Document 0N83xXwz0Oorr6D7eXLqb6ox

I Centre Analytical Laboratories, Inc. | P3h0o4n8e:Re(s6e1a4r)c2h3D1r-i6v0e32 Fax: (814) 231S-i1a2t5e3Coro(6l14l)P2aA311g-61e8580,01 | En-73 1 Analytical Report 1 Fluorochemical CharacterizationofDrinking Water Samples Cleveland, Tennessee (W1973) 1 Centre Analytical Laboratory Report No. 023-007A I Testing Laboratory 1 Centre30An4a8lyRteicsaelarLacbhorDartiovrey, Inc. State College, PA 16801 3M Environmental Laboratory Contact 1 Kent R. Lindstrom Bldg, 23E-09 1 P.0. Box 33331 St. Paul, MN 55133-3331 Phone: (651) 778-5352 Requester 1 3M EnvironmenKrtiaslJT.eHcahnnsoelno,gyPh&.DS.afety Services Bldg, 2-36-09 i P.O. Box 33331 St. Paul, MN 55133-3331 g 00354 1 Pace10es 1 1 Introduction I Rn Coe oEr ees eos Cots Roarse reu porteldforsthe analofyasseiriess ofdriwnalkersiamnplges roceivedbyCentre cooolrl.ectedfrom Cleveland, Tennessee. The Centre study numberassigned totheproject 023. 1 (SLpOecIiMfSiIcMflSu)owroacshermicealqchaurfaocertaesrlizstaatmiepolnbedsy.lAiquoitdacohfr17osmaatomgw/erprtaaelpnrdheeecymeismveadsfsorsapencatlroym:etry 1 `Thesamples were prepanadarnaleyzded by LCIMforStheIfolMlowSinglistof fluorochemicals: 1 + Table :TargetAnalysis 1 [CompoundName Teonm P[ erfiPuoroeoctf ane u Sufo-- o nviar mideo --o --cJtpaona[cPn art osea| 1 aPDrnaadtcariecgseeusnltes(raGartLeePod)n.ifn lTshuwpeipoahnratCleyontftircteah.lismDesatttuhadoydprwueessseendgtewendaesrhavteaeiiddratatchdecedobrhydiigCnheegsnttroqeu.UaSltTEyhPdeAatvaaGloaiodvaadtiiaoLbnalbpeorroaatttohocorsly ime. 1 2 Sample Receipt 1 TSThehveeesnstaaemmeppnlleienscdoivlwieedurtaeolnssadumabptmolisetewcdeonrteianinnoeitrnsdsvuwipdepluriaeeld.repclCeaihsvaiecld_.nc-ofSncalumasnpteloredssywaiennrfdoermrwaeetcrieeoinvenidsotoprnpers0e2es/ne1tr5ev/de0d0i..n 1 AtachmenAt 1 iSiasmpHlesaMnCo-n1s22/71eH60a0nn)d. MC-134H were not analyzed as per cent request. (Telephone cal to 3 Holding Times 1 Th rt ets rs ventt rs ig i 3 stayofteanalytes ofnerestforlongerperiodshas notbeen delormined. do. Tho 1 00355 1 Pace20es i 4 Methods - Analytical and Preparatory 1 44141 SLaCmpMlSeIPrMeSparation for L/MSIMS Analysis `Samples wer inital treated wih 200 ul.of 250 gL sodium thiosufate solution o remove | TLrheCseIicdMauSraIltrMicSdhglaoenrawilnayes.sis.fSroslAtiefdlourpthteadmwsiieltiheexr5trpmaocLrttoiiofonno4f(0Ss%PmE)etahwaawnsam osluitsrnepawdnasttfeolerrpserodee ltpuoaoarne.CTtyhheSePseEalmucpaaltreetsiwiegfeosr 1 c`dominesctcehanartndroealdtiwaoennosdfcttohhloelseScatPedEmfcoprolplarunimaeolnrysswtioassabnyatlhLyeOn'.MlSuItMeSd.witThhi1s0t0r%eatmmeetnhtanroels,uteAd 5inmainpsoirgthitonoiodf | 442 Sample AnablyyLOsMSiIMsS 1 aie 1 thcIeonlHuumPnkL.Ci,mBoaanbslealedqouhonatstohefe,eaxhftoiriaayconifstiahnjeecatrneladliyantneefdodpraftoshrseedscttarrtiooaungatrhyeaphrausimedopiunhnat:hseeocfcomheruo.rmatrFolgoorawepihnifgco 1 moHriPgdaLnCtiecsmepcpeoarrmaapttouiruoenns,d;sE,mSoInlcNeuScdupirenosgvifadrueeosrooancihrzaaepmdii,dcaaflnrsda.gaEmcelcneutcreiadrt,oesampnerdaaindyssegtefenorcertaan.lalyyIozopinensrgac2theawdriaadctlroaernlsagttecveoolffy known fuorochareeobmseirvcedaansd quantfaled against standards. 1 AanHaelwylzeettt-hPeacskaamrpdleHPe1x1tr0a0ctsH. PALnalsyyssitsemwacsoupeprlffoeordm@eMdicusrionmgassselUecttead MreSaIctMiSonwamosnuitsoerdinfgo 2(/S1R8M/)0.0.STahmeplHePsLwCearnedeMxtSraMctSedmoenth2o1d1s7u/0s0edafnodraannaallyysziesdanbdy MinSsItrMuSmenbteptawreaemnet2/e1r7s/0c0ananbde 1 5 Analysis 1 54 CATa-lpiobinrtactailobrnationcurvewasanalyzedatthebeginingandendoftheanalylcal sequence 5pf0oi0rt,itaehdendfcoor1me0pa0o0cuhnnopdlosLinoto.fpti)nUtsTeirhensegtr.leiTsnhepaeorncrsaeelgorteafsttsihiooenn pqwuoiaitnnhttis1t/awxteiwroeaniigpohrnivenpegar,rseutdhsetathsle0o,pce2o,5n,cye-5nn0i,erra1ct0oo0pn,tw2a5an0sd, c`ucromveelastiaoncccoefefipcieftntra>1)b0.al9n8de5co(ef>fi0c.i9e7n0to).f ceteminaton () were delermined. A caltration 1 Calbration staanepdrepaarerdusidngtshe same SPE procedure usforseampldes. ctCoahnlricobeurngathtroiauottniocnthshaeecrkeaswntiaaltnyidsniasr+d-ss2ew0qe%ureeonfcatneha.elaycCztoeudmaplpleviraialonudcei.ecalliys (every three to obtained F five. the `sample injections) standard analyte 1 Forthe resulsreporied hore, caltratoncriteriawere met. 1 GC0356 1 Pace3ors 1 cima tts retcot ae restt epat lr per 52 Blanks 1 t`heExxetrlraoaccwiteioovnnebllbalcananklkstsaswthieoorunedsnptoranetdpaharardve.deaFanonyrdhtaaenrsagelesytazanemadpllywteiestsh,pterhveeeesrxeytnreaxactttraiocortnaibobanonvbkeastwchheerocfoencscoaemmnptplrleaastn.itoT.nhoef. level calbraton siandard, and ato known highievel samples. Again, the blanks should fot a h`asvamepalnesytparrgeteanhaselryeteetshnperientssterneutmaedtntorbablovaeartehcneolmopklwi-alsnetv.elcalibration standard. Forthe 1 53 Surrogates Surrogatespikesarenot acomponoefnthte LC/MS/MSanalytical method. 1 54 MaE MtartirxisxpiSepe sikweesreprepo aredfor everysamplee a5!.aconcentattionn ooff 100 gl.using al [| Ficelodmpipesoowufeirnnetaedrlesssto.prFeipeadrsepdikoenresceovveerrailessaamrpelaelssaotgivecnoinnceAnttraacthimonenotfC1,00 nllusingal 1 55 ALDluspalmipYclaetsewsereanalyzedinduplicate. Resulsaregivenslongwiththesampleresusin i 56 LMaibgowrataetrowrayssCpoinkterdowlitSaallmcpolmeposundof teresta 25 and 250 nolL.Intlanalysisofthe 2h5avnegacLceCpStsahbloerweecodvleorwyr(7e0-c130o%f)vo.rAePllFroOtShye.rTrehceovsetraiensdafrodrwalalscoremipnojuecntdesdawenrdewbaestwfeoeunnd7f0o. a 130% in each LCS. 57 Sample Related Comments i thFrieoludghblaanhkypsearmcpelretscacrotnsiidsgteewdaosf eamdpdteydtcoonttahieneerms.pyFcoornttyamiinlelriatenrsd aofnatlyypzee|dIwnattehrefsiaermeed manansethre othersamples. 1 6 Data Summary B Please seotachment Bfor a delaed Isingofheanalyicalresus. 2 7 Data/Sample Retention i `Semple aredisposedofonemonthaferthereportis issuedunlessotherwisespecified. All electronicdataisarchived on retrievablemedia and hard copy reportsare stored indata folders mainainedbyCentre. i Ge357 B Paceacrs 7 q n 8 Attachments 81 AachmenAtChainofCustody n 62 Atscments: Ruts. 83 `Attachment C: Matrix Spike Recoveries (Field and LaboratorySpikes) n 84 Attachment D: LC/MS/MSRawAnalytical Data . 9 Signatures R 01 Mi. "Faherty Nagar industial Sovices Group Sites EQ n ms GeC nes - 3-Rb-00 1 a Cott amosGora a KEanraeknshSariWickremesinhe i | a a 2 a 00358 8 Pacesors ERE EEE EE ENE EE 3M Envi mental Laboratory Chainof Custody RReque. LaboratoryAnalytical 17120 E EE mee --[ -- e EenLo] | SW, vi boar OO Ter BBE et pepe dE YY Ir a Ew wa Cleveland TW 1 mee Tale e he PT =120 Tortabe Fie Black -JA boty|| [I] EE EE TT ieee E E e E e ee Cl]le [pay Ed 1 e EesmE e EH PE Ee Eoa i-- ---- tr a I -- EE -- el a cn Ty anaes ESSERE | 3 iEnvir vmeunetal Laboratory Ce hainof Custondso yRequOeT. url LabohyraTtorgyAnalyitiycal T1e71l2s1 EE ee pe] THmT | Erdue IS [ow rime PA oa COIS HNren| EEE WE wii Claw land, TR Inci ef l f IT E -2g0-Sike | Ta <h Dip APc = WBA [IIA [ud a erm NP E HT A e 1320 Sity3_p)4 11 | | PS BEET aE Ee Sos eer PE ee EN ee --tF a= == Cell Dorrit |: SPT 7 eee ------ A 5x TT LLL = [lo : bn ci aNAIYTICAL REPORT. CAN Centre Analytical Ji L Fe oamb .a oLar bora ataot arineo s,r a IInncci .. e =~ s. | i uue3eMeoSasnmple Identification sPeeron ae `Sample Description fruest E =m R fMurCe-a12t8H gE eni Site 1 PIN duplicate. R a NA Titi, Site 3 P/N duplicate =2==PFOS (ngiL) =<25 2<2%5 =-5z=PFOSA (ngiL) =<=25 <=2z5 2=P==aOsAA (ng) =<=25 =25 n 00361 00 ) TE