWE aboeainar 001826 Rep E0203 TonRoarVey Saris it SC ----O--------_ rs EE Tea TPE aa BRE - Bie ; fo * oi Sr TEE Lae I CoE i oe ll 3 - TRS se 36730 wr i# i oa i fe Cie 8 SEELdERAe E rT EE ETS alte EtCozyof oipa 001827 roevzons J-- . a Data File: \NEEStargot\Langetichemiducer,1\DS2OEEXtr soLad,B\DUDEO6R.D - ! br ' a i pe REECE) {a ios 2 Ia |i ER ! : : 3m 400 428 ade 40 i rae3 actCopyofOrigin fa 001828 Rapa Eczous I ---- DReaptoartPilDea:te:\\B0t5a-rDaercg2ec0\0t2ar1ge3c:i0c7hen\duder.3 \D020638. \DUDEO0S6.D Paaggee 3 3M Environmental Laboratory ZDTaaajtbasDmfapitleeT"a;}: \3\5BtDoatsa02s-g04e43t\Tecnna.rRgiveetr \1Va3cl0lh3eey06ms8aimEpdrlBueesDdEe00)S8s..0 55-7in-z003 02:35 CSWipipieraItnIfogoro | Taeinan. River Valley Fish. Prep-Iin7stsi1mD: 03d.udHe/siei.LA. 20 Jun 02 Comment} MMCaeeitt"hhpoaDdtaet"e i| ala Botte! 23\083\5-E1Dt7esNct-a23r00g00e73t\t01a33:r:40g81etd\cuhdeem\rdinudejrEG.uiaL\nDe0H2a0ypse2:sb.o5Bb\zeDbn002s0060.28.m i; TBIainrltgeegFtraacttVooerrr::sioF1n.a:0l0c0od0n.012 Compound Sublist: all.sub i: q CCponndceVnatrriaatbiloen Formula: Amt L*ocDaFl *CoCmppnoduVnadrViaarbilaeble cmt Ei alli | Br fan Soom nnn nomm me i 4C Flag Legend M - Compound response manually integrated. :i ExactCoy of riging) Lon 20 fn. Intl Date 001829 Reson Exz0us ~ ------------ <=. Ton. RrvaySars te Fil ar auch ASAE NERD - ET RSTR } Bal : aoiln i &Bil Aei) CE1 i TIE ER pa a ve : p { ia 8 1a 1 | IE 3 "yg Sie i FY 1 be i opxe Fes 3d - rz TT EatCopof gat coal a fron Iota oat 001L30 rosesus To Ry Sars cPram Bata Flies \\Etatachramghuee,b(\\DI2aOG2r1,IgNUeDE0b50\,5 - rae 3 leai Bi : Pr22 rom case " {CREbsee PRE i ois] ET | ra PoE bors : wT : Ba Copy c ofdigt est LwCa C(o50/0 001831 Repo 020043 Lo Tou.Rrvatey Saris RDeaptoartFilDea:te:\\E03tsDtaacrg2e0t0\2tar1g3:e0t7\chem\dudejr.1\D020628.b\DUDEOOG4.D Page 1 3M Environmental Laboratory ! LDIaanjbta'Dsafmtipele1a::: 28\1\5-B-3t0;s0t-3a2r0g02e2Et0\20t-3a0:r42g41e3t\Tcehnenm.\dRuidveejrr.Via\lDl0e2y06S2a8m.pbl\eDsUDEOO4.D : SHOippkeeraItnIofnrofo ||: Tmeinan. River Valley Fish. PrepIin7stduImD: 0%d.udCeUjEr/.MiLA. 20 Jun 02 i CMSaeoltTheDadDtaet.e |:| 20\33\--0DB0eNct--32a00t0033aa1r03ig:40e81 rdu\dcejaz.rigeCQtau1la\\n0tcF0A2hII0Ev6eYe2ss8:D.\U5DBAdESDTOuOD02Sd0Oe6.2Dz0. aIBlinsltegFbraoacrtteoolrre::! 133.00000 Falcon oma Version: a2 Compound Sublist: all.sub || CCoonncdenVtarriaatbiloen Formula: Amt L+ocDaFl C+omCpoonudnvdarViaarbilaeble 1 Compo se Wom ore mses a i| -- {oc Flag Legena Solemn ow 1 M - Compound response manually integrated. i B00 Ataaf aDayti.s L01L32 ResonEo20ues Lo ToonRovevateSales tn Fie tiene SLD - rez -- A TS ST sad se i ot : wR | sa q om 3 i 4 ii i i - RR Te ai mm { Eid SR at Copy ofdrighe a af 01833 ronc2ous "Tem. RrVetey Sarin Bata Filer \\Etatargetitarget\(\cDIhZ0o6m28\,EdABuUdDEeCOj6rA.,D. - [LT] 3] CRsEve i ww aE A | i=u 1 2 24 : } kXRX A 8% 826 | wey in f= lob 3 [ 3% des Am 40 480 i 1 Culedd Breet Coyof rig: C21240 far intel Date Repon 02043 <2 Tom. RiverVetey Samples RDeaptoartFilDea:te:\\B0t9s-tDeacr-g2e0t0\3tar13g:e0t7\chem\dudejr.i\D020638.b\DUDE0070.D Page 1 am Environmental Laboratory : LDaabtasmfpileTa!: \Si\oaB. tLsHotd-0a32r-0g4e43r\Tetnna.vRgivaert\V\acDl0lh3e0ey6n2s8a\mEpdAlBueUsdDEe0s07r0..D SOItpnfperaDItanotfreo Mise Info :: :| m2i3a-JUN-2002 Tenn. River 04:26 Valley Fish. Prep-Iin7stduImD: 02d.udeCdHrC/.MiLA. 20 Jun 02 ; MMCeeottmhmheondDtate i+ : 0\9\-EDtecs-t2a00r2ge13t:\0t1adrugdeejtz\.cihemQ\uadnutdTeyjpxe:..i5S\TDD00220066202.8m ADClaiall DFbaoactttteolre::: 2137.90-0J000N0-2002 00:48 Cal File: DUDE00SO.D ; TIanrtgeegtratVoerr:sioFna:lco4n.12 Compound Sublist: all.sub ]; CponndceVnatrriastbiioen Formula: Ant L*ocDaFl C+omCpponudnvdariVaarbilaeble ' * i QC Flag Legend M - Compound response manually integrated. | ! atCoyof Original Qwnh jaDajsa 001835 -- ET, --Bata File: ER TRH \\Ebstargetitajrr. g(\DoI2t06\28c. hIAeIUmDiE0h0,e " Pree 2 : pe be : pr 4 pe 1 pod ! br i a i Pr ; 0.8 16 1.8 Zo 28 Se 38 asus 86788 we s 7s 78 we 88 9 1a : 4a 1 bus 8 : ye am8G 36 3 Sm I [k oserl trons tial Date = 001836 FoonEc2.003 et beRrm wm : be Bf|i, 5i58 Fi ies i an oe 1: |:on 5 fp EET ; -- : po Pol ] I> 2w.o0: i ETT i Tenn. ve Vay Sarin rs Satomi faan ia13duatfo 2 ! 001837 ReponE0z0uss "Tem. verValeySamples RDaetpaortFilDea:te:\`\0B5tsDteacrg3e0t0\3ta1r3g:e3:8\chem\dudejr.$\0020626.\B\DUDEOOT0S Pageid 1 3u Environmental Laboratory DZaatba'smfpileTal: \Sh\aE. tDstd0a2r-0g4e43t\Tetnna.rRgiveert\|Va\clDl0h3ee0y6m3s8a\mEpdAlueSsDdEe00s7r6..D SOItpnjeeraiDtantofero:|: Be Todo | aT2el5na.n3.im-R2i0v0e3r 05:32 Valley Fish. Prep:I1n7stdu1n0: 03d.uGdHeM1sGA. 20 dun 02 Comment | MlCMeaatslthhobDadoDttaett.lee!:+ 24\033\9-B-JtD0seNtc-a-2r200g00e23t\t01a03r::4g583et\dcuhedme\dsiudejrGB.eaial\n"Der02sI0yE6e2e8b.ubad\yDE:0o2o0s6.28 .m TDIainrltgeesFtzaacttVooerrr::stF1oa.ml0c0o0n0e0.12 Compound Sublist: all.sub {} CGoonacdenVtarraitaibolne Formula: Amt L+oDcaPl C+omCopnoduvnadriVaabrliaeble i -- ss mmm wr wee an oa 3! Hed oooIo mnn nm m own n mn aw co ries ese - Compound response manually integrated. i | BactCopy ofOrigina Lax @lo)n leitla) Dats 001838 rErzous vn Toon RrvatrSans RE - SE RES Bata File: \\Etatargethtarget chem\chudefr, (\DI20628,BADUDEO076,D - pz pre - q| ooll 4| 2 po EEE EEE EE -- | wl " i ls 35 y m"#%ood rm EEE Ea J2 i rt 1 HH i: oa 340 36 3306 44 EE EET ExactCoyor0riging a ete 001539 Reon Eoaotes Fie CetTr E Na ST auf t 2ia pr ar3o0m3m Raed ane ld ; 2 |B tofu oai : : Tg ; PP iY: I. a i wl we Ton verve Soin avs | BtCarof in a (2 Oo1sg40 Report 020443 <= Tom. River lly Samples Data File: \\Etstarget\targe:1\\cD0h20e63m8\. bd\uDUdDEeOj0ErS..D Page 1 rmagsa eileR+e\veeorrearanoseoEvRibEzeomemeanttEapSilE. tYa-- ObaoRrEassSo-- hrEy 000s FalEarEe Shas tnto EBdohn. waver vate rion. pros rSato10, oduudenge. 20 sum M[ HHeotfehhoehEdaleee:ER|+ HO\\NEEStoBsItCaH SrgEeTt\R ItaErgetM\SchHeRm\MdeudTeeSjre.Eri\oDEs02a0e628m.bh\D0206.28m o EBlamreierl: iLoeo, Compound Sines att. oun i Gavin Concentration Formula: Amt P* RDFA cs * CpndVariable J TT nm a | Came IPoommgmmaem Emm EOSER OooE 4lac tas see 4 - Compound response samaly integrated. i BartCa ot y gina Line 134s0/0, Initia) Date: 001841 rosa Tommi --Bata File: ER aE \\Etatargetstargre, \tDiI2c0hG2e,nAI\UaTEhOaORd.eD. " Page 2 ,= ,= i Be i t|8 1i ad 1.2! # pa O68 36TIe ISHS 3As ws 4 se 86 ae 68 Te I 8s eR 3 : ert " ] i bo 3 :7 -- ot 303 3% 36" 306 i nd 1 ]a PE a via wei ee BactCoofporigyins . 001u42 spr Data File: \\Etatangethtargotschem\huder, (\DI20620, BABTECORD, ww FE CEBi = 36 ie eam ae , Ton 00 J wl i Hl [ | fs t - ial 3 = Poe TTT on san " Page 3 | | S52Coofprigiyngy 001843 SS, SO Data File: \\Btstarget\target\chem\dudejr.i\D020628.5\DUDE0102.D Page 1 - EE fDaatpanEeEftiilse,:EL: W\E\eBsteeaertl[Ea0v2ri-0tg44e3etTrein\onn.taReierveegxrrB.eiV\atDTl0l\o3e9cy6h2eS3aem[pHEmlgAeB\esUDdnEuOLd022e.0D 0 on i Comment : | EEEPeLE..E| Pm reer tones oy Method + \\Btstarget\target\chem\dudejr.1\D020628.b\D020628.m D1o guenmin Concentration Formula: Amt 1* DF Si, * CpndVariable 4 -- Er rr mee en i nm mm im woe i 23mos usm) - Man sem sees ene we Pic tCaogmtpeogensaponin samt ineagenn. gc germ i SeCory ot Origins: Cone 1270000 001844 [, [-- --Data File: RR RITES \\Etatargetstange(t\DiI2c06h28e,nI\\DLdDeEOjLGr2,.D - Page 2 : ial 1= ; ost vol CesT IR TE Ee ER ae a ae ia aE ' i 8 48 pH 5 i BoE RE ewe ; ww fh : pe | 1ia8 3 ON sag iis Ble El ed Ae we we he ExactCoofpOrgyat Clas Lapeson 001845 rosso vn Bata File: \ELstargotitarget(Di2c0h0o.nAtRIuEeNAjGr2,.D - ee Paced iol " HER: Fem TE Tole I -R rn i FE aE: HE I: : | A oe pagent Initial Data eens 001846 rasan Reson 02003 +o Tom RuvateeSaprien DRaetpaortFilDea:te:\\B0t5-sDteacr-g2e0t0\3tar1g3e:0t8\chem\dudejr.i\D020626.b\DUDE0104.D Page 1 i 3K Environmental Laboratory d DLaatba'smfpile1d}: \SL\-3E. tShseti-a102r-0g44e3tT\encn.arRigveert{V\\aDlc0l3eh9y6e2S6mam\Bp\ldeDsUuDdEOeL0s4..D OSTphneprDaitnaoftroe::: 2mTei5na-n0.5-R2i0v0e2r 10:40 Valley Fish. Prep-I1n7stduIDn: 0d2.udeGjHrC./iMLA. 20 Jum 02 i MCMoiemktmeheondItnfo + \\Btatarget\target\chen\dudejr.i\D020p26.b\D020628.m MACelatslhDbaoDttaett.lee!:: 028539--DJeUcN--22000022 1030::0418 dudejr.i QGuaa1n"tF1T2ype:buEnSeTaDoso.p DTIianlrtgeegFtraacttVooerrr::sio1Fna.:l0c0o0n040.12 Compound Sublist: all.sub 1! CCoonndg`eVnatrriastbiioen Formula: Amt L*ocDaPl C+omCpponudnVdariVaabrliaeble i Compote oes women nae um gen a | 20 me om dim dm tal am mane QC Flag Legend M - Compound response manually integrated. : 1: ExtCoofOpinyl Laane alrofoe 001547 Rap zo20us ~o Tonn. Ber VatSaris wpde ES Data Filer \\Etatargetitargeth(c\DhO2e0m62\0.cBhNIuUdDEeOjLOr4,.D - rae 2 CoE : pBrer) a ti q| i2 . Be : bod LoD k k i Bi EEE Er rr wT Eee 1 :: 3 ; Woy i won : B1uo.oe00l0 "2 Ti ee a Exogayofceot: . laltnal alOsaft or 601548 wesw = Tv aa re Data Filer \NEtatargedtisngts,a(\rDIgOEe2tDIrARcIEhOLe4.mD Page 3 3 18 of 3 tole Ce ORE % h "e ae ws 8 Ee :b i1 fo=l bob $ i EctCopyofOriginal i Ca 001849 ResonE020043 wo Tom.River VeySamples RDeaptoartFilDea:te:\\E0t5s-tDaacrg2e0t0\3ta1r3g:e0t8\chen\dudesr.1\002038.E\DUDE0L05.D Page 1 : 3m Environmental Laboratory DLaatba'smfpileTa:: S\B\-3B, tSsH1t-5a302r-g04e43t\Tetnna.rRgivsetr i\V\acDl0lh3e5ay6m2S8aim\pBd\luBeUsdDEeOLs0rS..D OSIpnEjapraIDtnaoftroe:: m2i9a.00N-2002 Tenn. River 10:51 Valley Fish. PrepI1n7stouIDn: 03d:udeCHdEs/.MiIA. 20 Jun 02 MiCeobtmehmeondItnfo Meth Date ; | 0\3\-EDtesct-a2r0g0e2t\1t3a:r0g1etd\ucdheejmz\.dludejrQu.ain\tD0T2y0p6e2:8.EbS\T0D020628.m AClasl Dil DbFaoattcett.olre::: 2166.50.07000N0-2002 00:48 Cal #41} DUDEO0S0.D |. TIanrtgeegtratVoerr:sioFna:lcon4.12 Compound Sublist: all.aub 1 CCponndceVnatrriaatbiloen Formula: Amt L*ocDaPl C+omCpponudnVdarViaarbilaeble 4 Compnnte es mmm wre umes mao a) i 2 wan Dm una am Mn he E QC Flag Legend M - Compound response manually integrated. iq i ECa og os fOgit nal Cut alalon ! wa Das 001850 Reso E020003 Lo Ton RteSos -- RS RRS Bata Filer \\Etatargethsaitr.a\rDIg20oG2t0,tE\cUDhE0e1m08s.D - rage 2 i i a2x) | wu |= a 3 41 lps ei] '3 Ti ogFseda 5 = i So i1 ls wsaol SB [al olEX Ng 0 : ad aoe 4% : tidied lTionlc. aDbatse) t 001851 rosa n T-------- Bata Files \\Etatargetttanger chem ner, (\DIZOG2D.WAIUDEO108. " rae 3 i bod Tors Coke SEs 1.00 3 CPE | ol ki = tobe 3 : w EE d T i | `ExactCopyofOring ite 001852 ResonEt20u3 So Tom. AverValeySamples RDeaptoartFilDea:te:\\E05t-sDteacr-g2e0t0\2tar13g:e0t8\chem\dudejr.i\D020628.b\DUDE0108.D Page 1 3M Environmental Laboratory DLaatba'smfpile14;: S\1\-3E; tSsHAtS5)a02z-0g44e3tT\entn.arRigveert1V\\aDlc0l2eh6y6e3Sm8amB\p\ldDeUsuDEdOe1038..D SOIpntjerDaiatntofero MiBc Info ::: Tm2i9ea.mJ.UN-R2i0v0e2r 11:25 Valley Fish. Prep-Iin7stou1n0: 03d.udGeHj/ri.MA. 20 Jun 02 NMCeeottmhheonDdtate \0\3B-tDsetca-r3g0e0t3\t1a3r:g0e3t\dcuhdeesj\rd.uidejrQ.u1a\nDt02T0y6p2e:8.bB\SDD020628.m DACiallls Fb`Daoacttett.loer!:: 12&7.30-0J0U0N0-2002 00:48 Cal File} DuDE00S0.D J TIanrtgeegtratVoerr:sioFna:lco4n.12 Compound Sublist: all.sub iii CponndceVnatrriaatbiloen Formula: Ant L*ocDaFl C+oCmppnoduVnadriVaabrliaeble i ap i a Wooo wre oe Ga aja) modo mo Inn ow | oC Flag Legend M - Compound response manually integrated. i i| BetCopy Origins dae casolon tel oats 001583 [------ [ER -- Data File \ELStargutALargetichonidhudr, (\O20620.O\IDE100.0 - Pare 2 Ea Ee TSO RE i ; sa a Let] IE: + |B = Se joa ii : Popm df = p" refae 36 ae i wo" "FE i# CokE ee 3% 3 34s a Exaot Cony dig a ager 001854 rents FS a Data File: \\Etatargetuietra. (r\gDIeO2t0,sS\cDUhDEeSLm00\,D - Page 3 Li FE % Cae de as Am 4% ei 2 ET Pr {5H i be 5 i Seaton Ga aliates . 0o1sss Reon E2003 J r-- DRaetpaortFilDea:te:\\27gAtuag t20a0r2 g1e0:r08\tardugdeet].ichen\ \0020653.b\OUDEG08S.D Page 1 3M Bavironmental Laboratory ! [E02-0443, Tenn. RiverValley Spies, DLaatbasmfpileTai: SLi. WELL \\Etstarget\target\chem\dudejr.i\D020629.b\DUDE008S.D OISnprjeprDaiatntfoeor wise Indo ::| m0Tie1ia-nJ.UL-R2i0v0e2r 04:25 valley Fish. replInystdu1mD: 03d.udGeRdMirIA. 20 un 02 Coment : MeHACetaslthhoDbdaDottaett.lee:::: 4\237\70B--tA0sUutNga--r22g00e00t22\t02a92r::g24e55t\dcuhdeemj\rd.uidejrGQ.au1lain\t5D01T2y08p6e2:b9u.nE5kS\aTDoO0s2e0.6o29.m | DTEienfrtsegeFrraacttvooerrr::sio1Pn.a:0r0e0o0n40.12 Compound Sublist: all.sub CCoonngdenVatrriastbiioen Formla: Ant L*ocDFa.l +CoCnppnoduVnadriVasrbilaeble q - wm me wre see a i ibo { Bmlekn: i a "d lM n msm om oommnnowm i ExecCoyis! Orgs | Lniak aleefor 0018s6 Ton zous in Tommy Bata Fils taba orchard,HEARED - ork SR i br iu bi BE: Tals le als ale' me we UNEASE aR ESTE TRE aleale hie 1 > Ton 30 | ls . iE i i i wi ' = : :5 fE ~ BactCoy ui dig. "4 eter "te 3% se i Taam 001857 roasizus wt Toms Bata Filer \Etatargatitargot\chentahuter.(0020629,MAIECO9. " rae 3 Tm ii Pa EEE ee i= 5 if [oi ra23 pros cer) ' PCo] ols } [jI be 33 bof ;: `ExactCogyof Original Lairne ofa (afeolor 001558 ReportEtz 0143 2 Tom. ReVateySamples DRaetpaortFilDea:te:\\2E7t-sAtuagr-g2e0t0\2ta1r0g:e0t7\chem\dude3jr.i\D020639.b\DUD0127.D Paggee 1 30 Bavironmental Laboratory ! DLaatba'sufpileTa;: S\i-\3B. tWesit50a2-r04g43e, tT\entn.acRigveerir\VD|aOlZcl0eRhy2seSaEmmApdDlUueSsEd0e12)7.rD oTop)erDataotre:: mO1a-JUL-2002 11:23 Inst 1D: dudejir i MSCihosomeeinIntnffoo +|: Temn. River Valley Pish. Prep-17 dun 02. GHC/MIA. 20 Jun 03 MMeetthhodDate | 2\7\-BAtusgt-a2r0g0e2t\0t9a:r3g9etd\ucdheejmr.\idudeQjura.nit\DT0y2p0e6:29E.S5T\DD020625 DACilalsl bFDaoattcett.loer!:: 1736.00-0J0U0N0-2002 22:46 Cal File! DUDEQ0S8.D j: TTaartgeegtratVoerr:sioFna:lcon4.12 Compound Sublist: all.sub |} CCoonndceVnatrriaatbiioen Formula: Ant L*oDcFal C+omCpponudvnadriVaabrlieable --- a a verge) 1 i E45Cp Original i CWnEc iaofaonfor 063859 Rasen zcz0us Tem Bharvarysums Bata Filer a \Etstargetitargire,1t\D\O2c06h29e,BAnI'IBdE0u12c7,eD - i EFSi | 2 Fiol [I{; "i RE 4 i po i - of ileal me ms eT i ey | io a - IE 3LoREped Te ee | PEr e :; peedd |reomi : Fos a B07 BlE lS He =e 3,3 rage 2 ale als ale po. anTacr sagaem, e -- 001860 Report E02.0443 = Tenn. River Valley Samples. Bata Filer \\ELstangeNLarge chance | \BO20G29,NNBEOLZY.D. - age 3 CE ls 3 Bi Fo Tw be 4 4 EE i =i I be i i ho { lo 1.0f P pofe mE i Seed aging i Lu. Labialo nifial ota 001861 Reson eszouss Eo Tenn RarVaty Saris DRaetpaortPiDlae:te:DUD3E70-0A8uSg-.2D002 11:06 - Page 1 3M Bovizonmental Laboratory : fD1ra3attaBafirleeA'!: \\Bsc0a2-r04g43e, tTe\nnt. Raivregr1Ve\a5lt02l0ie7y0c3Sha1m9ep3l0en7s62d).ub\dOUDeEDsOBsS .0 S3-aunr2002 07:02 Shrater | mia Inst 10. dudesr iCSmotpmemeInTntaftoo |: Tenn. River Valley Fish. Prep-17 Jun 02. CMC/MLA. 20 Jun 02 MMeG3oet5ith'hoBpBdaaattcteiee!||: 390\)23\-Bh0tu0sgLt-a32r00g00es2t\01t13a:1r20g11etd\ucdheesma\odiudejrEG.ainR\eD.I02yE0p7e0:2Sa(BDo2e00.s70e2.)n.b\D020702.m FR|E = BIinltegFraacttoorr:: F1.a0l0c0o0n0 Compound Sublist: ail.oub {Lo mem Concentration Formula: Amt L*oDcaFl C+oCmppnoduVnadriVaarbilaeble a me --_ne toy {| a ----tm ed rCoee am temm wuen maem mmem en % mmm BERR i i MQC-FCloamgpoLuengdendresponse manually integeated. - i atCay ofGg Cine 12fislor Initial Date. 001562 Report 02-0443. Tem. RiverValley Samples RA ES Saas Bata File: WEGtargettargetsr i\DOc2Oh702e(20m70t 2) Ba\BuUIEa0He D,D . race 2 wi gee 5 oonsi: 1 ori boa od TIS REE REA RR | |i =A-DL : | pe iPooike g3 5 12 2 me am = - i wa pos Ii] io RT es ee i ato EatCopyof Griginal vo1s63 [-- 5 To vtySami Bata Filer \NEtstarget\tsar,r\DgO2e0Tt02i(0c20h70e2)mB\ABdUDEuOSdEDe.D . Page 3 EE = I \ aE i--ie i: : ost 5 aa 48 a [LE i PE ii A LEE olaal TTT ee i Re Copyof Org 001864 Repon ccaous "Tom. Rie VaseySamples RDeatpaortFilDea:te:\\2B7t-sAtuagr-g2e0t0\2ta1r8g:e0t3\chem\dudejr.i\D02039.\b\DUDEOOS4.D Fase 1 3 Eavizonmental Laboratory DZaatba'smfipleTa;: S\h\iE.tsCcoaicr3Bg0e2t0\4c4a3rgTeetnn\,chReimvedru1d\vDea0]l2r0l5e2y5BXOsUampDleEs 00EH.D . OSIpnhfeprDaIatntofero :: : m3i0a-0UN-2002 Tenn. River 23:51 Valley Fish. Prep-I1n7stduInD: 03d.udGeUCj/irMIA. 20 Jun 02 {! MisMCeoctmhmeondItnfo Meth Date |: :| 2\7\-EAeusgt-a2r0g0e2t\0t9a:r3g3etd\ucdheejms.\idudeQjura.nit\DT0y2p0e6:29B.S5T\DD0206129 BACilalsl Fbpaaottcett.loer!:: 123.800-0J0U0N0-2002 22:45 Cal File: DUDE0OSS.D i TIanrtgegertatvoerr:sioFna:lcon4.12 Conpound Sublist: all.su i CcoonndcenVtarraitainotns Pormila: Amt L+ocDaPl C+omCpnoduvnadriVsabrlieable ments i -- wm or wi Bo din don eam wm mas ae | nn Wm la sm me wen we i | o mann oamoumn om QC Plag Legend M - Compound response manually integrated. ii ECn oyof t gen "wnlc afefor 001865 Report 02.0443 "7 Tenn.RiverValey Samples =Bata Filer aR REST \\Etstarget\tangetichem\dudedr, (\DI20629.SADUBEOOGA.D - rae 2 wpond i ww i = STE EE ; em i a i { b2e00l - }{ jii 5 3060 328 340 306 308 . pre mee = - =22]} ii aga wave TE ee Cet eng fLiro 42lor 0018566 ReponEozous TennRoe VaySaris Bata Filet \\ELSLanER\targetschemise BRIG),WIUBE006A. - rae Py @ hr dd ane LE i be] i 8 5a! 4 bi wl r The we we sw wa aE bof TT 1 23 bobH TTi R vy i { Ect ogy Lp L3fiotor v01867 Repo 02043 2 Tern, RiverVaseySampes DReaptoartF.ilDea:te:\\E2t7-sAtuagr-g2e0t0\2tar1g6e:t05\chem\dudejr.i\D020629.b\DUDEOOSS .D Page 1 3M Environmental Laboratory DLaatba'sufpile1d;: S\L\-B1.tsCt-3a-r150g2e-0t4\43c,arTgeennt.(cRihveemrdVualldeye)zS.abmp\\lDDeUs0E20065S2.5D , OSnpfjeprDaIatntofero ::: Tm01ei-naJn0.T.R-i2v0e02r 00:02 Valley Fish. Prep-I1ns7tdu1Dn: 02d.udeCjHCr/.MiIA. 20 Jun 02 i} CwiosmemenItnfo CMWaeeltthh`oDDdataet.e : 32\07-\-JAeUuNge--2s200t0022ar2029g::84e96td\ucdeajrc.gi acQCiua1alc1nt0hF0ieT2ly0n:p6e\2:D9aUDEuESTOdDOeSSl.Ds 2\D02629.m DAIilnlstegbFroaatctttolorer::: F129.a0l0c0o0n0 i Target Version: 4.12 Compound Sublist: all.sub i ii CCoonndceVnatrriaatbiioen Formula: Ant L*oDcEal C*omCpponudnVdarViaarbilaeble cmv ey man ara em ta i mo dim am am am ewe se QC Flag Legend M - Compound response manually integrated. i ue GHC 13afliafor 001868 Rap E020 32 Tom Rar etySues A -- rs = a TE Sars pr pe] pbrr] i E3pbi2rr: Eu i a i wu ` pv os Lo LS Ze 28 30 18 40 ae Be BE 66 68 7.0 78 86 88 ue y wT i ae q in 2 PoBE i 3.00320 3% 3 Ie Bes . obee fr)5 i 22a4 : Emet Coyy of Original Litaaln [2D]atio0for - 001869 aossious _-temettre armen Data Filer \ELstargot\bangeti(c\BhOo20n62s9a,BuNuIBiEeCdESr.,S| - Fae 3 Cobri wn | Doh 2 Fo : 46 LB um Bes Lr o] [aE CoE ! i pte ExtCoy 4 ey 001570 RoganEozou 52 Torn. RivervaySamos RDeaptoartPilDea:te:\\2B7t-Asutg-a2z0g02et1\6:r0a8rgt\chen\dudejr.\\DD0UD2E0O6OT7L5..D Page 1 3n Bavironmental Laboratory DTaatbasmfpileTa:: S\e\i.ECeo3s-250t2-a044r3,geTentnd.\udRcievsae.rr{V\gaDOl2le0e5yr25S\aBmLcpDlUehDsEe00m71 .D OTpnjeraDtaotre:| m0i1a-J0L-2002 01:08 Inst 10: dudejir i: iCSofkmpemeTnatIfnofo +: Tem. River Valley Fish. Prep-17 dun 02. GHC/MA. 20 Jun 02 MCMaeelttnDhaDtaoet.de::: 3\37\0-B-AtJusUgNt--a32r00g00e72t\02t82a::r24g96et\ducdheejmz\.diudejzQC.uaial\nFDti0l2Te0y!p6e2:9D.UD5BR\SQ0T0D0s280.6D2.;m DATinslteoFbraoacttttoolrre::! F13.a80l0c0o0n0 Compound Sublist: all.sub | Target Version: 4.12 i{concCeonndtrvaartiianoine Formula: Ant L*oDcaFl C*omCppouuanvdariVaabrliaeble { conse -- om wr om ara ara i i ama Te dm aan eae ee see 5 bmn om on i = 1 ! QC Flag Legend oooombmbnmounommoow M - Compound response manually integrated. ] at Goitrs 41 li(uta2lfyoDlaey 001871 JE-- ToBry Sais "ta- Fila AERA ara RR RS aroches or BORE IRE. - _ I wi ol ios {|e b RE EE Pw os ii kia Por= e A . Take 363 ; fk 4 CoE ; ii | 55 fe 30467306" 34 Am a EE) "ly fe BactCozy 1 v01872 Report 02.0443 = Tenn.RiverValley Samples Bata Filer \\Etstargotitange1t\DiOc20hG2e,mADhUuDEeOOi7eL.,D. - I } Ebol rt i BE ; |- z2a8ll eas Prep Pols i fh 2 : "o=s i3 wr Cee je pr ' IE2 i =ol i3 ii fae 3 a [ i C-- te UU1573 ResonE020043 +o Tom RoarvatSais RDeaptoartPilDea:te!\\B`t37s-tAaurgg-e2t0\0t3ar1g0e:t0\8chem\dudejr. i\D020633 b\DUDEG0T6.D Page 1 3 Environmental Laboratory DDaanta'sfmpileTa:: S\L\%,Bteaats5a02r-0g44e3,r\Tetona.rRgiveert1\\VDac0l2lh0e5ye2m5SaE\m\pdDlUeuBsZd0e07s6..D Co SOIhpnjperaDItnaoftroe';:: Ee TmOei1na-nJ.0LR2i0v0e3r 02:03 Valley Fish. Prep-Iin7stdu1n0: 03q.udaGgUrNiA. 20 Jun 02 ! NMeomtthehoDdnatte}| 3\0\-EAeusgt-a3r0g0e2t\0t9a:r2g0etd\ucdheesma\diudejGru.a1n\.D0T20y6e2.9.5BO\RDD020629.0 DACiaafl BFDaaotcret.ioer!:: 133.700.0J0U0N0-2002 22:46 Cal"F41% ubeooss.o | TIenrtgeegrratVoerr:sioFna:lcon4.12 Compound Sublist: a1l.sub 4Lo GConecenetrnatiaon Formula: Am: L*ocDaPl C+ompoundCpndVvaarriaibleeble rie mn wr -- i 3 ta peice Rr] i| S- ooTmn den Te oi nm5om aohmw QC Flag Legend - Compound response manually integrated. i str ! iCac 1afoerl 001874 renzo 5 Tis. Bata File: RT \Etatargetstange,t(\iDOo20h6Ze9,mA\ILdBiK0a0e7.rD. - page 2 i )- | i od { ol OB Le a8 me m8 Le 8a As le sls Ee EE He is ale ws me Bl PoE ti OE2 E=ioe 2 5 ' Ei 33a 3653 EE i ot ! | sei Sal LMC (afrofar. - 3% 3 ad es a 001875 Reon evzous [EE SA -- 2 mon cam we Bata File: \\Ctatargetstarget[i\oDOn20eAmZ9\IdARuRdEeCOiTr6..D - Pan 3 | pr : gi ay i ie CoEld If RR | wo TUT i pe i lms sEof wt 1 i BOct Copy 1 a ane ga,ln vo1s7e Repengzzous Tom vervateSamos RDeaptoartFilDea:te}\\E`2t7s-tAaurgg-e2t00\2tar10g:e0t8\chem\dudejr.i\D020633.5\DUDEOOS7.D Page 1 34 Environmental Laboratory : Df1a0r3taDaftielei;: O\l\-Bgatins-t3a00r7Bg0e20-r50:\454c33a,rgToentn|.chReivne\rd1\VuDad0le2l0se5yr2.5SaLmpXlBeUsDE007.D i SWSphieperaTtnIofnrofo:: Tmeinan. River Valley Fish. Prep-Iin7stJu1n0:03q.udCeHEj/irMA. 20 Jun 02 De3MMCeeattm phhoaBDdacat:tteie|i3330a)-0h\Uu\NEg-t3s3t00a00r32get20\29t::ar40g80ecardg\o)ucdcheesna\d.uidejx. ExG.ua1Fn\eD.0TT2y0e6e2:5bu"bBbBYs:\RoDSo0s2s0.so25.m | TBSniatensFraacttVooerrr::sio1Fn.a:0l0c0o04n0.12 Compound Sublist: all.sub Po| GComnceenvtriatnionn Pormila: Amt L*oDcPal C+omCpponuavnadriVaabrlieable { wm we ---- i;HE. i [td o moo mmNnim emumasamm Sum UD Im m Dem Ee eweESee amon ome Qc Flag Legend M - Compound response manually integrated. : FatCoy? iz 1 EMC 13fof ` rity we 001877 ReptEvzous So Tom ervey Sores Bata File: \Etstarget\target12i0c20h4e2m9S\\dIUuDEd00e9j7.r0. - Paez ET aa TESR > NE : Ea=BdS Pola t tael EEE a wo fh . EER | gi i i Pu Foo 326" 346 3% 3eb j= LH) { uo h12e0! i PRR eT ee EET Enctu nhey 13)pofon 001578 emus == = = 32 CoE ey a?Mad EERE : 2s} ' 1 EY iopE : wal 2 I ii ' i ak E 3 * ERE | [S-- ge BraetCopy of Originay 001879 Report 02.0443 "2 TennRiverValley Samples. DRaetpaortFilDea:te}\\'E2t7s-tAaurgg2e0t0\2tar1g0e:t0\8chem\dudejr.i\D020623. b\DUDEOLC.SD Page 1 3M Environmental Laboratory DDaatba'sfmigleTa!: \S1\3E,tsCt3a2r5g02e-t04\4t3,argTeentn.(cRhievmeridVauldleejyra.-miBp\\lBDeUs0BE30015025.5D Taj Date'; oL-gUL 2003 07:21 OSp5e5raItnofro |: Tmelnan. River Valley Plan. Prep'Iin)stduIDn: 0G7ude iGR/MIA. 20 2un 02 i MCuMieoastmtcheendDItantfeo :||; 2\0-eAuug-2s00t2 a09:r39gduederjsd\iudte)aQ.ur1i1n0eg02Te0y6p2re9s.\2B\ScD0S2h061a25 m1m CADaliisl'pbPaoattcett.loer::: 318.000-070U0N0-2007 22:48 EFT busooss. | TIanrteggercatvoerr;sioFna:lcon4.12 Compound Sublist: ali.sub |i CGoencaenatrrataioln Formula: Amt L*ocDaFl C+oCmppnoduvnadriVaabrilaeble J-- -- x mon wren res on tnt i| c fin] i wn o wo meUm vem sIeDm aomm wvne em pea vlguniiiioiliiod Q Flag Legend M - Compound response manually integrated. 3 BaCopycitc LE (3fof Initial i vvi88o rentzzons = tomas Bata Filer ---------- \Etstacrhegn heudetsr 1i\30t206a29,rINRgEOeLSt.3. - Paez fo i + RE ER CPooE Ekgo 2 3 306 387306" 36 30 CET : = -3 i bwie s i ssi aI EY CBeaEtCne ueApa, r > coset J. 1 T------ Bata File: \\Etatarget\tarr.g,\eD0t20i6c29h,BeNInUDtESu1dO8e.D - C , mE i 4 6a Mi i 36 ie sam ae { wi i fe wy 8 re Pops 1 | Ta 3 i la i wi i ot EE Pan 3 Bacto. ,, Age 001852 Reson Ev20u3 <o. TonRiverVatey Smses DRaetpoartFilDea:te:\\B`2t7s-tAaurgg-e2t00\2tar1g0:e0t7\chem\dudejr.i\D020625.b\DUDEO117.D Page 1 3M Environmental Laboratory ; DLIaantjbaDsfmaiptleeTa:;: \SO1B\-3JB,0Lt-C2so0et0d2Ea020r-90:g4343e3,t\Ternna.cRgiveerri\\VaDclol3he0ye52nS5aBnmYpBdlUeuBsEdO1s1)7.sD OMSipEkeoerTaItnTognrofo :|| nTelnan. River Valley Fish. PrepI1n7stJu10n: 0a3.udeCyHEr/.MiIA. 20 Jum 02 Coment Method : MACaeslt'hpbaDotatect.lee::: \238970\--BA0tuUsgNt--a22r00g00e22t\02t92a::r45g89etd\ucdheejmr\.duidejrQE.uaiai\n"FDt402TI0yEEp6e2:9b.ubpE\sSDoT0oD2s0s6.o29.m jo. DTIinaltseegFrraacttVooerrr::sio1Fn.a:0l0c0o0n40.12 Compound Sublist: all.sub :; CCoonndceVnatrriaatbiloen Formula: Amt L*ocDaFl C+oCmppnoduVnadrViaarbilaeble 1 ww me mre men Cn or i| n5 vmon com) ennGe im vm omawn emmmmeee 1 qc rag tegena M - Compound response manually integrated. 4 FactCoofpOriyn CTinwe. (HaElo) C01883 ronErzus [EE ---- Ba File Esha trot chr, REEDINREAS7,0 _ wl a-- | wl , ape Pole STIR TES EE ER I Flse iPBloR33 ! Fag Th iE Soo" di 343 Ed Pos Lp y 100 fee TT " "sigs a aan ee TRE CeExact Copyof Original a oa 001:L4 [SRE pp ---- amr Bata Fila: \\Etacottchaam rc(\oDO20t629\,IAtDDEa0L17r.D. - E ! LL o 33 4s am Ak IE LE al wigh:rwts PoE 1CofEoo IR 4 [2 Cit 12/s0f02. ta at 001885 AuponEczous SR ---- RDeaptoartFilDea:te:DUD2E7O-AOuEgS.2D002 11:05 - Page 1 ! 3M Environmental Laboratory 802-0443, Tenn. River Valley Samples OfP1r5apo5tegarDgatagocireHl'!+| \$e\3Bwt3sc3a0c0g12or0\2c.a4r9getchendude) 1\5020703 (550762) .b\oUDEA0G.D mia Inst 10. dudes MSCiEosomc"ImnTefanogot}|| Temn. River Valley Fish. prep i} dun 03 E/N. 20 gun 02 EBCaOiRT"oAaCte | | As bottle! GE 5\3-35u\i eu3t00srstHotaizs gca haemtd\udcesaEr0R0g2IA 0a70r2Su(n0s2o0o70s2s).p.5\D0207012 | BTIinaftreegBetRactVrooersr.!sioF1na-:i0co04n0.12 Compound Sublist: all.sus i CCoonnceanrtriantiioen Formula: Amt L+ocDaFl C+omCpoonudnVdariVaabrliesble { pie we Tn mn en -- -- oo WIE TET me Th i Sods moma ow {ac Pag Legena - compound response manually integrated. Ee | i Cap Ong Che iz, 001886 rErzou 12 Torn orvat Sais -Bata Filer RES SST \\ELALnEUAAro chemthater(A3020762 (526702) IAUBKO066,3. - cE pi 23 git ia Ja iC! oEEa !a LEU |; 3PP ; he 303 3936 3% ; ry 1bok= gu "ssa rae 2 aLcitngCopy qarfgsofor Cr 001887 _-- [-- LE Pw-e i 3 = [RTOS Teappy ar iw } Si i | 2pros em } |IEFE] H|E pE : i | | [RE -- - BactCopy ofOrigin 003888 Reson 020043 Tom. RiverVateySamples DReaptoartFilDea:te:DUD2E70-0A7u6g-.2D002 11:06 - rage 1 3M Environmental Laboratory DLaabptStuipleZ,a:: S\B\-E3t:ata4r-ge3rE\0ta2r0ge0t cheenm\ed;udReijvre.r valley1\020s903a(m5p3l0e70s2) .b\oUDE0076.0 IonpBje.rTaD8taZotere Mise Info ::: | mT0ei3ma-nJ.0L-R2i0v0e2r 04:39 Valley Pish. Prep-I1n7stdu1n. 03d.udGHeEj/irALA. 20 Jun 02 i JCMoeottmhhomdDeantet;: Cal Date" )207)3-E7Ai7ua0gt--a22r00g00e23ri10c31a::r20g11erd\cuhdeem\iaizudeszGus1n0e02t0y7m0e2: (D52a0m702) .5\D020702.m | ADIilnIstegbFroaatctttolorer::! F61a2.l0c00o0n0 Target Version: 4.12 Cal File! DuDEOOS.SD Compound Sublist: all.sub i| CCponndceVnatrriaatbiloen Formula: Ast L+ocDarl C+ocmppnoauvnadrtVaabriieable vate cncrmarion --r mE re er C Flag Legend M - Compound response manually integrated. : aCy Cras Cans @lrelor 001859 ReseaErzouss Bot-eFlierEtre tSaErso(i\otmor0i2A RaseTwngtRoeor,es Te RevaySani rt oi oul i ast EEE i PrPm om ; pe = Coai ;3 a= msam | } Lpiag : al : wu saa 5 aad gi we ae aa ERC Btoyof Orga LIC 2/0/00 ital En ' 001290 --_-- roan SE -- 2a i a: Ba File: \\ELabargethtargetchonkasedr (\HRORRCNRMOENDD C334 4 de I rs i wo [| f5e= !- 2 Cow TR i IE : #2 ok eam ee |1 Pars (orto Cte ladon 001891 Reon tzous ES -- RDeaptoartFiDlea:te:DUD3E70-0A8u3g-.3D002 11106 - Page 1 SM Environmental Laboratory DBIanagtna'BsfmRiplfea! G\RE\BE3tnTaicRtaarYlg5e02ors0\i0ts4ea3rgeTte{mc,haRniviedru{\dvBeaO)l2e0l3e0y3(550sa7cc0tes2) .b\DUDEO0S3.0 i Sopee.riantfoor || mTieam. miver valley pian. pren'ITnSstsi1n.oddudHesee.isn. 20 sun 02 {ComJHGmeeittenhhanotDdtea:te ||: ia Battie! 35\&33\.Sa3Eu0sg0ta3r0g02e030r8 \b1t13ai1r00gt1ecScuhebne\ddruodedsERi1aT1n00BO2R0077002S2u00b220a07o7002s)0sb\DO20702. | BTTinaftreegaetcatrvooesrr::sioF1na0:s0c0e0hn0a Compound Sublist: all.eub |i Sewn Concentration Formula: Amt L* oDcFa C+omCppnoduVnadriVaabrlieobe ww | Bm ttoo i -- a reli -3 cNomeantmtarered, 1 5G1CCofofrplgoyr "an hey 001892 ---- ee ee---- Repo 22.043 Tou River Vata Sompin - EE a RE SS Ba Fler Matargot\ argon, ABGRSIECOROTD NBORLD pe : sa 2) Paez NE: PoEil sod i ei !i i he on oa' ela rr coms correes eld ole] a 8A i ale te yy | TE := oo Ma BatCoof ryg Cine 12leafoz 001893 | Report E0200 "a Tom. AverVtey Sarin vi B00 Plies Nikatargotstarget ahem, (\DORTORER070D) MATE SORTD Pree3 ooot ! E = T tr coTrrres = 5 = ibe Hoy | =! Hep : : 44 Copyofrg CHiE @/"ihaa/pz 001894 | ResonE020443 J DRaetpaortPilDea:te:\\B2e7s-tAuagr-g3e0t0\3tar1g0e:t1| chen)dudejr. 100208124. b\buDEO0SS, D Page 1 3 Environmental Laboratory DILnaajbgDSuatmtipeleId::+ W1Wa3\t-e3ar6-tB2ls0a0tn3kEa-0212r-30:g424e13,r\Tetnan.zRgiavetr{{V\ca5l0hl3e0ey0nStaEmdpLluSeistbze0o)6se0: MWOiBpsCecr3aI5tn0of,ro Coment ||: | 0mi2a-0442 Water Blank Water SamIpnlsets;ID:omduedrej:r.i4/20/02, ox aVYeolrhhtDcaDetaete :| | Als bottle; J212027)-AAFUu3gp--3a2000t032a11z641:a1035ectu\detsaai.rgCGeaulra0n0Fc2i10she8u?e1e2sBm8u,\bEBADuO\D0Dd2072e.080s12z8..10 4 TDIaAnrItgeegFtraactVtooerrr::sioF1n.a:0l0c0o04n0.12 Compound Sublist: a1l.eup : i corso -- mm x oe rr : Lan : I oo Ge TaN ne i i : E0800. rg ClC ie 12rofp 001895 rors Tom eiSari Ba wi Fle NELtar goatch-- ae fe, 2s, G8, - oz prs iAo] i pe ii ipo] oa SE Cow TT 4 pst HiIbolo1p3:4) | 1 CoE ELL iIlebl #: ' E=H he a rg act Coys 7 L912 refer 001896 ------------------------------------------ Rast E020us Tom. Re Vay Sars Bata Filet \Etstarget\tanget\\cDOh2OeRLn2A',\IAdIuNEoECeOjSSr,D " wT ) =pd 3 ie fe 3 dean oe i= IatEe : = ; =: ] i|Pohpusf 1 pm : Fo - 3 aloe 442" Leh i |! Pare 3 GBahc"tCopyfeayl,e 001597 | oss Yo PRaetpaortFilDea:te:\\2E7t-sAtuagr-g2e0t0\2ta1r4g:e1t1\chem\dudejr.1\D02012.b\DUDEOOSS.D Page 1 5 Eicon Laorsory ! FmgBesrUltisEnaien| admBaeecS esBo0a2r-04m4a3c,kE Tsenen.rRsiveoorrS eVlialolyPeyAaSSaSempEE lsesH1ren, ox BEEiEenLeT.e || Me im ar man i poaorrm n mormonan.s | LEeEREELLEoNoT Compt uta arse : co Ja pl nome wre men er i i : Cn i B itea Coyoc tfregt,02 001E88 | Report E02.0043 ' = Tom.RverValeySamples : -Bata File: aORS \\Etatargethtrgotchensaucde)r, (\DI2ORL2A,b\NDECORS, D " Page 2 ho i 2 i- : i- | ll STR rr es |Coldi TT { 7 oi !i al Miss X i= =i 2 Etter Ca = 34673068 30 4/08 4 001899 [-- Boa Filer NEbutangotar otchontesr, (30260120IOURES0KG,D wo fiel rE : FBio i :i oe 36 30 Loe am ae 1 iiPolIs"E wn Tomer ergs - ros ; Ey Lio ! "8 B3 N i 1 ExtCopy Shc tafser 001300 | ReponEc20us we Ton.RieVaySams RReopEocrEtdaDtaat)e) E2y7 RAuagz3a00c5arSeetedchen dudes 10020625.B\OUDR0076.5 page 3 3 Bavizomental Laboratory Dita file: 123 5a] \1\3B%u8a-t2ar0g0e2Ec\0Ea2r.gCe1rAt cBhaonmtdaudyese: 1Yoab3beob1SsAagBersata0070s nGOipbkeeraIatTfoaord |||: Bmi0a3-043-38032; Water Samples)Inmsetn-1o0i;rscusit3e5/r1b2; ox MCHeaetlthhoDadDtaet.e : )12)72B-a0htu8ag-r'33g00e00r33\t11a64z::g30e36tccuhdeerntdiudesCGai1la1n0401A280%t1i2u5d.BsboA\0DDz0r2.0o812.m | BTIanfrteesgFtraeaciVttoenorr:r;sioF2na01.:l0c0o0in0.12 Compound Sublist: all.sus i ompnde a Rome ou moms ten ee i { i 1 Benton ic, "nc 2liofpr Initial ate 001901 [-- To eeeain Ba w Flot NEbstarcotargetcE han, (DER BORA E0076, ST - er2 0 bo pe pi iaas ia iw oa Lo 18 Te 28 We as 4% CHERRIES ri | pe Popa Coral osu ae a ales we !. 2 3); i 3 fgia NRE | Exact CopyofOriginal nac aloiee e 001902 [SE ine Bata Filer \\Etstargut\target\\DcOh20o0nL2s9aAhRaEStSe2s%.r.0 - Par 3 fe CCpr HE: ii fsei {ong& Vee Oe ne Ba ; aE _-- i ped i 1 : EC AC foroo 001803 Repon Evz0ues "TomRaeVatey Samples RRiecpaortPilDea:te:\`2\7-hBug2t3008s1t3:1achern dgudees.\\Dc020a62rA.bg\OUeDEOr073\.D page 1 3 Environmental Laboratory pLIanajtbaDsamftpieleTa!:: 3\3\0E3e5 starg2e0r2\,t0a4r3geTto(mc,heRimvdeur1d\ev0ay0ls2lo.ebyesseamBprlSeas oE00703 13AUG-2002 00:39 iOSpsmecraItnTofaroko ||: mEi0a2-0443-38023; Water Samples;Imnetn1GD:irduedieis/rii.a; ox fMCieoetmthheonDdtate Cal'bats. ||: 21\37)-ABUXSut-g3a002t0301a11r64::g0036edru\dtelainrgefSaulra\"nD\g102ca0Eh8o1en2b2nu.v2\Abgs\oaNdDDo!Oau2r0d.80e12xm. { TBTa1ar8teeegRrtaeacttvooearrr:;sioF2na01::l0c0o0in0.12 Compound Sublist: all.sun : {ee 3Rmemetaormn ww me wre CT Sm woo oalreenmNenDvISeNn oaWnmw mmnmeeen rm oom {oc Flag Legena - compound response mamally integrated. } acta | LaAC fa1fofor 01904 | Ren ozous = Ton. RoarVata Saris BataFiler \\Etatarget\tangetsches\ducejr, 1\D6200L2A.ANDECOTS,5 - Paez : si go i oi TM ii oa ; re CRE Hohe Cg 3 2 rm ii Tam TB i guns Cac12)sof SEER 001905 | --_---- mss ee Tom mrrn a Bata Filer \\Etat\achenmdgudeer,t1\DiO20t012a8, NnIUgDESeSTtT.D - Pan 3 ie | ' noi [8 30 -- ee : ie aw ame i ps ' iEal Fe ai AA ew aN dP eq {oe ' fobs j Sf i Bact Copyof Origins 001906 | RaperE020443 "Tom. RarVaySaren DRaetpaortFilDea:e! \3\B5toshtaortgienc\otsaregTere\nc)hen\dudejx.o 1\00208128.b\vDUDE0130.D psget ! 3M Bavironmental Laboratory DLaatbamfpileTa;: 3\80\3B0 tst02a-0r44g3,etT\entn.aRrigveer1t\VBa|Olc3lEhe1y5e0mEAdSaSmpUulesDdEOe13i0.s | OSImpnjperaDItanotfreo:|: MiBcInfo | m51i03a2--A0U4G4-32-0308203101;:0W8ater Samples;Inmsten-IGDi:r.duSsyeis/ies2; ox 1 YMCooottmhheondDta|te:|: Cai'pate. \13\33EA-t0hs3tu-a2gr0g03e020r2 \00t67a.:r40g48acd\cuhdeemd\uindedxEG.iaaln"\eFD.4012m80y%8e1sb25u.ni0go\oi0po0s2.0o0128.m | ApTIinasltreegrberoeatctcVtoleorerr:!sioL4nF2o:aolcoon4no.12 Compound subitansSublist: an all.sub [-- CA 3 ron tony i| i Gla on dh hee ee oo i : BaCrycrgt nac el- 601907 --_-------- sn I Bata Filer \\ELatargettargot[i\cDOhZOeRInZE\,d\DuUsBEeOAj3r0,.3 - Page 2 iu i oi Te !i EHwo OTHE gfe io Hoff onto ee Tr Bata Filer \Etstargetitargethchemidadngr,:\DO20RL2E.BADLDESL0.D - a fae 3 | -| Vole TR i ol [IE 3 x: i ww FY {a i Bartley ! GL nfl oodscs ResonEvzouts +. TonRocvatey Saris DRaetpaortFilDea:te:\`2\7Ehtags3t00a2rg14e:1r3 \targer\\DcOh20e8n12\bd\uDUdDEeOj0Sr2..D Page 1 3 Environmental Laboratory : DLIaanjbtasBfamigleaTa"!: 3\1830\5AB3d0t-2s00t2E0a20-4r0:40g433e,tT\encn.aRrigveer{tV\aBcl3lh0ehye10mSahdmEpNulBedDsEe00)5s2..0 OHSippkaeraItTnoaorto || aE0l3a-0043-20042; water Samples)Innsten-1O0:ir:duedredserie.2; ox CNHeoatmthmhoedDn"atte Car'vate: || | 1\2)3\Ah0Bu8g-r33a0000t32a11r46:1g0083edtud\ets airgtGEu\a\RnDcc0.I2h0yEe8p1en2:u8\n.Ezd5Go\Lu0DDaOdr2.e008j12x2..5 aBIinsltegBFroaatctttolorer:!: F314:a0l0c0o0n0 | Taser Version: 4.12 Compound Sublist: all.sub | TT nme are en a co {on i Ely Li a 1ae),le 001910 _-- [I ee om tes --Bat Flat a tab cho deia INESrM0d 72, - ot Pos gaa i- ilsou } Bale il Tae Tale ale Talus us B07 BI TRA HE ale als ale Ci gle i UT r 81 I i al | HYFe Tee : Soba E-- Con af 001911 Ar Report E02.0443 --------Ee-------- "T= Tenn. RiverVaeySamples Bata Filer \NEtstargutitargethI\aDOh20eRn12t0,ahNaILiIEo00s%r2,.0 - TE ie | od 30 30 40s A 4 ee RE: : iB3 IT iol 1 . Page 3 Bott GL13/ nfo 001912 Raper E020043 TennRie VateySamples RDeatpaortFilDea:te!\`\2E7t-shtuagrg2e0t0\7tar1g8:e1t1\chem\dudejr. i\D020812A.5\DUDEO0G7.D Page 1 3M Enviromental Laboratory ! DD1aa23btaDsafpiklee1'4;;: 13\82\0-3aB506t-2s00t2Ba022r-30:g434e33,t\Tetnan.rRgievetrA{\VaBclOlh2eOyeImoSna\mEdpAluSeIsdDeE0s06s7..0 i Operator Smp Info | : mia E02-0443-38025; Water nat 10. cues4 Samples; non-GLP; 6/20/02; OK i! MCiosmcenItnfo :: MeAMCaotsith"hpobaodDttaeet:lee!:| 331\21\2-B-AtAus0gt--a33r00g00e%3t\11t64a1:r10g36edtu\cdheesmn\diudejGrEu.ainF\cD.0IS2y0m8e1sb2uAbE.sobon\0.D2072.00812A.m i TBTineltneoBeraacttVooerrr::siF1oa.nl0c0o0in00a Compound Sublist: all.ews | Hed a Wm im Um ae tm am | oc vias tegens iM Compound response mamually integrated. { i| [---- LHIC 1193//p1sfpr 001913 _-- Report E02.0043 eee : "= Tenn.RiverVasiey Samples Bota Filet I A -- Elstar ot bargescheng, (DORR BAEEO0G7.D. - -_ od bo ; : ii oi: Be Ta Tn ST re Cw= yf 24 al aE Ee HE i us) !i Hi ' Ty fois Gre 13af 001914 ----------------EE -- ------ ------ ------ neers To eaern Bata Files \Etstarget targetchen\chudeJr. :\DIZ0R12A, \IUBESOE7.D " Pace 3 er i WE ' 363% aoe 4m ae EE i pr] i 3.2 Ee Wak wm eB Ce [I gE 1 i Feet i Batty yy i le 001915 ----------------e -- e-- e---- ee-- ns ResonEnz0ues "To Rove VataSamples DRaetpaortFilDea:te:\\B2t7s-tAaugr-g2e0t0\2tar1g4:e1t1\chem\dudejr.i\D020812A.b\DUDE0069.D Page 1 3M Environmental Laboratory DZaatna'sufpileTa:. \38\02B6 cat2a02r-0g44e3t, \Ttenan.rgRievetrAi\VDcaOlh2lOeeFyLmIsAia.mdBplAueDsUdDeEOj06rS..D i OISnpEjerriDanatttoeer |:: Bm1oi2da--AoUuGa-a2-0a0m2ea2s3;:55acer samples;InshtenoIDi:e;du7d47e/ij02 ox Comment MeHaCaetlth'hpobadBotteat.ele!|:|))3213B72eheAua3r-gg20e0rS02t03a11r46g-:e01t83icdhuedeniixduidejzQE.uaiRn\tD0It2y0p8e1:b2o8mHbrIAoDD0Da2r0.8012A.m | TBIinaltmeegFrraacttvooerrr::sio1Fn.a:0l0c0o04n0.12 Compound Sublist: all.sub | monte ! Te a we mew mee mens a ale pri irveivielyswelineii : QC Flag Legend | M - Compound response manually integrated. 1 i11 CFHeCi; pafufor 0o0ls16 e--------------A ------ ------ ---- J Tesro -Data File: TT \NEstargot\tangetic\DhIGeOsRLsZAd,Hh\IuIdDEeCOlErD.,D - age 2 wl ot Ce { oi Wale TTA Tle ale 3sTIE Als i Beale Ee TEE eA Tale Tals ae bof TTT i pe los pe . EE iibOLEi2 i 5 xl pe} = hs 303 3m Ae A KCB Cog p 00191 _-- rosso Ten ovis ts Data Filet \\ERstargetitairr,gI\eDtO2sORcLAh,eBAmIUiDEuSOaHD.eD. - Per i I wm iPA oEww + NAEY CE Poe Tops } NE: : !| Facto os LTHamC 12HY pm 091918 _-- Resor 020013 ee JE A -- : DRaetpaorPtilDea:te:\\B2t7-sAtuagr-g2e0t0\2tar1g8e::13\chem\dudejr.i\D020812A.b\DUDEO071.D Page 1 3M Environmental Laboratory DLaatbasfwileTa:: \38\02E7 tst50a2-r04g43e,c\Tecnna. rRigveert1V\|aDlcOlZhe0yHe1S5maAmdpBl\ueDsdUDeE0y07s1..D OTSappjerDaItanoftore':: 1m503i3-a-A0U4G4-32-0200202070;:17Water Samples;Insmton-IGDL:E;dud7e1j7r/.0i2; OX iCMoebmtemheonIdtnfo \\Etstarger\target\chem\dudejr.i\D020812A.b\DO20812A.m HACleaslthDbaobttaett.lee:|: 312)42-hAuUgG-2200002 11461:0163 dudeis GCaalnePAITdytpe.DUDBRON0D027.D |: DmTienlntsesgFeraacttvooerrr::sioF1n.a:0l0c0o0n40.12 Compound. Sublist: all.sub ; I frwr ome ex sm cwaorGmad rma ime Gre ven mm sen ee i |{Wwoc- Flag Legend compound response mamially integrated. i Fit op. Lh 12ffor 0Q1919 ------------ Reneszous we TomFervaeySoin -Bata Filer TE \\ERstangotudie]t,(a\BnOOgRLeIA\,Sc\BhEOeO7sS.tD. - Page 2 sai Ei i- i ost 1 os Tol AeA ale ase NETS TAS ale Rl le Tl aeTale ale as me : wo TTY ; i ife ) lo Pity 3, 001920 _-- ronzous on eeSarin src Bata Filer \\Etatargetd\uet)a,r\DOgZOeRLtIN\,Bc\IhUEe00m71t.D " raed kis [ERR = i| |pe : Pops ERCRCECEE rT Po ' I , fo ; ; NC Lalsofor. 001921 [-- "= Tom verve Suge RDeaptoartFiDlea:te!`\B\yEtosKtoasrTgaeots\taTrHgEeYt\chem\dudejr.i\D020812A.Hby\DUDB0078.D Pagege 3 aM Bavizonsenta Laboratory : GDD1ap5a5taanbSatfsoielreS!a!|: a1\333a\0%50E30-t2g00a2E0r20-g.043e443t, \Ttenan.rRgieveItrns{iVt\alDcl10e02yh;04ed13mSuAaddmBepuAlgBeiedUsDeEO)07s8..D CR SEIE 5Ee | B05-0u2-20023, water samples) menoie S/d, ox | 3eFGiosm'CneBatdeTeh;e!|| 3v \1\s2ts\0gttae taagor0\rg2er\t1ra6ra1Tgrgssst\schema\dudesrE.y 1R\D0I2081b2AuR,bo\n0a2r0.80125.- | R BTAhTtesFeraacttooinr.! 1Fn.a0t0o0oa 0n0 Compound Sublist: allows | on To rl rl T Err mE ii : 1 i deg sUag1 /HL/Lon 001922 -------------------------------------------------------- fA Te Soto sans -Bata File: a \\Etstargot\tange|t\iDOc2h00e12mA.\B\dIUuITcECeOj78e,D - ae 2 - [I i g od 1 --- Poe :| wPw P]: { sa i 5 afl st i ii Lg ee i wl i i awt 3sel SD es koa caue saluon 001923 _--_-- `ReportE02-0443 ' 7 Tenn. RiverValley Samples Se Bata Filet \Etstarget\targre,[t\DsIc20h01e20s, ItAIaDhE0uO7dS,e - [TF] gi 3630 doe Amal we ORE ' iT OX | al ' 1 BE 3 aoe am ae ae i1 GY SHC 12poor 001924 | RevonEnzanes = TomReet Samples RDeaptoartFilDea:te!\\2B7 tAsugta2r0g03st1\4t:1a1rget\chen\dudejr.ib\DDU0D2E0O08S1O2.AD Page 1 3M Bovironmental Laboratory t DDaabt'aswfpileTai: 3\8\0E3t4stargE0e2t0\8t43a,rgeTtecwh,emRiivdeur1d\evB)a0sl3.0iHe1ySnBABsaGmpDlesE0080.D | OSIptnjepraDntafotroe::| Misc Ino | aE1l03a2--A004G4-32-0308203041;:57Water Samples;Insnton-IGDi:r.dudaeifirb/.ei2; ox MMCeaottmhmheoDndtate Cai'Date: ;:| 31\72\-AA0Eu3gt--22s000t032a11r641:g10e38 td\udtearirs geEGtia\{nFe\c.D0ThT2y0ep8em1.S2u\AnEbdgN\aDuD0.OadZr.0e08d12r8. BAIilnlstegbFroaatctttoolrre::: F13.a60l0c0o0n0 | Tere Version ha Compound Sublist: all.sub } Toma so wm me nee em Ce oa Te Tm Tn ova i QC Flag Legend | # - compound response manually integrated. i Car ag Lhe 12fyofpen 001925 _-- ronecsacus S-- Bata let Astaro argo ESHAn WAE0, 09,0 - [ - Ex go I1 4 iol. ha olCAleT AS Tale ale Tale als Tule Le Ble" lS ele aisle ele ale we I || em 1 == " * fEele 00192 _-- ronccous Ton Rentssi P renla ? Bata Filer \\Etstanget\target(\\cDIh2Se12nA',Ia\IhUaIEe0j00r0,.3 " gi a aE caelae us 1S |1 } LE ; + oil A Ce |B | |[Xd v wt 300574008 4% 4s 4 : i rae 3 oy of Otginal Cid t 1a l2 of 001927 ---- apt E0203 Tern. Re Vey Sarin DRaetpaackFilpea:te!\\BErtsothabrsgTetR\staTrgOeRt\chem\dudejr.i\D020812A.b\DUDEO08.D Page 1 3H Environmental Laboratory i DT1a5a3tba'BsaefpikleeS'a!i: \1333\03B50t70s-t20a0r2[gE0e02l2-0:\44t413a,rgTeentn\,chReivmedru{V\daDelO]l2erOFyLISABam\plBeUsDE0S.4D [I SShErmItncfro | aE0s3-0443-3007; Water Samples,Tomsetn-Ia;ie;auedbeer/ie.2; oF Comment | MHeCoatsith'hpoBadBetater.tea!||T 133))62BghAsu0c8ga-3r30g0e00rs2it11a64r:1g103asrS\cehdeenrdlundoejzCg.aila1n\t0F0a2lT0ey}8v1e2rD2U.DEbRo\ODDD02270.8D12A. m | BDR ihttoFgE aacttoorr.:NF1oa0j0c0o0nT0a Compound Sublist: ail.sub i { Compounds ass ome ore mes Gg gj) Foemte D DfEn E im Ean mmoe oe i oc Flag tegen | W - Conpouna response manually integrated. ii{ EHw AeL 12a tfarfe 001928 ---- Report 02043 : "= Tenn. RiverValley Samples Cole- ES RG Bata Filer \\Etstargetitargetches\dhudejr. (\DO206128,BAUDE00M, 3 - Pace 2 pe . ww i ped i po ! bwow TR* tka : = ' iaif 3 5 C7gyy CEhaara, 001929 _-- sates "To rae ngs Data Filer \Etstarget\targvis(\cDOh20eG1n2Ns,aBAuRaIEeOj00r4,.D - Par 3 a Ba bi : i Li A]El306 3s 000 424 1INW a2 ORE: : wo Or - we 3006 T4844 ash : HC flo 001930 ResonEv20us So To. ReVay Sars RDeaptoartPDilaet:e! 3\7\B-tmsatarragsete\staregeer\)chem\dudsjr.3 1\D0208128.\B\DUDEG866.3.D pa.Page 3 3% Environmental Laboratory DDaatba"sefpilefal: 3\3\03E8tstarIogzeots\eyt,arTgoem,c\icvheera4\vtDidOeur2odhe1ssaermBpAlSeIsDE008E.D PASOIpnR EferaDitE naoftore';|| m5103a3-A00464-32-0308203083;:03Water samples;Inmsetn 1a0i:seauegi5e/ribz, ox Po MYCeeottmhhoeDdta|te:: ACasi'pDaottet:ie!: 321\172\--AAEu0g8e--22s0000t37a11r64::g1036edrutdcenaiszg]oEGu1rTa\d\H0e0Ic2a0Ehu8i1e22SAm8uspm\bAo\dpDn0u22r0d0.8e12dA.. | DTIinaitreogFtraactvtoeorrr:s;ioF1na.:l0c0o0n0i.0. Compound Sublist: all.su {mn ccarrina ww me or en Ce QC Flag Legend | como response mama integrated. i i : LCO oeLlriopOrg 001931 BE Reson Enzous , To RieVteySanps wi- ET Bata Filer \\ELatargetuietl,a(n\Dg2Se12tA,iIIcDhECeORmG,\ " rae 2 Eo i ei i wu ! J | ha TT ! FR ;i w 3 oy IE : bi sag se Fatooh el 001932 ---------------------------------------- ReportEQ2.043 "Tenn. River Valley Samples ta Filer Abstrgathtartchanced \SORORZAINBE086. " 3% ft ! 2 i !& saa we {8 ;% CCooEa pa = | wry i| g=n i TR ;i: os cusntt03)0! Orga) ar fel 001933 ---- RasonE0z0us TomRor ateSaris RDeaptoartpilDea:te!\\2B5t-sAtuasrtgae0t0\star0g1er3\chem\dudejr.i\D020128.5\DUDE0127.D Page 1 3M Bavizonmental Laboratory DLaacb"asmfpil1ea]: 3\0\03E8 est20a2-r04g43e, tT\encn,aRrigveer\tDVaOlil2ec0y Kh15Se8ammBp\dlBeuUsDdEOe12s7.sD i cSRh2o3aiTrHBanhtategesra";||| c1a03e-3a-0064-4230-032802180;:35Hater Samples)tsmeen.DG0i,zd:ud3e0s3/102; ox Pom aMEHeeittthnoBaoadBttaetciee!||4 411J32)3BhNgaaCtEga0zg8ReSorEicG67aa0ri0gaaarSicEhAenTidYudue xAa. inE\D0R2E08n12t8,Rbi\ED0o2008128.m Bi Factor! Loon compouns Subtiets atte | Taree Version: 4.12 F-- Tw rae we -- Sh { . Coix e fagzafor. 001934 _-- Rap E020us "Ton Rete Sarg Data Filer Re REFS \NEtatargotStarrg,o(\tJ0i20c61h23e,E\\IUcDEhCAu27t.,eD - Paez I = hc] i we ; = Cdly -a gta i wo TER i! poon io aC One G Tl aDeg b 001935 JEEEEEEEE---- se BR, | Eool = |i | : } ead flo Sey5 gal tach) Wie, 001936 --_--_-- ReportEc 0043 "2 TomRiVavteyeSaprien DRaetpaortFilDea:te)\\E25t-sAtuagr-g2e0t0\3ta0r7g:e1t2\chem\dudejr.1\D0208128.b\DUDEO133.D Pageize 1 3M Bovironmental Laboratory Bara rite: \\ms02-s044t3,acTheornnnd.gudReeiv3ecr\OVtaZlElRceyLa8SamBrp\lDesgEGLe3)r.0 i oSInpTjepraDItanotfreo :: m1Bl03a3--A0U4G4-32-0308203161;:4W1ater Samples;Innsotn-IGDL:F;dud8e/j2r0./0i2; OK Mise Info + ! CMMeeottmhheondDtate +| : \29-\AugE-20t02 s07:t00adcuhzdeemjgz\.diuedorfQu4a\\nDt0t2T0y8pae1:2r5BS\glD>0e208r128).m ADCliasll DbFaoattcett.olre:!: 1413.30-0A0U0G0-2002 06:44 Cal FATE DuDEOL06.D i TTaartgeegtratVoerr:sioFna:lco4n.12 Compound Sublist: all.sub i: wn awn--zs mre or es [Promig(eaiii) 1 iN EatCy 010 ! A -NILIEYLele 001937 Repngo20ie "2 To. AverVotaSarpns ER Bata Filet WERatangut targetchem er.1\SO200Z IARDEOLTI,0 - RT Paez py wi ios i ox | oR ITS me Ea Se a8 ale 48 we ae ae CEL 3 iCo awo rh1 PR ggE ilsu rT = Tr : n : 14 - i 12 os Emus un role TRE 001938 | Report E020443 } "Tenn. RiverValley Samples ' 2Bvao FiuenNettargoatch i HEE21INRE12.5 " es : wel - 2 IF al Ia PoE 1 | seol / NI E | bonei i 5 aFait,alto 001939 | Repo 02043 "a Tenn. River Vallay Samples. Report Date:`35-kug3003 07:13 Data File: \\Btstarget\target\chem\dudejr.i\D02012B.b\DUDE0136.D Page 1 33 Enviromental Laboratory DDaatbasmfpileTa!: 3\8\04B0 tst2a02-r04g43e,r\Tetmna. rRgiveerr1\v\a5l0lce2y0h4e13mE\pSdiamppluesEd01e3)6.r0 SOTpaEjeraDitnaofkroe}| Be Ito m31i03a2--A004G4-32-0308200102;:24Water Samples;Inhgeen1O.i;ane/tde5/s02: ox MNoeemttehhonDdsate dai'maze :|| | B3\3I\-ANEuEge-I3aN00tE3a80r70:g628odru\dreiainrcaGera\n\DtH0c2FT0ho8se1:2u\8bBabdbi\ut0n00d62.e008s12x8..m o DAIilnlstebgForatactttlooerr:.: F411a.l0c00o0n0 Taree Version haa Compound Sublist: all.sup | i Tm Te mn me a regres to Sm mm em wm i . CoofOy ring LTEi12nfTooyfd 001940 ross 2 Tom eaeSus -Beta Filer --L \\Etatargothtarget(i\JcO2h00e12mDi. NhNuItEeOLlHr..D - Pez I ion 1 i TET TEE ETEE REE Pla TT RE 43 P` oEwonile i ; ww RE 4 1 " 1 pe ' Tae 340 3m ae 4 ate 20Guy Sein, 001941 --- Data Filet \\ERStAREetbarge cham duaejr {\BOZORLZE.ENDECL6.D - a wi; 3 i| ETRE a TT i po ii ia 1 2 3sal oa TET ay pe : Toga fobs ee | rae 3 . ! FachCog vf Lin af/se [a 003942 Repo sczates Er -- DRaeptoartFilDea:te!\\B`It5s-tNaorvgZe3c00\8ta1r9g:e1t3\chem\itchy.i\1022113.b\ITCHY034.0 page 1 3M Environmental Laboratory DOSLTaatpajtoebarDaSTtuaafpfoiterleeT'd:]|:mO1Ei\AO2\a2-B3-%t00sW4Vt4B-a32rS-0g#0eB2t-\L1t;3a:rW4ga0ette\rchBelma\nikt;chMye.IOin\Hst10B2x110t:1a1c2it.t;be\nIy$i.T1COEcYt03042.,D mia CmeotBmhceondttao Meth Date |} \| \1B3t-sNtoavr-g3e8c0\3ta0r3g:e3t8\cLehcehny\iitc!hy.G1e\d1n0e21H2y1p2e.:b\N1a0s2s1112.m ADCilalls'pbFaaotctet.tolre:: 11313.-0N0o0v0-03007 13:14 gtict. ; ITnatreggertatVoerr:sioFna:lcon4.12 Compound Sublist: all.aub i i comgeunde. oT r-- cr ans EE rer moss WEE Te The Gg) Tem e/a om i rs tom i 4 ou lm dhe mm ven ie i FastCopy 3, &mah 1[g rHLoL le 003943 -YY YY [-- --_------ Ton. eeSari -Bata Filet ERTS \\Statarget(tttata,(r10g21e14t2,hAIcThONeOmM,t , =|= PCool.s-28 = ito ed Lol o boH la iIF3 CoE i Tre HO HE : Ch 1 imi Hasiorgis assis" Page 2 BBretlyye, 001944 | -------------------------------------------- Repo 204s [Ey ------ Be FLL} aba bargetchs hy. SELLS TESA, " Ps WR gos Pola 3a a Ae ie TN i1 i rEjd g ue ee hs i oT | EE i wtp; Graff 003945 | _-- Resonen20us we Tem. Rue vatey Suis RDeaptoartFilDea:te!\\19BNtovsist0a0srg13e:4t5\targeti\\10c2h11e13nb\\IiTCtHcY0h3y5..0 Page 1 } 3M Enviromental Laboratory ZDIaajbt"aBowafpbileeT'a;}: 2\O2A\%shESoVotiHaaB0t02a1r3:g5e0 r\target1\\10c2h11e12mb\\IiTtCHcYh03y5..D HSOippkeernatTeaocro ||| m5i03a-0443-WB-2; Water Blank; MLooHgeEx10b:iascceondsi'oct 02; va Comers | MaCHelaetlsth'npobaDodtatere:lee!|3 311)33\3BN0gos-vt:2a30r0g00e2%c\t15a33r.:g33e46t\Sceheenm\iitchy.EGuit\Rn10eI21HE1o1b2s:i-rbht\i1as0vR2o1e1.102.m |i TBTienltresgFdratacVtteoorrra:!teP1m.a:0t0e0o0n40.2 Compound Sublist: a11.sub 1 we rr aww me ae =oo mm TEETER Sm Te ii Tro mwom i w SooeoLmlormTonona oo i 4 Paapyc00t 1. oT Ql raffle 001946 -------------------------------------- nero % vomterom. Bata Filer \\Etstargetitotya,(n110g24e11t2,iBNoIThCHeO3n8,tD. - ry pwoe RRET : ei -22 30 26 2 || -- ou aT THe Ee aE Ral | RE wai 3 {ioL|Bpei " ; os el Te AEA We We Cole TT (= i Ge HR oe ty 90 Vf is EE # 001947 | --------e -- e-- e -- -- ---- ---- -- Repo Ezzaus "Tom Rue ete Samos i in tr NTE rs 3mcam gop FBiiE i aod Ta 4" 4 Pom q hwo! i pm er 3 i- * 11 EpOTaEE \ al | i ! FaCopy cOtz ASO 001948 | | renEr20s FE -- RDaetpaortPilDea:te!\\IoB-Ntovsst30a0srgTieeers\targeti\\10c2h11e33mb\\iITtCRcYh03y6..0 page 1 aM Environmental Laboratory [I SSrD5paEaatiratnBatftoRoierlei||: Bah\t0\r aB%t-es0tua) -re3g0e0t0\et4a-rn1g;ets\tcohte;m\mietocwhy.BIeine\sst1a0t21d1:s112Ht.BebLc\iIh%TtyCoHsY,03v8a.nD Botan | MHieettsrhonoBaDdaeatecet!1| \1e33\BNatosvteea3rug:sest\0it3a1rt5gsett\ecthmepmi\iitchy.AYig\N1h0o2E1a1a12z.T5\b1th0o2x1e1012.m o DE TihftesRrE eaetseer::NF1a0s0o. 0o0n0 Compound sublet: allows i A +aom mom imine mw om i runto be lm ie Vie en am em QC Flag Legend # - Compound response manually integrated. i 4 Eto: 0d bn_iafiln iota] oats 0013949 | --e-- e -------------------------- [-- [ES -- . pdel TR RE Data Filer \\Etatargettointy,a(\rIGg2Le12t,WIhToONhEIe8,nD - Page 2 pre i =i fi {oe i{ -= ' 8 Le 1m me BB Ne WEA TAS EERE WSUS TE ale ae ae |a {: p=A i: d iLor0aa : LE Toe ; ! p: od Frey ET asso ane flo ) 001850 --_-- ee -- [. SE prBata File \\ELStargettargetchem toby. (\O2L442 AITCHYE0,0. - Pace 3 gi CF2aaE S pmr AE : i EE uw {LgoEl wl re' Cine. 12 fel6 001551 | - wos 5 .-- Brn EE v \ Data File. Etstarget\target\chem\itchy.i\I021112.b\ITCHY040.D noeje s Sovisonmental aboracery E STDwaaetoaasfE miilee:a: BsMotiwesmeiesnn)ore, sens eon BPRRE KB, ea \\Btstarget\target\chem\itchy.i\1021112.b\ITCHY040.D : H SHSE> iIpEhnMehiERm ecee,oll|| | if\W\Bn!eie,smaergem\ricaagetny\cchaesnmm\tiatncyh y.f1Si\n\1sI02t:atLoenezs,MAo\E\ioT1s0o2] RE cmon stem en |S na me iLhse, compound spt a. I wn mm wre ---- -- |" ge 1 Fcraogmpzoeugneansxemponse mati integrated. i i C12 ufo 001952 | ----eree---------------------------------------- ReportEQ2-0443 | = Tenn.RiverValley Samples. =pd TRERT Data Filer \NEtatargetitargetchentfbchy. (\RLLUZINITOHMO.D. - rape 2 pnd for] fod |. - oma hs me me 36 HTS THER TREAT WE Sy ] IE: 3 1 gi H SE ale ae oe) i bo 1 po i at Fig ErtCayesanga Liu aol =! 001953 EE Repo o2003 Bk Fit tao SEITO. w 3mcamT Lo Tem RarvateSarvs - rs ' ET) PoE =op aE { a "Ee i | of oat CIC 12rolp 0019p4 | Repon Enz0us Lo Tom RievateSais DRaetpaortFilDea:te:\\`1E5-tNsovto3a00rg14s:4t3\target1\\1c02h11e15m.\b\iTTtCcHYh0Sy2..0 page 1 3M Bavironnental Laboratory SDOIZpanomjetbra"aDsItamnfotpfireoleTa!||::0Bm1\40i3\43a-B3-Nt0os34vt84-a033r4-0g430e827t03\4t14a5-:r30g;7etS\Lc-h1e;m\MietocRhy.EIxint\sr1ta0c21t10;:1123f.5eboo\nbIyiT.C1HozY;04m2i.aD wit Ino | CMHaeoltthhbeaDtaaetd:e"!|| As bottle! 1\13732\--NNuoOvtV--3s200t003a10r39::g234e6 rir\chty.a1rgeCG\atul1i\0n"2cF1iThl1ey1Sep2:mtbr\S\cet0aeo2tsz1e2c.1hp2.ym j oTTaaitseegFrraactVtoeorrr:s:ioP1n.a:0t0o0n040.12 Compound Sublist: al.sub F-- Tos Tn mr a Te Te Te mn mn i ' oc Plag Legend i M - Compound response manually integrated. i i Fait: Conc 13 [ofr 0013955 ----------------------------e-- e. Reon ates "Tom. verveSarin NET Bota Files ELStargot atchon (eh, I RLSS2ATTONOAZ.D - rz wai 20 ii I {ol STATIS i aT 1iE pi i >i we we AETHER EE i he Ta ae es ve . i u2ree a w:=1 :1 wael i i ET Jr CMC 12aESf 0o13s6 | --_-- Rs czzove ee Sr 2 Tow artySan no fz | i Pm | | a RT 1 IZ sai : CH nc 1R2fiolin 001957 | Rencizous [SR -- DRaetpaortFilbea:se\T\5oBNetvSaoo0ts aTerogeeit\chty.a\r10g211e15\.B\c1ThCHeY0n46\.D page 1 3M Environmental Laboratory | DpArISaajtirtaRaBttpafeToitrleeA'!:||aB\l$0\a32B0t-s00tsa5er30g-0e33t0\0t155a-:r15g;0et\51c-h3e;m\iMtecohy.BIen1rs\et1a0r12t01;:112Hs.eBbei\IntTyoCzHY,04w6.aD I Comet! MerC3at2iah'oBndaattetie|T 3a 1)7\3BNesvt-a0rg0e3t\t1p a3r1g4et \r chem\ itchy,Er 1\1E02A111e 2.nb\i10o2z11e12.m | oTIiantreegFeroaetVioearrt:s!ioPLna:oleon4.12 Compound auntie,subList: an al.eub 3 aes poh nme se en oe i os ton i | i ! St Nim ah am em 7O+nat c. a 11Orfiy ginyaloaf 001958 | -_ Rap E020u3 2 Toon RevaySaris Bt let Sra LNT0,3 rt Es wi = io : om Le Ls me me we AEA HE TRE We US Ae ]aEuo 1 Ig 3 !i And pe 3 ale als ae i i, : bbood 1 Rr EE I >ighalk ne 12fi) le 001959 r--r ---------------------------------------- Report E2003 wc Torn RiverVaySapien Bs ld Nbr ira on ESLITOH. - } n aon cumT : ia 3 -Fpial ; wt on a6 Se Te a dd" i "= I 1LE Fa | TA a a a = -_ wr pa fF Togs 3 CT i i os Fatt: ie, Cc @fnfa 001960 | --_-- Reson Eczaus wc. Tou. Rr Vay Sores RDeaptoartPilDea:te:\\`B15t-sNotva-2r0g07et1\4:c4a9rget\chen\icchy.B\\1I0T2C1HY10182..D Page 1 3M Bnviconmental Laboratory ODTLaopadtebarDasatfmtoipelreTa}::: m1\0i2\4a-B5Nt3os-v3t-8a02r40g50e-2t3\t1a6:r1g2et\chem\itchy.Iin\s1t02110:112f.rbn\yI.TiCHY048.D CWSi7os5mceInIntnffoo:|; H02-0443-38045-2; SL-3; MeoR Extract; 33 6% 02; Ma MACMeaetsith'hDobaoDdttaect:lee:|+ 11)3233)--SNNgoosvvt--a33r00g00e22tit01a93r::g3264atiitcchheym\iitchy Eg4u\a1En0t21ET1y1p2e.:ibn\cE1aS0rT2vso1z1s1.2o. 0 | TDTiaolrtgeesPttaacttvooerrr::sioF1na.:l0c0o0n040.12 Compound Sublist: all.su i-- -- Bom wre mes a a [re : [ te C(212T 001961 | ------ ---- EN. Bata Filer \\Etatargot ET targetchem toh,I\IGLL12,WAITONO4D,D. - roe z } ol g os El | wi a os 11S zie mm de HE us a |{ L@E VIBPEE A.: 8 e a) RC EE RETR rays Ce J i\ gi: A i ---- Saif -- 001962 | -- Report 02.0443 ! "Toon oorSing Bata Filet Elstargot\bargtoeny.t\IiGRIcSAhZ IaNITmONYhOMSi,D " 3 FOR cax3) HpipeEa] [> om! =tSe o 3630 Le 4m 4% i wd 3 I ORL FR re R ol 3 il ie LobE he) Ty : i } i ~ ag bt Brel 001963 | Repo 02003 "Tom RiverVatey Samples RDaetpaortFilDea:te:\\B15t-sNtoavrg3e0r0\5tar14g:e4t3\chem\itchy.i\I021113 b\ITCHY0S2.D P:age 1 a Bavizonmental Laboratory DITanaftbaoDarftsielefa!:: O1A2S-\SN\IOBStVRs-St2Ta0rE0gS2e)t1\6t:a4r4get\chem\itchvy.1\1021112.b\ITCHY051.0 ii oMSipmsecraItnIofnrofo :: mBi02a-0443-38045-3; SL-3; MeOH EIxntsrtac1t0;: 2s1eeOhyK.i02; Ma i MCeotmhmoedn:t Neth Date \: \1B3t-sNtoavr-g2e0t0\2ta0r9g:e1t6\cihtechmy\.iitchy.Qiu\a1n0t21T1y1p2e.:b\B1S0T231112.n AClasl bbaotcet.le:| 1332-NOV-2002 12:14 Cal File! Trcvozs.n |i DITinaltveegFsratacttVooerrr::sioF1na.:l0c00o0n40.12 Compound Sublist: all.sub i Compa eT + ms om i + mo can i } oe con ws Boma or mes en a wm a wo Te wes aes mame deem lm se a Woon nmoun oom om wooumumnnonm wm wom Le TR am sam ayy 3, 1 i [47a Y/ 97 Toy 001964 . | ee eee e eo ---- wn eso. =Bata Filet S---------- \tatargettteahrIIgGReALtLZ\NIcTOhNOe8Lm,D - [= i 3 ous | oi oe io Eel y 283A We ToE : Bi CIC ofa Te T------------------------ Report E2003 "Torn RiverVteySamples talle ebstaot argon G13. TOOL } = == Cope i | 5 ! TR mie i o rom cowT i HE ] {hE et |i wEr =r . IE I I | "um aa ei | ~e EC 2fof. 01966 | RaperE020043 er -- RDeaptoartPilDea:te:\\1B5-tNsotv-a2r0g02et1\4:t4a5rget\chen\itchy.bi\I\T1C0H2Y105131.20 Page 1 , 3 Environmental Laboratory ZDInaajnt'aDoamftpieleTa::+ 01\425-\3Wo3V8S-02405t0-20s817:t05 achrem)gitcehyt\1\021c11a2 b\rrcgavoessr> | MSOiwpBpecraITtnaoftroo:|: Bm0i2a-0443-38045-M3(3); SL-3; MeIOnRstEx1t0r:aciteschyJ.iioct 02; Mia MYCaeottmhhmoDdea|ntot::| Cal Date. | 11\23-\NNooBvv--e2200a0073t10a29::11r48 gdtechry.\iittchay Cgirau\li1gn0t'zFei1Tl1ydt1p} e2\:rrBccM\Rathnvosozez1e1n.2n2\.m DlIinsltegFbraoacttteoolrre::: F134:a0l0c0o0n0 4. Target Version: 4.12 Compound Sublist: all.sub i i ow Tn mn sen ry i wo la de Conn Tin W gg :. iCine jasale 001967 | -Y Report 02.0443 ' x Tenn.RiverValleySamples .i resemsos ES ---- r-- ! B=l gi PosB i RE: IE TEi ol - of Le LE ne 2 38 36a us BRIERE IE ae ae ee HR! I] ' {ihfes Cols id iij E. =a FY 8 FEET arLnCct."iasol = == vo1968 | Fe A----t a -- SE ------------------------ rs I | of5aHodo, a SET aE | = |a Bi El i ests ogg inc . 001969 | --_----m soaeMo---m----------------- ReponEc20043 "Tom RuevateSapien RDeaptoartFilDea:te:\'\1B5t-Nsotva2r0g05et1\3t:5a0rget\chemi\\iIt02c1h1y13.b\ITcHY055.D Page 1 ER . 34 Bavironmental Laboratory Data file : \\Btstarget\target\chen\itchy.{\1021112 b\ITCHY0S05 ;. SOInpmjerDaiatntofero::: Sc nfo mB1i02a2--N0o0v4-32-0308204167-:12;8 SL-2; MeOH IExntsrtac1t.; 2f1eaOnyF.i02; 1A MMC= aeatlthDaDtaet.e :| Als bottle: 411132-NN\o\oBvvt-3s2t00a00rg22e\tt10\a39tra::gre13gt46e\cth\tecneh\ecm\hiiiyttcchhyy,CG1au1\ls\1n10eF022l1F1e1r1r2e12e2.lTbT\NC1HaY0a00222161.1D20 | TDIAneItreagFiraactVteoorrrs::ioF1na.:l0c0o0an00z Compound Sublist: al.sub 1 1i ca oe--ne nme we a coen | cm, ig, 001970 | eeer eee eeeeeme--eemmeeeem. sen E0200 Tyg -BataFilet NE ELStargetS are chnt cy,11024412.INITONOBS,. - oz oi .= ! ol of 1s im me as ue Eas us Cae STE ee ale ae [ [a 1 |= Poh i BE == 4 A : EA 36 Co eA pe TTT i ri] Fioos FERN RTT LFotgOigy Je "lal. 001971 -- e-- e-------------------------------- [r---- RR ---- Bata Filer \\Etatargoti\totbya,1n\1g02r411t2,rINcIThOHeVOnSSt, " rm 3 per 12 : tiies 2= i apmils aa MNW EE : wl i ign Ey ; gy [5 |" 20i 2 |i i poe 3 LiSnog cpome: is Clog. 001972 | _-- Rago E020u3 A-- Report. Date! 15 Nov 2003 13:50 Data File: \\Btstarget\target\chem\itchy.i\1021112.b\ITCHY057.D Page 1 i SM Enviromental Laboratory | LY an nm TE CRDLIEafatsarBatEftEsie!lrefal||2: 1B\S\l5aEeia6tesso0ts0aaars0gie:ents)1t7as.r5g0ets\cuhaem\wietocnhyE.A 1asE\t1R02E11D1:12H.tebe\MnIy.TC,HY05a7.ap Comment | MABHCeiaetsl}th'hpobFaoaDdttcaeti'tleees!:|+ 31\1333\-BoNtvos-vt3-a3r08g00e%3t\1t53a3::r25g45etd\ecehnepm\ioitchyg.Au{a\nH1g02I1A1u1l22.hbbvy\I1e0Oe21.1102.m 1.00000 i.i TIanrtgeegtraVteorrsioFna:teen4.12 Compound Sublist: all.sub | QC Flag Legend M - Compound response manually integrated. |i i aTanr ,flCrgning_, E>) 001973 | _-- zs Tom Bata Files \\Etatar TR EE gottargeticnentitchy. \O2LLAZINITONCE?.D. - Paez i . ost . -: | oe Tn Be |LhH Ai Er ] 283 Tale I oad i _-- ize ET 001974 | --- mau Lwseeecransess" = 3 k= 2 i 206" 30 aa ae LE IE CE i ua iLo 8 ff Nm aa de ; wt TomStySn rs LC 1Oy Ele 001975 | er-------------------------------- Rant ots "TemRieety Sarin DRaetpaortFiDlae:te:\\B`It5sotwaervgieatot\star1g9e5t0\chem\itchy.i\I021112.b\ITCKY0S9.D Page 1 t 3M Bnvironmental Laboratory i DpG1a5pr)tlamoDtafgekireleM :iai\T\3aBotor svt-asregsest\t1a8:r1g2et\chem\itchy.Iin\s1t02110:112t.ebo\nIyT.iCHY059.D BPooTeEs | B03-0443-38046-3; SL-2; MeOm Exerac: Fiakiloa; ma i SoMEABlarlistnheobFaaDaotacettt"oehr!!:|| \1B41\33iRE-ootN0svo0t-v0:-0d3000033t\01t3a.rs3g6etL\ecehheym.\iitchy.GAiu\s1Tt02E1T1y1p2es.nbd\Na1vg0oa2ie11.102 i 2 1| REE Integrator: a Falcon Compound Sublist: all.sub : Compounda. a omer rar umoss (e/a) (e/a) i 3 on cam i <r om | fm" om wom ow n tmamih oe 5mm am i: BrCoapy cinka qm RBeAs 001,976 --e ee Repo Eszouss "Tom Rar Vtey Samp Be lt bree ALTOS - ro = ETE ;i oi or i 1i o=d | |x Bi t Se ew imeem i 3Y i i 6738 50 Eien cn fr . 00197? | EE -- ReportE020043 . Tem Ruervatey Samples i scan trea ET Colom al pBelz: 3i bors 36 3 1am ae I Tole wm! | po 1 iEg iose i Te io ! 4IT" i oe 2 i TE am ae ie 1 os Eni4 CNC 2p. 001978 | -- --e-- e -------- Reson E2043 wo. Tom. RivervaleSales ATTACHMENT D: SAMPLE PREP SHEETS, TEST SUBSTANCE, AND TEST SYSTEM INFORMATION 001979 - ReportE2003 "2. Toon RverVay Samples LabRepent EQ) - 0443 Tennessee River Valley Samples `Sample Loc1a, LtarigeMoounth Y EE Cee T EE weeRRR 2 --: | Passa T-- T CEC " FreTeeoee EE L98m7 TTTTTTIT A JR EreT ve EA FSre 1JI Pwereel= ROANSEBE HTESST 1 rr FR Crovonvuee-rsboI orga Sy [IT TSLSS Tel Sy rereEu A CW 1 | [e[nFeTuwEesnSs TIa=s"I C TETS1OE O FT TTT OEN TE REC T E [eos T-- TTT TT I TTC TATSy FO eso1 | Ceses T= TIT TRIN ST 1 corndtss urgesan enssnare _038% 1 bro 009 noBimlpleutn on Gotu vonMot lar 0 ot 5 1 cnsmiifoz2a0t20pmne coat rtm 0a STS wooHill: Toc Yu CoTonge ts nC RUN Sub CENTSSe . cots Ton20am L110 0m a-- Ci AN rnr IY e rem =20 i mn TUZ | rune 3600 mee 2 rey) Do cue ronleAaNnE cot ping sonar04220<780 sonore Lipps amoitsand100L on eatin larIEA int C8: Jun dos we Amnlltior eme cot TALL ke1 AE/DLUNC aT0820 aroLATOMS cusTonothaLy1 E20 001980 cornTones(a110) 0M . Gs4e 71o5srien aa nA3ao3g0e ID flr0S0p-F3AB , 100 JAAt E iywee --_--ee -------- Repo Ec2ous Tom. oe Vay Sunes areneE03R0Y443 TeSn amiRn Livaee craVans l,leCys utSaae nmple es 3 Pi Br & I ; I I TIoErE2L 42 ns 00SO IC rT IS E L 1 170 07 E I s | PCE eaetveessE BTao= N N NTA E SITTs TI IN i41f5 4 EFPareseeeselh=--anNII ASSIRS S TLo TTTN T S NT IT r CN Tr STN h 1| FFPereueeessssD I--= a TT Io Tr SR ITRS HTRS T O r---------- 3 1% FFrreeneT= Fee Ba NI IT TTSTITNTCHOOENR TSIIR PH he)3 : EFReE iE ees TE=n TCO 0 ee 1 ns | %534 !|i FPCoaaseemn T[=oR14 ENE--H --PTETr PIESE mT 3] 8 i ConseToPYT=ToT= IV o oT PT cut mano02BC { i CooLZUTvewronBlyli /50a cormidingnfonOne kt TOL HQ. TE woMELDTCNUS Cao Ton 30a e110 J220M. cut 00L Yip 4)OPoomaele came1QZ coJ sTAT2m61 2ONC c[aCmaoE pe L 220 } : rman 0 nnd ree 1 csvn, eet canon ope 10.0cn2c. nro ILL 00 TOC NGS cat spa sai0s_2262271 rato Lg423_ooetnipl con vanthipe_(o 14,010 coum Lito 001981 Tony 18 OC onoa AIC wp BE Col : TNA-UYLS o Lets gent dog wendRig $1141 ene res Pe my Ga Set, 590) ines Ye Cou RAAT SIARTA -_-- ReportEvz0us <o TomRv VateySaris tg gry Sam LTeantneossLeerRiverthVallaeytSamoplnesaoult Gi 1d K i eh RE CoaaeeTe(I "VT TO APOL T y P8 CE avaweasT7-- TTC CCCP OT EE E F S,1 [eawTereses =Ic RTT TrT/ OASTRTTs P[FaoszwsearB!a--an,MTSANONSRTRITSS TIHSINRTTSST TTok: Praweal-- IRON TST INET TSO Ted to Camebone Ld RENTS TT TTS PISITATS Te 2 { REET CasesT=IS ROTTTgq TRI3S 5 E apom | TOI TT TTTCOr T ee A Fs [EC I EE Ee A TR A Ae JTC.) En 3 curse i ssacec cur mmn_OS=g & ea 900 mospeneeighan|Dn. exsainTonLun atye corsoLinn {0147702Cine. | vewoMilli -0TORUS Po coe mo 0An Ben 0 cusTonE Lo1/m 22cn. come Tz RerouteJD oo rung)T. ous vnThan 0.03an car samsumanos02022:21. oonoe5 penertnpel Eatsip TOWLShinL100OLN cae von 255m e110SVC cmmo0Z Eprurmme10mcreIe D22 ot 170012S52 116 OC can l20__4000A woTBi O-0ONS collvaste Ciaoprin uPrenziite 19,0creo von Liston ie 11 0@c uintez Col: ThA-HIGS. Ld won:ma 45101) 25601982 LEH L ey pa ry td by h ni rere si an) -- ee------------------------ ResonE020043 2 TonRivervay Sars mre E100 `TenneSsasmeaeRitvrear iVanl.leytaSanmples. - 3 0 [16] 8] $ : 3 CFCaazo eens DE=oSwAA0TXd ATTECTPATCH TAHTrAaT ATTs a IA e aT p ------] ------ =%2 NECCrE 7 Sl <n| Fr I EFEeTY sTceaT]HIC NEE SoR HE HH HHy H ax ES ns 3aN33 IFCEETeN a elH 3 ES EH S dT VHIT I S es-- | 32a28t: PA [ress T= NNT A NTOS138 1 F[CPaaareeesssTTBo=--se Ire O PNTOMNINTTIa TTSH TS TS Sr TTI e --------1 w3% y A1 A BH Perarcea TP = RYIIIWPEHSS On-------- T|R) [osceusT--TH TNT TTTTTT feeser Loma THT EPA PA TFT 17 Pr 5 % od i Feaaaes1T--=T TT T PPPOTTO RNAST AN N 1 $25 i i|i Pave T= TT HT TSI Pg x3 CPpasoresesoemI HEE Re E To SEA s --a 3 i camel eau tr aro O52) ! bao UO rere [St tots ro merN ewan ms JfioAmLsN1O0S0 cootnniTelARLOTN. . cenuevvoonnE0al13eAL,O Kn<e. e(1 cme TZ mirenE Ooms2 ; J conTnLSrARm ermine2D Drew 1 LISWAT wari 30___61/1 01 mooGATIOS gg q983 a? tg mavens03032 = 77 on von 2000719, 40 comin coe 1.1 sence LOU owt en 228218, 1m i" vonihen Lo [EQ0 ounm4 ea 59 alo0 -2-52 ) CEotg n 2Tuan1e5]6s1 tmnc. _-- Olt roiduals SorLy(5 OuET a -------- ReponE2003 "2 TouRverVleySages mn fp) TenSneasmseeeLRoivceraVaLtlaligeeyoSonaum,nples - Cr oEr TI A WIeT N2 Y 728 7 | [aauemrssJE T o E Y er eeernss7K7dTy TY [sEruessTE--[ mJTC PCT I ns% Coasmeers 0 7=7 RTI PSPC EEgr sO8 : CaFseoneDE ow]TTCJIENCEEIT TATRPOE T Ts |Po [Coamsuonwe |== ONITS TTRSTTSCRSSCISSTR Ty 11;% |: [[moesseeesrB=ron INTNTESSITSTTRTCEOTTTRE I RN1318 [CCaavsasesas[T==ITPTICNT TTSCEESSR ISTSESI HE A N F T F FFoessusueeesrJ|am--aTlJNIET TTSo T TCTOC LOT2 Peesors[= A TTC TE PPO FiR veTarO o s A DewT= TIVITY T PINE PEORPRRGTy i conrmnlan 1I02CHC ussumo 0380 1 e090 reepesibigiSiipl|. st 74 edo LAOS usvon 200 Lo11/0 UN eras ToL BH wareJi111-0ToCDus oe vonL411)22-0. core vonTaine Go11t 02Uemelo cos onZnLo1B)82 On momofoZ (Pri nem [0 i ser) 23 cere TGz. i rermutne3020sinew LD core Ton23000 (01161 Gn cut sySiri 0203291 cornsvos(45pm U011025C) MC conven 3S 41150). weioMilli TOCHes cur 100 390.18,i041 411. 001984 sovsnseceLnAras [0048 1H8i a TNs BpRAyem , ated amGlo ry rh Q Se a4510i Jusi reSd eem t30 npn) MCA ER -- RepenEczous "Tom Rin vateySapien tonne Eps TennesSsaemeiRLiavecraVnal.lCeaytSaanmples - an 7 Fa Aa NHH nH = HH : Errm FeTT HA 71724 R ITN SS A A } INTECTI 773 FA [aaeaa T-- TTT PAO 15% ETONMI Tc 3 EYE RE WV I | iL [Coses mame SUT TP EE PE er 1i 4 er7 1 SY TR HP ES i Peso = ISTRYTO TN NAICS Tf Tg 1% Fase T= NIN TIT TS NN NT TdTy Te i [FseansT= ITN TN INST IN 18 [Psesces Toe[SIT PIE IGP ladT I TT T HT = [(oseseT= TTNTT TTT TRE TITIAN Je foes HE PH I TN 3 ss Yavotgl IY IOS TATOITANT [FoscesT=TTT IP IIP TRINT TT a FaseesT=" TTT TON 158 IEC RE I EI I "33 i [Coawes T==TATT TP TTC Je ii} CC[Coaosnaswsees[T T-- BoBLUENETITtA TT TPT P EC SI T SUNGTTm3 i cormoiTS Tao112/00 OC cus sno OAR, > 1 sawca0 100 raype ighrse sit EtSu TOAL2 (10 5(R0 LS curon[230m {y Dalirt fain TA UDAS LGR will -8TCHS cue reopen107.02. 0C coteTonT0000 imi C2 conn a2 cu va my Qh r anTDe sm LD re I ; J cnrondo lo IE ene. i rene2) imBros.20 wnmn300 E130) co 100 nl Bron vemHO Ris(06 4) 001985 aspingsumarsio0 0203317 can QUT0 Ft osmcone L001) messeasL cone 1000900 30,7: Aik = world,LaIQL wore mea_USADJudi) 38K cGa2gLels u Ou wry ars 4 manct mses GEL Es 7 abner Dn] Ee fr mm" FP ] i] rtp EEEE wo Emir Sooo, BEES S---- SfEi eEi nM,, pe agoits r >Pcoovd enywv ia e rE ia --n ii 001986 i WEITERE SolEcactonMosates we. { ! Me smartnesssng te ptpt 2. tn tm - 2142 10 5 ! ee Tr rs a E EE e rT eG Se Po fa Dean Er =i 2 --_-- aEmr i 001957 -_ Repeneczous ee "2 TomRoevateSais oeE20e015 TeEnrRn tivunee rrcVeas lifloremas yatSidoae nmplees ~~ eCTr o ETe771e 4% 7 Pa aWU 2edlTe Taa aTRuAT TTe PA ] re! E BRm -eLlama V7|Z(7 [7 VI TATv7Tacs vous] N~e~ r r rr rp rrr rreplete r --r~ rrrr rrr rrrrr r r GC C rNr C rrrr rN er r Crrrrr rr rr r r | C rr r sr e r S SSEE ST 0 E S|| CrrA rr rN| Po rrr re rr | Crr rr rr Ny Vcore amepon cos arn _Apalld S550 3 BD r 00weper IOnil m rs on 041gth goes !| cormaesan no 2414-0 1060 sais roel duran SAE 0L71[ iFo4s canon 330 agama ISS Co TonQI55 YT WB smZn oneIE TI Emir tom) ruecdl ; onnen0O.AUE LSS can von [595 Aer pr1 : rer nana sn 88 russ 10) caravanSE 2 Je is ue vn 001)zs mh wo (415-0 TOC Ploy caSpangSana 00C110032013 sGe0r0sa0cn5s7GS2T oRY: a 05 t GTIoFnLoarSe130Agseame aur dover DS cusvo L3SI 3138.000 Caen 1520 33,380 Gone oni: A 06[Eolised 3m S10 -- 001988 ee rao ms E re mE aha] NRSeed pEpoeu ema errou or EpEas A: [me 2g | ses, frame C[coo smos[]otonm||EEmEeEr[ |wo[w mm R loroon]toonm||StEaeE[ [ow [m em E Cnsuosoas| om| Soa |ww] | lefmrssesseeneee||ooteomm||EmeEr w=w]eeee -- ------| | osamon om|her[Tw [EEE LI veecuesomrn|ptrom| trICwTSweilI | E[coosmmeonn]| otomm|[ESEoiEr w ur e |i| [moscmoam] same|Eegsye[m fj eeo--m n ----] ]-- | [emaT]e Poom|I ba T TN w ilI] e rm ----s -- e] 6condition cowiutMerOH;OFwawisthmihl;C1 sample; ! 2Kvac dryu thecu olum mn; K,_ coleumnlwituhsotlvee nt, _c(<texrtraactinntosanfauteoviral elem ne med dle ebloadect, fiwal we owl) Nec| ti wis bord of A wETS I NH Tay a ro "ilo ny sens) 001989 Ak So ee ResonEnzous -------------------------------------- "Tom RieVateySarpien Non GLP SPE Columns Extraction Worksheet Er [emfe pArnoapyDsastnea:ls: OK172002 MSteurdoydNuRmebvesro.n. EEr2s0e0-t3seiie 2 50 ordescrton| fared ned | sphomixused| vous horton | som | mr| w [SORERST leoussos| som | Bar | ww[OTE leczoussmr| som | Simar[ww [ETRE lesson| om | EST [wo[RFE [ 1 111 11 Cr Is Tr i 1~__T [ T | T= 17 S ESE ST ss 1NT Co INS Co oTTN] 1 TT eerrrr LC ct Sep (Rha|Gore 1 | - 1 ~] oe tOvas i mii samp. Motte 208 OK, TAR. ge " : a Re--exhachou of sauples, ttntin us bused ott of ow E13 me Pho, WE Tiss ouly ied os 0 puiteling tttibakt 001990 Cr br a s aaaa oeElls. man ane nenesro= niaa { a i "emt Beef { [omer Jomefomerfsmuemaemesclfomoe]mameed omens 1 "AmountofComponentSandihates | 1 = [=T T= -T-T-T-T- [we GOR [STRTSTITS 3 13 [omer Tomelomadomodumedumedomedsmeduned oeismdss 1 omolcompmeswou rises | = 1r=-T==-T-T-T-T=T=--T-1T f C= =eTe =eo 5r TSTRT TPR=[=[T--| i i DTiaemhteriearT mos eiQdiliuGlYiMo0 agen 001991 CJERES mem pm eewemneim=se= i [mor Tomuemurlamas mlemamcme] | owes G|) [2ST Tip [35 [So [mo[aso] TS I v=>=]==] EA LL -- | --1=0- FF TTTTTT [mew OATS TTS [S313 10] [one emslmsdomadoodem LT Commenter 17 AmowtofCorpora snc aces | [Franspate PERE RE ee | I-- =[= = TTTTT 1-1 7 wm eo [3T5133[= [1 r2en TS ms ire oeow a a 001992 Aa a a a Te ar a a rr a wr r 2a E emat imnsevene i [ swmor [omademafumulomedumadensdoonnse] POORRPIF a FR POY PY PY PPPPLPP [Cosmos|AmowolComponeniSundariaddes | wm lowt--t+--+--[+71] [omnes omeomedemndemadamedanedsmadaned [ fr ooe CTomoeosr wwTne ot p Ta e ee| aTeo e r eAomneoe sp ClnheePdoowTdeede AsedRieesoea]|||| [rem lonIL TTT TNX i a Eatcto ab poet) ein llePTL) i 001993 ee tT etE Toesneiex DE 4S, FSA DEC PERS.DEQS. PT ad e_cevecso i [Aweconamntmewopel a] Fem HeELSremeTBa aae T TUNT TT Ce oomme Eam E mRPea nae Tonsa T TI TTT 11 e fFTeeaaTe TT TTTTT T INX] T7]] Pe TaNVoT] Foe Te :i SA ] femee A "Aago re ii 001994 ----------e--e---------------------------------------- Report E02.0443 "= Tenn. RiverValley Samples I ' - i SINGLECOMPONENT PREPARATION LG . oe 3) Oct (1) Book. _02050 i roast M11 Pagel. _ 34 d omavion_Logn Spike Ay in Woes: Es, Fore pens Piva =PEOS i sockmumbor_2 (0-(2 33 [meen Jeet wa AA i ! pow Concentrationor |P0pp Other CorF rectione : mme Kkl i : ComcedWegne_____-- i `SolvenWtanndtTHA STA pp Woes (AUh-G Toc pros) Mi A | raves) rst rome por, i soocatomion___ JME) Somnus J3 Nyy 8) i !1 oct CyofOil. 442Dipl) i i5 eeniplldays f 001995 4 - sss FE 1 I Hance sa femraaiToeninco | i| oomueptrmet_r(osT[i1c5k1S0o3ive ESTE oy | suotQoAcsn_ SustoonenMeea 1Lucy ! [mo] aww] re RE ee TE 14 | fps rm ee Loran PEC P2023 %6 RR[790 FT 126 SE, Cers [PRR ba SEY [| i ~~ _TC Tr T I~ L ee | ] iL -- 1T T | |T |T | > [lel Exe Copyof Origa deed = . TEee 7T0 dd -- 001996 -------------------------------------------- Rao Ev20tes Ten ores Sarin -------------------- an . SIOLECOUPONENTPREPARATIONLOG a Lo J FYATIT dow CMC BookNo. 02022 Pole _T_ . owabi_0 loon Spebde . | GD en L} Sack ber canta -33 1 a. ii a UAWw3e, 2iSlee we -- * 0p 8! T= . pec . oman. = Se M0 TOL Yu lu 31 avis Sale acoensan_gom Ye o i 1. " G88 ExctoCfOohpayd ial Daly omen_ faz] wiomatr Zo lw(ent) * 001997 _ eeee------------------------re ees Reopen 020043 Tom. RivervateSamos . SINGLECOMPONENT PREPARATIONLOG - rvee [A1I5A0702 PSookeite_a8o0w - %h Aide Acid in ill-0 . 1i a. i EA-1A 5101 sone DPLTTES Th-A-SITF Warnnsn. 200ml Banca0: MA " . 9999+% - Dg comcwen_ AA WA ne _Lhilh-(9 TOC Plus, | 8i. Frases) Praca [Ys o someuase__ Fl fp evince_ 2)Nsw0) - cto G0 42a P) a] AF " Rees Ls 2t Goer " - 001998 -_ rane [EE SA -- -------------------------------------- - - co. rDaotee:te `SINGLE COMPONENTPREPARATIONLOG 0O02rc waver: TEHS oo --5 BookNo. _02001 - Socmmber___ 96 036 || - TZ 00% - 0.676 . CL cme 4 wesw Om. A SG oy fia-sa50-3 | Fina Vou: oul raiConcentrators __D) JSPRAM. - somos! for Evnsmone__ 10:03 . .| En LSaaEg, , : reer lilo ron . 001999 _-- Repo Ec20u3 _--_-- eee we Tom vervateSains .- -- ow__lo `SINGLECOMPONENTPREPARATIONLOG -- ska Po owe ___ TOA iHI [. a | I i. - Sanne oD029 "NE_e ITT comiNen__ueak -- i" rove Songotocatrs___ dSpl Jud fo BQ omo= men a" SNE Hn [pik 3592-3 orem tgp Exntaou____H0.0B - eeitefe [I pco oytOt 1 a of 002000 ---------- e--e ------------------------ Report 020043 2 Tom.RiverVateySamples vo. - . i: i= - - |. 1 SINGLE COMPONENT PREPARATIONLOG omQTFrh@2 oo Alf Ousetpton: PFOS BPookoie.s_atsztoem_ sawn _10030-036 oe__ (0.53364 sae 9/4/ Concaoato--nor -- -- Oncor---_ _ vmevamin MeOH, TWA 6007 W mews VE rh pot reaver _QSmC `woo 23QYpn oieF 2 le ceSe ERIOow Eto tone fo.- LPHBaikoaa tota - 002001 ET ---- [---- 12 TomBranson .- --om Eb SINGLE COMPONENTPREPARATION LOG S--e-- Pe ower EC-JY3 JPEOA - samme 99030-0930 1a wv 0.579, i- ol - a Hq P) i mavonsn_25mL ssw a SS MOH 6007 roe 213 gen - `SorageLocation: 2 Flr epn JLo Fbn D3one i= ii . oe) 22002$90 BCa opyoc fOdgt lad) . see fihficgtolin - 002002 - Rept Ezotes [EE ---- _--PnP--m - :` SINGLECOMPONENT PREPARATIONLOG em sn am - ows PEBS /1-FOSB14t2 (GF, 50,4) - : a sexo: TCR-00012-07] / T(R-359 Cildlhen,) ia :|. = WeightorVolume __osots, i sawao___g1Y CM ems 9939 em -- o CA meme Qf | !v eave 0p) TR T MeO HA gallS FewConcent ZN Sn 7, . Ca we1SOiEs het) . 3 ` extasnvue_ 23 Noy 03 weilk) ing = 002003 Rap Eczau42 ee So Tom RiesValeySargon `- . om JOTuneodSINGLECOMPONENTPREPARATIONLOG oe__ CMC tPoea sem - owes __ EC reive, lpr @ "os002" nom - soammer_(2e0-33 y| o. rt = ie I | |. vam loo Bam_38 ConcankAatovnorl0X 0prn TER-- OtherComection Comcndwege RN. WaterPeoH,TNA- 4520 Fonivome: 10 connor _|pin, "mi9e 08 n eeeom json [ 0" "iR2 E0 seeU02. == = = 002004 ee mms wn SS TCR Receipt & General Information (Cwane iA _--_oswview | Pood Forman: CAFIISOMNe Numbersofcorners {18 migees continer | Bodin wnmapowdsw Se Cou | Ea ----____ WetGn_ @vow | ; E BE wrL e i | I | 1 Ff i [AmouioiRewn wes Coase Da ewww Checwdby(eneiowm) | [CoEma menT ts neT s ti frites Date Theckeaby Dae : EE orerr i; En r En ens pas ! oem rnre i iachments wel rsZF s sorsndDlsesnes `i :TO ArchivediSubstance at Avaiabio| or wnts(I 002005 -- Bo -------------- ee Reon E0202 [ES -- | r TCR Receipt & Genm ewralwIneformationww | C oa -- FT--E O ---- CE -- TT ---- ee io 1 : ee ii [pprCorimn Tr (0 yw |] : F_ ommeansar a_ ee re _ JnUE llas Dal_ e heckeab_ y Daw | Seanbanmort-- arn rn 47 i:|i Eon e ETaiep ccueodvei ammusebspeis saodny,evuLso aAdrCon1nr0R3dd e1r01 r No FESSn LAED oaco i amon satomsdspd_soSbnesTotse TASE RRAS| ii i"wn popiul t iLsA Foe 002006 --e -- e ---------- ee. Report E020u3 12 TomRiverVatey Samples TCR Racolpt & General Information Noir Goo Wed megeen | raat--------evo i1 we iCrretmtepTotreomCa8nSinesrtn i C -- [ 7 w --o L-- S m te -- e cesswwe [presen 77 : Creme www Eommens wes Owe Frededy Daw | eon mo ce1 som47 i : a acaTveaaseawerwsopaersetogcnawineaasor,ocSoeanderartvzeno00 erydstAeEdonoam perro 50 ties10n8 ro ea n ccoaEmmm0a1:T REtyGUofAc CTnEDnTOe NS TDaTngers } 2 lecedemras fest.acheAsC sna C: ArchivediSubataricsNotAvailab|e eu, 0) H ws C 002007 -,--,------eee ResonE2043 "o. Tom. Riervatey Saries TOR Rocolp&t Genoral Information . BEdeosa c mpaie Nwereeisdere wm neots || ; me] i1 EE -- i | 4: Cw are ww] tie esrvs re 1mm 27 iincot:FS C 840 00on1 do)LA i sesnd ounpcre {: mongSeneormo ,surasngsi cod i SATO Haste 3 Rimes : BA al i ois 3 e HwayCuO 002008 EE rastE020u3 -- Te. veValaSampo TCR Receipt & General Information m 1 y bw me -- t pr Tewoewewr HSo sRotRroman rd i -- wo ---- i Femme CC omwg 7 oweae F=e eI i EehT Ca ; a Aths i| oI es comerrsss. --La--gi ! 000177meds. 20081771, oremrirasa ArchivediSibistancNa|ot Aviibie| : peyAISi [4 = 002009 : ---- EO222-0443 Sampses iv rzeR SL :ii OBOonriteeasan 0 OsRoMwn:2 CCGomowewesoaws QoOwotwomn OGOtaenwtet DOinmoend OoOgwreasner { |fo' t LeieE mCo HAINBOFnCUSe TODYANDAB NALYTICAL REQoUEmSoTRnEtCnOgRDaueer da B_ i ! cae T: C F roee78--0 [ome Jom[omfom] [EE [wor gale [CITwake ATTT agore | VfSworDp TwTwTTAT TVIVTTTTTTTTsTp2I e T| Flaworzraw TiTh TL TUTTITTT TTTTTT stony flswarmed [nw To I Tx TUTTITTTTTT 3500 8[Escor=tiw [wv[Ix TCTTTTTTTTTT akong + [Fscol=riad [re[nw | IX[1[TIT TTT TTT] 3% | | Smt Peete Eh [Foon ooTwmo[ [ TvDe JIT TTT ITT 380m | + [Feea = ow To PT TT efIT TTTTTTTT 58032 | 5 [Svos mle [XT Tue TTTTTTT LLL ene | 3 i [Praga =r rere me Dus Te Mcovegny OA 0 Owe Tw Tie [iw [Bd CGec/305 [diiron { 1 T 1% oT | 1 002010 ee SEC EO2- 0443SAMs in Raz B - :! fOrCreoesn OCBllsoo2wnn 7 [=OGrwinms e QOoumesn| DOteemnwows mOlasm DOawwnes : CHAINOFCUSTODYANDANALYTICAL REQUEST RECORD 8 uBR i neTPassRosRR eBt)lscr Bs GrleiTThEaE ANALYTICAL REQUEST owe EM pp I7890) [are74s, RORLRY. moar 9 [+ [wSooasDLuoewFRWAI[owTl X [XT TTWTekTRTFTTTTTTT TTTT1T11T3o8e003neer | | CSwormed [TeTICTTTTATTLTTTTTTTT 38006 | [Swoa [1Tee| [To [VTTTT TTT awo3a | [Swoa-de [TV TxThTTT TTTTT sg039 | BR EV SSVword [( |J.T XI ICVOI 0TIP S 328X0| Fscon-Loo [TT TIVE TPT TT oer | F [Fscoa ted |[TVIIIVTTTTTT ssoea 7] wo bexel |V| | | [VIVIV TTTTTTTTT 38003 | 1 [oe te re nests ow wm] eee be LL rr eT 002011 - EEE 02-0443 SamsMAsRvRay :| CQOk cwoeemn O0 tlosam OOOoovmos m QComoes DoSweowwwe uOmmes DOowmne f 8 | amorcoro moron reussrascons rm Lit i [edcatn enorme aty_(lgio 7-601906 ANALYTICALREQUEST i owe SM ropa 178901 2 Zero] RARER moar [o [om]m fome ] [22/5 s [Spor Tefis] INT ed XTTTT TT TTT 3800s | ET EE tn 7 : [Spoa IX] 18 Dfmesy | TT ee PTT soe ee Lee) r= [errr -- 1 TT EeeLr =TT TTree Fr TTTTTTTS] e en e--, EZR i | -- UTT TPIT ITLL ----1 -- rrr TT] et 171 00g012 . = EO2-0244 i, SSOvaeman nBB aum.M BOBammeo . eBoemn BGimmc GGwie ggoeer | i | CHAINOFCUSTODYANDANALYTICAL REQUESTRECORD la3 bi fDi vmrorRsun Galaga TI ANALYTIGN. REQUEST ese20d 8 ----_ J CE ===] J) ea 7 EE 2 Cr Hawomesa ToTTTUT TIRE TTTTTTbebd [300 it6 | Jlowimen [ol TT TTT TTIOTTTTTTT 158460][nan th oe | Serovar TA TT TV TTT TTT Babs [2aize| V0storenos TT TTTTT TT TTTT Bdid Tose 2s 0a) frome |TT TTT TTTTTTTT 38eh2] apan101 | JV] FTTHI EC 0 ES 5 1.7 I TOT J ST: I HCO 0 2 2 4 Er vlSteznros TTT1 TTTPTTTTTT1R4618] [Rie mz] visro-carey [VT 1TVIVTVINT TT TTT | 3848 [tim mz] i Rotated Dus me 2 `Racaived by 08 owe ree i Cree 002013 2Zi4 EE Eo2-03%1 SuGeeiosme BOSbemSnn T GSOaaewme BOaomwern BOEpNmDowTss BOtEemRs oOluodwer | i CHAN OFCUSTODYANDANALYTICALREQUESTRECORD ng 2 u_ Ed eon Gt ilg HY Myra nEuEST [Bese lob BAR wen = SE a | SCoi--Coos[ral | 1X[1[aI][| [11 [38%2d Jo Sn | V[Seoi=caton SS [x [| PI PTT TTTTagekal Issn. Bn gal =i ree rrrrrrrt r= rrr rrr rr Sr rer rrr e eer sereee e r rT CrerrrSs 14 rrrrr NN i EH = 3 { C= e 1 m C1 i UE Ree] fyBlm yellue i 002014 . DEE nae EO2-0341 ; SmSohen gB wamm.M oB Smaemi Sgnmrk Dfmmomwe ggumml gguwms | : : : `CHAINOFCUSTODYANDANALYTICAL REQUESTRECORD pu ut t oo Toston, Don Al coneBong Lile 7-3 057 ANALYTICAL REQUEST owe 30 pera161 ome?Mat lf RU, RR. womre ree EEL] TStronceamadnJaI ] [K CEJowe [1 {11A1A2E E(om eTrino| (arvooas-tCtioern|T| 1T1T| CTL BB9oa0l]] J[oatdmsneinnosee| BMeeatoT n[N T TVT pe la]e mear sse C II = ey =r Aeee cs == os PleatedBy Due Tina Received = Bo ome me E CC e EN C n E ied 002015 Lo Emr : . EO2-0344 EBaEmT Smm Bae BEmr gmmme fmm game | Eo fn ooBo ae n CHAINOFCUSTODYANDANALYTICAL RmEQUyESTnREE .CORrDeay verroa { { me Hl Ny ce g . m -- : E T= = HEa = JrceE z CO4 2 25 | E 7 rrrCr Wr r 702 ee CC --+-- LT rrrrrr r r = rr e ree Pe IPE rer r r ---- 5 Ea 3 re (og ITou rors ahane AiZZd Ke Liil_-- i | = A ecr onai n ] 0080! 6" Emr koL-037 i:i OOObmwsan CDBinmeo CBDooiwwnsos n GOoymes gDmoewme gDweemw gDuaemse i CHAINOFCUSTODYANDANALYTICALREQUESTRECORD old i ER SN ad ANALYTICAL REQUEST oweAp N elo) =A [Sto8-Troy[Heal|[IT [on [1{|RE6AE [9a 20 2. | [Stoz-tMoTo [TTTV TTTTT Bede [30mintm [Stoz-tmos[wI T TTT TTTTTTTTT BAZ] [17am on2a] Broz-Smor[IT[FTVTTT TTTTTTB8kdol[Ron ta #2 | Asrox=toy Tv1 TT psd][em suso.) VI 10a -Caror[Peal TTTTN [TTT TTT[|Deke] [smn Yad. {tox-cavoaln [TTT TTTAT ||B8bde][Somm,38 fon| v[swea=caresTw TTTT TTT Pokal] [595m osGn| vSwoa=Carod| ITTTT poeqo|[sr5m fuon] i posersATL erraE n --V LVI TTT TT 2ifsoes ne 1 i V/A A er 7 11 002017 | . Lo Eo2-03 OB=autm,. = mm Olsson SBDumtha,. Olmed n Qmoewe 0EastOeemich Ques 0Edmond gow Doig Haber i Eth eCeHAINaOFCUeSTODTYANDNAHALYTICAL REQmUaESrTiRoECORnDeues wD { owe 3M pew l7Mo) Sr Mast od, RE --~--_________ [STTEr Garog F u1 a(1 T {1(ePaS tA TEerEezTa] OT 5FA TIEN E teeetatH 1 HHH2HHH Ee hTacias|EeY Tires )E PE TTT ITT r = t reee rre r ; e] C -- T > T T e i|i e Fse Ge amse lS ii 02018 -- eee --e-- e ------ es-- ReportE0203 So Tom.RiverVaty Samples ATTACHMENT E: Notes TO FILE >a <r --_-- 002019 _------ nomErzous Tom RtSari 3M ENVIRONMENTAL LABORATORY Note to File Project or Study Number: E02-0443 LIMS Number: NA Affected Data: D020626Extracted, D020628, D020629, and D020702 (Fish Tissue) ThLhueiflohwaivngesepnieeslwdrseemi1abeTldhnth 0eslpociwvseseuences.Thywreal bled111 when hey DDDeo2z2000g66z2s:6;EcDDmUUaDDcEdEO:DODSSUsnDndEd SDDUU'DD,EEOOOD?SS,, nBodaonez: pupeoez. 2`Blainkose(35t)hwetrsdeosnamwpilehaprceaSriponivaLsodcoi,e1heswiatmheatmh;fhercforsy,peWoftoBlannks (cVacEh)ossnoS.veTnhis asdoe ne Wo ndS38 rtcami he uepepofen a rem oh `specietsaorfyfWisBhbeaing5andalsyzcedo.iTnheedWwBsiaindSheBLsawgeerMeanoaltyzoedwSimthtMhoeuCtathfsisnhisapmples.qFuoerntcheissreason,there. 3 `Thefishtissuesampleswereanalyzedintriplicate. Eachfishtissue parentsamplewasfirstweighedoutinto a plcontainer (CTohleumwe2)l, thaadswarteecroraddedded oe 1 row (Column 3), sanadf oe FinTet rcshh then homogenized(Column 4) C before it on was separated into tThotrbiipliwciathesMarEeg:enwereartekdfreom twhienhhomeoigenatlea(tMiSosnareaCloslougmenneratedatthistime). Thesampthlatweerse. "h.aeiofimosusumathyasvnsucsdnn.h xTrhaicwtisddceurvnes ewasdnfgmrheahmoanesgaempBloedwoigtehexopwstamountof TVshaeteExtrracetdfunhsuamsnainoanisvoersB,adi0t bssiovreMpoee.LTisppointrwabsoepratfrfehecalibrationcusnd TCPhree1i0nngpnio.asadya cr1v9pdon94i.nTheEsxtaFciitesdLwrergoMsouetxhcSeansdiFoCcurveehisd2a1%dhnd2n%teovahnsa,o epg Gc on he ah aly do1 Flt ing rounded 3 5 hopsnClad poln on hides 002020 Recorded B > 7 eZ Cy J, lot | ---- ee -- FA. Tortsae 3M ENVIORONNMEENNTTAALLLAABOORRAATTOORRYYeect Note to File LP.iceCoanttoroilSaamplses(dCS)vwrappoenfordherReiveprhSeece ts. Hoe wever, eftomwiassot t ded Tf2ooclioisoomosteani12c112 traf cy stpf prs nics. RA LF Lec 02021 | Paced arh ----------------es Report 02.03 <=. TonRiverVateySamples 3--_M--ENVIRONMENTAL LABORATORY Note to File Project or Study Number: E02-0443 Affected Data: D020812A and D020812B. sAel1qludeantcaethiastmiasdienuDpOo2f [06811ia2nnjAdeDcOt2i0o8n1s2.BFairleesfrDoUmDoEneDOoOriIgtionaDlsUeDqEuDenOc9eS:aDrOe2f0o8u1n2d,TihtheeDsUu2b0s8e1q2upeanrceent i'DO2t0w8oIs2eAp.aFrialteessuDbseUquDencEetsoaOfDeUOrDLECS/D1M?6S1aanealiynssisutbo-sseiqmpuleinfcyedDaOt2a0a8nIal2yBs.isT.heparentsequwsebrnokcenuep LowsucobnsceeqnuternactieoDnOs2a0m8p1i2sAt.hat linthebotomendofthstandardcalibration curve(0.1 ng/mLto50 gm)are V1e0r1y00h0ignhgco/nmcLe)ntarreatiinosnusbasmepqlueesntchetDrOe2qu0i8r1e2B.small nection volumes that fll inthetopendof thecurve (5 ng/mL. `Therearenotanyfilestha arecontainedinbothsubsequences. T2here ar ampis whtowsoedriefseurletnswteexrteraqcuteisotnidoantaebslfeo.rth samples:20Jun 02and 17Jul 2. This i du to ar-extractoof n m`3.Tahterifxolslpoiwkiesn:g ars the LIMS numbers and the sample names ofthe samplesandthei associated duplicates and 33830022s6 SSwWoOtLDup `FSSWC-=FSiaemlpdleSaWmaptleer(CSoanmtprolle Location) 3388002287 SSWWOOll.MLeodw 38029 FSCOI-Low LFBo=w=FLieolwd BFliaelndkSpike MedeMediumFieldSpike 3388003320 FFSBCOO2I-Med 3388003334 sSWwoo3s-Dup 3388003365 SSWWoO33MLeodw 3388003378 SsWwoo22.Dup 3388304309 SSWWOo22MLeodw 3M00421 FFCCSS0022 LMoewd 3an8d043 TripBlank #1 002022 38047 Trip Blan#k2 Reconjed By. Cot Date: | nz ot - mses roms : I3MMENENVVIIRROONNMMEENNTTAALLLLAABBOORRAATTOORRYY Note to File TT a seeapasiU mT m retCha mnaSMbe eBwe) Recorded By, Vote Date: 20 002023 neal eh FE rosa -- ror ann S3MMEENVNIRVONIMRENOTANL MLAEBONRTATAORLYLAB~OR~ATORY Noteto File ProjoreStcudty Number: E02-0443 Affected Data: All Data Note:Tis s 0explainhvthe gtitctonwas performedon hedata. ie atscuttincivves rdnenon srs the ie as be sy fn sy D Tr E Te B `cases,highlevelcurvepointswere "Disabled"inth eahrooreosttduenean italmdr esoftwareandwereremovedfrom thecurvecalculation. veeInall 2e Ther dtecotme aoe thteTmapesecslnovaPr,eoim,iTotsiwwlealllyobeTiqred tt a Recorded By: 2 fo 2 Date: J vuz02a uea J---- 3M ENVIRONMENTAL LABORATORY Note to File ee ww Tn---- 4:Lthese reproprocs afte sssferhhomogenizationprocs Ge) he hogs Ei mepion aces. Be ett ws en bearer ee oeson centrfoirafsuhogrtetimdeandthensha(kSteep5n).Thecentr wasidonfetu oelg imina atet theifoaomtn hat 25 Fe /Z vuz02s --